1YWWA

Nmr structure of p. aeruginosa protein pa4738: northeast structural genomics consortium target pap2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
65
structure length
65
Chain Sequence
MNSDVIKGKWKQLTGKIKERWGDLTDDDLQAADGHAEYLVGKLQERYGWSKERAEQEVRDFSDRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PA4738
publication title NMR structure of Pseudomonas aeruginosa protein PA4738
rcsb
source organism Pseudomonas aeruginosa
total genus 21
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05532 CsbD CsbD-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1470.10 Mainly Alpha Orthogonal Bundle Protein Yjbj; Chain: A; YjbJ 1ywwA00
1RYKA 1YWWA
chains in the Genus database with same CATH superfamily
2PX6A 3TJMA 1YWWA 1XKTA 1RYKA 4Z49A
chains in the Genus database with same CATH topology
1RYKA 1YWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYK A;  1YWW A; 
#chains in the Genus database with same CATH topology
 2PX6 A;  3TJM A;  1YWW A;  1XKT A;  1RYK A;  4Z49 A; 
#chains in the Genus database with same CATH homology
 1RYK A;  1YWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...