1YXRA

Nmr structure of vps4a mit domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
b'MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vacuolar protein sorting factor 4A
publication title NMR Structure of VPS4A MIT Domain
rcsb
source organism Homo sapiens
molecule tags Protein trafficking
total genus 29
structure length 77
sequence length 77
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1yxrA01
4U31A 5FVLA 4WZXA 2A9UA 5LB7B 2MPKA 3ZT5A 2JQHA 3ZT7A 2CRBA 5CGMA 3EABA 4U2YA 5FVKA 4U7YA 2WY2A 4U2ZA 4U7IA 3K1SA 4A5XA 2V6YA 4CN6A 2JQKA 2LRKA 2LRLA 5CJ5A 3ZSSA 2CPTA 3ZT6A 2V6YB 2W2UA 2JQ9A 1WR0A 4U3CA 4CN4A 2V6XA 2XZEA 1WFDA 3ZSTA 4CN1A 4NIQA 2DL1A 4IT4A 2WWVA 1WCRA 1YXRA 4P1NA 4U33A 4ZEYA 2RPAA 2K3WA
chains in the Genus database with same CATH superfamily
2UUCT 4G63A 4F6RC 2KSRA 4JI0T 1QSDA 2KNDA 4O2AE 3P7IA 4UR9A 3I1AA 3VR9A 3RH3A 4LF4T 5HCJA 2D0TA 3AE7A 4ZS2A 2W00A 3H3AA 3CPZA 5FXZA 4UF0A 4IL9A 3KDSE 4YSYA 1MIVA 3PUYF 4UXNB 4ILCA 4EB6E 3ZCIA 3UQ7A 4UIGA 2K5BB 1MNEA 1ZOYA 4AKIA 2E9XB 5L3DB 3RKGA 1WFDA 2UXDT 2KMFA 2M67A 4O4HE 2XQAA 2Q9QB 5JDLA 1ZEEA 4HWCA 5LCYA 2Y8DA 3AE2A 1SA0E 1XMQT 3WAKA 4ZS3A 4ISSA 5LG4A 4YJ3E 5L3CB 4IE0A 4CXXA 3ZT6A 4PJMA 4HWDA 4PFOA 4JLEA 4IIJE 5JDMA 1BR1A 5L2LA 5AQIB 5AQSB 3F57A 1HNXT 2EHOC 4AQYT 2UXBT 4UVCB 3PUXF 3CQCB 4DBRA 4EZ4A 4MFRA 1OEDE 1HTJF 5HXEA 2VB6A 2M6IA 2WQYA 4YY3T 2NOXA 3UUMA 3VHLA 3AE9A 5AQVB 3KV4A 4DR3T 5FY0A 4EXTA 4JI1T 4O2BE 5IUXA 5DQWA 1WR6A 3CKDA 3QUJA 1KFYA 3DP7A 5L3EB 1LRZA 2V6YB 4TWHA 4ZZCA 3IHRA 4C90A 3DJBA 2XTLA 2CLYC 3AVRA 3NBXX 1WLXA 4Q25A 1OXZA 1MMDA 2KXPB 2L9QA 3B57A 5AQNB 2VL8A 5J0ZA 4CI2B 2V26A 3B5MA 3PUWF 4E7ZA 1X79A 2WB5A 2H7OA 4I4TE 2ZM2A 2X68A 2X0YA 2NTYA 1HX1B 4O4LE 2X51A 5F5WA 2JMKA 4GYSA 3JC6C 4H9OC 4YHHT 2VWAA 1HS7A 1V9DA 3LJCA 2D0UA 3Q9DA 5HXCA 2CEAA 4ILBA 3FB2A 3T8OA 1MMGA 5L4EA 3TLUA 5FYMA 3A8YC 1JNZA 3F31A 3N9LA 3TLTA 3EUHA 4LMJA 4EYUA 1KNZA 5AQLB 4X5TA 5EK2A 4LFBT 2XAQB 2BVMA 3RYFE 1HX8A 4B3TT 1VCSA 2YU2A 4IDPA 4DUZT 4CN1A 3BQLA 3N2GE 5HEJA 5M4YA 4J2CA 3ONLC 1QUUA 4I50E 3RGLA 1KNRA 2W63A 1YQ4A 2CBJA 2BKOA 3BQIA 2X9HA 3VRBA 3NZQA 2JQ9A 4HN9A 4NXMT 2XM2A 3KINB 2OV9A 5L4HA 3F2EA 2BS4A 4LF5T 3MA9A 4YTMA 4PK6A 2V8SV 2E8IA 2BBHA 2EHOB 4H63V 3FBZA 2VQFT 3BQKA 4TNWA 4KMCA 4IREA 3GN5B 1SHZC 1YD8G 5HCMA 3PUVF 5ABEA 2W62A 3SS1A 4YTPA 1N32T 2CMRA 2CCQA 2E9XA 3TLVA 2YINA 3LK3B 3ZCJA 5CJ5A 4DV3T 4PJNA 2J1DG 4DMVA 2Q9QA 4AI6A 5HEHA 3N9PA 3PDYA 3VU7H 5LMUT 4KHZF 5BR8T 3ZYKA 4B3ST 2VKOA 2XQ8A 5J2UE 4PNIA 2BZBA 3EDUA 4YT0A 2YDSA 2JPFA 2CLYB 2I0MA 4ZZBA 4DV7T 3P4QA 4PJJA 3RHWA 1EZ3A 4IDQA 5JDFA 3V5UA 3CWZB 1XNQT 2VKDA 4U2YA 2WU5A 1HNZT 2CPTA 2HN1A 2W2UA 4CQIA 2H7VC 3CX7B 4DMWA 4QX7B 2ACZA 5JDHA 1AJ3A 4P0BA 1YW0A 5AQQB 2CRBA 2ODUA 2LKGA 2WMOA 4JI4T 4BAYB 1U5PA 2WY2A 2I59A 3KFWX 3ZJ2A 1NENA 2FJEA 2NW9A 4QKNA 1D0ZA 4ANJA 5GONE 2XQ4A 4YXDA 3L3PA 2MAWA 2JQQA 4DR5T 2ZM8A 3EHZA 5L3BB 2IIUA 5JR9B 1KF6A 5LHGB 3AEBA 2V6YA 2XAFB 3I9YA 2H88A 3RYIE 2QGSA 2KWIB 2LJLA 2PFVA 3HL6A 1FMVA 4DR4T 3QOFA 1WCRA 3E08A 2VVSA 3LSVA 2P9BA 3HKBE 5FVLA 2H3RA 1M62A 3K3NA 3N5LA 1D1CA 3M65A 3NVOA 1J5ET 1SUMB 1S35A 2WZIA 3Q5WA 4ZOLE 2LOPA 3P50A 5HEOA 4AKGA 3PUQA 1VRBA 4EEDA 2B1EA 4P1NA 4KI0F 4A98A 3AEEA 4HWHA 3ZMSB 2LLYA 2X0LB 2OLTA 2WZHA 3L09A 3ANWA 4TV8E 5LA6E 2N1GA 3RX6A 1J1JA 2YDRA 1OEDB 2K9AA 1WR0A 3JADA 2UXXB 3N2KE 2D5UA 4U31A 4I43B 4HFHA 1HF8A 3PJAA 4V1Av 3AE5A 4U2ZA 3Q5XA 1G8XA 4EZHA 2XAHB 2BS3A 3E22E 4KP3C 4NUVA 4PK4A 3ZYLA 4IHJE 2HHHT 5AQTB 2XQ7A 5FL1A 4QXHB 3KV5A 2CA5A 1FEWA 2K24A 2NP9A 5HWXA 1ZV4X 5E0OA 4G2AA 1N36T 2L3LA 4OFZA 5AQMB 4EEBA 3ZSSA 2XQ6A 5DJQC 2XQ3A 4JI6T 5HXRA 1IJ6A 4P0AA 3C4ZA 2X9YA 3ZC1A 4M1PA 4XBFB 1I6ZA 2JQHA 2LHNA 2X67A 3FHNA 4JEHB 5HXHA 3TLWA 3EVYA 3C98B 3GMIA 2VL0A 4DV6T 4CZZB 3PV0F 3RRWA 3D0TA 3UU3A 4CN4A 5JDQA 1E1HB 3AAIA 2N2NA 4WBNE 4CI1B 4GYRA 3P4PA 2VURA 4DNDA 3GN5A 2E9XD 4LMLA 3FZFB 4H9RC 2D9DA 2IDOB 5HXSA 2Q9QD 3JAEA 4IDZA 3NZPA 3RQUA 3ZC0A 4PJLA 2LSGA 5HAXA 2CHNA 1ZKEA 5C3JA 5ADXL 1W0BA 4HFDA 2I6HA 1XZYA 4HFIA 3QNUA 3CX6B 5JH7E 3J9X1 4UV9B 1FIOA 4KBMB 2W66A 4L9IA 5CA0E 2NW7A 3AE3A 4MHCA 2UUBT 2WWVA 4ISTA 3O1JA 2V7MA 2WWUA 3N2OA 2C0SA 4CI3B 5FP3A 4XAXB 4A5XA 2FJBA 3AAEB 3WI3A 2XY8B 4BJNA 2DHRA 2ZLYA 4IE4A 5KDMC 5DABA 2BKNA 2XPKA 4AQFA 2C5IT 2V5CA 2PBIA 2LM2A 5FKYA 3AB3B 4Z8XA 3CVRA 2JIWA 4HKAA 4AXPA 5JR9A 5AQKB 2M6BA 4PAGA 4A56A 4LF7T 1HCIA 2D2SA 3C51A 3KBTA 3A5XA 3CQXC 3AAAB 4HWIB 4DR1T 2X9WA 5AQUB 3UU4A 2XZEA 4YJ2E 4O4JE 1IJ5A 3CQGB 1D0YA 5EZYE 3ZMZB 4ZI3C 2WU2A 3VKGA 2F4VT 3M3ZB 5JQGE 4DV4T 2FJDA 2NR4A 2QRXA 5F8PA 4GIWA 2JMHA 5IYZE 4OYJA 5J1GA 2KLQA 2XQYA 2MOZA 3OTOT 2E5VA 2YOEA 5CGMA 1T98A 3H3MA 4DV2T 2ES0A 5LG3A 3AEDA 2AXDS 4YSXA 5JTGA 1OEDA 2RP4A 4DO0A 3L39A 3OJAA 2WP9A 3ZSTA 3LBXB 4QH4A 1YXRA 1UK5A 2A9UA 3PTRB 4IDOA 5LJMA 4IGUA 5DQVA 5AFUL 5IWAT 1W9RA 3P8CD 3RIAA 2LOSA 4O4IE 1UX5A 1N34T 5LOVE 4JI7T 2LSYA 1BR4A 2BDEA 3O1HA 2WS3A 5ETWA 2QYWA 1MMAA 3NRYA 3N9QA 4AQGA 4BA9A 2LT3A 5LJNA 1I94T 3LK42 1IZNB 2BKPA 4TZ4C 5LP6E 2NW8A 4O8SA 4QWNB 2AE9A 1XDOA 3QC9A 3ONXA 2W61A 4CXYA 3X1DA 3SFDA 4TV9E 2ACXA 2J4GA 2XQ9A 3LK2B 2DCFA 5LBQB 5C8YE 3AA0B 3RF1A 2EHOD 5AQGB 2VKHA 3J7Yq 2BG9C 5LYJE 4B3MT 3VR8A 1KEYA 4YFSA 3RYHE 1L0VA 3NWIA 4X65T 3MK7C 1VOMA 2WAUA 4NPPA 5CFBA 4GKKT 3PE0A 2K48A 4U3CA 2WMNA 2PTFA 4ERRA 3K8PC 2IC9A 5ABHA 3PUGA 4B6XA 2WSSV 1IBKT 4H9QC 4JYAT 2WBLA 3MACA 4KX6A 3UULA 3TKLB 1Y64B 2XM1A 4KUMB 2XAJB 3PU8A 4IE7A 4AKRB 2CXFA 4XZCA 2XHEB 2FUPA 3EAMA 3RIUA 5LGTB 4DR2T 4I0UA 2DI4A 5JDGA 2XQ5A 1HG5A 4EOZB 3IF8B 2Y48B 4ILAA 2LEHA 5IHYA 5CA1E 5AQJB 5JDNA 3ZLIA 3GA8A 1T7SA 2V7KA 4PFPA 4Z90A 3ZT5A 1T8BA 5LHIB 1UCUA 3K3QC 2E9XC 3JC6D 2LSJA 2IAKA 4LF9T 4DBQA 1H7CA 4IT4A 4ZI2D 2UXCT 2XSAA 4WW0A 1LKXA 3AECA 2YEVC 5L3FB 3PUAA 1D0XA 5EK3A 2WCAA 4UV8B 4DR7T 5FMNA 4TX5A 4QH5A 3FZHB 4EV6A 3VKHA 5LNKA 2UXNB 4IE5A 4Z91A 5H6QB 4TN7B 3N9MA 4K0UA 5AQPB 5AQHB 3C4XA 3ZN1B 1GQEA 2V7LA 3R84B 5FL0A 5KMGP 4IE6A 2QA7A 4LFCT 4JUYA 3MKDA 3ZPOA 4QXBB 4DV5T 4YHJA 4H9PC 3BK9A 1MIWA 3ZMVB 3HKCE 3Q5EA 3L8RA 3V5SA 2ZMAA 1HNWT 3JAFA 1LVFA 3C50A 4TWFA 3PU3A 3OKQA 3O4XE 2VKJA 3S4UA 2CXDA 3KV9A 4KHPT 4HFEA 5HYAA 3G06A 4HFVA 3AE6A 4ASKA 1OWAA 5LGNB 2IMLA 4U7YA 1CUNA 5EK4A 4AKLA 1CHUA 2LRLA 3UT5E 2V5DA 3CX8B 4YLHA 3LBXA 2BVLA 5HEGA 2BG9B 4X20E 2DWGA 2DNXA 2N9DA 3FXEB 3IA3A 3Q5DA 3GWHA 5AQRB 3QB5A 2LKHA 4MBQA 3K1SA 4A97A 2IC6A 4HGAA 2V6XA 4MLKA 2XJ7A 3I0QA 3N9OA 1MMNA 5LXTE 2A72A 2YDQA 3DTOA 2FJAA 1O3XA 4PW8A 3OYXA 4GKJT 3HR0A 4X1YE 3AEGA 4B3RT 2C5JA 1HR0T 1S94A 1WYCA 5LBMA 5JVDE 3RC3A 3RRCA 2CHOA 4LFAT 4WNKA 3EABA 4ZXLA 5FNVE 2LSIA 2VQET 3VRAA 4WBOA 3ZKRA 3OBVE 1YKEB 4X62T 4U7IA 2EHOA 2JQKA 3OVUA 2E5LT 5HEUA 4YTNA 2YN6A 2JRKA 2DL1A 3UU6A 4EGWA 1XMOT 2VK9A 3U3IA 2LSKA 2MPKA 2CWOA 4AIUA 1BR0A 3KV6A 3UUXB 4OYKA 2LRKA 4P09A 4GK5E 4X1IE 2IUBA 3ZJ1A 3Q2MA 3RYCE 4JEUB 3SRZA 5ABGA 3RQWA 3RC8A 2V1DB 3ZYMA 1MNDA 3I0OA 5TAOA 3T1YT 4DVDA 2UUAT 1UUSA 3R6NA 2W4XA 1B7TA 3EDVA 3LDQB 1UX4A 4YSZA 1HG2A 4ZI7E 2ZM0A 1NEKA 1R8IA 1Z8UA 2CBIA 3LFMA 2CE7A 3AEFA 2SPCA 1WRDA 4GK0E 2ODVA 1QLBA 3SWHA 2BG9E 4DR6T 2E2AA 1NWMX 3ETVA 3RI5A 4DV1T 2CWYA 4U33A 2RPAA 5JREA 3AXJB 4ZHQE 1DU2A 2WDQA 5FXXA 3NKZA 1IBLT 3IEEA 4HFBA 4U74A 4OHFA 2DWKA 5L47A 2NTXA 3QB5K 5FY7A 1YQ3A 3PJAJ 4U72A 3PUZF 4JI3T 2W67A 4K0KT 3UFGA 2V7IA 2WDVA 3KVAA 3P4SA 4COFA 2H89A 1XDPA 4E7SA 3KVBA 3FZKB 3AE1A 2LE8A 4AKHA 4H9SE 3CIRA 1E7PA 4H9NC 1W0AA 3ANWB 3P4RA 4LF8T 4AQFC 5ABFB 4ZI2C 4QX8B 1HFAA 4ZEYA 3E0ZA 3ZEFB 2KT9A 3AEAA 5JR9C 3ZMTB 3RLFF 2XAGB 3H37A 3QK6A 5FY1A 1NAFA 3UTKA 3MXZA 4JI5T 4EIWA 1FJGT 5JRCB 1VCTA 2BG9A 3HKDE 2PJQA 4HE8A 3B13A 3P4WA 1Z0PA 5FVKA 3T1HT 3RKOA 1U4QA 4UELA 4DIDB 3MZKB 3JCFA 4F8HA 2WM9A 1KNPA 1KK7A 2DLRA 2YK0A 3WAJA 2IHR1 1WYBA 3TLSA 3U78A 4CXWA 4WYVA 1SE7A 2R6GF 3UU8A 5FXVA 1OEDC 1LVKA 4MALA 3I9WA 4UF0B 3MJXA 2X66A 3CMLA 2OA5A 1IBMT 4FI5A 2XASB 4JV5T 4UEMA 2B76A 5J2TE 4CN6A 3SFEA 3ESLA 3C64A 4ILUA 3RPUA 3FXDB 3UQ4A 2J47A 4HFCA 2KWHA 3UUBA 1XNRT 3ABVA 2CXLA 2V7JA 3PURA 3HA4A 3ZN0B 3OPCA 3EI0A 3W15B 3AA1B 4EYYR 4GOUA 4BJMA 3LG7A 1G73A 1N33T 4OK0A 1D1BA 2YKSA 3AE8A 2YU1A 2BS2A 2X9XA 4DUYT 2JJ9A 3OYZA 1MIYA 1ZP0A 4JBWF 2MBGA 1US7B 2LM9A 4UVBB 4AISA 3SOLA 1JNRA 4X64T 3O9XA 2A2FX 4PK5A 4ZI3D 4L5GA 1IAPA 1T72A 3O1IA 2ZM6T 4OX9T 4TWDA 4DV0T 2J62A 4JI2T 5L3GB 3K3OA 2MTQA 4IDNA 1D1AA 2WDRA 2UU9T 4QHOA 2Q9QC 2PG8A 4NXNT 2LHRA 2A3DA 4L0RA 4WZXA 5LB7B 4UVAB 4HWFA 4ADZA 2CM0A 3IBPA 1M7KA 4QH1A 3N9NA 1W09A 2Z6EA 3FZMB 5LGUB 2KINB 3KBUA 3AXJA 4NIQA 5KXJA 4JI8T 2VVNA 4IL4A 2X0HA 4HEAA 3RIUC 5FXWA 3ZT7A 3HKEE 3UFEA 2XUEA 3AVSA 5AQFB 1ZHCA 2G0UA 1XWMA 4LMKA 5A1LA 5AQOB 1UURA 4TUYE 2XSBA 5LMNT 2W0GA 1UGOA 3ETUA 4N78D 4LF6T 4TNVA 2KZ7B 2HN2A 2BBJA 5BMVE 3ZMUB 3UUNA 2L8KA 3C4WA 5C2TA 4QXCB 1FMWA 2RA1A 2IW5B 2FBWA 4I55E 5ABFA 2QVAA 2HPJA 1BR2A 3CK6A 2GK9A 3FZLB 2HPLA 4HTEA 2HH7A 5F3JA 3A7MA 4C91A 4EAHA 5H6RB 3HI2A 3FBLA 5JRCA 5HWYA 3AE4A 3PUSA 2MYSA 4X1KE 4X66T 1YKHB 5KX5E 5LHHB 2K3WA 1Y01A 3ONJA 2C5KT 3RIFA 2Y6XA 2VASA 1E2AA 3AA7B 3NRXA 5CB4E 4FJOA 3UU5A 4H63H 3AA6B 2NWBA 1J5WA 1X9BA 4NUUA
chains in the Genus database with same CATH topology
4U31A 5FVLA 4WZXA 2A9UA 5LB7B 2MPKA 3ZT5A 2JQHA 3ZT7A 2CRBA 5CGMA 3EABA 4U2YA 5FVKA 4U7YA 2WY2A 4U2ZA 4U7IA 3K1SA 4A5XA 2V6YA 4CN6A 2JQKA 2LRKA 2LRLA 5CJ5A 3ZSSA 2CPTA 3ZT6A 2V6YB 2W2UA 2JQ9A 1WR0A 4U3CA 4CN4A 2V6XA 2XZEA 1WFDA 3ZSTA 4CN1A 4NIQA 2DL1A 4IT4A 2WWVA 1WCRA 1YXRA 4P1NA 4U33A 4ZEYA 2RPAA 2K3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U31 A;  5FVL A;  4WZX A;  2A9U A;  5LB7 B;  2MPK A;  3ZT5 A;  2JQH A;  3ZT7 A;  2CRB A;  5CGM A;  3EAB A;  4U2Y A;  5FVK A;  4U7Y A;  2WY2 A;  4U2Z A;  4U7I A;  3K1S A;  4A5X A;  2V6Y A;  4CN6 A;  2JQK A;  2LRK A;  2LRL A;  5CJ5 A;  3ZSS A;  2CPT A;  3ZT6 A;  2V6Y B;  2W2U A;  2JQ9 A;  1WR0 A;  4U3C A;  4CN4 A;  2V6X A;  2XZE A;  1WFD A;  3ZST A;  4CN1 A;  4NIQ A;  2DL1 A;  4IT4 A;  2WWV A;  1WCR A;  1YXR A;  4P1N A;  4U33 A;  4ZEY A;  2RPA A;  2K3W A; 
#chains in the Genus database with same CATH topology
 2UUC T;  4G63 A;  4F6R C;  2KSR A;  4JI0 T;  1QSD A;  2KND A;  4O2A E;  3P7I A;  4UR9 A;  3I1A A;  3VR9 A;  3RH3 A;  4LF4 T;  5HCJ A;  2D0T A;  3AE7 A;  4ZS2 A;  2W00 A;  3H3A A;  3CPZ A;  5FXZ A;  4UF0 A;  4IL9 A;  3KDS E;  4YSY A;  1MIV A;  3PUY F;  4UXN B;  4ILC A;  4EB6 E;  3ZCI A;  3UQ7 A;  4UIG A;  2K5B B;  1MNE A;  1ZOY A;  4AKI A;  2E9X B;  5L3D B;  3RKG A;  1WFD A;  2UXD T;  2KMF A;  2M67 A;  4O4H E;  2XQA A;  2Q9Q B;  5JDL A;  1ZEE A;  4HWC A;  5LCY A;  2Y8D A;  3AE2 A;  1SA0 E;  1XMQ T;  3WAK A;  4ZS3 A;  4ISS A;  5LG4 A;  4YJ3 E;  5L3C B;  4IE0 A;  4CXX A;  3ZT6 A;  4PJM A;  4HWD A;  4PFO A;  4JLE A;  4IIJ E;  5JDM A;  1BR1 A;  5L2L A;  5AQI B;  5AQS B;  3F57 A;  1HNX T;  2EHO C;  4AQY T;  2UXB T;  4UVC B;  3PUX F;  3CQC B;  4DBR A;  4EZ4 A;  4MFR A;  1OED E;  1HTJ F;  5HXE A;  2VB6 A;  2M6I A;  2WQY A;  4YY3 T;  2NOX A;  3UUM A;  3VHL A;  3AE9 A;  5AQV B;  3KV4 A;  4DR3 T;  5FY0 A;  4EXT A;  4JI1 T;  4O2B E;  5IUX A;  5DQW A;  1WR6 A;  3CKD A;  3QUJ A;  1KFY A;  3DP7 A;  5L3E B;  1LRZ A;  2V6Y B;  4TWH A;  4ZZC A;  3IHR A;  4C90 A;  3DJB A;  2XTL A;  2CLY C;  3AVR A;  3NBX X;  1WLX A;  4Q25 A;  1OXZ A;  1MMD A;  2KXP B;  2L9Q A;  3B57 A;  5AQN B;  2VL8 A;  5J0Z A;  4CI2 B;  2V26 A;  3B5M A;  3PUW F;  4E7Z A;  1X79 A;  2WB5 A;  2H7O A;  4I4T E;  2ZM2 A;  2X68 A;  2X0Y A;  2NTY A;  1HX1 B;  4O4L E;  2X51 A;  5F5W A;  2JMK A;  4GYS A;  3JC6 C;  4H9O C;  4YHH T;  2VWA A;  1HS7 A;  1V9D A;  3LJC A;  2D0U A;  3Q9D A;  5HXC A;  2CEA A;  4ILB A;  3FB2 A;  3T8O A;  1MMG A;  5L4E A;  3TLU A;  5FYM A;  3A8Y C;  1JNZ A;  3F31 A;  3N9L A;  3TLT A;  3EUH A;  4LMJ A;  4EYU A;  1KNZ A;  5AQL B;  4X5T A;  5EK2 A;  4LFB T;  2XAQ B;  2BVM A;  3RYF E;  1HX8 A;  4B3T T;  1VCS A;  2YU2 A;  4IDP A;  4DUZ T;  4CN1 A;  3BQL A;  3N2G E;  5HEJ A;  5M4Y A;  4J2C A;  3ONL C;  1QUU A;  4I50 E;  3RGL A;  1KNR A;  2W63 A;  1YQ4 A;  2CBJ A;  2BKO A;  3BQI A;  2X9H A;  3VRB A;  3NZQ A;  2JQ9 A;  4HN9 A;  4NXM T;  2XM2 A;  3KIN B;  2OV9 A;  5L4H A;  3F2E A;  2BS4 A;  4LF5 T;  3MA9 A;  4YTM A;  4PK6 A;  2V8S V;  2E8I A;  2BBH A;  2EHO B;  4H63 V;  3FBZ A;  2VQF T;  3BQK A;  4TNW A;  4KMC A;  4IRE A;  3GN5 B;  1SHZ C;  1YD8 G;  5HCM A;  3PUV F;  5ABE A;  2W62 A;  3SS1 A;  4YTP A;  1N32 T;  2CMR A;  2CCQ A;  2E9X A;  3TLV A;  2YIN A;  3LK3 B;  3ZCJ A;  5CJ5 A;  4DV3 T;  4PJN A;  2J1D G;  4DMV A;  2Q9Q A;  4AI6 A;  5HEH A;  3N9P A;  3PDY A;  3VU7 H;  5LMU T;  4KHZ F;  5BR8 T;  3ZYK A;  4B3S T;  2VKO A;  2XQ8 A;  5J2U E;  4PNI A;  2BZB A;  3EDU A;  4YT0 A;  2YDS A;  2JPF A;  2CLY B;  2I0M A;  4ZZB A;  4DV7 T;  3P4Q A;  4PJJ A;  3RHW A;  1EZ3 A;  4IDQ A;  5JDF A;  3V5U A;  3CWZ B;  1XNQ T;  2VKD A;  4U2Y A;  2WU5 A;  1HNZ T;  2CPT A;  2HN1 A;  2W2U A;  4CQI A;  2H7V C;  3CX7 B;  4DMW A;  4QX7 B;  2ACZ A;  5JDH A;  1AJ3 A;  4P0B A;  1YW0 A;  5AQQ B;  2CRB A;  2ODU A;  2LKG A;  2WMO A;  4JI4 T;  4BAY B;  1U5P A;  2WY2 A;  2I59 A;  3KFW X;  3ZJ2 A;  1NEN A;  2FJE A;  2NW9 A;  4QKN A;  1D0Z A;  4ANJ A;  5GON E;  2XQ4 A;  4YXD A;  3L3P A;  2MAW A;  2JQQ A;  4DR5 T;  2ZM8 A;  3EHZ A;  5L3B B;  2IIU A;  5JR9 B;  1KF6 A;  5LHG B;  3AEB A;  2V6Y A;  2XAF B;  3I9Y A;  2H88 A;  3RYI E;  2QGS A;  2KWI B;  2LJL A;  2PFV A;  3HL6 A;  1FMV A;  4DR4 T;  3QOF A;  1WCR A;  3E08 A;  2VVS A;  3LSV A;  2P9B A;  3HKB E;  5FVL A;  2H3R A;  1M62 A;  3K3N A;  3N5L A;  1D1C A;  3M65 A;  3NVO A;  1J5E T;  1SUM B;  1S35 A;  2WZI A;  3Q5W A;  4ZOL E;  2LOP A;  3P50 A;  5HEO A;  4AKG A;  3PUQ A;  1VRB A;  4EED A;  2B1E A;  4P1N A;  4KI0 F;  4A98 A;  3AEE A;  4HWH A;  3ZMS B;  2LLY A;  2X0L B;  2OLT A;  2WZH A;  3L09 A;  3ANW A;  4TV8 E;  5LA6 E;  2N1G A;  3RX6 A;  1J1J A;  2YDR A;  1OED B;  2K9A A;  1WR0 A;  3JAD A;  2UXX B;  3N2K E;  2D5U A;  4U31 A;  4I43 B;  4HFH A;  1HF8 A;  3PJA A;  4V1A v;  3AE5 A;  4U2Z A;  3Q5X A;  1G8X A;  4EZH A;  2XAH B;  2BS3 A;  3E22 E;  4KP3 C;  4NUV A;  4PK4 A;  3ZYL A;  4IHJ E;  2HHH T;  5AQT B;  2XQ7 A;  5FL1 A;  4QXH B;  3KV5 A;  2CA5 A;  1FEW A;  2K24 A;  2NP9 A;  5HWX A;  1ZV4 X;  5E0O A;  4G2A A;  1N36 T;  2L3L A;  4OFZ A;  5AQM B;  4EEB A;  3ZSS A;  2XQ6 A;  5DJQ C;  2XQ3 A;  4JI6 T;  5HXR A;  1IJ6 A;  4P0A A;  3C4Z A;  2X9Y A;  3ZC1 A;  4M1P A;  4XBF B;  1I6Z A;  2JQH A;  2LHN A;  2X67 A;  3FHN A;  4JEH B;  5HXH A;  3TLW A;  3EVY A;  3C98 B;  3GMI A;  2VL0 A;  4DV6 T;  4CZZ B;  3PV0 F;  3RRW A;  3D0T A;  3UU3 A;  4CN4 A;  5JDQ A;  1E1H B;  3AAI A;  2N2N A;  4WBN E;  4CI1 B;  4GYR A;  3P4P A;  2VUR A;  4DND A;  3GN5 A;  2E9X D;  4LML A;  3FZF B;  4H9R C;  2D9D A;  2IDO B;  5HXS A;  2Q9Q D;  3JAE A;  4IDZ A;  3NZP A;  3RQU A;  3ZC0 A;  4PJL A;  2LSG A;  5HAX A;  2CHN A;  1ZKE A;  5C3J A;  5ADX L;  1W0B A;  4HFD A;  2I6H A;  1XZY A;  4HFI A;  3QNU A;  3CX6 B;  5JH7 E;  3J9X 1;  4UV9 B;  1FIO A;  4KBM B;  2W66 A;  4L9I A;  5CA0 E;  2NW7 A;  3AE3 A;  4MHC A;  2UUB T;  2WWV A;  4IST A;  3O1J A;  2V7M A;  2WWU A;  3N2O A;  2C0S A;  4CI3 B;  5FP3 A;  4XAX B;  4A5X A;  2FJB A;  3AAE B;  3WI3 A;  2XY8 B;  4BJN A;  2DHR A;  2ZLY A;  4IE4 A;  5KDM C;  5DAB A;  2BKN A;  2XPK A;  4AQF A;  2C5I T;  2V5C A;  2PBI A;  2LM2 A;  5FKY A;  3AB3 B;  4Z8X A;  3CVR A;  2JIW A;  4HKA A;  4AXP A;  5JR9 A;  5AQK B;  2M6B A;  4PAG A;  4A56 A;  4LF7 T;  1HCI A;  2D2S A;  3C51 A;  3KBT A;  3A5X A;  3CQX C;  3AAA B;  4HWI B;  4DR1 T;  2X9W A;  5AQU B;  3UU4 A;  2XZE A;  4YJ2 E;  4O4J E;  1IJ5 A;  3CQG B;  1D0Y A;  5EZY E;  3ZMZ B;  4ZI3 C;  2WU2 A;  3VKG A;  2F4V T;  3M3Z B;  5JQG E;  4DV4 T;  2FJD A;  2NR4 A;  2QRX A;  5F8P A;  4GIW A;  2JMH A;  5IYZ E;  4OYJ A;  5J1G A;  2KLQ A;  2XQY A;  2MOZ A;  3OTO T;  2E5V A;  2YOE A;  5CGM A;  1T98 A;  3H3M A;  4DV2 T;  2ES0 A;  5LG3 A;  3AED A;  2AXD S;  4YSX A;  5JTG A;  1OED A;  2RP4 A;  4DO0 A;  3L39 A;  3OJA A;  2WP9 A;  3ZST A;  3LBX B;  4QH4 A;  1YXR A;  1UK5 A;  2A9U A;  3PTR B;  4IDO A;  5LJM A;  4IGU A;  5DQV A;  5AFU L;  5IWA T;  1W9R A;  3P8C D;  3RIA A;  2LOS A;  4O4I E;  1UX5 A;  1N34 T;  5LOV E;  4JI7 T;  2LSY A;  1BR4 A;  2BDE A;  3O1H A;  2WS3 A;  5ETW A;  2QYW A;  1MMA A;  3NRY A;  3N9Q A;  4AQG A;  4BA9 A;  2LT3 A;  5LJN A;  1I94 T;  3LK4 2;  1IZN B;  2BKP A;  4TZ4 C;  5LP6 E;  2NW8 A;  4O8S A;  4QWN B;  2AE9 A;  1XDO A;  3QC9 A;  3ONX A;  2W61 A;  4CXY A;  3X1D A;  3SFD A;  4TV9 E;  2ACX A;  2J4G A;  2XQ9 A;  3LK2 B;  2DCF A;  5LBQ B;  5C8Y E;  3AA0 B;  3RF1 A;  2EHO D;  5AQG B;  2VKH A;  3J7Y q;  2BG9 C;  5LYJ E;  4B3M T;  3VR8 A;  1KEY A;  4YFS A;  3RYH E;  1L0V A;  3NWI A;  4X65 T;  3MK7 C;  1VOM A;  2WAU A;  4NPP A;  5CFB A;  4GKK T;  3PE0 A;  2K48 A;  4U3C A;  2WMN A;  2PTF A;  4ERR A;  3K8P C;  2IC9 A;  5ABH A;  3PUG A;  4B6X A;  2WSS V;  1IBK T;  4H9Q C;  4JYA T;  2WBL A;  3MAC A;  4KX6 A;  3UUL A;  3TKL B;  1Y64 B;  2XM1 A;  4KUM B;  2XAJ B;  3PU8 A;  4IE7 A;  4AKR B;  2CXF A;  4XZC A;  2XHE B;  2FUP A;  3EAM A;  3RIU A;  5LGT B;  4DR2 T;  4I0U A;  2DI4 A;  5JDG A;  2XQ5 A;  1HG5 A;  4EOZ B;  3IF8 B;  2Y48 B;  4ILA A;  2LEH A;  5IHY A;  5CA1 E;  5AQJ B;  5JDN A;  3ZLI A;  3GA8 A;  1T7S A;  2V7K A;  4PFP A;  4Z90 A;  3ZT5 A;  1T8B A;  5LHI B;  1UCU A;  3K3Q C;  2E9X C;  3JC6 D;  2LSJ A;  2IAK A;  4LF9 T;  4DBQ A;  1H7C A;  4IT4 A;  4ZI2 D;  2UXC T;  2XSA A;  4WW0 A;  1LKX A;  3AEC A;  2YEV C;  5L3F B;  3PUA A;  1D0X A;  5EK3 A;  2WCA A;  4UV8 B;  4DR7 T;  5FMN A;  4TX5 A;  4QH5 A;  3FZH B;  4EV6 A;  3VKH A;  5LNK A;  2UXN B;  4IE5 A;  4Z91 A;  5H6Q B;  4TN7 B;  3N9M A;  4K0U A;  5AQP B;  5AQH B;  3C4X A;  3ZN1 B;  1GQE A;  2V7L A;  3R84 B;  5FL0 A;  5KMG P;  4IE6 A;  2QA7 A;  4LFC T;  4JUY A;  3MKD A;  3ZPO A;  4QXB B;  4DV5 T;  4YHJ A;  4H9P C;  3BK9 A;  1MIW A;  3ZMV B;  3HKC E;  3Q5E A;  3L8R A;  3V5S A;  2ZMA A;  1HNW T;  3JAF A;  1LVF A;  3C50 A;  4TWF A;  3PU3 A;  3OKQ A;  3O4X E;  2VKJ A;  3S4U A;  2CXD A;  3KV9 A;  4KHP T;  4HFE A;  5HYA A;  3G06 A;  4HFV A;  3AE6 A;  4ASK A;  1OWA A;  5LGN B;  2IML A;  4U7Y A;  1CUN A;  5EK4 A;  4AKL A;  1CHU A;  2LRL A;  3UT5 E;  2V5D A;  3CX8 B;  4YLH A;  3LBX A;  2BVL A;  5HEG A;  2BG9 B;  4X20 E;  2DWG A;  2DNX A;  2N9D A;  3FXE B;  3IA3 A;  3Q5D A;  3GWH A;  5AQR B;  3QB5 A;  2LKH A;  4MBQ A;  3K1S A;  4A97 A;  2IC6 A;  4HGA A;  2V6X A;  4MLK A;  2XJ7 A;  3I0Q A;  3N9O A;  1MMN A;  5LXT E;  2A72 A;  2YDQ A;  3DTO A;  2FJA A;  1O3X A;  4PW8 A;  3OYX A;  4GKJ T;  3HR0 A;  4X1Y E;  3AEG A;  4B3R T;  2C5J A;  1HR0 T;  1S94 A;  1WYC A;  5LBM A;  5JVD E;  3RC3 A;  3RRC A;  2CHO A;  4LFA T;  4WNK A;  3EAB A;  4ZXL A;  5FNV E;  2LSI A;  2VQE T;  3VRA A;  4WBO A;  3ZKR A;  3OBV E;  1YKE B;  4X62 T;  4U7I A;  2EHO A;  2JQK A;  3OVU A;  2E5L T;  5HEU A;  4YTN A;  2YN6 A;  2JRK A;  2DL1 A;  3UU6 A;  4EGW A;  1XMO T;  2VK9 A;  3U3I A;  2LSK A;  2MPK A;  2CWO A;  4AIU A;  1BR0 A;  3KV6 A;  3UUX B;  4OYK A;  2LRK A;  4P09 A;  4GK5 E;  4X1I E;  2IUB A;  3ZJ1 A;  3Q2M A;  3RYC E;  4JEU B;  3SRZ A;  5ABG A;  3RQW A;  3RC8 A;  2V1D B;  3ZYM A;  1MND A;  3I0O A;  5TAO A;  3T1Y T;  4DVD A;  2UUA T;  1UUS A;  3R6N A;  2W4X A;  1B7T A;  3EDV A;  3LDQ B;  1UX4 A;  4YSZ A;  1HG2 A;  4ZI7 E;  2ZM0 A;  1NEK A;  1R8I A;  1Z8U A;  2CBI A;  3LFM A;  2CE7 A;  3AEF A;  2SPC A;  1WRD A;  4GK0 E;  2ODV A;  1QLB A;  3SWH A;  2BG9 E;  4DR6 T;  2E2A A;  1NWM X;  3ETV A;  3RI5 A;  4DV1 T;  2CWY A;  4U33 A;  2RPA A;  5JRE A;  3AXJ B;  4ZHQ E;  1DU2 A;  2WDQ A;  5FXX A;  3NKZ A;  1IBL T;  3IEE A;  4HFB A;  4U74 A;  4OHF A;  2DWK A;  5L47 A;  2NTX A;  3QB5 K;  5FY7 A;  1YQ3 A;  3PJA J;  4U72 A;  3PUZ F;  4JI3 T;  2W67 A;  4K0K T;  3UFG A;  2V7I A;  2WDV A;  3KVA A;  3P4S A;  4COF A;  2H89 A;  1XDP A;  4E7S A;  3KVB A;  3FZK B;  3AE1 A;  2LE8 A;  4AKH A;  4H9S E;  3CIR A;  1E7P A;  4H9N C;  1W0A A;  3ANW B;  3P4R A;  4LF8 T;  4AQF C;  5ABF B;  4ZI2 C;  4QX8 B;  1HFA A;  4ZEY A;  3E0Z A;  3ZEF B;  2KT9 A;  3AEA A;  5JR9 C;  3ZMT B;  3RLF F;  2XAG B;  3H37 A;  3QK6 A;  5FY1 A;  1NAF A;  3UTK A;  3MXZ A;  4JI5 T;  4EIW A;  1FJG T;  5JRC B;  1VCT A;  2BG9 A;  3HKD E;  2PJQ A;  4HE8 A;  3B13 A;  3P4W A;  1Z0P A;  5FVK A;  3T1H T;  3RKO A;  1U4Q A;  4UEL A;  4DID B;  3MZK B;  3JCF A;  4F8H A;  2WM9 A;  1KNP A;  1KK7 A;  2DLR A;  2YK0 A;  3WAJ A;  2IHR 1;  1WYB A;  3TLS A;  3U78 A;  4CXW A;  4WYV A;  1SE7 A;  2R6G F;  3UU8 A;  5FXV A;  1OED C;  1LVK A;  4MAL A;  3I9W A;  4UF0 B;  3MJX A;  2X66 A;  3CML A;  2OA5 A;  1IBM T;  4FI5 A;  2XAS B;  4JV5 T;  4UEM A;  2B76 A;  5J2T E;  4CN6 A;  3SFE A;  3ESL A;  3C64 A;  4ILU A;  3RPU A;  3FXD B;  3UQ4 A;  2J47 A;  4HFC A;  2KWH A;  3UUB A;  1XNR T;  3ABV A;  2CXL A;  2V7J A;  3PUR A;  3HA4 A;  3ZN0 B;  3OPC A;  3EI0 A;  3W15 B;  3AA1 B;  4EYY R;  4GOU A;  4BJM A;  3LG7 A;  1G73 A;  1N33 T;  4OK0 A;  1D1B A;  2YKS A;  3AE8 A;  2YU1 A;  2BS2 A;  2X9X A;  4DUY T;  2JJ9 A;  3OYZ A;  1MIY A;  1ZP0 A;  4JBW F;  2MBG A;  1US7 B;  2LM9 A;  4UVB B;  4AIS A;  3SOL A;  1JNR A;  4X64 T;  3O9X A;  2A2F X;  4PK5 A;  4ZI3 D;  4L5G A;  1IAP A;  1T72 A;  3O1I A;  2ZM6 T;  4OX9 T;  4TWD A;  4DV0 T;  2J62 A;  4JI2 T;  5L3G B;  3K3O A;  2MTQ A;  4IDN A;  1D1A A;  2WDR A;  2UU9 T;  4QHO A;  2Q9Q C;  2PG8 A;  4NXN T;  2LHR A;  2A3D A;  4L0R A;  4WZX A;  5LB7 B;  4UVA B;  4HWF A;  4ADZ A;  2CM0 A;  3IBP A;  1M7K A;  4QH1 A;  3N9N A;  1W09 A;  2Z6E A;  3FZM B;  5LGU B;  2KIN B;  3KBU A;  3AXJ A;  4NIQ A;  5KXJ A;  4JI8 T;  2VVN A;  4IL4 A;  2X0H A;  4HEA A;  3RIU C;  5FXW A;  3ZT7 A;  3HKE E;  3UFE A;  2XUE A;  3AVS A;  5AQF B;  1ZHC A;  2G0U A;  1XWM A;  4LMK A;  5A1L A;  5AQO B;  1UUR A;  4TUY E;  2XSB A;  5LMN T;  2W0G A;  1UGO A;  3ETU A;  4N78 D;  4LF6 T;  4TNV A;  2KZ7 B;  2HN2 A;  2BBJ A;  5BMV E;  3ZMU B;  3UUN A;  2L8K A;  3C4W A;  5C2T A;  4QXC B;  1FMW A;  2RA1 A;  2IW5 B;  2FBW A;  4I55 E;  5ABF A;  2QVA A;  2HPJ A;  1BR2 A;  3CK6 A;  2GK9 A;  3FZL B;  2HPL A;  4HTE A;  2HH7 A;  5F3J A;  3A7M A;  4C91 A;  4EAH A;  5H6R B;  3HI2 A;  3FBL A;  5JRC A;  5HWY A;  3AE4 A;  3PUS A;  2MYS A;  4X1K E;  4X66 T;  1YKH B;  5KX5 E;  5LHH B;  2K3W A;  1Y01 A;  3ONJ A;  2C5K T;  3RIF A;  2Y6X A;  2VAS A;  1E2A A;  3AA7 B;  3NRX A;  5CB4 E;  4FJO A;  3UU5 A;  4H63 H;  3AA6 B;  2NWB A;  1J5W A;  1X9B A;  4NUU A; 
#chains in the Genus database with same CATH homology
 4U31 A;  5FVL A;  4WZX A;  2A9U A;  5LB7 B;  2MPK A;  3ZT5 A;  2JQH A;  3ZT7 A;  2CRB A;  5CGM A;  3EAB A;  4U2Y A;  5FVK A;  4U7Y A;  2WY2 A;  4U2Z A;  4U7I A;  3K1S A;  4A5X A;  2V6Y A;  4CN6 A;  2JQK A;  2LRK A;  2LRL A;  5CJ5 A;  3ZSS A;  2CPT A;  3ZT6 A;  2V6Y B;  2W2U A;  2JQ9 A;  1WR0 A;  4U3C A;  4CN4 A;  2V6X A;  2XZE A;  1WFD A;  3ZST A;  4CN1 A;  4NIQ A;  2DL1 A;  4IT4 A;  2WWV A;  1WCR A;  1YXR A;  4P1N A;  4U33 A;  4ZEY A;  2RPA A;  2K3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...