1YXRA

Nmr structure of vps4a mit domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vacuolar protein sorting factor 4A
publication title NMR Structure of VPS4A MIT Domain
rcsb
source organism Homo sapiens
molecule tags Protein trafficking
total genus 29
structure length 77
sequence length 77
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1yxrA01
2LRKA 3ZT5A 3ZSSA 3ZT7A 3ZSTA 2RPAA 2WWVA 2CRBA 4ZEYA 4IT4A 1WCRA 3EABA 5FVKA 4U3CA 2JQHA 2W2UA 5CGMA 5LB7B 3ZT6A 4U31A 2DL1A 4U7YA 4CN1A 4U7IA 4A5XA 2CPTA 4U2ZA 4P1NA 5FVLA 2WY2A 2JQ9A 2V6YB 5CJ5A 3K1SA 1WFDA 2K3WA 4NIQA 1YXRA 1WR0A 4U33A 2V6XA 2LRLA 4U2YA 2XZEA 4CN4A 2A9UA 2MPKA 4WZXA 2V6YA 4CN6A 2JQKA
chains in the Genus database with same CATH superfamily
2XQ3A 2H89A 4ILAA 3NZQA 4U7IA 3BQKA 1HG2A 1Y01A 2X68A 3KV6A 4K0UA 2XQYA 1YQ3A 3ZYLA 3K3NA 4UF0A 1HNZT 4NPPA 2ODUA 4IL4A 2VWAA 3UU5A 1YXRA 4B6XA 4YSZA 1MNDA 4KI0F 3UU4A 3CVRA 5JR9B 5HWYA 2BS2A 3I9YA 4JI1T 1J5ET 2ACXA 5HEUA 2K9AA 4WNKA 4EZ4A 4IGUA 4P1NA 4DMVA 2X0HA 4AXPA 4O2BE 2V8SV 3PUQA 3P4SA 2LRLA 4QXHB 5HXRA 2QYWA 2FBWA 4UV9B 3ZEFB 4X5TA 4EYYR 3KINB 3EHZA 4LFBT 2WU2A 3OPCA 2J47A 1JNZA 2NW7A 3EDVA 3EVYA 4OYKA 4A97A 2KMFA 1T72A 2ZMAA 5IHYA 3AEDA 4TWDA 3JAEA 3AA7B 3ZN1B 3ETUA 1Y64B 1WR6A 4UV8B 5LG3A 4HTEA 4L9IA 3RIUC 2KNDA 2PG8A 3HI2A 3PUZF 4FJOA 3OTOT 1KNPA 3AAAB 5AQSB 3N9OA 1FMVA 2WY2A 3AVSA 3J7Yq 4JI3T 2IUBA 1CUNA 3SOLA 1HX1B 3ONLC 3QOFA 5LJMA 3T1HT 2XTLA 5JDFA 3RRCA 4GKJT 3EABA 1D1AA 5BR8T 2FUPA 5FMNA 2XM1A 2JQQA 3AAIA 3IA3A 2XPKA 3DJBA 5LGUB 4X20E 2V7KA 3RI5A 3UQ7A 4H9SE 3FBZA 5L4HA 1VCTA 1NENA 4U74A 2GK9A 4LF4T 2MPKA 2SPCA 2LM9A 5HWXA 2PTFA 3AAEB 3FZKB 4I50E 1SA0E 5HAXA 5LB7B 2Q9QA 1B7TA 1E7PA 2DWGA 4IE5A 4XBFB 2BBJA 3FZLB 3LBXA 5AQPB 1SHZC 4CXXA 1HCIA 4I55E 2BKOA 4PK4A 4X1IE 1JNRA 5DQVA 4QXCB 1US7B 1YQ4A 4JI2T 1OWAA 1HG5A 2VURA 2BDEA 2C5KT 3E08A 4HEAA 3PUAA 2WSSV 3FB2A 5AQKB 3V5SA 1UURA 3HKCE 3TLWA 4ZZCA 4C91A 3RIAA 1HNXT 1UX4A 2BS4A 4U2ZA 4ZOLE 2W61A 4XZCA 2M6IA 2UXXB 3OBVE 4ADZA 4OK0A 2ACZA 4HWHA 5AQIB 4G63A 3VKHA 3M65A 5LXTE 1HNWT 2CXLA 2BS3A 5J2UE 2H3RA 1FJGT 2ZM0A 5L47A 3EDUA 4JEUB 3ZMTB 3M3ZB 3AE9A 3O4XE 2VQFT 5EZYE 2B76A 5KX5E 2LHRA 3B13A 4QXBB 4GOUA 1BR1A 1QLBA 4PJJA 3IBPA 4Z90A 2XQ8A 2CWYA 3ABVA 4UVAB 3LK42 3AXJB 3TKLB 4ZI7E 4YLHA 5JDLA 3A8YC 2IDOB 3AE6A 1XDOA 1H7CA 3I0OA 4AKIA 2RA1A 5JQGE 4U31A 4DV1T 2KWHA 2XM2A 5DABA 2HN1A 2KT9A 4WYVA 2AE9A 3ZYKA 2V6YA 1KK7A 2IIUA 1O3XA 1SUMB 1WLXA 2VB6A 2EHOC 4LF6T 3JAFA 5AQGB 4EB6E 1M62A 4IHJE 2WZHA 3MACA 4YY3T 2WS3A 5FNVE 2NTXA 3AECA 2BKNA 4ZEYA 3LJCA 4AKRB 4UELA 1W9RA 3KV9A 4AQFC 2V7LA 4HFHA 5HXSA 4WBOA 2PBIA 2HHHT 2PFVA 1V9DA 4AKHA 2VVSA 5JTGA 3N9QA 4ZS2A 3N5LA 2XQ9A 4IDOA 2A3DA 2DI4A 2KWIB 2XQ6A 3PUXF 4GYSA 4CXWA 2LSGA 1IJ5A 4IDPA 3GN5B 2QA7A 1ZEEA 3AEBA 4HWDA 3UUMA 3FXEB 4YTPA 1OEDA 4B3MT 2Y48B 5IUXA 2W2UA 2LJLA 5HCMA 5JREA 2L9QA 3BQLA 4H9NC 4LMLA 2XAGB 2B1EA 4LF9T 2JMKA 2IC6A 3Q5DA 5LYJE 5DQWA 3A5XA 3AEEA 5CA0E 3NZPA 4CN1A 3RC8A 3C64A 5LGNB 2I59A 2XQ7A 4DR4T 2CBIA 1N33T 2WM9A 1HS7A 3AE8A 5L3GB 4TWFA 2V5CA 4UXNB 4A5XA 5AQUB 2CXDA 2LEHA 3AE4A 4OFZA 2KZ7B 4XAXB 2V6XA 3ONJA 3R84B 4U2YA 4UEMA 2D5UA 2W66A 5LGTB 4UF0B 2JQKA 3NWIA 4H9OC 3Q9DA 2UUBT 4H63H 4NUUA 5FXZA 4KHZF 1SE7A 4HWCA 1KEYA 3HL6A 2XUEA 4LF5T 2L8KA 3KFWX 4J2CA 3FXDB 3RH3A 2X9HA 2LSKA 1WYBA 3EUHA 3VR9A 5LJNA 2C5IT 2CLYC 4PK5A 4QWNB 4H9RC 5E0OA 2A72A 1BR2A 5HCJA 4Q25A 4MBQA 4IE0A 5AQFB 4X64T 3AEFA 2UUAT 2XQ5A 3JC6C 4K0KT 2NR4A 4DV7T 1HTJF 2XQAA 5LA6E 5GONE 4X1YE 5AQVB 4PW8A 5HYAA 2VK9A 3A7MA 2HPLA 1XNQT 4TV9E 3O9XA 4QH4A 4ZS3A 1BR0A 1DU2A 4B3TT 3ONXA 4DBQA 3I9WA 2YK0A 2V7IA 4CN6A 1MMGA 3ZSSA 2J62A 2CBJA 4YSYA 5KXJA 2VKJA 3KDSE 1OEDC 2ODVA 3U3IA 3L39A 3GWHA 4DR3T 1FMWA 2IC9A 2ZM8A 3NKZA 3P4QA 1OXZA 3P4WA 2PJQA 1NWMX 2BKPA 4IT4A 4LF8T 4DVDA 1J5WA 5LHGB 2HN2A 3PUYF 1UX5A 3UUNA 3PDYA 4V1Av 3QB5A 3HA4A 4ZHQE 3ZKRA 5L3CB 3NBXX 2E2AA 4ZI3D 4HE8A 2Z6EA 3MJXA 2JRKA 3WAJA 4DR2T 3HKBE 2ZLYA 2UUCT 2BBHA 3KVAA 1N32T 5LMUT 2W62A 4E7SA 3AEAA 4ILUA 2LT3A 3LBXB 3O1HA 2X9WA 5LOVE 1IZNB 4JI6T 4LFAT 4PJLA 4C90A 3OYZA 2W4XA 1XWMA 1QUUA 2IMLA 4CN4A 3JADA 5CA1E 1LVFA 1D0YA 3ZSTA 3VHLA 1YKEB 2X0YA 5EK2A 2CE7A 2OA5A 4O4LE 2X0LB 3K8PC 2UXBT 4YTNA 3PUWF 2E9XC 1XNRT 2IHR1 3ZC1A 2CHNA 2XSAA 1YKHB 3AA0B 3C98B 1KFYA 4QH5A 4ZI2D 2H88A 4GK0E 5H6RB 4NXNT 2EHOA 4I4TE 4DUZT 1G73A 5F8PA 1CHUA 4TZ4C 4E7ZA 2OLTA 2KINB 4GK5E 2LKHA 5C2TA 1N36T 1HF8A 4CZZB 4JBWF 2WWUA 3PJAA 2LSYA 3N9MA 5JH7E 5FXWA 2DCFA 2N1GA 3OYXA 4AQFA 2WDRA 3ETVA 5FXXA 3BK9A 3CMLA 4H63V 5L2LA 4UVBB 2OV9A 4P09A 2BG9C 3EI0A 3RLFF 2CHOA 3TLTA 2KLQA 2V1DB 4KUMB 2QGSA 3R6NA 4LF7T 1W0AA 1EZ3A 3RC3A 4QH1A 1FIOA 4EAHA 2WDVA 4AQYT 3TLSA 4EIWA 2UXCT 2XAQB 2JQHA 3CKDA 4EYUA 2VKOA 2V6YB 2WP9A 5LNKA 4IREA 3UUXB 2BVLA 2NW9A 4F8HA 3ANWA 3P8CD 3FBLA 3RQWA 3UQ4A 5JRCB 1MMNA 3AE7A 1MMAA 1X9BA 3OVUA 2X67A 3S4UA 3O1JA 4ILCA 4GKKT 2M67A 3PTRB 3RIFA 2FJDA 3ZPOA 2YOEA 2HPJA 3K1SA 2WMOA 3CPZA 5LG4A 4O2AE 3UUBA 2XAFB 4IE4A 3VKGA 2V7JA 4YHHT 4P0BA 3PURA 2W0GA 2D2SA 3HKEE 3RYHE 3ESLA 4DV0T 2KXPB 4BA9A 3FHNA 1OEDE 3RHWA 2L3LA 5HXCA 5IYZE 3FZFB 1LKXA 1Z0PA 3LK2B 2KSRA 4I0UA 5ADXL 3MA9A 3P4PA 2YN6A 3ZYMA 4TNVA 3CQGB 3ZJ1A 2V26A 3RRWA 2VKHA 5JR9C 2CPTA 4TUYE 5L3DB 1IBLT 1MIYA 1D1BA 4YSXA 5JDQA 4DR1T 1ZOYA 2Y8DA 2X9XA 1XZYA 4AKLA 2D0UA 3MXZA 5AQJB 4BJMA 2X9YA 3GA8A 2LKGA 4B3ST 5L4EA 2LHNA 4TV8E 5JVDE 3L09A 1UGOA 1ZP0A 3N2GE 4AI6A 3O1IA 3UU6A 1WR0A 4TN7B 2ES0A 5ABHA 3CWZB 3I0QA 4WBNE 5JDHA 3QB5K 4HWIB 3J9X1 5LCYA 4H9PC 3SFDA 1D0ZA 5LP6E 4JV5T 1N34T 5LBQB 5C3JA 3NRYA 3HR0A 3FZHB 3KBTA 4HWFA 1T7SA 4O4JE 3AXJA 3PUSA 1YW0A 3ZMVB 4ANJA 4HKAA 4JLEA 4U3CA 5ABEA 3PJAJ 4DR6T 2G0UA 4DO0A 3N9LA 4WZXA 2WDQA 4ISSA 4PK6A 2XQ4A 4GIWA 2WCAA 4COFA 3PV0F 4LMJA 4YJ2E 4A98A 4IE7A 2DNXA 2XASB 4L5GA 2BG9E 2YINA 2NOXA 3RX6A 4DV5T 4F6RC 5HXEA 3DTOA 2WMNA 2CCQA 4HFEA 1WCRA 1NEKA 5J0ZA 3ZCIA 3VR8A 2CXFA 4DV2T 5FY7A 3MZKB 2YU2A 3AA1B 3C4XA 3E22E 2W63A 5M4YA 2YEVC 3K3QC 5ABFA 2LSJA 3ZCJA 3PE0A 2E9XA 4FI5A 2FJBA 2QRXA 5LMNT 4I43B 2CMRA 3PU3A 2YU1A 3AE1A 3P50A 4QX8B 1MIWA 1J1JA 2JPFA 3WI3A 2W67A 1S35A 4DR5T 1FEWA 4CI3B 2XSBA 1M7KA 3UFGA 3KV5A 4ERRA 4TWHA 3UTKA 3V5UA 3N2KE 3ZC0A 2JQ9A 4AIUA 3JCFA 1IBMT 3TLUA 3T1YT 1E2AA 2LRKA 4HFVA 4PAGA 4EOZB 2M6BA 4KP3C 5AQRB 4JI7T 4PFPA 3G06A 1QSDA 5AFUL 1T98A 2K3WA 2BG9A 1U5PA 4DMWA 5BMVE 3B5MA 4IDZA 2V5DA 2CRBA 3QUJA 3FZMB 3SRZA 5TAOA 4DV6T 2UU9T 4IE6A 1HX8A 2CM0A 4YFSA 3BQIA 2A9UA 3UU8A 1ZV4X 3AB3B 2FJEA 2HH7A 5AQQB 1WRDA 3ZT6A 1AJ3A 1G8XA 4BAYB 1W09A 3N2OA 2JJ9A 1S94A 4X62T 3NRXA 4DR7T 3CK6A 2EHOB 4PJMA 4DIDB 3CX6B 2V7MA 4KBMB 4MFRA 5EK4A 3SFEA 5LBMA 3RGLA 1ZHCA 2XHEB 5J2TE 3VRAA 4YTMA 1I6ZA 1X79A 3UT5E 3RQUA 3PUVF 2CWOA 5JDGA 3AE2A 5CGMA 3HKDE 2Q9QB 4IDQA 1D0XA 3LSVA 2EHOD 4HFBA 5FVKA 1R8IA 1GQEA 3RKGA 3KV4A 1KNRA 4O8SA 5FKYA 5ABGA 1XMQT 3DP7A 3ZJ2A 4IDNA 5AQNB 2MTQA 3N9NA 2UXDT 2W00A 5LHIB 2VL0A 2LM2A 5FXVA 3Q5WA 5LHHB 2Q9QD 1HFAA 2K48A 4LMKA 3Q5EA 2E8IA 2MOZA 5L3EB 3SS1A 2ZM6T 1E1HB 4P0AA 4JI4T 4ASKA 5FY0A 1IJ6A 2C0SA 2WU5A 3UFEA 3CQCB 2BVMA 5JR9A 4A56A 4DBRA 3ANWB 4KHPT 4X66T 2CA5A 4JYAT 1IAPA 3H3MA 5ETWA 2XY8B 2D9DA 5C8YE 3L3PA 4NXMT 4U7YA 3PUGA 4CQIA 5CJ5A 3CX7B 3C4WA 2DLRA 3CX8B 4OX9T 4KX6A 1T8BA 2LLYA 2LOSA 2JMHA 2WQYA 2LSIA 4Z8XA 2C5JA 4JI8T 3RYIE 3N9PA 3ZMUB 4GYRA 5HXHA 3Q5XA 2FJAA 3H37A 3ZT5A 1U4QA 4IIJE 2I6HA 4HFIA 2DL1A 5FL0A 5AQTB 5FY1A 4OYJA 2AXDS 2XAJB 2CLYB 3UULA 2MBGA 4EV6A 5FP3A 2XZEA 1VCSA 1UUSA 4CXYA 3AVRA 3KBUA 4B3RT 5IWAT 4AISA 4Z91A 2DWKA 5AQLB 1I94T 2N9DA 4BJNA 4G2AA 3UU3A 3L8RA 3GMIA 2XAHB 2NWBA 3ZLIA 2RPAA 3LFMA 4U72A 2CEAA 2LE8A 3RYFE 4KMCA 2ZM2A 1ZKEA 2UXNB 1MNEA 5L3BB 2VASA 4ILBA 3MKDA 4NIQA 3CQXC 3LDQB 3VU7H 3AA6B 4O4HE 4PFOA 4IL9A 4CI2B 3E0ZA 3C51A 2N2NA 4JEHB 4JI0T 3F2EA 3QNUA 4DV4T 3B57A 3JC6D 1Z8UA 3ZT7A 1WYCA 3TLVA 2WAUA 2A2FX 2VQET 5FL1A 4QHOA 5F3JA 2RP4A 4HGAA 1W0BA 2LOPA 1OEDB 5HEGA 2K24A 2K5BB 2E5LT 4TNWA 1MIVA 3OKQA 5H6QB 3IHRA 3VRBA 4TX5A 4AKGA 2YDQA 1LRZA 1LVKA 5CFBA 4QX7B 2IW5B 3QK6A 5EK3A 2J1DG 3K3OA 4ZI3C 4NUVA 2YKSA 5L3FB 3WAKA 1IBKT 3ZN0B 3AEGA 5F5WA 4JI5T 3PU8A 4UIGA 5JRCA 3IF8B 3LG7A 3C50A 5AQMB 5AQOB 4HFCA 4N78D 1HR0T 3P7IA 5JDMA 3Q2MA 3W15B 4PJNA 4MALA 2Q9QC 1UK5A 5AQHB 4EEDA 3U78A 4U33A 3H3AA 5JDNA 5ABFB 4MLKA 2D0TA 2E9XB 4M1PA 5J1GA 4L0RA 3CIRA 2NP9A 4ZI2C 3RPUA 2E5VA 4EEBA 4DUYT 4MHCA 4ZZBA 2VVNA 5FYMA 4EGWA 4YXDA 5HEJA 3AE5A 4X65T 3RF1A 3T8OA 2E9XD 2R6GF 3SWHA 4WW0A 5KDMC 4AQGA 3QC9A 4EZHA 3AE3A 4QKNA 3X1DA 4LFCT 2WWVA 4YT0A 4HFDA 2BG9B 3OJAA 3IEEA 4HN9A 2DHRA 5FVLA 3EAMA 3RKOA 3ZMZB 2MAWA 2NTYA 5DJQC 2H7VC 1VRBA 2QVAA 3P4RA 2WB5A 3F57A 4ZXLA 2VL8A 3RIUA 3NVOA 1MMDA 2JIWA 2BZBA 3RYCE 4H9QC 4X1KE 2XJ7A 4DV3T 4YHJA 1KF6A 5KMGP 4ISTA 5A1LA 1NAFA 1WFDA 1L0VA 4CI1B 2YDRA 2WZIA 2H7OA 2VKDA 2X51A 3I1AA 1UCUA 4JUYA 1XDPA 3GN5A 4UVCB 2IAKA 3KVBA 1D1CA 4EXTA 3C4ZA 5HEHA 2Y6XA 2X66A 2F4VT 2MYSA 2J4GA 2I0MA 1KNZA 1XMOT 3MK7C 2NW8A 3LK3B 4UR9A 4DNDA 2WBLA 4O4IE 3D0TA 1BR4A 5CB4E 3F31A 4OHFA 4YJ3E 2P9BA 3ZMSB 1YD8G 2YDSA 4PNIA 1VOMA 5HEOA
chains in the Genus database with same CATH topology
2LRKA 3ZT5A 3ZSSA 3ZT7A 3ZSTA 2RPAA 2WWVA 2CRBA 4ZEYA 4IT4A 1WCRA 3EABA 5FVKA 4U3CA 2JQHA 2W2UA 5CGMA 5LB7B 3ZT6A 4U31A 2DL1A 4U7YA 4CN1A 4U7IA 4A5XA 2CPTA 4U2ZA 4P1NA 5FVLA 2WY2A 2JQ9A 2V6YB 5CJ5A 3K1SA 1WFDA 2K3WA 4NIQA 1YXRA 1WR0A 4U33A 2V6XA 2LRLA 4U2YA 2XZEA 4CN4A 2A9UA 2MPKA 4WZXA 2V6YA 4CN6A 2JQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LRK A;  3ZT5 A;  3ZSS A;  3ZT7 A;  3ZST A;  2RPA A;  2WWV A;  2CRB A;  4ZEY A;  4IT4 A;  1WCR A;  3EAB A;  5FVK A;  4U3C A;  2JQH A;  2W2U A;  5CGM A;  5LB7 B;  3ZT6 A;  4U31 A;  2DL1 A;  4U7Y A;  4CN1 A;  4U7I A;  4A5X A;  2CPT A;  4U2Z A;  4P1N A;  5FVL A;  2WY2 A;  2JQ9 A;  2V6Y B;  5CJ5 A;  3K1S A;  1WFD A;  2K3W A;  4NIQ A;  1YXR A;  1WR0 A;  4U33 A;  2V6X A;  2LRL A;  4U2Y A;  2XZE A;  4CN4 A;  2A9U A;  2MPK A;  4WZX A;  2V6Y A;  4CN6 A;  2JQK A; 
#chains in the Genus database with same CATH topology
 2XQ3 A;  2H89 A;  4ILA A;  3NZQ A;  4U7I A;  3BQK A;  1HG2 A;  1Y01 A;  2X68 A;  3KV6 A;  4K0U A;  2XQY A;  1YQ3 A;  3ZYL A;  3K3N A;  4UF0 A;  1HNZ T;  4NPP A;  2ODU A;  4IL4 A;  2VWA A;  3UU5 A;  1YXR A;  4B6X A;  4YSZ A;  1MND A;  4KI0 F;  3UU4 A;  3CVR A;  5JR9 B;  5HWY A;  2BS2 A;  3I9Y A;  4JI1 T;  1J5E T;  2ACX A;  5HEU A;  2K9A A;  4WNK A;  4EZ4 A;  4IGU A;  4P1N A;  4DMV A;  2X0H A;  4AXP A;  4O2B E;  2V8S V;  3PUQ A;  3P4S A;  2LRL A;  4QXH B;  5HXR A;  2QYW A;  2FBW A;  4UV9 B;  3ZEF B;  4X5T A;  4EYY R;  3KIN B;  3EHZ A;  4LFB T;  2WU2 A;  3OPC A;  2J47 A;  1JNZ A;  2NW7 A;  3EDV A;  3EVY A;  4OYK A;  4A97 A;  2KMF A;  1T72 A;  2ZMA A;  5IHY A;  3AED A;  4TWD A;  3JAE A;  3AA7 B;  3ZN1 B;  3ETU A;  1Y64 B;  1WR6 A;  4UV8 B;  5LG3 A;  4HTE A;  4L9I A;  3RIU C;  2KND A;  2PG8 A;  3HI2 A;  3PUZ F;  4FJO A;  3OTO T;  1KNP A;  3AAA B;  5AQS B;  3N9O A;  1FMV A;  2WY2 A;  3AVS A;  3J7Y q;  4JI3 T;  2IUB A;  1CUN A;  3SOL A;  1HX1 B;  3ONL C;  3QOF A;  5LJM A;  3T1H T;  2XTL A;  5JDF A;  3RRC A;  4GKJ T;  3EAB A;  1D1A A;  5BR8 T;  2FUP A;  5FMN A;  2XM1 A;  2JQQ A;  3AAI A;  3IA3 A;  2XPK A;  3DJB A;  5LGU B;  4X20 E;  2V7K A;  3RI5 A;  3UQ7 A;  4H9S E;  3FBZ A;  5L4H A;  1VCT A;  1NEN A;  4U74 A;  2GK9 A;  4LF4 T;  2MPK A;  2SPC A;  2LM9 A;  5HWX A;  2PTF A;  3AAE B;  3FZK B;  4I50 E;  1SA0 E;  5HAX A;  5LB7 B;  2Q9Q A;  1B7T A;  1E7P A;  2DWG A;  4IE5 A;  4XBF B;  2BBJ A;  3FZL B;  3LBX A;  5AQP B;  1SHZ C;  4CXX A;  1HCI A;  4I55 E;  2BKO A;  4PK4 A;  4X1I E;  1JNR A;  5DQV A;  4QXC B;  1US7 B;  1YQ4 A;  4JI2 T;  1OWA A;  1HG5 A;  2VUR A;  2BDE A;  2C5K T;  3E08 A;  4HEA A;  3PUA A;  2WSS V;  3FB2 A;  5AQK B;  3V5S A;  1UUR A;  3HKC E;  3TLW A;  4ZZC A;  4C91 A;  3RIA A;  1HNX T;  1UX4 A;  2BS4 A;  4U2Z A;  4ZOL E;  2W61 A;  4XZC A;  2M6I A;  2UXX B;  3OBV E;  4ADZ A;  4OK0 A;  2ACZ A;  4HWH A;  5AQI B;  4G63 A;  3VKH A;  3M65 A;  5LXT E;  1HNW T;  2CXL A;  2BS3 A;  5J2U E;  2H3R A;  1FJG T;  2ZM0 A;  5L47 A;  3EDU A;  4JEU B;  3ZMT B;  3M3Z B;  3AE9 A;  3O4X E;  2VQF T;  5EZY E;  2B76 A;  5KX5 E;  2LHR A;  3B13 A;  4QXB B;  4GOU A;  1BR1 A;  1QLB A;  4PJJ A;  3IBP A;  4Z90 A;  2XQ8 A;  2CWY A;  3ABV A;  4UVA B;  3LK4 2;  3AXJ B;  3TKL B;  4ZI7 E;  4YLH A;  5JDL A;  3A8Y C;  2IDO B;  3AE6 A;  1XDO A;  1H7C A;  3I0O A;  4AKI A;  2RA1 A;  5JQG E;  4U31 A;  4DV1 T;  2KWH A;  2XM2 A;  5DAB A;  2HN1 A;  2KT9 A;  4WYV A;  2AE9 A;  3ZYK A;  2V6Y A;  1KK7 A;  2IIU A;  1O3X A;  1SUM B;  1WLX A;  2VB6 A;  2EHO C;  4LF6 T;  3JAF A;  5AQG B;  4EB6 E;  1M62 A;  4IHJ E;  2WZH A;  3MAC A;  4YY3 T;  2WS3 A;  5FNV E;  2NTX A;  3AEC A;  2BKN A;  4ZEY A;  3LJC A;  4AKR B;  4UEL A;  1W9R A;  3KV9 A;  4AQF C;  2V7L A;  4HFH A;  5HXS A;  4WBO A;  2PBI A;  2HHH T;  2PFV A;  1V9D A;  4AKH A;  2VVS A;  5JTG A;  3N9Q A;  4ZS2 A;  3N5L A;  2XQ9 A;  4IDO A;  2A3D A;  2DI4 A;  2KWI B;  2XQ6 A;  3PUX F;  4GYS A;  4CXW A;  2LSG A;  1IJ5 A;  4IDP A;  3GN5 B;  2QA7 A;  1ZEE A;  3AEB A;  4HWD A;  3UUM A;  3FXE B;  4YTP A;  1OED A;  4B3M T;  2Y48 B;  5IUX A;  2W2U A;  2LJL A;  5HCM A;  5JRE A;  2L9Q A;  3BQL A;  4H9N C;  4LML A;  2XAG B;  2B1E A;  4LF9 T;  2JMK A;  2IC6 A;  3Q5D A;  5LYJ E;  5DQW A;  3A5X A;  3AEE A;  5CA0 E;  3NZP A;  4CN1 A;  3RC8 A;  3C64 A;  5LGN B;  2I59 A;  2XQ7 A;  4DR4 T;  2CBI A;  1N33 T;  2WM9 A;  1HS7 A;  3AE8 A;  5L3G B;  4TWF A;  2V5C A;  4UXN B;  4A5X A;  5AQU B;  2CXD A;  2LEH A;  3AE4 A;  4OFZ A;  2KZ7 B;  4XAX B;  2V6X A;  3ONJ A;  3R84 B;  4U2Y A;  4UEM A;  2D5U A;  2W66 A;  5LGT B;  4UF0 B;  2JQK A;  3NWI A;  4H9O C;  3Q9D A;  2UUB T;  4H63 H;  4NUU A;  5FXZ A;  4KHZ F;  1SE7 A;  4HWC A;  1KEY A;  3HL6 A;  2XUE A;  4LF5 T;  2L8K A;  3KFW X;  4J2C A;  3FXD B;  3RH3 A;  2X9H A;  2LSK A;  1WYB A;  3EUH A;  3VR9 A;  5LJN A;  2C5I T;  2CLY C;  4PK5 A;  4QWN B;  4H9R C;  5E0O A;  2A72 A;  1BR2 A;  5HCJ A;  4Q25 A;  4MBQ A;  4IE0 A;  5AQF B;  4X64 T;  3AEF A;  2UUA T;  2XQ5 A;  3JC6 C;  4K0K T;  2NR4 A;  4DV7 T;  1HTJ F;  2XQA A;  5LA6 E;  5GON E;  4X1Y E;  5AQV B;  4PW8 A;  5HYA A;  2VK9 A;  3A7M A;  2HPL A;  1XNQ T;  4TV9 E;  3O9X A;  4QH4 A;  4ZS3 A;  1BR0 A;  1DU2 A;  4B3T T;  3ONX A;  4DBQ A;  3I9W A;  2YK0 A;  2V7I A;  4CN6 A;  1MMG A;  3ZSS A;  2J62 A;  2CBJ A;  4YSY A;  5KXJ A;  2VKJ A;  3KDS E;  1OED C;  2ODV A;  3U3I A;  3L39 A;  3GWH A;  4DR3 T;  1FMW A;  2IC9 A;  2ZM8 A;  3NKZ A;  3P4Q A;  1OXZ A;  3P4W A;  2PJQ A;  1NWM X;  2BKP A;  4IT4 A;  4LF8 T;  4DVD A;  1J5W A;  5LHG B;  2HN2 A;  3PUY F;  1UX5 A;  3UUN A;  3PDY A;  4V1A v;  3QB5 A;  3HA4 A;  4ZHQ E;  3ZKR A;  5L3C B;  3NBX X;  2E2A A;  4ZI3 D;  4HE8 A;  2Z6E A;  3MJX A;  2JRK A;  3WAJ A;  4DR2 T;  3HKB E;  2ZLY A;  2UUC T;  2BBH A;  3KVA A;  1N32 T;  5LMU T;  2W62 A;  4E7S A;  3AEA A;  4ILU A;  2LT3 A;  3LBX B;  3O1H A;  2X9W A;  5LOV E;  1IZN B;  4JI6 T;  4LFA T;  4PJL A;  4C90 A;  3OYZ A;  2W4X A;  1XWM A;  1QUU A;  2IML A;  4CN4 A;  3JAD A;  5CA1 E;  1LVF A;  1D0Y A;  3ZST A;  3VHL A;  1YKE B;  2X0Y A;  5EK2 A;  2CE7 A;  2OA5 A;  4O4L E;  2X0L B;  3K8P C;  2UXB T;  4YTN A;  3PUW F;  2E9X C;  1XNR T;  2IHR 1;  3ZC1 A;  2CHN A;  2XSA A;  1YKH B;  3AA0 B;  3C98 B;  1KFY A;  4QH5 A;  4ZI2 D;  2H88 A;  4GK0 E;  5H6R B;  4NXN T;  2EHO A;  4I4T E;  4DUZ T;  1G73 A;  5F8P A;  1CHU A;  4TZ4 C;  4E7Z A;  2OLT A;  2KIN B;  4GK5 E;  2LKH A;  5C2T A;  1N36 T;  1HF8 A;  4CZZ B;  4JBW F;  2WWU A;  3PJA A;  2LSY A;  3N9M A;  5JH7 E;  5FXW A;  2DCF A;  2N1G A;  3OYX A;  4AQF A;  2WDR A;  3ETV A;  5FXX A;  3BK9 A;  3CML A;  4H63 V;  5L2L A;  4UVB B;  2OV9 A;  4P09 A;  2BG9 C;  3EI0 A;  3RLF F;  2CHO A;  3TLT A;  2KLQ A;  2V1D B;  4KUM B;  2QGS A;  3R6N A;  4LF7 T;  1W0A A;  1EZ3 A;  3RC3 A;  4QH1 A;  1FIO A;  4EAH A;  2WDV A;  4AQY T;  3TLS A;  4EIW A;  2UXC T;  2XAQ B;  2JQH A;  3CKD A;  4EYU A;  2VKO A;  2V6Y B;  2WP9 A;  5LNK A;  4IRE A;  3UUX B;  2BVL A;  2NW9 A;  4F8H A;  3ANW A;  3P8C D;  3FBL A;  3RQW A;  3UQ4 A;  5JRC B;  1MMN A;  3AE7 A;  1MMA A;  1X9B A;  3OVU A;  2X67 A;  3S4U A;  3O1J A;  4ILC A;  4GKK T;  2M67 A;  3PTR B;  3RIF A;  2FJD A;  3ZPO A;  2YOE A;  2HPJ A;  3K1S A;  2WMO A;  3CPZ A;  5LG4 A;  4O2A E;  3UUB A;  2XAF B;  4IE4 A;  3VKG A;  2V7J A;  4YHH T;  4P0B A;  3PUR A;  2W0G A;  2D2S A;  3HKE E;  3RYH E;  3ESL A;  4DV0 T;  2KXP B;  4BA9 A;  3FHN A;  1OED E;  3RHW A;  2L3L A;  5HXC A;  5IYZ E;  3FZF B;  1LKX A;  1Z0P A;  3LK2 B;  2KSR A;  4I0U A;  5ADX L;  3MA9 A;  3P4P A;  2YN6 A;  3ZYM A;  4TNV A;  3CQG B;  3ZJ1 A;  2V26 A;  3RRW A;  2VKH A;  5JR9 C;  2CPT A;  4TUY E;  5L3D B;  1IBL T;  1MIY A;  1D1B A;  4YSX A;  5JDQ A;  4DR1 T;  1ZOY A;  2Y8D A;  2X9X A;  1XZY A;  4AKL A;  2D0U A;  3MXZ A;  5AQJ B;  4BJM A;  2X9Y A;  3GA8 A;  2LKG A;  4B3S T;  5L4E A;  2LHN A;  4TV8 E;  5JVD E;  3L09 A;  1UGO A;  1ZP0 A;  3N2G E;  4AI6 A;  3O1I A;  3UU6 A;  1WR0 A;  4TN7 B;  2ES0 A;  5ABH A;  3CWZ B;  3I0Q A;  4WBN E;  5JDH A;  3QB5 K;  4HWI B;  3J9X 1;  5LCY A;  4H9P C;  3SFD A;  1D0Z A;  5LP6 E;  4JV5 T;  1N34 T;  5LBQ B;  5C3J A;  3NRY A;  3HR0 A;  3FZH B;  3KBT A;  4HWF A;  1T7S A;  4O4J E;  3AXJ A;  3PUS A;  1YW0 A;  3ZMV B;  4ANJ A;  4HKA A;  4JLE A;  4U3C A;  5ABE A;  3PJA J;  4DR6 T;  2G0U A;  4DO0 A;  3N9L A;  4WZX A;  2WDQ A;  4ISS A;  4PK6 A;  2XQ4 A;  4GIW A;  2WCA A;  4COF A;  3PV0 F;  4LMJ A;  4YJ2 E;  4A98 A;  4IE7 A;  2DNX A;  2XAS B;  4L5G A;  2BG9 E;  2YIN A;  2NOX A;  3RX6 A;  4DV5 T;  4F6R C;  5HXE A;  3DTO A;  2WMN A;  2CCQ A;  4HFE A;  1WCR A;  1NEK A;  5J0Z A;  3ZCI A;  3VR8 A;  2CXF A;  4DV2 T;  5FY7 A;  3MZK B;  2YU2 A;  3AA1 B;  3C4X A;  3E22 E;  2W63 A;  5M4Y A;  2YEV C;  3K3Q C;  5ABF A;  2LSJ A;  3ZCJ A;  3PE0 A;  2E9X A;  4FI5 A;  2FJB A;  2QRX A;  5LMN T;  4I43 B;  2CMR A;  3PU3 A;  2YU1 A;  3AE1 A;  3P50 A;  4QX8 B;  1MIW A;  1J1J A;  2JPF A;  3WI3 A;  2W67 A;  1S35 A;  4DR5 T;  1FEW A;  4CI3 B;  2XSB A;  1M7K A;  3UFG A;  3KV5 A;  4ERR A;  4TWH A;  3UTK A;  3V5U A;  3N2K E;  3ZC0 A;  2JQ9 A;  4AIU A;  3JCF A;  1IBM T;  3TLU A;  3T1Y T;  1E2A A;  2LRK A;  4HFV A;  4PAG A;  4EOZ B;  2M6B A;  4KP3 C;  5AQR B;  4JI7 T;  4PFP A;  3G06 A;  1QSD A;  5AFU L;  1T98 A;  2K3W A;  2BG9 A;  1U5P A;  4DMW A;  5BMV E;  3B5M A;  4IDZ A;  2V5D A;  2CRB A;  3QUJ A;  3FZM B;  3SRZ A;  5TAO A;  4DV6 T;  2UU9 T;  4IE6 A;  1HX8 A;  2CM0 A;  4YFS A;  3BQI A;  2A9U A;  3UU8 A;  1ZV4 X;  3AB3 B;  2FJE A;  2HH7 A;  5AQQ B;  1WRD A;  3ZT6 A;  1AJ3 A;  1G8X A;  4BAY B;  1W09 A;  3N2O A;  2JJ9 A;  1S94 A;  4X62 T;  3NRX A;  4DR7 T;  3CK6 A;  2EHO B;  4PJM A;  4DID B;  3CX6 B;  2V7M A;  4KBM B;  4MFR A;  5EK4 A;  3SFE A;  5LBM A;  3RGL A;  1ZHC A;  2XHE B;  5J2T E;  3VRA A;  4YTM A;  1I6Z A;  1X79 A;  3UT5 E;  3RQU A;  3PUV F;  2CWO A;  5JDG A;  3AE2 A;  5CGM A;  3HKD E;  2Q9Q B;  4IDQ A;  1D0X A;  3LSV A;  2EHO D;  4HFB A;  5FVK A;  1R8I A;  1GQE A;  3RKG A;  3KV4 A;  1KNR A;  4O8S A;  5FKY A;  5ABG A;  1XMQ T;  3DP7 A;  3ZJ2 A;  4IDN A;  5AQN B;  2MTQ A;  3N9N A;  2UXD T;  2W00 A;  5LHI B;  2VL0 A;  2LM2 A;  5FXV A;  3Q5W A;  5LHH B;  2Q9Q D;  1HFA A;  2K48 A;  4LMK A;  3Q5E A;  2E8I A;  2MOZ A;  5L3E B;  3SS1 A;  2ZM6 T;  1E1H B;  4P0A A;  4JI4 T;  4ASK A;  5FY0 A;  1IJ6 A;  2C0S A;  2WU5 A;  3UFE A;  3CQC B;  2BVM A;  5JR9 A;  4A56 A;  4DBR A;  3ANW B;  4KHP T;  4X66 T;  2CA5 A;  4JYA T;  1IAP A;  3H3M A;  5ETW A;  2XY8 B;  2D9D A;  5C8Y E;  3L3P A;  4NXM T;  4U7Y A;  3PUG A;  4CQI A;  5CJ5 A;  3CX7 B;  3C4W A;  2DLR A;  3CX8 B;  4OX9 T;  4KX6 A;  1T8B A;  2LLY A;  2LOS A;  2JMH A;  2WQY A;  2LSI A;  4Z8X A;  2C5J A;  4JI8 T;  3RYI E;  3N9P A;  3ZMU B;  4GYR A;  5HXH A;  3Q5X A;  2FJA A;  3H37 A;  3ZT5 A;  1U4Q A;  4IIJ E;  2I6H A;  4HFI A;  2DL1 A;  5FL0 A;  5AQT B;  5FY1 A;  4OYJ A;  2AXD S;  2XAJ B;  2CLY B;  3UUL A;  2MBG A;  4EV6 A;  5FP3 A;  2XZE A;  1VCS A;  1UUS A;  4CXY A;  3AVR A;  3KBU A;  4B3R T;  5IWA T;  4AIS A;  4Z91 A;  2DWK A;  5AQL B;  1I94 T;  2N9D A;  4BJN A;  4G2A A;  3UU3 A;  3L8R A;  3GMI A;  2XAH B;  2NWB A;  3ZLI A;  2RPA A;  3LFM A;  4U72 A;  2CEA A;  2LE8 A;  3RYF E;  4KMC A;  2ZM2 A;  1ZKE A;  2UXN B;  1MNE A;  5L3B B;  2VAS A;  4ILB A;  3MKD A;  4NIQ A;  3CQX C;  3LDQ B;  3VU7 H;  3AA6 B;  4O4H E;  4PFO A;  4IL9 A;  4CI2 B;  3E0Z A;  3C51 A;  2N2N A;  4JEH B;  4JI0 T;  3F2E A;  3QNU A;  4DV4 T;  3B57 A;  3JC6 D;  1Z8U A;  3ZT7 A;  1WYC A;  3TLV A;  2WAU A;  2A2F X;  2VQE T;  5FL1 A;  4QHO A;  5F3J A;  2RP4 A;  4HGA A;  1W0B A;  2LOP A;  1OED B;  5HEG A;  2K24 A;  2K5B B;  2E5L T;  4TNW A;  1MIV A;  3OKQ A;  5H6Q B;  3IHR A;  3VRB A;  4TX5 A;  4AKG A;  2YDQ A;  1LRZ A;  1LVK A;  5CFB A;  4QX7 B;  2IW5 B;  3QK6 A;  5EK3 A;  2J1D G;  3K3O A;  4ZI3 C;  4NUV A;  2YKS A;  5L3F B;  3WAK A;  1IBK T;  3ZN0 B;  3AEG A;  5F5W A;  4JI5 T;  3PU8 A;  4UIG A;  5JRC A;  3IF8 B;  3LG7 A;  3C50 A;  5AQM B;  5AQO B;  4HFC A;  4N78 D;  1HR0 T;  3P7I A;  5JDM A;  3Q2M A;  3W15 B;  4PJN A;  4MAL A;  2Q9Q C;  1UK5 A;  5AQH B;  4EED A;  3U78 A;  4U33 A;  3H3A A;  5JDN A;  5ABF B;  4MLK A;  2D0T A;  2E9X B;  4M1P A;  5J1G A;  4L0R A;  3CIR A;  2NP9 A;  4ZI2 C;  3RPU A;  2E5V A;  4EEB A;  4DUY T;  4MHC A;  4ZZB A;  2VVN A;  5FYM A;  4EGW A;  4YXD A;  5HEJ A;  3AE5 A;  4X65 T;  3RF1 A;  3T8O A;  2E9X D;  2R6G F;  3SWH A;  4WW0 A;  5KDM C;  4AQG A;  3QC9 A;  4EZH A;  3AE3 A;  4QKN A;  3X1D A;  4LFC T;  2WWV A;  4YT0 A;  4HFD A;  2BG9 B;  3OJA A;  3IEE A;  4HN9 A;  2DHR A;  5FVL A;  3EAM A;  3RKO A;  3ZMZ B;  2MAW A;  2NTY A;  5DJQ C;  2H7V C;  1VRB A;  2QVA A;  3P4R A;  2WB5 A;  3F57 A;  4ZXL A;  2VL8 A;  3RIU A;  3NVO A;  1MMD A;  2JIW A;  2BZB A;  3RYC E;  4H9Q C;  4X1K E;  2XJ7 A;  4DV3 T;  4YHJ A;  1KF6 A;  5KMG P;  4IST A;  5A1L A;  1NAF A;  1WFD A;  1L0V A;  4CI1 B;  2YDR A;  2WZI A;  2H7O A;  2VKD A;  2X51 A;  3I1A A;  1UCU A;  4JUY A;  1XDP A;  3GN5 A;  4UVC B;  2IAK A;  3KVB A;  1D1C A;  4EXT A;  3C4Z A;  5HEH A;  2Y6X A;  2X66 A;  2F4V T;  2MYS A;  2J4G A;  2I0M A;  1KNZ A;  1XMO T;  3MK7 C;  2NW8 A;  3LK3 B;  4UR9 A;  4DND A;  2WBL A;  4O4I E;  3D0T A;  1BR4 A;  5CB4 E;  3F31 A;  4OHF A;  4YJ3 E;  2P9B A;  3ZMS B;  1YD8 G;  2YDS A;  4PNI A;  1VOM A;  5HEO A; 
#chains in the Genus database with same CATH homology
 2LRK A;  3ZT5 A;  3ZSS A;  3ZT7 A;  3ZST A;  2RPA A;  2WWV A;  2CRB A;  4ZEY A;  4IT4 A;  1WCR A;  3EAB A;  5FVK A;  4U3C A;  2JQH A;  2W2U A;  5CGM A;  5LB7 B;  3ZT6 A;  4U31 A;  2DL1 A;  4U7Y A;  4CN1 A;  4U7I A;  4A5X A;  2CPT A;  4U2Z A;  4P1N A;  5FVL A;  2WY2 A;  2JQ9 A;  2V6Y B;  5CJ5 A;  3K1S A;  1WFD A;  2K3W A;  4NIQ A;  1YXR A;  1WR0 A;  4U33 A;  2V6X A;  2LRL A;  4U2Y A;  2XZE A;  4CN4 A;  2A9U A;  2MPK A;  4WZX A;  2V6Y A;  4CN6 A;  2JQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...