1YXRA

Nmr structure of vps4a mit domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Structure of VPS4A MIT Domain
rcsb
source organism Homo sapiens
molecule tags Protein trafficking
molecule keywords vacuolar protein sorting factor 4A
total genus 29
structure length 77
sequence length 77
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1yxrA01
3EABA 2WWVA 2CRBA 2K3WA 4U2ZA 1WR0A 2MPKA 5CJ5A 2V6XA 3ZSSA 2XZEA 4WZXA 3ZT5A 4CN4A 2V6YA 2V6YB 2JQHA 2WY2A 4U7IA 5CGMA 2LRKA 5FVLA 2RPAA 4CN1A 4P1NA 3ZT7A 2A9UA 4U33A 4CN6A 4U2YA 2LRLA 4A5XA 2JQKA 4IT4A 1WFDA 2W2UA 4ZEYA 1WCRA 5LB7B 3ZSTA 5FVKA 4NIQA 3ZT6A 4U3CA 4U7YA 4U31A 1YXRA 2CPTA 2JQ9A 2DL1A 3K1SA
chains in the Genus database with same CATH superfamily
2MTQA 2VL8A 4JI4T 2KZ7B 3N5LA 3O1JA 4I50E 2A2FX 2J1DG 2LLYA 2CLYC 2MPKA 3RF1A 5FL1A 4LFAT 2ZM2A 2BS4A 2BDEA 1FEWA 2LM2A 2WMOA 4HFIA 4UEMA 2FJDA 4YLHA 5IHYA 1NWMX 2XAQB 3T8OA 4WBOA 3VR8A 3KVAA 4B3ST 2IC9A 2X68A 4ZXLA 2BKPA 2BS2A 4YJ3E 4GKJT 3UUBA 4JI0T 4I43B 1G73A 2V5DA 2W4XA 5C8YE 2PBIA 2E9XD 2RA1A 4DMWA 5L3GB 1KNZA 2XPKA 5AQVB 1ZEEA 2EHOB 3FZFB 3VRBA 2DWKA 2VB6A 4P0BA 2PJQA 3BK9A 2EHOC 5AQLB 1XNRT 1S35A 4PJMA 1VOMA 2LEHA 3AE3A 3RYFE 3TLWA 5J2TE 1YQ3A 1ZOYA 3AAEB 2YEVC 2LOPA 3FZLB 4JI5T 5JDGA 3ZC1A 3I9YA 1HF8A 4UVCB 2MBGA 4TNWA 4LF5T 2AE9A 1LRZA 2KMFA 3ZPOA 2BKNA 2D5UA 3C64A 2Y8DA 3AXJB 2WWVA 4DO0A 2K3WA 4U2ZA 4E7ZA 4ADZA 1KNRA 2KWHA 3WI3A 2WP9A 5HXEA 4H9PC 3PJAJ 2ODUA 3SRZA 2BS3A 3AE1A 2JPFA 5EK4A 5HEHA 1WR6A 3R84B 3RKOA 2UUCT 3FHNA 2LSGA 5DQWA 5HCJA 3JC6D 4EB6E 5LJNA 4MBQA 4HWDA 5HCMA 2XQ4A 5JR9A 4KHPT 3MZKB 1HNZT 4WNKA 4MFRA 2YKSA 4A98A 5JRCB 5E0OA 3FZMB 3P4QA 4A5XA 4HFBA 2X0HA 4JLEA 5LBQB 2H7VC 3EHZA 2UUBT 4DR4T 2CXLA 4OX9T 3RLFF 2E8IA 3R6NA 4QXBB 1W0AA 4NUVA 4UF0A 1MNEA 4OHFA 4UXNB 5C2TA 1XMOT 2UUAT 2N1GA 4QH1A 4EZHA 2HN1A 2AXDS 4OYJA 2UXBT 3ZJ1A 4DR2T 2LT3A 5IYZE 1V9DA 4DNDA 3RYHE 3AE2A 3GN5A 3PV0F 1NEKA 3ABVA 2ZLYA 4IHJE 2V7IA 2LKHA 2I6HA 2BVMA 4HFDA 3PU3A 5DQVA 4IGUA 3UU4A 3AE4A 3UULA 1Z8UA 2V7JA 2NTXA 3KINB 4OK0A 2V6YA 4Q25A 5AQIB 5H6QB 5LCYA 3RGLA 3HKDE 4U7IA 5HAXA 3AA6B 4X64T 1UX5A 2WCAA 3A5XA 2C0SA 2IAKA 2FJEA 1D0YA 2WMNA 4IE6A 4O4HE 4ZHQE 2CA5A 1D1BA 3N9LA 5LOVE 5EK2A 2VQFT 2PG8A 4PK4A 3Q5XA 3KFWX 5JH7E 4ZEYA 2BZBA 3X1DA 1IBMT 2WAUA 4IE7A 3J7Yq 2LSKA 3F2EA 3IHRA 5LXTE 4CXWA 1D0ZA 2L3LA 2V7LA 3WAKA 4B6XA 2CEAA 2HPJA 5AQPB 4DIDB 5FMNA 4V1Av 4AQYT 4X1YE 1NENA 5ABFB 3ZC0A 2QRXA 2C5KT 4L0RA 3ANWA 3EUHA 4BA9A 1KK7A 2UXXB 2CRBA 4H9OC 4HWHA 1WR0A 2UU9T 2V6XA 3RIUC 3BQLA 4B3RT 3OYZA 5F5WA 2NW9A 3ETUA 2CBJA 4PK6A 3Q2MA 4QKNA 2LSIA 4QWNB 4DBQA 3S4UA 1H7CA 4I4TE 4DVDA 5LMUT 4AKHA 5FVLA 4ZS3A 2HH7A 2VKJA 4AKLA 3G06A 2R6GF 5AQQB 3I9WA 4FI5A 5L3BB 2IW5B 3F57A 3HR0A 4ZOLE 3T1HT 1IBKT 4O2BE 4IDQA 1QLBA 2W62A 3PE0A 5FNVE 4AI6A 2W61A 3GA8A 1UGOA 2K9AA 4IDOA 1BR0A 4TV8E 1E1HB 4LFCT 4M1PA 4JBWF 1MMNA 1KNPA 3GMIA 2ZM6T 2V5CA 4YFSA 2XQ8A 5EZYE 4MALA 5JTGA 3B5MA 3PUZF 3P50A 4HWCA 4O8SA 4JEHB 3L8RA 5CJ5A 3UFGA 2WM9A 4JI7T 4X5TA 3O1IA 1T98A 3SOLA 3ZMVB 5KDMC 5C3JA 4AKIA 2WBLA 1XNQT 2A3DA 3RQWA 4AXPA 2Y6XA 3SS1A 2VL0A 2A9UA 4OYKA 3ZYMA 3NBXX 4DUZT 3AECA 2LSJA 1YKEB 3AAIA 4XAXB 2XQ3A 1D0XA 2MAWA 3MK7C 2D2SA 3BQKA 4UV9B 3RYCE 3HKEE 1FMWA 4LFBT 1MIYA 5J0ZA 4G63A 4TNVA 2RP4A 3CVRA 3P7IA 2YDSA 3LK42 4UV8B 2VVSA 3J9X1 1HX1B 3N2KE 3K3NA 1BR4A 2J62A 5JR9B 5L47A 3AEEA 3HI2A 4EZ4A 5LP6E 1W9RA 1WRDA 3VU7H 3AE8A 3RRCA 3PUQA 4EXTA 4HN9A 3VRAA 3LK3B 2KXPB 4ASKA 2XSBA 4X62T 1T72A 1MMAA 2ZM0A 4UVBB 3AE7A 3PUXF 4HEAA 2CHOA 2X51A 3PU8A 4X20E 2M6IA 3UU5A 2QA7A 3F31A 5AQFB 3AE6A 5CGMA 4LF4T 1VCTA 1MIVA 1WLXA 3VR9A 1HS7A 3OKQA 3RIFA 4EGWA 4CN6A 3LSVA 4H9NC 2ODVA 5KX5E 2WWUA 3OYXA 1QSDA 2WU5A 2JQKA 2XAJB 4PJNA 3ZYKA 4X1KE 5FP3A 4ILCA 1BR1A 3H37A 4UVAB 4ZI7E 3N9OA 1FJGT 2N9DA 2BVLA 2DCFA 2V7KA 2YDQA 3KBTA 4K0UA 5KMGP 3NRYA 5L4EA 3QK6A 4P0AA 3VHLA 2DWGA 3RC3A 4DR1T 3VKGA 2XJ7A 3B13A 3QB5A 4J2CA 4ILBA 4YTNA 1HNWT 2I59A 2JMHA 3CQXC 3K1SA 2XASB 1U4QA 3DTOA 2ZMAA 2JQQA 2X0YA 5AQKB 4ZZCA 2K48A 1IJ5A 4DUYT 2XZEA 2K24A 5ABHA 1GQEA 4TWFA 2LKGA 4L5GA 4PAGA 3UU8A 4AISA 4A56A 1B7TA 4TWDA 5GONE 3RHWA 4DBRA 4DV2T 4CZZB 4X66T 1Z0PA 1Y01A 3CIRA 4GYRA 1X9BA 2XQ7A 4YXDA 4DV7T 3JC6C 1MNDA 2FBWA 3DP7A 1N34T 2FJBA 3K8PC 2E9XB 4AKGA 3UQ7A 3RQUA 3ZCIA 1N36T 2UXDT 1MIWA 3AEBA 3UUMA 2LSYA 4FJOA 4WBNE 3RI5A 1OEDA 2VVNA 1KEYA 2WB5A 1OXZA 2XM1A 3RC8A 1SUMB 2VASA 2N2NA 4GYSA 4HFCA 4U3CA 5DABA 1FIOA 3RRWA 3I0QA 1UCUA 2LE8A 2JQ9A 4PK5A 4KHZF 1YQ4A 5HXHA 3K3OA 5FY0A 4QX8B 2LOSA 5LGUB 4OFZA 3RH3A 3ZEFB 5CA0E 2MYSA 3ONLC 3QC9A 5F8PA 1JNZA 3CQGB 5M4YA 2CLYB 5AQRB 5JRCA 2VK9A 2WY2A 2KWIB 3P4PA 2W67A 2LRKA 4H9RC 5AQOB 5AQNB 3RX6A 3UFEA 4CI3B 4CN1A 3PUYF 4DR5T 1D1CA 5ABGA 2XAHB 2VKDA 2VURA 3NRXA 2J47A 3LK2B 4IIJE 5AQMB 3P4WA 4DV4T 2LJLA 2VWAA 3O4XE 2WDRA 3EAMA 5HEOA 3PJAA 5LBMA 3SFEA 2LM9A 4B3MT 4NIQA 3AEAA 3DJBA 2Q9QC 3CMLA 2BKOA 3CX7B 4HGAA 5HEJA 2F4VT 3ZMZB 3ONXA 4B3TT 3AA1B 5ABEA 4HWIB 2V26A 2JMKA 2H7OA 3RIUA 3RIAA 3N9MA 1J1JA 2W66A 3ETVA 1SE7A 3OJAA 3HA4A 3C98B 4NXMT 2EHOD 5FYMA 2EHOA 4TZ4C 1OEDB 1BR2A 3RKGA 1LVFA 4QH4A 2K5BB 5LGNB 4HFHA 2KSRA 2NWBA 2XAFB 4KUMB 3N2GE 4AQFA 2IC6A 4QHOA 3P4SA 2E9XA 4TX5A 5L3DB 3N9PA 5LJMA 3GWHA 4ILAA 1HR0T 3CWZB 2YINA 2W00A 4WW0A 4IT4A 3Q9DA 4H9SE 1S94A 1XWMA 3CPZA 2WSSV 4GK0E 2YDRA 4N78D 3A7MA 2NR4A 2DNXA 3CKDA 5L4HA 3VKHA 1J5WA 4EV6A 4CXYA 1SA0E 1YXRA 3HKBE 2H89A 4C91A 3M3ZB 3N9NA 2BG9E 3Q5EA 1R8IA 2H3RA 4O4JE 3NKZA 3PUVF 4HE8A 4PFPA 5DJQC 3D0TA 5BMVE 3CQCB 2WDVA 2LHNA 2IUBA 3Q5WA 3AEDA 5CFBA 1DU2A 3LG7A 3UQ4A 5L3CB 2V8SV 3MACA 3C4ZA 4PJJA 4WZXA 3ZJ2A 5HWYA 4XZCA 4LMLA 5F3JA 4EYYR 5KXJA 4LF9T 5EK3A 3UU6A 5LHHB 1CHUA 2RPAA 2YK0A 3H3MA 1IJ6A 4P1NA 3PURA 5HXRA 2KINB 2CWOA 4U72A 3OTOT 1E7PA 1FMVA 2GK9A 3QNUA 4EEBA 2CBIA 4JI6T 5AFUL 1WFDA 3ZMSB 4ZS2A 4ZI2C 3FXDB 5JDHA 1WCRA 2WS3A 3N2OA 4L9IA 2SPCA 5JVDE 4DR6T 5HWXA 4MHCA 4CQIA 4PNIA 2OV9A 1HFAA 2Q9QD 2W0GA 4JI8T 2E5VA 2P9BA 3ZYLA 4LMKA 4F8HA 3L3PA 3CX8B 4IE0A 1XMQT 3OPCA 2JRKA 1X79A 4QX7B 3MKDA 4Z8XA 2XTLA 1KFYA 5FL0A 3K3QC 5IUXA 2D0TA 1SHZC 3N9QA 2BG9C 5JDMA 2CM0A 2A72A 1M7KA 3QB5K 3FBZA 5JDNA 4ANJA 3ZT5A 2CXDA 4IDPA 2V6YB 1O3XA 3LDQB 2UXNB 2Y48B 2XY8B 3TLSA 3MA9A 4ISSA 5JDLA 5LHGB 4YY3T 3AB3B 5JDFA 4F6RC 5FXWA 4P09A 4QXCB 5FXVA 1N33T 1OEDE 2I0MA 3LFMA 5H6RB 4DV5T 2XQYA 2BBJA 1JNRA 4KP3C 2D9DA 3KBUA 4IREA 1MMGA 5AQTB 3EDVA 3ZN1B 3ZKRA 3FB2A 4IL4A 2X67A 2KNDA 5HEGA 2NW8A 3LJCA 4IL9A 1T8BA 4UF0B 5LYJE 4DV0T 4UIGA 3NWIA 2ES0A 2KT9A 5J2UE 2L9QA 4UELA 5FY1A 3JCFA 3JAFA 4EYUA 2J4GA 3AVSA 3FBLA 4H63V 5LA6E 4LF6T 3EDUA 3C51A 3AA7B 1ZKEA 4IDZA 1L0VA 3FXEB 4GOUA 4O2AE 5FXZA 4EOZB 2YOEA 3AEFA 5CA1E 1XZYA 2VKOA 5HXSA 4IE4A 1ZP0A 2FJAA 3ZLIA 4BJNA 4YT0A 1YW0A 2X9XA 4BAYB 2DLRA 5ABFA 2FUPA 3AEGA 4ZZBA 2ZM8A 1YKHB 4KMCA 3MJXA 2X66A 3C4XA 1CUNA 4CI2B 3P8CD 2HN2A 2G0UA 1T7SA 3OBVE 3ZN0B 3WAJA 5HEUA 3AXJA 2CE7A 1VRBA 4BJMA 3UUNA 3A8YC 3LBXA 1G8XA 4ISTA 4WYVA 3UUXB 2M67A 1ZHCA 2W2UA 3RYIE 2B76A 3JAEA 5LB7B 1VCSA 3ZSTA 4YSZA 4Z90A 5FVKA 1XDOA 3JADA 2C5IT 4EEDA 4ZI2D 5LG4A 3AVRA 4ZI3D 1WYCA 1W09A 2XQAA 4PFOA 4YTMA 2W63A 4U31A 4YSXA 1J5ET 2Q9QB 2WDQA 5AQJB 2VQET 3ANWB 2HHHT 4HKAA 4GKKT 1HG2A 5BR8T 2WZIA 4XBFB 1D1AA 3ZCJA 3M65A 1KF6A 1YD8G 1HCIA 2NW7A 2XUEA 4NUUA 4U74A 1NAFA 4LF7T 2Z6EA 4COFA 4JEUB 4KBMB 1IAPA 5AQSB 3B57A 4U33A 3AE9A 3PUGA 2X9HA 2PTFA 2CWYA 2JIWA 2NOXA 4U2YA 3NVOA 4NXNT 2ACXA 4AKRB 2UXCT 3TLUA 1EZ3A 3CX6B 3IBPA 3PUSA 5JQGE 2E2AA 4A97A 4X1IE 5IWAT 1IBLT 1U5PA 3UU3A 3HL6A 2Q9QA 2CPTA 3GN5B 3E0ZA 2DL1A 4AIUA 2MOZA 2V1DB 3HKCE 4ILUA 4JUYA 2IDOB 1UURA 5ETWA 3FZKB 2PFVA 1OEDC 3BQIA 4PW8A 4YSYA 3ZSSA 4IE5A 2BBHA 4IDNA 3LBXB 5LMNT 5L3FB 4CN4A 2BG9B 4AQFC 1UUSA 2JQHA 2NP9A 3EI0A 3NZQA 4EAHA 4Z91A 1HTJF 4HTEA 3ZMTB 3ESLA 5L2LA 4JI1T 2XQ5A 4HFVA 1I6ZA 4CI1B 3V5UA 4YHHT 1MMDA 2IIUA 3E08A 3IF8B 1LVKA 1UK5A 4G2AA 4TV9E 4AQGA 1QUUA 4KX6A 1LKXA 4TN7B 3QUJA 3UT5E 4YHJA 2JJ9A 2YN6A 1OWAA 2HPLA 2B1EA 2VKHA 2XM2A 3KV4A 4MLKA 5L3EB 5JR9C 5LGTB 4KI0F 3KV9A 1E2AA 3P4RA 3TKLB 3TLVA 2E5LT 2C5JA 2NTYA 3U78A 3AA0B 4DR3T 2X9YA 4JI3T 4JV5T 5HYAA 3EABA 4DR7T 2M6BA 2WQYA 4GK5E 3KV5A 3H3AA 1W0BA 5AQGB 3FZHB 5TAOA 3O1HA 3KVBA 3IEEA 4DMVA 3KDSE 2IHR1 3PTRB 4DV3T 4JI2T 2CXFA 4NPPA 3L39A 5LG3A 1HNXT 1N32T 4HFEA 3Q5DA 1UX4A 4EIWA 1ZV4X 1M62A 3ZT7A 2E9XC 2QYWA 1HX8A 1IZNB 4PJLA 4UR9A 4HWFA 3I1AA 3UTKA 4I55E 2YU2A 3W15B 2LRLA 2D0UA 4QXHB 1HG5A 4LF8T 4E7SA 4DV1T 3IA3A 3L09A 4QH5A 4X65T 3T1YT 1US7B 3AAAB 3QOFA 3C50A 2OA5A 2ACZA 4O4LE 4C90A 3KV6A 3NZPA 3C4WA 5AQHB 3RPUA 5FKYA 4DV6T 5JREA 4ERRA 1I94T 2CHNA 3OVUA 3I0OA 2XAGB 4TWHA 3V5SA 2WU2A 1Y64B 2XQ9A 2XHEB 2DI4A 4H63H 2WZHA 2YU1A 4YJ2E 3E22E 5ADXL 2CMRA 3SWHA 5A1LA 2KLQA 2CCQA 2X0LB 1WYBA 2BG9A 3CK6A 4YTPA 3ZMUB 5JDQA 4LMJA 3EVYA 2XQ6A 4TUYE 4ZI3C 2DHRA 4O4IE 5LHIB 2XSAA 3U3IA 5LNKA 4K0KT 2IMLA 2QGSA 3ONJA 5AQUB 2V7MA 3O9XA 3PUWF 3PUAA 2H88A 2OLTA 1XDPA 2X9WA 5FY7A 4H9QC 3TLTA 1AJ3A 3PDYA 5CB4E 3AE5A 5HXCA 2L8KA 4CXXA 3ZT6A 2QVAA 4I0UA 4U7YA 3SFDA 5J1GA 4JYAT 5FXXA 3MXZA 4GIWA 2LHRA
chains in the Genus database with same CATH topology
3EABA 2WWVA 2CRBA 2K3WA 4U2ZA 1WR0A 2MPKA 5CJ5A 2V6XA 3ZSSA 2XZEA 4WZXA 3ZT5A 4CN4A 2V6YA 2V6YB 2JQHA 2WY2A 4U7IA 5CGMA 2LRKA 5FVLA 2RPAA 4CN1A 4P1NA 3ZT7A 2A9UA 4U33A 4CN6A 4U2YA 2LRLA 4A5XA 2JQKA 4IT4A 1WFDA 2W2UA 4ZEYA 1WCRA 5LB7B 3ZSTA 5FVKA 4NIQA 3ZT6A 4U3CA 4U7YA 4U31A 1YXRA 2CPTA 2JQ9A 2DL1A 3K1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAB A;  2WWV A;  2CRB A;  2K3W A;  4U2Z A;  1WR0 A;  2MPK A;  5CJ5 A;  2V6X A;  3ZSS A;  2XZE A;  4WZX A;  3ZT5 A;  4CN4 A;  2V6Y A;  2V6Y B;  2JQH A;  2WY2 A;  4U7I A;  5CGM A;  2LRK A;  5FVL A;  2RPA A;  4CN1 A;  4P1N A;  3ZT7 A;  2A9U A;  4U33 A;  4CN6 A;  4U2Y A;  2LRL A;  4A5X A;  2JQK A;  4IT4 A;  1WFD A;  2W2U A;  4ZEY A;  1WCR A;  5LB7 B;  3ZST A;  5FVK A;  4NIQ A;  3ZT6 A;  4U3C A;  4U7Y A;  4U31 A;  1YXR A;  2CPT A;  2JQ9 A;  2DL1 A;  3K1S A; 
#chains in the Genus database with same CATH topology
 2MTQ A;  2VL8 A;  4JI4 T;  2KZ7 B;  3N5L A;  3O1J A;  4I50 E;  2A2F X;  2J1D G;  2LLY A;  2CLY C;  2MPK A;  3RF1 A;  5FL1 A;  4LFA T;  2ZM2 A;  2BS4 A;  2BDE A;  1FEW A;  2LM2 A;  2WMO A;  4HFI A;  4UEM A;  2FJD A;  4YLH A;  5IHY A;  1NWM X;  2XAQ B;  3T8O A;  4WBO A;  3VR8 A;  3KVA A;  4B3S T;  2IC9 A;  2X68 A;  4ZXL A;  2BKP A;  2BS2 A;  4YJ3 E;  4GKJ T;  3UUB A;  4JI0 T;  4I43 B;  1G73 A;  2V5D A;  2W4X A;  5C8Y E;  2PBI A;  2E9X D;  2RA1 A;  4DMW A;  5L3G B;  1KNZ A;  2XPK A;  5AQV B;  1ZEE A;  2EHO B;  3FZF B;  3VRB A;  2DWK A;  2VB6 A;  4P0B A;  2PJQ A;  3BK9 A;  2EHO C;  5AQL B;  1XNR T;  1S35 A;  4PJM A;  1VOM A;  2LEH A;  3AE3 A;  3RYF E;  3TLW A;  5J2T E;  1YQ3 A;  1ZOY A;  3AAE B;  2YEV C;  2LOP A;  3FZL B;  4JI5 T;  5JDG A;  3ZC1 A;  3I9Y A;  1HF8 A;  4UVC B;  2MBG A;  4TNW A;  4LF5 T;  2AE9 A;  1LRZ A;  2KMF A;  3ZPO A;  2BKN A;  2D5U A;  3C64 A;  2Y8D A;  3AXJ B;  2WWV A;  4DO0 A;  2K3W A;  4U2Z A;  4E7Z A;  4ADZ A;  1KNR A;  2KWH A;  3WI3 A;  2WP9 A;  5HXE A;  4H9P C;  3PJA J;  2ODU A;  3SRZ A;  2BS3 A;  3AE1 A;  2JPF A;  5EK4 A;  5HEH A;  1WR6 A;  3R84 B;  3RKO A;  2UUC T;  3FHN A;  2LSG A;  5DQW A;  5HCJ A;  3JC6 D;  4EB6 E;  5LJN A;  4MBQ A;  4HWD A;  5HCM A;  2XQ4 A;  5JR9 A;  4KHP T;  3MZK B;  1HNZ T;  4WNK A;  4MFR A;  2YKS A;  4A98 A;  5JRC B;  5E0O A;  3FZM B;  3P4Q A;  4A5X A;  4HFB A;  2X0H A;  4JLE A;  5LBQ B;  2H7V C;  3EHZ A;  2UUB T;  4DR4 T;  2CXL A;  4OX9 T;  3RLF F;  2E8I A;  3R6N A;  4QXB B;  1W0A A;  4NUV A;  4UF0 A;  1MNE A;  4OHF A;  4UXN B;  5C2T A;  1XMO T;  2UUA T;  2N1G A;  4QH1 A;  4EZH A;  2HN1 A;  2AXD S;  4OYJ A;  2UXB T;  3ZJ1 A;  4DR2 T;  2LT3 A;  5IYZ E;  1V9D A;  4DND A;  3RYH E;  3AE2 A;  3GN5 A;  3PV0 F;  1NEK A;  3ABV A;  2ZLY A;  4IHJ E;  2V7I A;  2LKH A;  2I6H A;  2BVM A;  4HFD A;  3PU3 A;  5DQV A;  4IGU A;  3UU4 A;  3AE4 A;  3UUL A;  1Z8U A;  2V7J A;  2NTX A;  3KIN B;  4OK0 A;  2V6Y A;  4Q25 A;  5AQI B;  5H6Q B;  5LCY A;  3RGL A;  3HKD E;  4U7I A;  5HAX A;  3AA6 B;  4X64 T;  1UX5 A;  2WCA A;  3A5X A;  2C0S A;  2IAK A;  2FJE A;  1D0Y A;  2WMN A;  4IE6 A;  4O4H E;  4ZHQ E;  2CA5 A;  1D1B A;  3N9L A;  5LOV E;  5EK2 A;  2VQF T;  2PG8 A;  4PK4 A;  3Q5X A;  3KFW X;  5JH7 E;  4ZEY A;  2BZB A;  3X1D A;  1IBM T;  2WAU A;  4IE7 A;  3J7Y q;  2LSK A;  3F2E A;  3IHR A;  5LXT E;  4CXW A;  1D0Z A;  2L3L A;  2V7L A;  3WAK A;  4B6X A;  2CEA A;  2HPJ A;  5AQP B;  4DID B;  5FMN A;  4V1A v;  4AQY T;  4X1Y E;  1NEN A;  5ABF B;  3ZC0 A;  2QRX A;  2C5K T;  4L0R A;  3ANW A;  3EUH A;  4BA9 A;  1KK7 A;  2UXX B;  2CRB A;  4H9O C;  4HWH A;  1WR0 A;  2UU9 T;  2V6X A;  3RIU C;  3BQL A;  4B3R T;  3OYZ A;  5F5W A;  2NW9 A;  3ETU A;  2CBJ A;  4PK6 A;  3Q2M A;  4QKN A;  2LSI A;  4QWN B;  4DBQ A;  3S4U A;  1H7C A;  4I4T E;  4DVD A;  5LMU T;  4AKH A;  5FVL A;  4ZS3 A;  2HH7 A;  2VKJ A;  4AKL A;  3G06 A;  2R6G F;  5AQQ B;  3I9W A;  4FI5 A;  5L3B B;  2IW5 B;  3F57 A;  3HR0 A;  4ZOL E;  3T1H T;  1IBK T;  4O2B E;  4IDQ A;  1QLB A;  2W62 A;  3PE0 A;  5FNV E;  4AI6 A;  2W61 A;  3GA8 A;  1UGO A;  2K9A A;  4IDO A;  1BR0 A;  4TV8 E;  1E1H B;  4LFC T;  4M1P A;  4JBW F;  1MMN A;  1KNP A;  3GMI A;  2ZM6 T;  2V5C A;  4YFS A;  2XQ8 A;  5EZY E;  4MAL A;  5JTG A;  3B5M A;  3PUZ F;  3P50 A;  4HWC A;  4O8S A;  4JEH B;  3L8R A;  5CJ5 A;  3UFG A;  2WM9 A;  4JI7 T;  4X5T A;  3O1I A;  1T98 A;  3SOL A;  3ZMV B;  5KDM C;  5C3J A;  4AKI A;  2WBL A;  1XNQ T;  2A3D A;  3RQW A;  4AXP A;  2Y6X A;  3SS1 A;  2VL0 A;  2A9U A;  4OYK A;  3ZYM A;  3NBX X;  4DUZ T;  3AEC A;  2LSJ A;  1YKE B;  3AAI A;  4XAX B;  2XQ3 A;  1D0X A;  2MAW A;  3MK7 C;  2D2S A;  3BQK A;  4UV9 B;  3RYC E;  3HKE E;  1FMW A;  4LFB T;  1MIY A;  5J0Z A;  4G63 A;  4TNV A;  2RP4 A;  3CVR A;  3P7I A;  2YDS A;  3LK4 2;  4UV8 B;  2VVS A;  3J9X 1;  1HX1 B;  3N2K E;  3K3N A;  1BR4 A;  2J62 A;  5JR9 B;  5L47 A;  3AEE A;  3HI2 A;  4EZ4 A;  5LP6 E;  1W9R A;  1WRD A;  3VU7 H;  3AE8 A;  3RRC A;  3PUQ A;  4EXT A;  4HN9 A;  3VRA A;  3LK3 B;  2KXP B;  4ASK A;  2XSB A;  4X62 T;  1T72 A;  1MMA A;  2ZM0 A;  4UVB B;  3AE7 A;  3PUX F;  4HEA A;  2CHO A;  2X51 A;  3PU8 A;  4X20 E;  2M6I A;  3UU5 A;  2QA7 A;  3F31 A;  5AQF B;  3AE6 A;  5CGM A;  4LF4 T;  1VCT A;  1MIV A;  1WLX A;  3VR9 A;  1HS7 A;  3OKQ A;  3RIF A;  4EGW A;  4CN6 A;  3LSV A;  4H9N C;  2ODV A;  5KX5 E;  2WWU A;  3OYX A;  1QSD A;  2WU5 A;  2JQK A;  2XAJ B;  4PJN A;  3ZYK A;  4X1K E;  5FP3 A;  4ILC A;  1BR1 A;  3H37 A;  4UVA B;  4ZI7 E;  3N9O A;  1FJG T;  2N9D A;  2BVL A;  2DCF A;  2V7K A;  2YDQ A;  3KBT A;  4K0U A;  5KMG P;  3NRY A;  5L4E A;  3QK6 A;  4P0A A;  3VHL A;  2DWG A;  3RC3 A;  4DR1 T;  3VKG A;  2XJ7 A;  3B13 A;  3QB5 A;  4J2C A;  4ILB A;  4YTN A;  1HNW T;  2I59 A;  2JMH A;  3CQX C;  3K1S A;  2XAS B;  1U4Q A;  3DTO A;  2ZMA A;  2JQQ A;  2X0Y A;  5AQK B;  4ZZC A;  2K48 A;  1IJ5 A;  4DUY T;  2XZE A;  2K24 A;  5ABH A;  1GQE A;  4TWF A;  2LKG A;  4L5G A;  4PAG A;  3UU8 A;  4AIS A;  4A56 A;  1B7T A;  4TWD A;  5GON E;  3RHW A;  4DBR A;  4DV2 T;  4CZZ B;  4X66 T;  1Z0P A;  1Y01 A;  3CIR A;  4GYR A;  1X9B A;  2XQ7 A;  4YXD A;  4DV7 T;  3JC6 C;  1MND A;  2FBW A;  3DP7 A;  1N34 T;  2FJB A;  3K8P C;  2E9X B;  4AKG A;  3UQ7 A;  3RQU A;  3ZCI A;  1N36 T;  2UXD T;  1MIW A;  3AEB A;  3UUM A;  2LSY A;  4FJO A;  4WBN E;  3RI5 A;  1OED A;  2VVN A;  1KEY A;  2WB5 A;  1OXZ A;  2XM1 A;  3RC8 A;  1SUM B;  2VAS A;  2N2N A;  4GYS A;  4HFC A;  4U3C A;  5DAB A;  1FIO A;  3RRW A;  3I0Q A;  1UCU A;  2LE8 A;  2JQ9 A;  4PK5 A;  4KHZ F;  1YQ4 A;  5HXH A;  3K3O A;  5FY0 A;  4QX8 B;  2LOS A;  5LGU B;  4OFZ A;  3RH3 A;  3ZEF B;  5CA0 E;  2MYS A;  3ONL C;  3QC9 A;  5F8P A;  1JNZ A;  3CQG B;  5M4Y A;  2CLY B;  5AQR B;  5JRC A;  2VK9 A;  2WY2 A;  2KWI B;  3P4P A;  2W67 A;  2LRK A;  4H9R C;  5AQO B;  5AQN B;  3RX6 A;  3UFE A;  4CI3 B;  4CN1 A;  3PUY F;  4DR5 T;  1D1C A;  5ABG A;  2XAH B;  2VKD A;  2VUR A;  3NRX A;  2J47 A;  3LK2 B;  4IIJ E;  5AQM B;  3P4W A;  4DV4 T;  2LJL A;  2VWA A;  3O4X E;  2WDR A;  3EAM A;  5HEO A;  3PJA A;  5LBM A;  3SFE A;  2LM9 A;  4B3M T;  4NIQ A;  3AEA A;  3DJB A;  2Q9Q C;  3CML A;  2BKO A;  3CX7 B;  4HGA A;  5HEJ A;  2F4V T;  3ZMZ B;  3ONX A;  4B3T T;  3AA1 B;  5ABE A;  4HWI B;  2V26 A;  2JMK A;  2H7O A;  3RIU A;  3RIA A;  3N9M A;  1J1J A;  2W66 A;  3ETV A;  1SE7 A;  3OJA A;  3HA4 A;  3C98 B;  4NXM T;  2EHO D;  5FYM A;  2EHO A;  4TZ4 C;  1OED B;  1BR2 A;  3RKG A;  1LVF A;  4QH4 A;  2K5B B;  5LGN B;  4HFH A;  2KSR A;  2NWB A;  2XAF B;  4KUM B;  3N2G E;  4AQF A;  2IC6 A;  4QHO A;  3P4S A;  2E9X A;  4TX5 A;  5L3D B;  3N9P A;  5LJM A;  3GWH A;  4ILA A;  1HR0 T;  3CWZ B;  2YIN A;  2W00 A;  4WW0 A;  4IT4 A;  3Q9D A;  4H9S E;  1S94 A;  1XWM A;  3CPZ A;  2WSS V;  4GK0 E;  2YDR A;  4N78 D;  3A7M A;  2NR4 A;  2DNX A;  3CKD A;  5L4H A;  3VKH A;  1J5W A;  4EV6 A;  4CXY A;  1SA0 E;  1YXR A;  3HKB E;  2H89 A;  4C91 A;  3M3Z B;  3N9N A;  2BG9 E;  3Q5E A;  1R8I A;  2H3R A;  4O4J E;  3NKZ A;  3PUV F;  4HE8 A;  4PFP A;  5DJQ C;  3D0T A;  5BMV E;  3CQC B;  2WDV A;  2LHN A;  2IUB A;  3Q5W A;  3AED A;  5CFB A;  1DU2 A;  3LG7 A;  3UQ4 A;  5L3C B;  2V8S V;  3MAC A;  3C4Z A;  4PJJ A;  4WZX A;  3ZJ2 A;  5HWY A;  4XZC A;  4LML A;  5F3J A;  4EYY R;  5KXJ A;  4LF9 T;  5EK3 A;  3UU6 A;  5LHH B;  1CHU A;  2RPA A;  2YK0 A;  3H3M A;  1IJ6 A;  4P1N A;  3PUR A;  5HXR A;  2KIN B;  2CWO A;  4U72 A;  3OTO T;  1E7P A;  1FMV A;  2GK9 A;  3QNU A;  4EEB A;  2CBI A;  4JI6 T;  5AFU L;  1WFD A;  3ZMS B;  4ZS2 A;  4ZI2 C;  3FXD B;  5JDH A;  1WCR A;  2WS3 A;  3N2O A;  4L9I A;  2SPC A;  5JVD E;  4DR6 T;  5HWX A;  4MHC A;  4CQI A;  4PNI A;  2OV9 A;  1HFA A;  2Q9Q D;  2W0G A;  4JI8 T;  2E5V A;  2P9B A;  3ZYL A;  4LMK A;  4F8H A;  3L3P A;  3CX8 B;  4IE0 A;  1XMQ T;  3OPC A;  2JRK A;  1X79 A;  4QX7 B;  3MKD A;  4Z8X A;  2XTL A;  1KFY A;  5FL0 A;  3K3Q C;  5IUX A;  2D0T A;  1SHZ C;  3N9Q A;  2BG9 C;  5JDM A;  2CM0 A;  2A72 A;  1M7K A;  3QB5 K;  3FBZ A;  5JDN A;  4ANJ A;  3ZT5 A;  2CXD A;  4IDP A;  2V6Y B;  1O3X A;  3LDQ B;  2UXN B;  2Y48 B;  2XY8 B;  3TLS A;  3MA9 A;  4ISS A;  5JDL A;  5LHG B;  4YY3 T;  3AB3 B;  5JDF A;  4F6R C;  5FXW A;  4P09 A;  4QXC B;  5FXV A;  1N33 T;  1OED E;  2I0M A;  3LFM A;  5H6R B;  4DV5 T;  2XQY A;  2BBJ A;  1JNR A;  4KP3 C;  2D9D A;  3KBU A;  4IRE A;  1MMG A;  5AQT B;  3EDV A;  3ZN1 B;  3ZKR A;  3FB2 A;  4IL4 A;  2X67 A;  2KND A;  5HEG A;  2NW8 A;  3LJC A;  4IL9 A;  1T8B A;  4UF0 B;  5LYJ E;  4DV0 T;  4UIG A;  3NWI A;  2ES0 A;  2KT9 A;  5J2U E;  2L9Q A;  4UEL A;  5FY1 A;  3JCF A;  3JAF A;  4EYU A;  2J4G A;  3AVS A;  3FBL A;  4H63 V;  5LA6 E;  4LF6 T;  3EDU A;  3C51 A;  3AA7 B;  1ZKE A;  4IDZ A;  1L0V A;  3FXE B;  4GOU A;  4O2A E;  5FXZ A;  4EOZ B;  2YOE A;  3AEF A;  5CA1 E;  1XZY A;  2VKO A;  5HXS A;  4IE4 A;  1ZP0 A;  2FJA A;  3ZLI A;  4BJN A;  4YT0 A;  1YW0 A;  2X9X A;  4BAY B;  2DLR A;  5ABF A;  2FUP A;  3AEG A;  4ZZB A;  2ZM8 A;  1YKH B;  4KMC A;  3MJX A;  2X66 A;  3C4X A;  1CUN A;  4CI2 B;  3P8C D;  2HN2 A;  2G0U A;  1T7S A;  3OBV E;  3ZN0 B;  3WAJ A;  5HEU A;  3AXJ A;  2CE7 A;  1VRB A;  4BJM A;  3UUN A;  3A8Y C;  3LBX A;  1G8X A;  4IST A;  4WYV A;  3UUX B;  2M67 A;  1ZHC A;  2W2U A;  3RYI E;  2B76 A;  3JAE A;  5LB7 B;  1VCS A;  3ZST A;  4YSZ A;  4Z90 A;  5FVK A;  1XDO A;  3JAD A;  2C5I T;  4EED A;  4ZI2 D;  5LG4 A;  3AVR A;  4ZI3 D;  1WYC A;  1W09 A;  2XQA A;  4PFO A;  4YTM A;  2W63 A;  4U31 A;  4YSX A;  1J5E T;  2Q9Q B;  2WDQ A;  5AQJ B;  2VQE T;  3ANW B;  2HHH T;  4HKA A;  4GKK T;  1HG2 A;  5BR8 T;  2WZI A;  4XBF B;  1D1A A;  3ZCJ A;  3M65 A;  1KF6 A;  1YD8 G;  1HCI A;  2NW7 A;  2XUE A;  4NUU A;  4U74 A;  1NAF A;  4LF7 T;  2Z6E A;  4COF A;  4JEU B;  4KBM B;  1IAP A;  5AQS B;  3B57 A;  4U33 A;  3AE9 A;  3PUG A;  2X9H A;  2PTF A;  2CWY A;  2JIW A;  2NOX A;  4U2Y A;  3NVO A;  4NXN T;  2ACX A;  4AKR B;  2UXC T;  3TLU A;  1EZ3 A;  3CX6 B;  3IBP A;  3PUS A;  5JQG E;  2E2A A;  4A97 A;  4X1I E;  5IWA T;  1IBL T;  1U5P A;  3UU3 A;  3HL6 A;  2Q9Q A;  2CPT A;  3GN5 B;  3E0Z A;  2DL1 A;  4AIU A;  2MOZ A;  2V1D B;  3HKC E;  4ILU A;  4JUY A;  2IDO B;  1UUR A;  5ETW A;  3FZK B;  2PFV A;  1OED C;  3BQI A;  4PW8 A;  4YSY A;  3ZSS A;  4IE5 A;  2BBH A;  4IDN A;  3LBX B;  5LMN T;  5L3F B;  4CN4 A;  2BG9 B;  4AQF C;  1UUS A;  2JQH A;  2NP9 A;  3EI0 A;  3NZQ A;  4EAH A;  4Z91 A;  1HTJ F;  4HTE A;  3ZMT B;  3ESL A;  5L2L A;  4JI1 T;  2XQ5 A;  4HFV A;  1I6Z A;  4CI1 B;  3V5U A;  4YHH T;  1MMD A;  2IIU A;  3E08 A;  3IF8 B;  1LVK A;  1UK5 A;  4G2A A;  4TV9 E;  4AQG A;  1QUU A;  4KX6 A;  1LKX A;  4TN7 B;  3QUJ A;  3UT5 E;  4YHJ A;  2JJ9 A;  2YN6 A;  1OWA A;  2HPL A;  2B1E A;  2VKH A;  2XM2 A;  3KV4 A;  4MLK A;  5L3E B;  5JR9 C;  5LGT B;  4KI0 F;  3KV9 A;  1E2A A;  3P4R A;  3TKL B;  3TLV A;  2E5L T;  2C5J A;  2NTY A;  3U78 A;  3AA0 B;  4DR3 T;  2X9Y A;  4JI3 T;  4JV5 T;  5HYA A;  3EAB A;  4DR7 T;  2M6B A;  2WQY A;  4GK5 E;  3KV5 A;  3H3A A;  1W0B A;  5AQG B;  3FZH B;  5TAO A;  3O1H A;  3KVB A;  3IEE A;  4DMV A;  3KDS E;  2IHR 1;  3PTR B;  4DV3 T;  4JI2 T;  2CXF A;  4NPP A;  3L39 A;  5LG3 A;  1HNX T;  1N32 T;  4HFE A;  3Q5D A;  1UX4 A;  4EIW A;  1ZV4 X;  1M62 A;  3ZT7 A;  2E9X C;  2QYW A;  1HX8 A;  1IZN B;  4PJL A;  4UR9 A;  4HWF A;  3I1A A;  3UTK A;  4I55 E;  2YU2 A;  3W15 B;  2LRL A;  2D0U A;  4QXH B;  1HG5 A;  4LF8 T;  4E7S A;  4DV1 T;  3IA3 A;  3L09 A;  4QH5 A;  4X65 T;  3T1Y T;  1US7 B;  3AAA B;  3QOF A;  3C50 A;  2OA5 A;  2ACZ A;  4O4L E;  4C90 A;  3KV6 A;  3NZP A;  3C4W A;  5AQH B;  3RPU A;  5FKY A;  4DV6 T;  5JRE A;  4ERR A;  1I94 T;  2CHN A;  3OVU A;  3I0O A;  2XAG B;  4TWH A;  3V5S A;  2WU2 A;  1Y64 B;  2XQ9 A;  2XHE B;  2DI4 A;  4H63 H;  2WZH A;  2YU1 A;  4YJ2 E;  3E22 E;  5ADX L;  2CMR A;  3SWH A;  5A1L A;  2KLQ A;  2CCQ A;  2X0L B;  1WYB A;  2BG9 A;  3CK6 A;  4YTP A;  3ZMU B;  5JDQ A;  4LMJ A;  3EVY A;  2XQ6 A;  4TUY E;  4ZI3 C;  2DHR A;  4O4I E;  5LHI B;  2XSA A;  3U3I A;  5LNK A;  4K0K T;  2IML A;  2QGS A;  3ONJ A;  5AQU B;  2V7M A;  3O9X A;  3PUW F;  3PUA A;  2H88 A;  2OLT A;  1XDP A;  2X9W A;  5FY7 A;  4H9Q C;  3TLT A;  1AJ3 A;  3PDY A;  5CB4 E;  3AE5 A;  5HXC A;  2L8K A;  4CXX A;  3ZT6 A;  2QVA A;  4I0U A;  4U7Y A;  3SFD A;  5J1G A;  4JYA T;  5FXX A;  3MXZ A;  4GIW A;  2LHR A; 
#chains in the Genus database with same CATH homology
 3EAB A;  2WWV A;  2CRB A;  2K3W A;  4U2Z A;  1WR0 A;  2MPK A;  5CJ5 A;  2V6X A;  3ZSS A;  2XZE A;  4WZX A;  3ZT5 A;  4CN4 A;  2V6Y A;  2V6Y B;  2JQH A;  2WY2 A;  4U7I A;  5CGM A;  2LRK A;  5FVL A;  2RPA A;  4CN1 A;  4P1N A;  3ZT7 A;  2A9U A;  4U33 A;  4CN6 A;  4U2Y A;  2LRL A;  4A5X A;  2JQK A;  4IT4 A;  1WFD A;  2W2U A;  4ZEY A;  1WCR A;  5LB7 B;  3ZST A;  5FVK A;  4NIQ A;  3ZT6 A;  4U3C A;  4U7Y A;  4U31 A;  1YXR A;  2CPT A;  2JQ9 A;  2DL1 A;  3K1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...