1YXRA

Nmr structure of vps4a mit domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
77
structure length
77
Chain Sequence
b'MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vacuolar protein sorting factor 4A
molecule tags Protein trafficking
source organism Homo sapiens
publication title NMR Structure of VPS4A MIT Domain
rcsb
total genus 29
structure length 77
sequence length 77
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 1yxrA01
2V6YB 5CGMA 2CPTA 1WFDA 4CN4A 4ZEYA 2JQKA 2K3WA 2V6YA 2JQHA 3EABA 4IT4A 2V6XA 5FVLA 2LRLA 2W2UA 2LRKA 4U2ZA 4U31A 5FVKA 3K1SA 3ZT7A 3ZSTA 4U3CA 4CN6A 4CN1A 5CJ5A 2RPAA 4U7YA 2A9UA 3ZT6A 2JQ9A 1WCRA 4U7IA 3ZT5A 3ZSSA 4U2YA 4U33A 4WZXA 2DL1A 1YXRA 5LB7B 2WY2A 4P1NA 4NIQA 4A5XA 1WR0A 2XZEA 2WWVA 2CRBA 2MPKA
chains in the Genus database with same CATH superfamily
4IE4A 5LXTE 5E0OA 4JI5T 4DIDB 3C98B 4AKLA 4YTMA 3J7Yq 3CMLA 2C5JA 1LVFA 2FBWA 2C5KT 2XASB 2XQ5A 2E2AA 3KVBA 4MBQA 2DWKA 3JC6D 5ABGA 2NTYA 2QGSA 4NUUA 5FVLA 3UTKA 1BR1A 2XQAA 3T1YT 4UVBB 5HEGA 1WYCA 2E9XB 5IWAT 2WCAA 3I9WA 3IF8B 1WYBA 5TAOA 2LE8A 3UUBA 5HEJA 3O9XA 3AE8A 2VQET 3WI3A 2JMHA 4AQFC 4EEDA 3RYHE 5JDHA 5JQGE 1ZHCA 3EDVA 2JQ9A 3EI0A 4ILUA 1JNRA 3EUHA 3ZJ1A 2DL1A 5AQVB 3ZCJA 3ZN1B 4M1PA 2CE7A 4ZXLA 2K5BB 1IJ6A 4DR4T 2CHNA 3LG7A 3O1IA 2VVNA 2N9DA 2WY2A 3Q5DA 2YDRA 3HKEE 3CX7B 1KF6A 3E22E 3K8PC 5HCMA 2ES0A 5IYZE 3AEFA 4IE7A 3QB5K 3N2OA 4OYJA 5IHYA 4HFHA 3P7IA 3IA3A 5L3FB 5AQIB 4JEHB 2MTQA 3AE1A 4IT4A 5L3DB 3UT5E 4LF7T 2AE9A 3FXEB 2XSAA 2D2SA 3AEAA 3N2GE 3W15B 4ASKA 1HFAA 2NP9A 2IAKA 3PUAA 3ZC0A 4OHFA 2V8SV 4DBRA 4AXPA 4CN6A 3SS1A 2BZBA 1G8XA 3HKCE 1LKXA 4YJ3E 3TLUA 4C91A 2NW8A 5LG4A 4AIUA 3I1AA 5AQRB 5JDQA 2PTFA 3U78A 4YT0A 3AEGA 4H63H 4TWDA 5FP3A 3AECA 2HHHT 3RYFE 1EZ3A 3AEEA 3FB2A 2RA1A 3PU8A 4QX7B 3RYCE 4GYSA 2XAFB 3P4RA 3S4UA 4DO0A 2QYWA 2JQKA 2BS4A 4WNKA 2V6YA 2D5UA 4ILCA 4GKJT 2VASA 1J5WA 1HX1B 4EYUA 2CA5A 1OEDA 1Z8UA 3L39A 3NRYA 1R8IA 2H7OA 1MIYA 3AA7B 3RKOA 4YSXA 4B3ST 2E8IA 2K9AA 2L3LA 4YFSA 2D0TA 4AQGA 3AB3B 2WDQA 1LRZA 3UU5A 1FMVA 1MMNA 2CXFA 4JI7T 2YN6A 2BBHA 2LKGA 2DNXA 2UXXB 4U3CA 2BG9B 2YINA 4PK5A 4EIWA 3AE9A 1OEDC 4X1YE 2CMRA 1VCSA 2I0MA 1OEDE 3C4ZA 4U7IA 4P0AA 4AKHA 4KBMB 2X9WA 3O4XE 2BVLA 2NWBA 3LK42 4HGAA 2IMLA 5CFBA 5FXZA 2YU1A 1YKEB 3B13A 2LT3A 3KV9A 3LK2B 3N5LA 3OYZA 1GQEA 5J1GA 4TUYE 3F2EA 2A72A 2MOZA 4H9SE 2PJQA 3EAMA 3H3AA 2XUEA 2V5DA 3AAIA 3B57A 4EZHA 5JDMA 3RQUA 4IE5A 5KX5E 2A2FX 2V26A 1NWMX 5LBQB 2WMNA 4KX6A 2XQ6A 1UX4A 3AVSA 3AE7A 3LJCA 2HN1A 4AKIA 3UUNA 3ZMTB 3T8OA 5HXSA 1YW0A 3PE0A 4GYRA 4KI0F 3QOFA 3CKDA 3CQXC 3OPCA 4PJJA 4UVAB 5JDFA 3R6NA 2ZM8A 3X1DA 4DR7T 4DV3T 2V7KA 5H6QB 1T7SA 3IEEA 3C51A 2LM9A 4UXNB 1V9DA 3J9X1 3LBXA 3RQWA 4OFZA 3TLTA 1HTJF 2DI4A 3KBTA 5ABFB 4WW0A 3R84B 5AQQB 4CXXA 3E08A 3ZSSA 2J47A 3ABVA 4I50E 4U33A 2LSIA 3LDQB 5JTGA 5LJMA 1UX5A 1U5PA 1SHZC 2WQYA 2YEVC 1N34T 2CWYA 1KEYA 1J1JA 3PUXF 4MLKA 1HR0T 2UXCT 1U4QA 2LSYA 5J0ZA 4IDQA 3HA4A 3N9PA 4F6RC 4DR2T 4OK0A 5LHHB 5C3JA 2G0UA 4QH1A 2IUBA 2CWOA 3P4PA 3FBZA 2WWUA 3UU4A 3CQGB 2WP9A 4QXHB 4JBWF 3AAAB 4ZI3C 3ZYMA 2E5VA 4EOZB 3RI5A 5FL1A 4YLHA 5EK3A 3SFEA 1W0BA 2W00A 5L3CB 5LMUT 5JDLA 3CPZA 4Q25A 1XWMA 4LMLA 3JC6C 1KNZA 3NZPA 4LFAT 5FVKA 3VR9A 2VL0A 2KXPB 2WZHA 4HEAA 4UV9B 2WZIA 3T1HT 3BQKA 4IHJE 5DQVA 2KLQA 3Q9DA 3MKDA 3QUJA 3AEDA 4HTEA 4U7YA 2JMKA 5DQWA 5FY7A 3ZYLA 5CJ5A 1D0XA 4B3RT 1YKHB 3OKQA 5AQLB 4CQIA 4NXNT 2H88A 4JI3T 4LF4T 1BR4A 4PK6A 3PTRB 3RGLA 1NAFA 3C4XA 2C5IT 5JR9A 4MFRA 3UQ7A 5AQTB 1MNEA 1S35A 2VB6A 2Y48B 2SPCA 3NBXX 2YK0A 3L3PA 1M62A 2WS3A 3QC9A 2M6BA 4UV8B 5LCYA 2IW5B 1IBKT 3LFMA 2XQ8A 4NPPA 4UEMA 4ADZA 3KVAA 4CN4A 4YSZA 3DP7A 3EABA 5LBMA 1SA0E 4CI1B 1D1CA 3A7MA 1H7CA 3ZYKA 4QXBB 3VU7H 2V1DB 1MIVA 3CK6A 3F31A 2IC6A 4EB6E 4HFCA 2XJ7A 2DLRA 4IL4A 4UF0A 2XY8B 3M3ZB 4LF9T 4NXMT 2KT9A 2J1DG 3RX6A 4L0RA 4TX5A 3TLSA 2E9XC 2RP4A 4EAHA 4HWCA 2LOSA 5FKYA 3RKGA 4CN1A 3RIAA 5JH7E 5M4YA 3ZT6A 3ANWA 1UURA 4HWHA 4C90A 4J2CA 4QH5A 3RH3A 2ZM0A 3AEBA 3BK9A 5AQJB 5LGNB 1XMQT 4UR9A 2UXBT 1HCIA 1MIWA 4TNVA 1LVKA 1B7TA 4ZI2D 2E9XA 4B3TT 1HNZT 4YY3T 2EHOB 2LKHA 2ACZA 2XM1A 4I4TE 3AVRA 4TWFA 2ZM6T 4YTNA 4DR6T 2YDQA 1HS7A 3DTOA 2YDSA 3V5UA 4ZEYA 4HKAA 3N9MA 4GK5E 2HN2A 5LMNT 3PURA 5LHGB 1NENA 3OBVE 4U2ZA 4O4HE 2X66A 2ODVA 2B1EA 2J4GA 4FI5A 4MALA 2V7IA 2XHEB 5AQPB 4V1Av 3UFEA 2BKPA 2LLYA 2WDVA 2RPAA 3FZHB 4OX9T 2XPKA 4IL9A 4PNIA 4WBOA 4JUYA 5HXEA 3H37A 2KMFA 4TN7B 2BG9E 4IDZA 4H9RC 2W4XA 5LG3A 4DMVA 2WB5A 4A5XA 1OEDB 4JI4T 1WR0A 1L0VA 3C64A 1XZYA 3MK7C 2MPKA 3BQIA 4PW8A 4UELA 2V6YB 3NRXA 4X5TA 3VRAA 2W67A 2BS3A 1WR6A 2KWHA 2XAGB 3UQ4A 3ZCIA 1MNDA 2CLYB 4TV9E 4Z91A 4YHJA 5KMGP 4DR1T 2Q9QD 2W2UA 2FJDA 2NW7A 4YSYA 4IDNA 3RRWA 2VURA 3P4WA 4YHHT 3N9OA 1HF8A 2LHNA 2N2NA 5JDGA 1FMWA 2WU5A 4ZI7E 1KNRA 3RYIE 2BKOA 4QH4A 5J2TE 4IDOA 4XZCA 2B76A 2XAJB 3PUVF 4Z8XA 4H9NC 2UXDT 2WBLA 4HWIB 1X79A 2HH7A 2H7VC 2X51A 4QWNB 1T8BA 2I59A 2VKHA 5HXCA 1XDPA 3NVOA 4ANJA 4YJ2E 5AQFB 1FJGT 2LJLA 3ZPOA 4HFIA 2XQ4A 1D0ZA 5JVDE 5FY0A 1VOMA 4B6XA 1ZEEA 5BR8T 3FBLA 4IE6A 1VCTA 3OYXA 4O8SA 4A97A 5F3JA 1XNRT 2L8KA 2JPFA 2LRKA 2CXDA 2VWAA 3ZMZB 4DUZT 2EHOA 2CLYC 4HFDA 2KSRA 3TLWA 4AISA 5ADXL 2ODUA 5HWYA 5JDNA 4DV2T 1N36T 4DV5T 1WLXA 5FXXA 4A56A 5L47A 4DV4T 2A9UA 1WCRA 4XBFB 1D0YA 4JI1T 4YTPA 3CVRA 4WZXA 5LHIB 1ZKEA 2PBIA 3RC3A 3P4QA 3VKHA 1MMDA 3OJAA 2BDEA 4N78D 5LGTB 1IZNB 4TNWA 3AA6B 1MMGA 4HWDA 5C2TA 4AQFA 3LK3B 5FXWA 5FY1A 4IREA 4LF6T 1M7KA 2BS2A 2IIUA 4H63V 2X67A 3RPUA 4H9QC 2NOXA 2M67A 1QLBA 4DVDA 4DV7T 4KHPT 3L8RA 1OXZA 1E7PA 4HFBA 3A5XA 1MMAA 2UU9T 3PUQA 3PUSA 3RIFA 4KMCA 2BG9C 4PAGA 5FL0A 4JI2T 1VRBA 3IHRA 3PJAA 3JADA 5J2UE 1W0AA 1HX8A 4U74A 4X64T 2D9DA 4JI0T 2Q9QC 4JLEA 1W9RA 4TV8E 4CXWA 1DU2A 3AAEB 4K0KT 4GKKT 5AQMB 3UUXB 2BG9A 5L3GB 2XQYA 2X9XA 2A3DA 4ZZBA 3AA0B 5JRCB 4E7ZA 5JRCA 5HXHA 5HEOA 1IJ5A 2V5CA 3RRCA 2Q9QA 3QB5A 2XTLA 2JRKA 3OVUA 4L9IA 2CBIA 2BKNA 3H3MA 5FYMA 5EK2A 5LNKA 3P4SA 3PUWF 4EYYR 3MZKB 4ZZCA 2QRXA 3CX8B 3HI2A 2HPLA 3KBUA 5AQSB 1FIOA 2N1GA 4DV1T 4FJOA 3FZFB 4PFPA 5F8PA 4WBNE 3MJXA 4ZS3A 1XDOA 4EV6A 4QKNA 5LGUB 4BJNA 1D1BA 3ESLA 2CXLA 4I55E 3EDUA 5KDMC 3OTOT 2V7JA 2V7MA 5KXJA 2YOEA 3RHWA 3VKGA 1YD8G 3G06A 3ETVA 4ISTA 1J5ET 1I94T 1X9BA 2KWIB 2X9YA 3FHNA 3QNUA 2DCFA 3GMIA 5ABHA 3U3IA 2GK9A 2ZMAA 4KUMB 3N9NA 2YKSA 4H9OC 4LMJA 1KFYA 2X0LB 4DNDA 2J62A 3GN5B 5FMNA 4QXCB 4O2BE 1XNQT 1IAPA 5L4HA 2WM9A 5HEUA 4JI6T 2F4VT 4DR5T 1T98A 1UCUA 3EHZA 3UU8A 2X68A 5GONE 2W0GA 5AQOB 3NZQA 2HPJA 4KHZF 2W61A 4PJLA 3FXDB 4AKRB 4BJMA 4LFCT 1BR2A 1I6ZA 4GK0E 3PUGA 1UK5A 4LF8T 3AE5A 3SWHA 5LJNA 3AE3A 4HE8A 2KNDA 2H3RA 3PJAJ 5L3EB 2LOPA 2Y8DA 1HG2A 3EVYA 3UU3A 2DWGA 3JAEA 3Q5XA 4UVCB 5C8YE 1UUSA 4PJNA 2M6IA 2E5LT 4B3MT 2W62A 3HL6A 2XQ9A 4NUVA 4ZOLE 5CB4E 2UUCT 1W09A 2NTXA 3NKZA 5CA1E 5HEHA 2X9HA 3AXJA 3F57A 1T72A 4BAYB 1G73A 2W66A 3MA9A 3PUZF 4ZI2C 3N2KE 2Z6EA 4UF0B 3SRZA 3P8CD 2OA5A 4JYAT 2CBJA 2OV9A 4JI8T 4HFVA 5LB7B 2EHOD 1ZV4X 4COFA 5HXRA 3SFDA 4NIQA 2W63A 1ZP0A 3KV6A 2XZEA 2WWVA 4HWFA 1XMOT 2FUPA 3KINB 5ETWA 2L9QA 3Q2MA 3KV4A 2XQ7A 4TWHA 1FEWA 4K0UA 2OLTA 3C4WA 3AE6A 5HAXA 3WAKA 1US7B 2VK9A 3SOLA 2UUBT 3O1JA 5AFUL 3ZC1A 4IGUA 2BVMA 3GN5A 2Q9QB 2WSSV 2MBGA 2NR4A 3WAJA 2X0YA 1Y64B 4DR3T 4I43B 4EXTA 4EZ4A 2CM0A 4JV5T 2JQQA 3PUYF 1QUUA 4L5GA 1QSDA 3ZEFB 5BMVE 5JR9C 4CXYA 4X62T 3CIRA 3CWZB 4Z90A 4EEBA 1S94A 3UULA 3PU3A 2H89A 3FZLB 5AQHB 3ZT5A 3BQLA 3V5SA 2WMOA 1JNZA 1UGOA 3K3OA 2P9BA 3IBPA 4ZHQE 1YXRA 2KINB 2VKDA 3MXZA 3B5MA 1AJ3A 3VHLA 5AQKB 4P1NA 3UFGA 5AQUB 3I0OA 3KV5A 2FJBA 4PK4A 2JIWA 3Q5WA 2C0SA 1IBMT 3UU6A 3VR8A 4QX8B 5JREA 3PV0F 1N33T 3KFWX 2VQFT 2XQ3A 3TKLB 4AI6A 4X65T 5EZYE 4YXDA 4P0BA 2LRLA 3ONXA 2I6HA 4H9PC 3KDSE 4LF5T 4IIJE 1O3XA 4IE0A 5DABA 2LSJA 3ETUA 3P50A 4O2AE 4DMWA 4I0UA 4JEUB 4E7SA 2XM2A 3E0ZA 2QA7A 4ZI3D 5L4EA 5EK4A 3AE2A 1YQ4A 3RLFF 5ABFA 4OYKA 3AE4A 3LBXB 2XAQB 3GA8A 5FXVA 4F8HA 1HNWT 2ZM2A 3I0QA 1KK7A 5LP6E 3FZKB 4GIWA 4P09A 1CUNA 3TLVA 2FJEA 2DHRA 3NWIA 4MHCA 3ZKRA 2VKJA 3O1HA 4U72A 2CRBA 5AQGB 1KNPA 2LM2A 4G2AA 2VVSA 5ABEA 2QVAA 2CHOA 5CGMA 1Y01A 3Q5EA 2CPTA 4O4JE 2BBJA 4LMKA 2VL8A 4QHOA 2K3WA 2JQHA 2KZ7B 4ERRA 4X1IE 3RIUA 3JAFA 4CI3B 4LFBT 4GOUA 1SUMB 3L09A 4X20E 2E9XD 5DJQC 4ZS2A 2AXDS 1OWAA 4U31A 4WYVA 1WRDA 3FZMB 3ONLC 3ZT7A 3A8YC 3C50A 3ZSTA 2Y6XA 5LYJE 2LSGA 3CX6B 2UUAT 2LHRA 3DJBA 1E1HB 4PFOA 3HR0A 2CEAA 5HWXA 4AKGA 2YU2A 4PJMA 4HN9A 3RIUC 1HNXT 3PDYA 3JCFA 1E2AA 3D0TA 4ILBA 4CZZB 2WU2A 1NEKA 3ZLIA 1CHUA 4DUYT 2PFVA 1HG5A 2MYSA 4X1KE 2NW9A 2WAUA 3ZMUB 2K24A 4DBQA 2VKOA 4AQYT 1IBLT 1N32T 3CQCB 4UIGA 4O4IE 3GWHA 3M65A 2LSKA 4G63A 2D0UA 4XAXB 5LOVE 1WFDA 1BR0A 3ZJ2A 3RC8A 5HYAA 2IC9A 4IDPA 2K48A 3K3QC 2V6XA 5IUXA 2LEHA 4TZ4C 3UUMA 5CA0E 3N9LA 2UXNB 5L2LA 2JJ9A 2ACXA 4DV0T 5H6RB 1SE7A 2ZLYA 5LA6E 2X0HA 2V7LA 2FJAA 3K1SA 2XSBA 3K3NA 3QK6A 5AQNB 4EGWA 4CI2B 5JR9B 4A98A 1D1AA 3LSVA 1YQ3A 2R6GF 1Z0PA 4ILAA 3ZMVB 3MACA 3VRBA 3N9QA 3ZN0B 3HKDE 5L3BB 2WDRA 2CCQA 5HCJA 1ZOYA 4HFEA 4KP3C 3HKBE 4U2YA 5F5WA 2PG8A 3I9YA 3ZMSB 4X66T 4DV6T 3AA1B 4ISSA 3RF1A 3ANWB 5FNVE 2XAHB 5A1LA 3ONJA 4O4LE 4BA9A 2IDOB 2MAWA 3AXJB 2IHR1 2EHOC
chains in the Genus database with same CATH topology
2V6YB 5CGMA 2CPTA 1WFDA 4CN4A 4ZEYA 2JQKA 2K3WA 2V6YA 2JQHA 3EABA 4IT4A 2V6XA 5FVLA 2LRLA 2W2UA 2LRKA 4U2ZA 4U31A 5FVKA 3K1SA 3ZT7A 3ZSTA 4U3CA 4CN6A 4CN1A 5CJ5A 2RPAA 4U7YA 2A9UA 3ZT6A 2JQ9A 1WCRA 4U7IA 3ZT5A 3ZSSA 4U2YA 4U33A 4WZXA 2DL1A 1YXRA 5LB7B 2WY2A 4P1NA 4NIQA 4A5XA 1WR0A 2XZEA 2WWVA 2CRBA 2MPKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6Y B;  5CGM A;  2CPT A;  1WFD A;  4CN4 A;  4ZEY A;  2JQK A;  2K3W A;  2V6Y A;  2JQH A;  3EAB A;  4IT4 A;  2V6X A;  5FVL A;  2LRL A;  2W2U A;  2LRK A;  4U2Z A;  4U31 A;  5FVK A;  3K1S A;  3ZT7 A;  3ZST A;  4U3C A;  4CN6 A;  4CN1 A;  5CJ5 A;  2RPA A;  4U7Y A;  2A9U A;  3ZT6 A;  2JQ9 A;  1WCR A;  4U7I A;  3ZT5 A;  3ZSS A;  4U2Y A;  4U33 A;  4WZX A;  2DL1 A;  1YXR A;  5LB7 B;  2WY2 A;  4P1N A;  4NIQ A;  4A5X A;  1WR0 A;  2XZE A;  2WWV A;  2CRB A;  2MPK A; 
#chains in the Genus database with same CATH topology
 4IE4 A;  5LXT E;  5E0O A;  4JI5 T;  4DID B;  3C98 B;  4AKL A;  4YTM A;  3J7Y q;  3CML A;  2C5J A;  1LVF A;  2FBW A;  2C5K T;  2XAS B;  2XQ5 A;  2E2A A;  3KVB A;  4MBQ A;  2DWK A;  3JC6 D;  5ABG A;  2NTY A;  2QGS A;  4NUU A;  5FVL A;  3UTK A;  1BR1 A;  2XQA A;  3T1Y T;  4UVB B;  5HEG A;  1WYC A;  2E9X B;  5IWA T;  2WCA A;  3I9W A;  3IF8 B;  1WYB A;  5TAO A;  2LE8 A;  3UUB A;  5HEJ A;  3O9X A;  3AE8 A;  2VQE T;  3WI3 A;  2JMH A;  4AQF C;  4EED A;  3RYH E;  5JDH A;  5JQG E;  1ZHC A;  3EDV A;  2JQ9 A;  3EI0 A;  4ILU A;  1JNR A;  3EUH A;  3ZJ1 A;  2DL1 A;  5AQV B;  3ZCJ A;  3ZN1 B;  4M1P A;  2CE7 A;  4ZXL A;  2K5B B;  1IJ6 A;  4DR4 T;  2CHN A;  3LG7 A;  3O1I A;  2VVN A;  2N9D A;  2WY2 A;  3Q5D A;  2YDR A;  3HKE E;  3CX7 B;  1KF6 A;  3E22 E;  3K8P C;  5HCM A;  2ES0 A;  5IYZ E;  3AEF A;  4IE7 A;  3QB5 K;  3N2O A;  4OYJ A;  5IHY A;  4HFH A;  3P7I A;  3IA3 A;  5L3F B;  5AQI B;  4JEH B;  2MTQ A;  3AE1 A;  4IT4 A;  5L3D B;  3UT5 E;  4LF7 T;  2AE9 A;  3FXE B;  2XSA A;  2D2S A;  3AEA A;  3N2G E;  3W15 B;  4ASK A;  1HFA A;  2NP9 A;  2IAK A;  3PUA A;  3ZC0 A;  4OHF A;  2V8S V;  4DBR A;  4AXP A;  4CN6 A;  3SS1 A;  2BZB A;  1G8X A;  3HKC E;  1LKX A;  4YJ3 E;  3TLU A;  4C91 A;  2NW8 A;  5LG4 A;  4AIU A;  3I1A A;  5AQR B;  5JDQ A;  2PTF A;  3U78 A;  4YT0 A;  3AEG A;  4H63 H;  4TWD A;  5FP3 A;  3AEC A;  2HHH T;  3RYF E;  1EZ3 A;  3AEE A;  3FB2 A;  2RA1 A;  3PU8 A;  4QX7 B;  3RYC E;  4GYS A;  2XAF B;  3P4R A;  3S4U A;  4DO0 A;  2QYW A;  2JQK A;  2BS4 A;  4WNK A;  2V6Y A;  2D5U A;  4ILC A;  4GKJ T;  2VAS A;  1J5W A;  1HX1 B;  4EYU A;  2CA5 A;  1OED A;  1Z8U A;  3L39 A;  3NRY A;  1R8I A;  2H7O A;  1MIY A;  3AA7 B;  3RKO A;  4YSX A;  4B3S T;  2E8I A;  2K9A A;  2L3L A;  4YFS A;  2D0T A;  4AQG A;  3AB3 B;  2WDQ A;  1LRZ A;  3UU5 A;  1FMV A;  1MMN A;  2CXF A;  4JI7 T;  2YN6 A;  2BBH A;  2LKG A;  2DNX A;  2UXX B;  4U3C A;  2BG9 B;  2YIN A;  4PK5 A;  4EIW A;  3AE9 A;  1OED C;  4X1Y E;  2CMR A;  1VCS A;  2I0M A;  1OED E;  3C4Z A;  4U7I A;  4P0A A;  4AKH A;  4KBM B;  2X9W A;  3O4X E;  2BVL A;  2NWB A;  3LK4 2;  4HGA A;  2IML A;  5CFB A;  5FXZ A;  2YU1 A;  1YKE B;  3B13 A;  2LT3 A;  3KV9 A;  3LK2 B;  3N5L A;  3OYZ A;  1GQE A;  5J1G A;  4TUY E;  3F2E A;  2A72 A;  2MOZ A;  4H9S E;  2PJQ A;  3EAM A;  3H3A A;  2XUE A;  2V5D A;  3AAI A;  3B57 A;  4EZH A;  5JDM A;  3RQU A;  4IE5 A;  5KX5 E;  2A2F X;  2V26 A;  1NWM X;  5LBQ B;  2WMN A;  4KX6 A;  2XQ6 A;  1UX4 A;  3AVS A;  3AE7 A;  3LJC A;  2HN1 A;  4AKI A;  3UUN A;  3ZMT B;  3T8O A;  5HXS A;  1YW0 A;  3PE0 A;  4GYR A;  4KI0 F;  3QOF A;  3CKD A;  3CQX C;  3OPC A;  4PJJ A;  4UVA B;  5JDF A;  3R6N A;  2ZM8 A;  3X1D A;  4DR7 T;  4DV3 T;  2V7K A;  5H6Q B;  1T7S A;  3IEE A;  3C51 A;  2LM9 A;  4UXN B;  1V9D A;  3J9X 1;  3LBX A;  3RQW A;  4OFZ A;  3TLT A;  1HTJ F;  2DI4 A;  3KBT A;  5ABF B;  4WW0 A;  3R84 B;  5AQQ B;  4CXX A;  3E08 A;  3ZSS A;  2J47 A;  3ABV A;  4I50 E;  4U33 A;  2LSI A;  3LDQ B;  5JTG A;  5LJM A;  1UX5 A;  1U5P A;  1SHZ C;  2WQY A;  2YEV C;  1N34 T;  2CWY A;  1KEY A;  1J1J A;  3PUX F;  4MLK A;  1HR0 T;  2UXC T;  1U4Q A;  2LSY A;  5J0Z A;  4IDQ A;  3HA4 A;  3N9P A;  4F6R C;  4DR2 T;  4OK0 A;  5LHH B;  5C3J A;  2G0U A;  4QH1 A;  2IUB A;  2CWO A;  3P4P A;  3FBZ A;  2WWU A;  3UU4 A;  3CQG B;  2WP9 A;  4QXH B;  4JBW F;  3AAA B;  4ZI3 C;  3ZYM A;  2E5V A;  4EOZ B;  3RI5 A;  5FL1 A;  4YLH A;  5EK3 A;  3SFE A;  1W0B A;  2W00 A;  5L3C B;  5LMU T;  5JDL A;  3CPZ A;  4Q25 A;  1XWM A;  4LML A;  3JC6 C;  1KNZ A;  3NZP A;  4LFA T;  5FVK A;  3VR9 A;  2VL0 A;  2KXP B;  2WZH A;  4HEA A;  4UV9 B;  2WZI A;  3T1H T;  3BQK A;  4IHJ E;  5DQV A;  2KLQ A;  3Q9D A;  3MKD A;  3QUJ A;  3AED A;  4HTE A;  4U7Y A;  2JMK A;  5DQW A;  5FY7 A;  3ZYL A;  5CJ5 A;  1D0X A;  4B3R T;  1YKH B;  3OKQ A;  5AQL B;  4CQI A;  4NXN T;  2H88 A;  4JI3 T;  4LF4 T;  1BR4 A;  4PK6 A;  3PTR B;  3RGL A;  1NAF A;  3C4X A;  2C5I T;  5JR9 A;  4MFR A;  3UQ7 A;  5AQT B;  1MNE A;  1S35 A;  2VB6 A;  2Y48 B;  2SPC A;  3NBX X;  2YK0 A;  3L3P A;  1M62 A;  2WS3 A;  3QC9 A;  2M6B A;  4UV8 B;  5LCY A;  2IW5 B;  1IBK T;  3LFM A;  2XQ8 A;  4NPP A;  4UEM A;  4ADZ A;  3KVA A;  4CN4 A;  4YSZ A;  3DP7 A;  3EAB A;  5LBM A;  1SA0 E;  4CI1 B;  1D1C A;  3A7M A;  1H7C A;  3ZYK A;  4QXB B;  3VU7 H;  2V1D B;  1MIV A;  3CK6 A;  3F31 A;  2IC6 A;  4EB6 E;  4HFC A;  2XJ7 A;  2DLR A;  4IL4 A;  4UF0 A;  2XY8 B;  3M3Z B;  4LF9 T;  4NXM T;  2KT9 A;  2J1D G;  3RX6 A;  4L0R A;  4TX5 A;  3TLS A;  2E9X C;  2RP4 A;  4EAH A;  4HWC A;  2LOS A;  5FKY A;  3RKG A;  4CN1 A;  3RIA A;  5JH7 E;  5M4Y A;  3ZT6 A;  3ANW A;  1UUR A;  4HWH A;  4C90 A;  4J2C A;  4QH5 A;  3RH3 A;  2ZM0 A;  3AEB A;  3BK9 A;  5AQJ B;  5LGN B;  1XMQ T;  4UR9 A;  2UXB T;  1HCI A;  1MIW A;  4TNV A;  1LVK A;  1B7T A;  4ZI2 D;  2E9X A;  4B3T T;  1HNZ T;  4YY3 T;  2EHO B;  2LKH A;  2ACZ A;  2XM1 A;  4I4T E;  3AVR A;  4TWF A;  2ZM6 T;  4YTN A;  4DR6 T;  2YDQ A;  1HS7 A;  3DTO A;  2YDS A;  3V5U A;  4ZEY A;  4HKA A;  3N9M A;  4GK5 E;  2HN2 A;  5LMN T;  3PUR A;  5LHG B;  1NEN A;  3OBV E;  4U2Z A;  4O4H E;  2X66 A;  2ODV A;  2B1E A;  2J4G A;  4FI5 A;  4MAL A;  2V7I A;  2XHE B;  5AQP B;  4V1A v;  3UFE A;  2BKP A;  2LLY A;  2WDV A;  2RPA A;  3FZH B;  4OX9 T;  2XPK A;  4IL9 A;  4PNI A;  4WBO A;  4JUY A;  5HXE A;  3H37 A;  2KMF A;  4TN7 B;  2BG9 E;  4IDZ A;  4H9R C;  2W4X A;  5LG3 A;  4DMV A;  2WB5 A;  4A5X A;  1OED B;  4JI4 T;  1WR0 A;  1L0V A;  3C64 A;  1XZY A;  3MK7 C;  2MPK A;  3BQI A;  4PW8 A;  4UEL A;  2V6Y B;  3NRX A;  4X5T A;  3VRA A;  2W67 A;  2BS3 A;  1WR6 A;  2KWH A;  2XAG B;  3UQ4 A;  3ZCI A;  1MND A;  2CLY B;  4TV9 E;  4Z91 A;  4YHJ A;  5KMG P;  4DR1 T;  2Q9Q D;  2W2U A;  2FJD A;  2NW7 A;  4YSY A;  4IDN A;  3RRW A;  2VUR A;  3P4W A;  4YHH T;  3N9O A;  1HF8 A;  2LHN A;  2N2N A;  5JDG A;  1FMW A;  2WU5 A;  4ZI7 E;  1KNR A;  3RYI E;  2BKO A;  4QH4 A;  5J2T E;  4IDO A;  4XZC A;  2B76 A;  2XAJ B;  3PUV F;  4Z8X A;  4H9N C;  2UXD T;  2WBL A;  4HWI B;  1X79 A;  2HH7 A;  2H7V C;  2X51 A;  4QWN B;  1T8B A;  2I59 A;  2VKH A;  5HXC A;  1XDP A;  3NVO A;  4ANJ A;  4YJ2 E;  5AQF B;  1FJG T;  2LJL A;  3ZPO A;  4HFI A;  2XQ4 A;  1D0Z A;  5JVD E;  5FY0 A;  1VOM A;  4B6X A;  1ZEE A;  5BR8 T;  3FBL A;  4IE6 A;  1VCT A;  3OYX A;  4O8S A;  4A97 A;  5F3J A;  1XNR T;  2L8K A;  2JPF A;  2LRK A;  2CXD A;  2VWA A;  3ZMZ B;  4DUZ T;  2EHO A;  2CLY C;  4HFD A;  2KSR A;  3TLW A;  4AIS A;  5ADX L;  2ODU A;  5HWY A;  5JDN A;  4DV2 T;  1N36 T;  4DV5 T;  1WLX A;  5FXX A;  4A56 A;  5L47 A;  4DV4 T;  2A9U A;  1WCR A;  4XBF B;  1D0Y A;  4JI1 T;  4YTP A;  3CVR A;  4WZX A;  5LHI B;  1ZKE A;  2PBI A;  3RC3 A;  3P4Q A;  3VKH A;  1MMD A;  3OJA A;  2BDE A;  4N78 D;  5LGT B;  1IZN B;  4TNW A;  3AA6 B;  1MMG A;  4HWD A;  5C2T A;  4AQF A;  3LK3 B;  5FXW A;  5FY1 A;  4IRE A;  4LF6 T;  1M7K A;  2BS2 A;  2IIU A;  4H63 V;  2X67 A;  3RPU A;  4H9Q C;  2NOX A;  2M67 A;  1QLB A;  4DVD A;  4DV7 T;  4KHP T;  3L8R A;  1OXZ A;  1E7P A;  4HFB A;  3A5X A;  1MMA A;  2UU9 T;  3PUQ A;  3PUS A;  3RIF A;  4KMC A;  2BG9 C;  4PAG A;  5FL0 A;  4JI2 T;  1VRB A;  3IHR A;  3PJA A;  3JAD A;  5J2U E;  1W0A A;  1HX8 A;  4U74 A;  4X64 T;  2D9D A;  4JI0 T;  2Q9Q C;  4JLE A;  1W9R A;  4TV8 E;  4CXW A;  1DU2 A;  3AAE B;  4K0K T;  4GKK T;  5AQM B;  3UUX B;  2BG9 A;  5L3G B;  2XQY A;  2X9X A;  2A3D A;  4ZZB A;  3AA0 B;  5JRC B;  4E7Z A;  5JRC A;  5HXH A;  5HEO A;  1IJ5 A;  2V5C A;  3RRC A;  2Q9Q A;  3QB5 A;  2XTL A;  2JRK A;  3OVU A;  4L9I A;  2CBI A;  2BKN A;  3H3M A;  5FYM A;  5EK2 A;  5LNK A;  3P4S A;  3PUW F;  4EYY R;  3MZK B;  4ZZC A;  2QRX A;  3CX8 B;  3HI2 A;  2HPL A;  3KBU A;  5AQS B;  1FIO A;  2N1G A;  4DV1 T;  4FJO A;  3FZF B;  4PFP A;  5F8P A;  4WBN E;  3MJX A;  4ZS3 A;  1XDO A;  4EV6 A;  4QKN A;  5LGU B;  4BJN A;  1D1B A;  3ESL A;  2CXL A;  4I55 E;  3EDU A;  5KDM C;  3OTO T;  2V7J A;  2V7M A;  5KXJ A;  2YOE A;  3RHW A;  3VKG A;  1YD8 G;  3G06 A;  3ETV A;  4IST A;  1J5E T;  1I94 T;  1X9B A;  2KWI B;  2X9Y A;  3FHN A;  3QNU A;  2DCF A;  3GMI A;  5ABH A;  3U3I A;  2GK9 A;  2ZMA A;  4KUM B;  3N9N A;  2YKS A;  4H9O C;  4LMJ A;  1KFY A;  2X0L B;  4DND A;  2J62 A;  3GN5 B;  5FMN A;  4QXC B;  4O2B E;  1XNQ T;  1IAP A;  5L4H A;  2WM9 A;  5HEU A;  4JI6 T;  2F4V T;  4DR5 T;  1T98 A;  1UCU A;  3EHZ A;  3UU8 A;  2X68 A;  5GON E;  2W0G A;  5AQO B;  3NZQ A;  2HPJ A;  4KHZ F;  2W61 A;  4PJL A;  3FXD B;  4AKR B;  4BJM A;  4LFC T;  1BR2 A;  1I6Z A;  4GK0 E;  3PUG A;  1UK5 A;  4LF8 T;  3AE5 A;  3SWH A;  5LJN A;  3AE3 A;  4HE8 A;  2KND A;  2H3R A;  3PJA J;  5L3E B;  2LOP A;  2Y8D A;  1HG2 A;  3EVY A;  3UU3 A;  2DWG A;  3JAE A;  3Q5X A;  4UVC B;  5C8Y E;  1UUS A;  4PJN A;  2M6I A;  2E5L T;  4B3M T;  2W62 A;  3HL6 A;  2XQ9 A;  4NUV A;  4ZOL E;  5CB4 E;  2UUC T;  1W09 A;  2NTX A;  3NKZ A;  5CA1 E;  5HEH A;  2X9H A;  3AXJ A;  3F57 A;  1T72 A;  4BAY B;  1G73 A;  2W66 A;  3MA9 A;  3PUZ F;  4ZI2 C;  3N2K E;  2Z6E A;  4UF0 B;  3SRZ A;  3P8C D;  2OA5 A;  4JYA T;  2CBJ A;  2OV9 A;  4JI8 T;  4HFV A;  5LB7 B;  2EHO D;  1ZV4 X;  4COF A;  5HXR A;  3SFD A;  4NIQ A;  2W63 A;  1ZP0 A;  3KV6 A;  2XZE A;  2WWV A;  4HWF A;  1XMO T;  2FUP A;  3KIN B;  5ETW A;  2L9Q A;  3Q2M A;  3KV4 A;  2XQ7 A;  4TWH A;  1FEW A;  4K0U A;  2OLT A;  3C4W A;  3AE6 A;  5HAX A;  3WAK A;  1US7 B;  2VK9 A;  3SOL A;  2UUB T;  3O1J A;  5AFU L;  3ZC1 A;  4IGU A;  2BVM A;  3GN5 A;  2Q9Q B;  2WSS V;  2MBG A;  2NR4 A;  3WAJ A;  2X0Y A;  1Y64 B;  4DR3 T;  4I43 B;  4EXT A;  4EZ4 A;  2CM0 A;  4JV5 T;  2JQQ A;  3PUY F;  1QUU A;  4L5G A;  1QSD A;  3ZEF B;  5BMV E;  5JR9 C;  4CXY A;  4X62 T;  3CIR A;  3CWZ B;  4Z90 A;  4EEB A;  1S94 A;  3UUL A;  3PU3 A;  2H89 A;  3FZL B;  5AQH B;  3ZT5 A;  3BQL A;  3V5S A;  2WMO A;  1JNZ A;  1UGO A;  3K3O A;  2P9B A;  3IBP A;  4ZHQ E;  1YXR A;  2KIN B;  2VKD A;  3MXZ A;  3B5M A;  1AJ3 A;  3VHL A;  5AQK B;  4P1N A;  3UFG A;  5AQU B;  3I0O A;  3KV5 A;  2FJB A;  4PK4 A;  2JIW A;  3Q5W A;  2C0S A;  1IBM T;  3UU6 A;  3VR8 A;  4QX8 B;  5JRE A;  3PV0 F;  1N33 T;  3KFW X;  2VQF T;  2XQ3 A;  3TKL B;  4AI6 A;  4X65 T;  5EZY E;  4YXD A;  4P0B A;  2LRL A;  3ONX A;  2I6H A;  4H9P C;  3KDS E;  4LF5 T;  4IIJ E;  1O3X A;  4IE0 A;  5DAB A;  2LSJ A;  3ETU A;  3P50 A;  4O2A E;  4DMW A;  4I0U A;  4JEU B;  4E7S A;  2XM2 A;  3E0Z A;  2QA7 A;  4ZI3 D;  5L4E A;  5EK4 A;  3AE2 A;  1YQ4 A;  3RLF F;  5ABF A;  4OYK A;  3AE4 A;  3LBX B;  2XAQ B;  3GA8 A;  5FXV A;  4F8H A;  1HNW T;  2ZM2 A;  3I0Q A;  1KK7 A;  5LP6 E;  3FZK B;  4GIW A;  4P09 A;  1CUN A;  3TLV A;  2FJE A;  2DHR A;  3NWI A;  4MHC A;  3ZKR A;  2VKJ A;  3O1H A;  4U72 A;  2CRB A;  5AQG B;  1KNP A;  2LM2 A;  4G2A A;  2VVS A;  5ABE A;  2QVA A;  2CHO A;  5CGM A;  1Y01 A;  3Q5E A;  2CPT A;  4O4J E;  2BBJ A;  4LMK A;  2VL8 A;  4QHO A;  2K3W A;  2JQH A;  2KZ7 B;  4ERR A;  4X1I E;  3RIU A;  3JAF A;  4CI3 B;  4LFB T;  4GOU A;  1SUM B;  3L09 A;  4X20 E;  2E9X D;  5DJQ C;  4ZS2 A;  2AXD S;  1OWA A;  4U31 A;  4WYV A;  1WRD A;  3FZM B;  3ONL C;  3ZT7 A;  3A8Y C;  3C50 A;  3ZST A;  2Y6X A;  5LYJ E;  2LSG A;  3CX6 B;  2UUA T;  2LHR A;  3DJB A;  1E1H B;  4PFO A;  3HR0 A;  2CEA A;  5HWX A;  4AKG A;  2YU2 A;  4PJM A;  4HN9 A;  3RIU C;  1HNX T;  3PDY A;  3JCF A;  1E2A A;  3D0T A;  4ILB A;  4CZZ B;  2WU2 A;  1NEK A;  3ZLI A;  1CHU A;  4DUY T;  2PFV A;  1HG5 A;  2MYS A;  4X1K E;  2NW9 A;  2WAU A;  3ZMU B;  2K24 A;  4DBQ A;  2VKO A;  4AQY T;  1IBL T;  1N32 T;  3CQC B;  4UIG A;  4O4I E;  3GWH A;  3M65 A;  2LSK A;  4G63 A;  2D0U A;  4XAX B;  5LOV E;  1WFD A;  1BR0 A;  3ZJ2 A;  3RC8 A;  5HYA A;  2IC9 A;  4IDP A;  2K48 A;  3K3Q C;  2V6X A;  5IUX A;  2LEH A;  4TZ4 C;  3UUM A;  5CA0 E;  3N9L A;  2UXN B;  5L2L A;  2JJ9 A;  2ACX A;  4DV0 T;  5H6R B;  1SE7 A;  2ZLY A;  5LA6 E;  2X0H A;  2V7L A;  2FJA A;  3K1S A;  2XSB A;  3K3N A;  3QK6 A;  5AQN B;  4EGW A;  4CI2 B;  5JR9 B;  4A98 A;  1D1A A;  3LSV A;  1YQ3 A;  2R6G F;  1Z0P A;  4ILA A;  3ZMV B;  3MAC A;  3VRB A;  3N9Q A;  3ZN0 B;  3HKD E;  5L3B B;  2WDR A;  2CCQ A;  5HCJ A;  1ZOY A;  4HFE A;  4KP3 C;  3HKB E;  4U2Y A;  5F5W A;  2PG8 A;  3I9Y A;  3ZMS B;  4X66 T;  4DV6 T;  3AA1 B;  4ISS A;  3RF1 A;  3ANW B;  5FNV E;  2XAH B;  5A1L A;  3ONJ A;  4O4L E;  4BA9 A;  2IDO B;  2MAW A;  3AXJ B;  2IHR 1;  2EHO C; 
#chains in the Genus database with same CATH homology
 2V6Y B;  5CGM A;  2CPT A;  1WFD A;  4CN4 A;  4ZEY A;  2JQK A;  2K3W A;  2V6Y A;  2JQH A;  3EAB A;  4IT4 A;  2V6X A;  5FVL A;  2LRL A;  2W2U A;  2LRK A;  4U2Z A;  4U31 A;  5FVK A;  3K1S A;  3ZT7 A;  3ZST A;  4U3C A;  4CN6 A;  4CN1 A;  5CJ5 A;  2RPA A;  4U7Y A;  2A9U A;  3ZT6 A;  2JQ9 A;  1WCR A;  4U7I A;  3ZT5 A;  3ZSS A;  4U2Y A;  4U33 A;  4WZX A;  2DL1 A;  1YXR A;  5LB7 B;  2WY2 A;  4P1N A;  4NIQ A;  4A5X A;  1WR0 A;  2XZE A;  2WWV A;  2CRB A;  2MPK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...