1YYHA

Crystal structure of the human notch 1 ankyrin domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the human Notch 1 ankyrin domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle,transcription
molecule keywords Notch 1, ankyrin domain
total genus 68
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1yyhA00
1N11A 2DZNA 4BETA 4BSZB 2DZOA 4OAVB 5AAOA 4TUMA 3V2XA 1G3NB 1N0RA 5CECB 4DX5D 1DCQA 3KEAA 2BKKB 5EYLA 4HNAD 2V4HC 3TWSA 5AARA 2RFAA 5KNHD 3LJNA 4K5BA 2ZGDA 3V30A 3B7BA 4O1OA 4Z68A 2BKGA 2DVWA 3Q9UC 1K3ZD 4K5CA 4U8VD 4HB5A 4YDWA 3F6QA 5AQ7A 5AQAA 1N0QA 2JABA 3ZNGA 1OY3D 4HRMB 3UTMA 2P2CP 2NYJA 4HRLA 1BLXB 3DEOA 2HE0A 4U8YD 3HG0D 5ENPD 5CBNA 4G8LA 1K1BA 1BD8A 2F8XK 2XZTG 3NOGD 5KNGA 4GMRA 3JXIA 1SVXA 3TWTA 3NBNB 2Y0BG 2PNNA 1AP7A 4YDYA 2F8YA 2MYOA 2QC9A 4NIKA 3EHRA 5HRYA 4ZFHA 1BU9A 4DRXE 5AQ9A 4ATZD 5CEAA 4J8YA 5EYPF 1S70B 4CYMD 4HRNA 3V2OA 3TWXA 4O60A 3ZU7B 2ETAA 1TR4A 2ETBA 4B93B 4HI8A 3TWQA 2XZDG 1QYMA 2A5EA 5FINA 3HRAA 1IKND 4CZ2D 5JMND 1MX2A 2QYJA 1DC2A 2V5QC 4LNUD 4ZHBA 4DUIA 5HKPA 5KBAA 2AJAA 3IXEA 5FIOA 3SO8A 1YMPA 3DEPA 2ZGGA 5EIDA 4HBDA 4DX2A 3TWRA 1K1AA 2VGEA 5JA4D 3V31A 5CBOA 1UOHA 4JB8P 5KWDA 3Q9NC 2F37A 2KXPC 1AWCB 2FO1E 1WDYA 3AJIA 1OT8A 4HI9A 1MX6A 4HQDA 3C5RA 5ENRD 2RFMA 4GPMA 3UI2A 5ENSD 2L6BA 1YYHA 4RLYA 2XEHA 4O1PA 4QFVA 4U96D 4QQIA 1MX4A 4DX6D 1SW6A 3ZKJA 5HS0A 1MJ0A 5ITZF 1YCSB 2XEEA 3W9GA 4C48B 3J5PA 3D9HA 3EHQA 4LSZE 4BESA 1IHBA 4OAUC 2XENA 3TWWA 1A5EA 1D9SA 3TWVA 5ENTD 2Y1LE 3ZUVB 3V79K 4A63B 4U95D 5D66A 5AN8A 4UUCA 1IXVA 5BXUA 5EN5D 5AQBA 5BXOA 1BI8B 2KBXA 1MYOA 4K5AB 4BEPA 5CEDB 5CERB 1NFIE 3AAAC 4HLLA 4J7WA 4LG6A 4N5QA 3NOCD 4DX7D 3T8KA 4F1PA 3JUEA 2B0OE 1BI7B 2DWZA 1WG0A 3UXGA 3JXJA 5EIBE 3W9FA 2ETCA 3EU9A 4DX1A 4G8KA 5EILA 3B95A 3TWUA 3J5QB 5ENOD 4BERA 4F6RD 5ENQD 2J8SD 3T9KA
chains in the Genus database with same CATH superfamily
4B89A 3SQVA 2DZOA 4N3BA 2EIME 2XPIA 4IN3B 3ASFA 5LX8A 3EJNA 5KNHD 3RIBA 3B7RL 2YQ8A 4Q69A 3CK9A 1JWGA 2WM9A 2J49A 3NF1A 3UM0A 3LPZA 5G05C 5M72A 3TWQA 3QAQA 2CFZA 2QYJA 3U4TA 1O5MA 4BSXA 2FEZA 3Q78A 4C9BB 2IQCA 3KSQA 3PZ2A 1O1RA 2WXPA 3PVLA 2DYRE 3HXFA 1HH8A 4G11A 3U3WA 4GCOA 4O1PA 3NB2A 2XRYA 4BT9A 4GZ5A 5HS0A 3TJPA 3W9GA 1INZA 3ZIMA 3ZXSA 5JJ6A 1A5EA 3PUJA 4GYWA 4JD2G 1UJJA 5BPPA 2P9LG 1H6KA 4FU3A 2X6HA 5CEDB 3LVQE 2CHWA 4KVMA 4EZJA 1BI7B 4HOUA 2I1JA 4YNDA 5ENOD 1MZCA 3UIOC 2M63A 4FADA 3CHRA 3LJ3A 2VTBB 1LD8A 2DCPA 1DVPA 3HXCA 3TWSA 4WWPA 3NAWA 2R2LA 3UPVA 4MS6A 4XI9A 4O1OA 1HZ4A 5FZSA 1ELRA 3HVEA 3CHQA 2P2CP 3PNLB 3D9KA 5DBKA 1BD8A 3E34A 5BT1A 3JXIA 1SVXA 3NBNB 3D9LA 1PY1A 4FJYA 3RRUA 2XEVA 3TWXA 4HI8A 1IKND 3RRMB 3MJWA 4G25A 1JCSA 3VTXA 4UWLA 4DUIA 3RKVA 3FULA 1D8EA 2L0TB 4FP7A 2ZISA 2VGEA 1H0AA 5EX3A 2ZXWE 3G2WA 3RJVA 5B3SE 3ZPJA 2H6GA 2VSNA 2FF4A 4UWHA 3DSUA 4PS7A 1IHGA 1NZNA 2Q7FA 2WXOA 3EHMA 3SGHA 2WXHA 1Z6TA 3QC1A 4U0SA 3G2TA 4BESA 5FWQA 1D9SA 4GZ6A 5AN8A 2X3MA 3SF4A 5AJDA 3FUMA 4WWNA 3KEZA 1H19A 2WXNA 4UI9K 4ANVA 3TWUA 5KJLA 3FEYA 1NP7A 3ML8A 1KPSB 1SA4A 3ASHA 4TUMA 1KZOA 1JCQA 5A23A 1ZB1A 2C0MA 1OCRE 1SZ9A 2ZGDA 4ILIA 2LNIA 4G2VA 4A1SA 3D9OA 5ENPD 5AIJA 3L54A 2ILRA 5E76A 4G23A 3O48A 3K9IA 3ULYA 2AVPA 2BUGA 4HLEA 2IOLA 5DIZA 4FA6A 3FTWA 2XPZA 5T3RA 4G1TA 4E6HA 1V55E 1LF8A 2F37A 3AJIA 2A5UA 3UM1A 3PUKA 4J8FA 4UQZA 3CLJA 4ABNA 4U96D 5D0OD 2ZU6B 2KZTB 3HYMB 2WQHA 1MJ0A 4FHJA 3IEGA 3J5PA 2FULA 3FU6A 2EILE 1YA0A 2WXLA 3PZDA 1UG3A 1IXVA 4NACA 4JW1A 1ELKA 2NXPA 2L6JA 3T8KA 4RSYA 4F3VA 2AXZA 4CT0A 4BERA 2I6HA 1TN6A 4DI4A 4F53A 3SNXA 4JEHA 3FUNA 3DXKG 2BKKB 5EYLA 5AARA 3WXXA 1E8ZA 3ABLE 1XGWA 3Q9UC 4K5CA 3AU5A 5AJLA 4XIFA 3LY9A 1OY3D 4KYOB 4I9CA 1XNFA 5CBNA 4KZCA 1K1BA 3D3MA 2WQ6A 2Y0BG 3QWWA 2VGXA 2H6HA 3EHRA 4AY5A 3CHOA 5KJKA 3VTYA 2PM7A 4HRNA 1HO8A 4HFGA 2XGSA 3FTVA 4EZLA 4L7TA 2VYIA 3E37A 1UN8A 5JMND 4I1MA 4LNUD 4ZHBA 4IRUA 3APCA 3SO8A 5FTPA 2R5SA 5HQ8A 3HHMA 2KXPC 3MX3A 1DCEA 1WDYA 2I2OA 1YYHA 2XEHA 4Y6CA 3DSSA 3DSWA 3FTXA 3ZGQA 5ITZF 4XEIG 3D9HA 1NI1A 1SQMA 3AS4A 4L1BA 3QDNA 2V8SE 3ZYLA 3CK7A 4AOFA 1LTXA 3ZYKA 3BQOA 4ILGA 3FU3A 3URZA 3ZXPA 5EIBE 3OXGA 2IO3C 3DXMG 3MYVA 3LKUA 3ULQA 3C98A 5FZRA 2QFCA 1TNOA 4HOSA 4I6JA 3S7JA 3QKYA 3APFA 3IV0A 2EIKE 5ENNA 2L0IA 2RFAA 1TJCA 3DRAA 3FWVA 4OVVA 3ONLA 2UY1A 3ABKE 3L82A 5T4YA 4U63A 5FQ7A 2AXVA 3PE3A 4LNGA 4U8YD 4G8LA 2XRZA 1OWMA 1NL4A 4FLHA 4GMRA 3TWTA 4NIKA 5HRYA 2WQ7A 3ZRHA 4TXPA 5JJTA 2WMNA 2ETAA 3SD5A 3ASOE 2XCBA 2V5QC 2CFUA 2IJGX 4Q94A 4C0MA 1HX8A 3DWLG 3MA5A 2RFMA 3NQPA 2GROB 3SI5A 1MX4A 1H2TC 2XEEA 5CCLA 2BF0X 2IEJA 1Z3XA 1N54A 1EDUA 2XENA 3ZUVB 4A63B 2H6IA 3AG3E 2WXJA 5AQBA 3EHNA 3JUEA 2R17C 3UXGA 2P9UG 2VSXE 4I9EA 1RZ4A 2VSYA 4AIFA 4JA7A 4ANXA 3G2VA 2QZAA 2IU1A 1E8WA 4DX5D 5JHAA 2C0LA 4A3TA 1N94A 1PC2A 2CG2A 4P29A 2Y3AA 4GCNA 4M3OA 4GA1A 5G04J 4U8VD 2DYSE 4Y6WA 4CDMA 3JQ1A 2P9KG 3CKBA 4A55A 2XGMA 3NOGD 4GA2A 4GTVA 3UT8A 3IKOB 4JL0A 1TEZA 5CEAA 3RO3A 4NURA 4BSZB 3FUEA 4U07A 3NZUA 4I2ZA 1S63A 2DIWA 2LAHA 5FQ6A 3B7TA 4WUYA 3PH0C 4LERA 1H2VC 4PS3A 4AV7A 4JC8A 3VLFA 3E32A 4O6FA 3GZ2A 1IYGA 4HI9A 5KCMA 3CHPA 3QJZA 4GPMA 4R7LA 3T5XA 2WXFA 3D9IA 5B1BE 4RQIA 3D9PA 2LUHA 2RG8A 4DX6D 2CHXA 4DI3A 3ESKA 2XGOA 3MKQB 1E8YA 3TG4A 2WPVA 4UUCA 4ATGA 3OAWA 3PEVB 2YINA 2XHEA 1TN8A 2AWIA 4HLLA 1KZPA 3JQ0A 4URKA 5EILA 4N2SA 2I9CA 2R03A 1N95A 4GTSA 2E2EA 2WB2A 2C2LA 3APDA 3V2XA 4H7YA 1G3NB 1U3DA 2R05A 3EIQC 1FPPA 4I1AA 5JHBA 2V4LA 3LJNA 4K5BA 1K3ZD 3CVUA 2JABA 4HRMB 4KMOA 2NYJA 2LO6A 3LEWA 3EUVA 2J09A 2LSVA 1U3CA 1OCOE 2HYZA 1JPLA 1OWPA 2PM6A 3V2OA 3PZ3A 1BPOA 2WXRA 3FTYA 5BUZA 3ZYMA 3CVVA 5KBAA 3TGOA 1K1AA 1UOHA 1GW6A 4GTRA 1X81A 4HQDA 4IULA 3Q47B 4GMLA 4EPZA 3CVXA 2L6BA 4RLYA 3FP3A 3CQCB 3ML9A 4GU5A 2P9SG 4G24A 3RU0A 5D2MC 3SFYA 5EX0A 3TWVA 1JUQA 3C72A 2X6KA 4ILHB 4XZ4A 1SA5A 4DLOA 2GRNB 3FTSA 4N5QA 2CG3A 4YDEA 3T5VA 2OEVA 4J8EA 2JEKA 2J8SD 2EINE 2DZNA 4I17A 2XQ0A 3Q4AB 3HXEA 5CECB 2CHZA 3GW4A 4BWRA 1O1SA 3Q75A 3FH5A 5AQAA 4YDWA 1TNZA 1HFAA 3FEXA 3CEQA 3SBSA 1V54E 2PNNA 5ARFA 3KSLA 3AS5A 3FTZA 3OXFA 4FLBA 3PE4A 5FINA 4CZ2D 2RKKA 2X38A 1TN7A 5HKPA 3UKUG 2VGYA 1YMPA 1UN9A 2XCCA 4U8HA 3TWRA 4A1GA 5LCWJ 4E85A 3CKCA 5IY5E 4AEZC 4CEMA 4DK5A 3SY2A 4FJZA 3FH7A 3QNKA 3RAUA 1K8KG 4L9PA 3ONKA 1QQEA 3OTNA 2V0PA 3FDHA 1X5BA 1E8XA 3JCKC 3L13A 5FQ4A 4GA0A 4GYYA 1MYOA 4BEPA 2JLBA 5CERB 1HS6A 5CCMA 2VGXB 4DX7D 3DSTA 4F1PA 5G04C 3JXJA 4HORA 1QZ2A 4MBGA 4MRUA 4GMJA 4NRHB 4XE0A 4J8SA 3C3OA 5LOZA 3MZLB 2V4HC 2EIJE 3V30A 2BKGA 3VLEA 3SFZA 3HXBA 1N0QA 3E33A 4B94A 4I43A 3LCAA 3FFLA 4V3IA 1AP7A 1L5JA 2QC9A 4U0UA 4CYMD 4M7CA 4O60A 4WNFA 3TXMA 4FULA 5HI7A 4EQFA 3HRAA 4GTPA 1DC2A 3DPYA 4F7AA 3CIAA 1OWLA 2F0YA 3D9JA 5EIDA 3B7SA 1FT1A 4BTBA 3Q9NC 2XS1A 3CK8A 3LXUX 4H7XA 4QFVA 4J8DA 1YCSB 4GYOA 4LSZE 4TXQA 3LY8A 4I6EA 1IHBA 3DSXA 1WM5A 5FZQA 2P9PG 3Q73A 5EN5D 1OWOA 2V5FA 5J90A 4LG6A 3NOCD 1KT0A 2QY7A 4W9RA 3EU9A 3ISMC 4EHMA 2WXIA 4AP2A 5ENQD 4AVXA 4MKTA 2PQRA 4JXTA 4WWOA 2J4DA 5D0QD 1FVHA 3BG1B 1DCQA 1FT2A 2KCLA 2Y4UA 3CVYA 3I3NA 3VLDA 2J07A 1JCRA 3S7FA 1H6PA 3DEOA 2J4BA 3ULEG 2VSOE 1U2VG 2B6CA 1Z3YA 5B1AE 2GW1A 1E7UA 3Q15A 4GTQA 1TR4A 3L08A 2XZDG 2R02A 3CHMA 4D10C 2P9IG 5LCWC 3OXLA 4WAFA 4GTOA 2GRQB 4N39A 4DX2A 2ONDA 2WXGA 3ZHEA 3C5RA 4DJAA 2HO1A 4JZYA 2KC7A 3MV3B 4XKBA 1HXIA 3Q7AA 4BX9A 3G2UA 4PH4B 1S0PA 4ME2A 1EPUA 3QB2A 3DBSA 2IY0C 1N4QA 3PREA 2Y1LE 1MQSA 3FHEA 4N2QA 3FUFA 3AAAC 2IFUA 1A17A 3FUIA 4L2YA 3UQ3A 2PL2A 4G26A 2OCCE 3FUJA 1HE8A 4I6GA 1EF1C 3E30A 1N4RA 1N0RA 3R9MA 3EDTB 3FU0A 3AU4A 4FHKA 5LFAA 3ABME 3NZSA 3B13A 2VTBA 4GZ3A 1TJFA 5AQ7A 4HB5A 3ZFWA 4HS2A 1HG5A 3TG5A 2XPYA 3HG0D 4YVQC 2XZTG 4JHJA 3FU5A 2VJ8A 4B8AA 4DRXE 4J8YA 3QWVA 2Y69E 3ZU7B 3ENEA 2OOEA 4WNDA 3U66A 2AJAA 1MHQA 3DEPA 3PEUB 3UX4A 3AG1E 2OV8A 4YVOA 5ARGA 3V31A 3HIZA 1TNUA 3HDXA 3ASNE 1TNBA 3KAEA 4HXIA 3ZVVA 5C2YA 3MCXA 4C48B 2GRPB 4XKCA 3UM2A 2AXUA 3UMVA 4WNGA 3CQGB 2FI7A 1IQRA 4YDOA 4CGWA 3UUXA 1N52A 4CRWA 2DWZA 1WG0A 3L16A 4JHKA 5CMWA 2GRLA 3RRNB 5J08A 3D9NA 4ANUA 5CMYA 2UY1B 4UWKA 3FY4A 3MEKA 4AY6A 2WVIA 2FBNA 4HNAD 3U9WA 2OVFA 2HM8A 3S7BA 4Q96A 2LXLA 1FCHA 1QBQA 1S64A 1N4PA 1OCZE 2OEWA 4K03A 3KS2A 2NC9A 4LCTA 4GTMA 5CRVA 1HG2A 1WY6A 4RVBA 3CR3A 1AWCB 2AW6A 4KXKB 1OT8A 3CVNA 3DSVA 3CVPA 3GZ1A 3IHVA 3PZ1A 5C1DA 1UW4B 4CT4A 3UI2A 1Y6IA 3ASDA 3EIJA 4BTAA 4UWGA 2KCKA 1N4SA 3Q79A 4LNBA 2DBAA 3Q49B 3ZHEB 5BNWA 2J9QA 5CRUA 1OCCE 3T8MA 1Z5SC 3CV0A 3TWWA 4GZDA 3R9AB 3UT7A 5D66A 4PUCA 5BXOA 3EU5A 1Y8MA 4UWFA 1TNYA 5E75A 3QWPA 3CVWA 2X6JA 3I4GA 4GAAA 3L22A 3W9FA 2ETCA 4DX1A 3B95A 4X8QA 3CVQA 4PS8A 2IONA 5FQ8A 4LEUA 4TXRA 2E0IA 4GPKA 4ACLA 2WMOA 5BW8C 4DPRA 2DVWA 3ZW3A 3UTMA 1BLXB 2GRMA 5AENA 2IOSA 2F8XK 3BEEA 4I1OB 4AM9A 4BFRA 3SZ7A 3CGHA 3FUKA 3PRZA 2RD0A 3MKQA 3BUAA 1QYMA 5LP0A 1MX2A 4UQYA 5G05J 4KVOA 3IXEA 5FIOA 3CSTA 3E4BA 1NA0A 1RW2A 2YNQA 4IYPA 3QOUA 4AJWA 4L23A 4KBQA 3DPDA 2KATA 3PNTB 5ENSD 2WXQA 3L9TA 2VQ2A 4APFA 4QQIA 5BV0A 1SW6A 3ZKJA 3S7DA 4N3CA 4RG6A 4JHRA 3FUHA 3AG2E 1ELWA 3V79K 1PAQA 2XS8A 4EBAA 5G55A 3X2QE 4APOA 4J7WA 5KJMA 1E96B 3AG4E 3MV2B 4JVSA 1HF8A 1ZU2A 4N3AA 4G8KA 3SHFA 4EZKA 1N11A 1SZAA 3QK0A 4RG9A 3FUDA 4CCAA 5AAOA 2QYUA 1O1TA 4XX5A 1EYHA 3PZ4A 1FVFA 2YHEA 4J6IA 1QNFA 2P58C 4JA9A 3ZNGA 4GZCA 4HRLA 4DLQA 2UWJG 4BX8A 2F8YA 1BU9A 1HU3A 4EECA 4ATZD 1S70B 2ETBA 5T8IA 3CVLA 5CHEE 4MLPA 1TYQG 4OYSA 3ZN3A 2WXMA 3P1UA 3U64A 2GRRB 5JJ7A 4HVBA 4HBDA 4KT6B 5JA4D 5KWDA 2L9BA 2KZTA 3CHSA 4L2LA 1OUVA 3HVEB 3WG7E 3IBEA 5EDSA 3Q5MA 1OWNA 3LYAA 4U7EB 1ZBPA 4F1SA 3D9MA 3UIPC 4A3VA 1JWFA 4EBAG 3JUIA 4WNEA 5ENTD 3BU8A 3G2SA 5ANRA 1KLXA 2NSZA 3UT4A 5BXUA 3KD7A 4U04A 1IQUA 3LDZA 3SFXA 4AXHA 5BV1A 4CDRA 3R7RA 2PZIA 3LS8A 3B7UX 4BETA 3GYZA 4K0RA 4LRZA 4OAVB 4J0UA 3KEAA 1E7VA 4HOTA 5A7DB 3B7BA 4Z68A 1Q2ZA 2WXKA 3ESLA 2R59A 2Y4TA 2HE0A 4LUNU 3SBTB 3N71A 1W3BA 3AS8A 4YDYA 4CGVA 4ZFHA 2HR2A 3RSEG 3CSFA 4B93B 4B8CB 5ANLA 1WAO1 1D8DA 5AYWD 3QARA 4I2WA 3UM3A 1LD7A 2P9NG 2LAIA 4C0EA 3FH8A 5A6CA 5ENRD 3I5PA 2MRIA 2EQXA 3HXDA 1NA3A 5KJNA 3GZSA 2IO2C 5G2NA 1B89A 2X6FA 2OVBA 1P5QA 2IF4A 4UI9J 4OAUC 3TXNA 4NQ0A 4U95D 1DNPA 4OVUA 4ANWA 1BI8B 2KBXA 4TV3A 3S2AA 1NFIE 2YHCA 1VDYA 1KT1A 2B0OE 2PQNA 3ASGA 2KCVA 1UJKA 3J5QB 5FT9A 4CDNA 3L17A 4UI9C 4BY6A 2BEDA 5H7PA 4U0ZA 1OXJA 3MGBA 3PDNA 2LXMA 3O4ZA 3FTUA 3UINC 4BT8A 4XI0A 3F6QA 3IHYA 5FJYA 3LVRE 2A4ZA 5KNGA 2ZIRA 2MYOA 4N5CA 2GGFA 3LY7A 5AQ9A 5EYPF 5EKQD 3UKRG 4UQXA 3Q7FA 3RK6A 3L6AA 1N9AA 2A5EA 3ZYQA 4JPSA 2X6IA 4FC8A 4GB9A 3P2BA 2ZGGA 3BG0B 4TRQA 3ZEFA 4ACKA 5CBOA 4HOQA 4JB8P 2I1KA 3C3QA 3JYSA 3TAXA 2FO1E 3TL5A 1MX6A 1H2UA 3I4RB 3MKRA 2FO7A 4GTTA 3PS6A 3RO2A 4PDXA 1H6OA 2KM4A 2J08A 2MOWA 4B0ZA 3EHQA 2H6FA 3C3RA 4JEUA 4TUUA 2BTDA 1E90A 4K5AB 4KZ0A 2MHKA 2LSUA 3R7QA 4F6RD 3T9KA
chains in the Genus database with same CATH topology
1N11A 2DZNA 4BETA 4BSZB 2DZOA 4OAVB 5AAOA 4TUMA 3V2XA 1G3NB 1N0RA 5CECB 4DX5D 1DCQA 3KEAA 2BKKB 5EYLA 4HNAD 2V4HC 3TWSA 5AARA 2RFAA 5KNHD 3LJNA 4K5BA 2ZGDA 3V30A 3B7BA 4O1OA 4Z68A 2BKGA 2DVWA 3Q9UC 1K3ZD 4K5CA 4U8VD 4HB5A 4YDWA 3F6QA 5AQ7A 5AQAA 1N0QA 2JABA 3ZNGA 1OY3D 4HRMB 3UTMA 2P2CP 2NYJA 4HRLA 1BLXB 3DEOA 2HE0A 4U8YD 3HG0D 5ENPD 5CBNA 4G8LA 1K1BA 1BD8A 2F8XK 2XZTG 3NOGD 5KNGA 4GMRA 3JXIA 1SVXA 3TWTA 3NBNB 2Y0BG 2PNNA 1AP7A 4YDYA 2F8YA 2MYOA 2QC9A 4NIKA 3EHRA 5HRYA 4ZFHA 1BU9A 4DRXE 5AQ9A 4ATZD 5CEAA 4J8YA 5EYPF 1S70B 4CYMD 4HRNA 3V2OA 3TWXA 4O60A 3ZU7B 2ETAA 1TR4A 2ETBA 4B93B 4HI8A 3TWQA 2XZDG 1QYMA 2A5EA 5FINA 3HRAA 1IKND 4CZ2D 5JMND 1MX2A 2QYJA 1DC2A 2V5QC 4LNUD 4ZHBA 4DUIA 5HKPA 5KBAA 2AJAA 3IXEA 5FIOA 3SO8A 1YMPA 3DEPA 2ZGGA 5EIDA 4HBDA 4DX2A 3TWRA 1K1AA 2VGEA 5JA4D 3V31A 5CBOA 1UOHA 4JB8P 5KWDA 3Q9NC 2F37A 2KXPC 1AWCB 2FO1E 1WDYA 3AJIA 1OT8A 4HI9A 1MX6A 4HQDA 3C5RA 5ENRD 2RFMA 4GPMA 3UI2A 5ENSD 2L6BA 1YYHA 4RLYA 2XEHA 4O1PA 4QFVA 4U96D 4QQIA 1MX4A 4DX6D 1SW6A 3ZKJA 5HS0A 1MJ0A 5ITZF 1YCSB 2XEEA 3W9GA 4C48B 3J5PA 3D9HA 3EHQA 4LSZE 4BESA 1IHBA 4OAUC 2XENA 3TWWA 1A5EA 1D9SA 3TWVA 5ENTD 2Y1LE 3ZUVB 3V79K 4A63B 4U95D 5D66A 5AN8A 4UUCA 1IXVA 5BXUA 5EN5D 5AQBA 5BXOA 1BI8B 2KBXA 1MYOA 4K5AB 4BEPA 5CEDB 5CERB 1NFIE 3AAAC 4HLLA 4J7WA 4LG6A 4N5QA 3NOCD 4DX7D 3T8KA 4F1PA 3JUEA 2B0OE 1BI7B 2DWZA 1WG0A 3UXGA 3JXJA 5EIBE 3W9FA 2ETCA 3EU9A 4DX1A 4G8KA 5EILA 3B95A 3TWUA 3J5QB 5ENOD 4BERA 4F6RD 5ENQD 2J8SD 3T9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N11 A;  2DZN A;  4BET A;  4BSZ B;  2DZO A;  4OAV B;  5AAO A;  4TUM A;  3V2X A;  1G3N B;  1N0R A;  5CEC B;  4DX5 D;  1DCQ A;  3KEA A;  2BKK B;  5EYL A;  4HNA D;  2V4H C;  3TWS A;  5AAR A;  2RFA A;  5KNH D;  3LJN A;  4K5B A;  2ZGD A;  3V30 A;  3B7B A;  4O1O A;  4Z68 A;  2BKG A;  2DVW A;  3Q9U C;  1K3Z D;  4K5C A;  4U8V D;  4HB5 A;  4YDW A;  3F6Q A;  5AQ7 A;  5AQA A;  1N0Q A;  2JAB A;  3ZNG A;  1OY3 D;  4HRM B;  3UTM A;  2P2C P;  2NYJ A;  4HRL A;  1BLX B;  3DEO A;  2HE0 A;  4U8Y D;  3HG0 D;  5ENP D;  5CBN A;  4G8L A;  1K1B A;  1BD8 A;  2F8X K;  2XZT G;  3NOG D;  5KNG A;  4GMR A;  3JXI A;  1SVX A;  3TWT A;  3NBN B;  2Y0B G;  2PNN A;  1AP7 A;  4YDY A;  2F8Y A;  2MYO A;  2QC9 A;  4NIK A;  3EHR A;  5HRY A;  4ZFH A;  1BU9 A;  4DRX E;  5AQ9 A;  4ATZ D;  5CEA A;  4J8Y A;  5EYP F;  1S70 B;  4CYM D;  4HRN A;  3V2O A;  3TWX A;  4O60 A;  3ZU7 B;  2ETA A;  1TR4 A;  2ETB A;  4B93 B;  4HI8 A;  3TWQ A;  2XZD G;  1QYM A;  2A5E A;  5FIN A;  3HRA A;  1IKN D;  4CZ2 D;  5JMN D;  1MX2 A;  2QYJ A;  1DC2 A;  2V5Q C;  4LNU D;  4ZHB A;  4DUI A;  5HKP A;  5KBA A;  2AJA A;  3IXE A;  5FIO A;  3SO8 A;  1YMP A;  3DEP A;  2ZGG A;  5EID A;  4HBD A;  4DX2 A;  3TWR A;  1K1A A;  2VGE A;  5JA4 D;  3V31 A;  5CBO A;  1UOH A;  4JB8 P;  5KWD A;  3Q9N C;  2F37 A;  2KXP C;  1AWC B;  2FO1 E;  1WDY A;  3AJI A;  1OT8 A;  4HI9 A;  1MX6 A;  4HQD A;  3C5R A;  5ENR D;  2RFM A;  4GPM A;  3UI2 A;  5ENS D;  2L6B A;  1YYH A;  4RLY A;  2XEH A;  4O1P A;  4QFV A;  4U96 D;  4QQI A;  1MX4 A;  4DX6 D;  1SW6 A;  3ZKJ A;  5HS0 A;  1MJ0 A;  5ITZ F;  1YCS B;  2XEE A;  3W9G A;  4C48 B;  3J5P A;  3D9H A;  3EHQ A;  4LSZ E;  4BES A;  1IHB A;  4OAU C;  2XEN A;  3TWW A;  1A5E A;  1D9S A;  3TWV A;  5ENT D;  2Y1L E;  3ZUV B;  3V79 K;  4A63 B;  4U95 D;  5D66 A;  5AN8 A;  4UUC A;  1IXV A;  5BXU A;  5EN5 D;  5AQB A;  5BXO A;  1BI8 B;  2KBX A;  1MYO A;  4K5A B;  4BEP A;  5CED B;  5CER B;  1NFI E;  3AAA C;  4HLL A;  4J7W A;  4LG6 A;  4N5Q A;  3NOC D;  4DX7 D;  3T8K A;  4F1P A;  3JUE A;  2B0O E;  1BI7 B;  2DWZ A;  1WG0 A;  3UXG A;  3JXJ A;  5EIB E;  3W9F A;  2ETC A;  3EU9 A;  4DX1 A;  4G8K A;  5EIL A;  3B95 A;  3TWU A;  3J5Q B;  5ENO D;  4BER A;  4F6R D;  5ENQ D;  2J8S D;  3T9K A; 
#chains in the Genus database with same CATH topology
 4B89 A;  3SQV A;  2DZO A;  4N3B A;  2EIM E;  2XPI A;  4IN3 B;  3ASF A;  5LX8 A;  3EJN A;  5KNH D;  3RIB A;  3B7R L;  2YQ8 A;  4Q69 A;  3CK9 A;  1JWG A;  2WM9 A;  2J49 A;  3NF1 A;  3UM0 A;  3LPZ A;  5G05 C;  5M72 A;  3TWQ A;  3QAQ A;  2CFZ A;  2QYJ A;  3U4T A;  1O5M A;  4BSX A;  2FEZ A;  3Q78 A;  4C9B B;  2IQC A;  3KSQ A;  3PZ2 A;  1O1R A;  2WXP A;  3PVL A;  2DYR E;  3HXF A;  1HH8 A;  4G11 A;  3U3W A;  4GCO A;  4O1P A;  3NB2 A;  2XRY A;  4BT9 A;  4GZ5 A;  5HS0 A;  3TJP A;  3W9G A;  1INZ A;  3ZIM A;  3ZXS A;  5JJ6 A;  1A5E A;  3PUJ A;  4GYW A;  4JD2 G;  1UJJ A;  5BPP A;  2P9L G;  1H6K A;  4FU3 A;  2X6H A;  5CED B;  3LVQ E;  2CHW A;  4KVM A;  4EZJ A;  1BI7 B;  4HOU A;  2I1J A;  4YND A;  5ENO D;  1MZC A;  3UIO C;  2M63 A;  4FAD A;  3CHR A;  3LJ3 A;  2VTB B;  1LD8 A;  2DCP A;  1DVP A;  3HXC A;  3TWS A;  4WWP A;  3NAW A;  2R2L A;  3UPV A;  4MS6 A;  4XI9 A;  4O1O A;  1HZ4 A;  5FZS A;  1ELR A;  3HVE A;  3CHQ A;  2P2C P;  3PNL B;  3D9K A;  5DBK A;  1BD8 A;  3E34 A;  5BT1 A;  3JXI A;  1SVX A;  3NBN B;  3D9L A;  1PY1 A;  4FJY A;  3RRU A;  2XEV A;  3TWX A;  4HI8 A;  1IKN D;  3RRM B;  3MJW A;  4G25 A;  1JCS A;  3VTX A;  4UWL A;  4DUI A;  3RKV A;  3FUL A;  1D8E A;  2L0T B;  4FP7 A;  2ZIS A;  2VGE A;  1H0A A;  5EX3 A;  2ZXW E;  3G2W A;  3RJV A;  5B3S E;  3ZPJ A;  2H6G A;  2VSN A;  2FF4 A;  4UWH A;  3DSU A;  4PS7 A;  1IHG A;  1NZN A;  2Q7F A;  2WXO A;  3EHM A;  3SGH A;  2WXH A;  1Z6T A;  3QC1 A;  4U0S A;  3G2T A;  4BES A;  5FWQ A;  1D9S A;  4GZ6 A;  5AN8 A;  2X3M A;  3SF4 A;  5AJD A;  3FUM A;  4WWN A;  3KEZ A;  1H19 A;  2WXN A;  4UI9 K;  4ANV A;  3TWU A;  5KJL A;  3FEY A;  1NP7 A;  3ML8 A;  1KPS B;  1SA4 A;  3ASH A;  4TUM A;  1KZO A;  1JCQ A;  5A23 A;  1ZB1 A;  2C0M A;  1OCR E;  1SZ9 A;  2ZGD A;  4ILI A;  2LNI A;  4G2V A;  4A1S A;  3D9O A;  5ENP D;  5AIJ A;  3L54 A;  2ILR A;  5E76 A;  4G23 A;  3O48 A;  3K9I A;  3ULY A;  2AVP A;  2BUG A;  4HLE A;  2IOL A;  5DIZ A;  4FA6 A;  3FTW A;  2XPZ A;  5T3R A;  4G1T A;  4E6H A;  1V55 E;  1LF8 A;  2F37 A;  3AJI A;  2A5U A;  3UM1 A;  3PUK A;  4J8F A;  4UQZ A;  3CLJ A;  4ABN A;  4U96 D;  5D0O D;  2ZU6 B;  2KZT B;  3HYM B;  2WQH A;  1MJ0 A;  4FHJ A;  3IEG A;  3J5P A;  2FUL A;  3FU6 A;  2EIL E;  1YA0 A;  2WXL A;  3PZD A;  1UG3 A;  1IXV A;  4NAC A;  4JW1 A;  1ELK A;  2NXP A;  2L6J A;  3T8K A;  4RSY A;  4F3V A;  2AXZ A;  4CT0 A;  4BER A;  2I6H A;  1TN6 A;  4DI4 A;  4F53 A;  3SNX A;  4JEH A;  3FUN A;  3DXK G;  2BKK B;  5EYL A;  5AAR A;  3WXX A;  1E8Z A;  3ABL E;  1XGW A;  3Q9U C;  4K5C A;  3AU5 A;  5AJL A;  4XIF A;  3LY9 A;  1OY3 D;  4KYO B;  4I9C A;  1XNF A;  5CBN A;  4KZC A;  1K1B A;  3D3M A;  2WQ6 A;  2Y0B G;  3QWW A;  2VGX A;  2H6H A;  3EHR A;  4AY5 A;  3CHO A;  5KJK A;  3VTY A;  2PM7 A;  4HRN A;  1HO8 A;  4HFG A;  2XGS A;  3FTV A;  4EZL A;  4L7T A;  2VYI A;  3E37 A;  1UN8 A;  5JMN D;  4I1M A;  4LNU D;  4ZHB A;  4IRU A;  3APC A;  3SO8 A;  5FTP A;  2R5S A;  5HQ8 A;  3HHM A;  2KXP C;  3MX3 A;  1DCE A;  1WDY A;  2I2O A;  1YYH A;  2XEH A;  4Y6C A;  3DSS A;  3DSW A;  3FTX A;  3ZGQ A;  5ITZ F;  4XEI G;  3D9H A;  1NI1 A;  1SQM A;  3AS4 A;  4L1B A;  3QDN A;  2V8S E;  3ZYL A;  3CK7 A;  4AOF A;  1LTX A;  3ZYK A;  3BQO A;  4ILG A;  3FU3 A;  3URZ A;  3ZXP A;  5EIB E;  3OXG A;  2IO3 C;  3DXM G;  3MYV A;  3LKU A;  3ULQ A;  3C98 A;  5FZR A;  2QFC A;  1TNO A;  4HOS A;  4I6J A;  3S7J A;  3QKY A;  3APF A;  3IV0 A;  2EIK E;  5ENN A;  2L0I A;  2RFA A;  1TJC A;  3DRA A;  3FWV A;  4OVV A;  3ONL A;  2UY1 A;  3ABK E;  3L82 A;  5T4Y A;  4U63 A;  5FQ7 A;  2AXV A;  3PE3 A;  4LNG A;  4U8Y D;  4G8L A;  2XRZ A;  1OWM A;  1NL4 A;  4FLH A;  4GMR A;  3TWT A;  4NIK A;  5HRY A;  2WQ7 A;  3ZRH A;  4TXP A;  5JJT A;  2WMN A;  2ETA A;  3SD5 A;  3ASO E;  2XCB A;  2V5Q C;  2CFU A;  2IJG X;  4Q94 A;  4C0M A;  1HX8 A;  3DWL G;  3MA5 A;  2RFM A;  3NQP A;  2GRO B;  3SI5 A;  1MX4 A;  1H2T C;  2XEE A;  5CCL A;  2BF0 X;  2IEJ A;  1Z3X A;  1N54 A;  1EDU A;  2XEN A;  3ZUV B;  4A63 B;  2H6I A;  3AG3 E;  2WXJ A;  5AQB A;  3EHN A;  3JUE A;  2R17 C;  3UXG A;  2P9U G;  2VSX E;  4I9E A;  1RZ4 A;  2VSY A;  4AIF A;  4JA7 A;  4ANX A;  3G2V A;  2QZA A;  2IU1 A;  1E8W A;  4DX5 D;  5JHA A;  2C0L A;  4A3T A;  1N94 A;  1PC2 A;  2CG2 A;  4P29 A;  2Y3A A;  4GCN A;  4M3O A;  4GA1 A;  5G04 J;  4U8V D;  2DYS E;  4Y6W A;  4CDM A;  3JQ1 A;  2P9K G;  3CKB A;  4A55 A;  2XGM A;  3NOG D;  4GA2 A;  4GTV A;  3UT8 A;  3IKO B;  4JL0 A;  1TEZ A;  5CEA A;  3RO3 A;  4NUR A;  4BSZ B;  3FUE A;  4U07 A;  3NZU A;  4I2Z A;  1S63 A;  2DIW A;  2LAH A;  5FQ6 A;  3B7T A;  4WUY A;  3PH0 C;  4LER A;  1H2V C;  4PS3 A;  4AV7 A;  4JC8 A;  3VLF A;  3E32 A;  4O6F A;  3GZ2 A;  1IYG A;  4HI9 A;  5KCM A;  3CHP A;  3QJZ A;  4GPM A;  4R7L A;  3T5X A;  2WXF A;  3D9I A;  5B1B E;  4RQI A;  3D9P A;  2LUH A;  2RG8 A;  4DX6 D;  2CHX A;  4DI3 A;  3ESK A;  2XGO A;  3MKQ B;  1E8Y A;  3TG4 A;  2WPV A;  4UUC A;  4ATG A;  3OAW A;  3PEV B;  2YIN A;  2XHE A;  1TN8 A;  2AWI A;  4HLL A;  1KZP A;  3JQ0 A;  4URK A;  5EIL A;  4N2S A;  2I9C A;  2R03 A;  1N95 A;  4GTS A;  2E2E A;  2WB2 A;  2C2L A;  3APD A;  3V2X A;  4H7Y A;  1G3N B;  1U3D A;  2R05 A;  3EIQ C;  1FPP A;  4I1A A;  5JHB A;  2V4L A;  3LJN A;  4K5B A;  1K3Z D;  3CVU A;  2JAB A;  4HRM B;  4KMO A;  2NYJ A;  2LO6 A;  3LEW A;  3EUV A;  2J09 A;  2LSV A;  1U3C A;  1OCO E;  2HYZ A;  1JPL A;  1OWP A;  2PM6 A;  3V2O A;  3PZ3 A;  1BPO A;  2WXR A;  3FTY A;  5BUZ A;  3ZYM A;  3CVV A;  5KBA A;  3TGO A;  1K1A A;  1UOH A;  1GW6 A;  4GTR A;  1X81 A;  4HQD A;  4IUL A;  3Q47 B;  4GML A;  4EPZ A;  3CVX A;  2L6B A;  4RLY A;  3FP3 A;  3CQC B;  3ML9 A;  4GU5 A;  2P9S G;  4G24 A;  3RU0 A;  5D2M C;  3SFY A;  5EX0 A;  3TWV A;  1JUQ A;  3C72 A;  2X6K A;  4ILH B;  4XZ4 A;  1SA5 A;  4DLO A;  2GRN B;  3FTS A;  4N5Q A;  2CG3 A;  4YDE A;  3T5V A;  2OEV A;  4J8E A;  2JEK A;  2J8S D;  2EIN E;  2DZN A;  4I17 A;  2XQ0 A;  3Q4A B;  3HXE A;  5CEC B;  2CHZ A;  3GW4 A;  4BWR A;  1O1S A;  3Q75 A;  3FH5 A;  5AQA A;  4YDW A;  1TNZ A;  1HFA A;  3FEX A;  3CEQ A;  3SBS A;  1V54 E;  2PNN A;  5ARF A;  3KSL A;  3AS5 A;  3FTZ A;  3OXF A;  4FLB A;  3PE4 A;  5FIN A;  4CZ2 D;  2RKK A;  2X38 A;  1TN7 A;  5HKP A;  3UKU G;  2VGY A;  1YMP A;  1UN9 A;  2XCC A;  4U8H A;  3TWR A;  4A1G A;  5LCW J;  4E85 A;  3CKC A;  5IY5 E;  4AEZ C;  4CEM A;  4DK5 A;  3SY2 A;  4FJZ A;  3FH7 A;  3QNK A;  3RAU A;  1K8K G;  4L9P A;  3ONK A;  1QQE A;  3OTN A;  2V0P A;  3FDH A;  1X5B A;  1E8X A;  3JCK C;  3L13 A;  5FQ4 A;  4GA0 A;  4GYY A;  1MYO A;  4BEP A;  2JLB A;  5CER B;  1HS6 A;  5CCM A;  2VGX B;  4DX7 D;  3DST A;  4F1P A;  5G04 C;  3JXJ A;  4HOR A;  1QZ2 A;  4MBG A;  4MRU A;  4GMJ A;  4NRH B;  4XE0 A;  4J8S A;  3C3O A;  5LOZ A;  3MZL B;  2V4H C;  2EIJ E;  3V30 A;  2BKG A;  3VLE A;  3SFZ A;  3HXB A;  1N0Q A;  3E33 A;  4B94 A;  4I43 A;  3LCA A;  3FFL A;  4V3I A;  1AP7 A;  1L5J A;  2QC9 A;  4U0U A;  4CYM D;  4M7C A;  4O60 A;  4WNF A;  3TXM A;  4FUL A;  5HI7 A;  4EQF A;  3HRA A;  4GTP A;  1DC2 A;  3DPY A;  4F7A A;  3CIA A;  1OWL A;  2F0Y A;  3D9J A;  5EID A;  3B7S A;  1FT1 A;  4BTB A;  3Q9N C;  2XS1 A;  3CK8 A;  3LXU X;  4H7X A;  4QFV A;  4J8D A;  1YCS B;  4GYO A;  4LSZ E;  4TXQ A;  3LY8 A;  4I6E A;  1IHB A;  3DSX A;  1WM5 A;  5FZQ A;  2P9P G;  3Q73 A;  5EN5 D;  1OWO A;  2V5F A;  5J90 A;  4LG6 A;  3NOC D;  1KT0 A;  2QY7 A;  4W9R A;  3EU9 A;  3ISM C;  4EHM A;  2WXI A;  4AP2 A;  5ENQ D;  4AVX A;  4MKT A;  2PQR A;  4JXT A;  4WWO A;  2J4D A;  5D0Q D;  1FVH A;  3BG1 B;  1DCQ A;  1FT2 A;  2KCL A;  2Y4U A;  3CVY A;  3I3N A;  3VLD A;  2J07 A;  1JCR A;  3S7F A;  1H6P A;  3DEO A;  2J4B A;  3ULE G;  2VSO E;  1U2V G;  2B6C A;  1Z3Y A;  5B1A E;  2GW1 A;  1E7U A;  3Q15 A;  4GTQ A;  1TR4 A;  3L08 A;  2XZD G;  2R02 A;  3CHM A;  4D10 C;  2P9I G;  5LCW C;  3OXL A;  4WAF A;  4GTO A;  2GRQ B;  4N39 A;  4DX2 A;  2OND A;  2WXG A;  3ZHE A;  3C5R A;  4DJA A;  2HO1 A;  4JZY A;  2KC7 A;  3MV3 B;  4XKB A;  1HXI A;  3Q7A A;  4BX9 A;  3G2U A;  4PH4 B;  1S0P A;  4ME2 A;  1EPU A;  3QB2 A;  3DBS A;  2IY0 C;  1N4Q A;  3PRE A;  2Y1L E;  1MQS A;  3FHE A;  4N2Q A;  3FUF A;  3AAA C;  2IFU A;  1A17 A;  3FUI A;  4L2Y A;  3UQ3 A;  2PL2 A;  4G26 A;  2OCC E;  3FUJ A;  1HE8 A;  4I6G A;  1EF1 C;  3E30 A;  1N4R A;  1N0R A;  3R9M A;  3EDT B;  3FU0 A;  3AU4 A;  4FHK A;  5LFA A;  3ABM E;  3NZS A;  3B13 A;  2VTB A;  4GZ3 A;  1TJF A;  5AQ7 A;  4HB5 A;  3ZFW A;  4HS2 A;  1HG5 A;  3TG5 A;  2XPY A;  3HG0 D;  4YVQ C;  2XZT G;  4JHJ A;  3FU5 A;  2VJ8 A;  4B8A A;  4DRX E;  4J8Y A;  3QWV A;  2Y69 E;  3ZU7 B;  3ENE A;  2OOE A;  4WND A;  3U66 A;  2AJA A;  1MHQ A;  3DEP A;  3PEU B;  3UX4 A;  3AG1 E;  2OV8 A;  4YVO A;  5ARG A;  3V31 A;  3HIZ A;  1TNU A;  3HDX A;  3ASN E;  1TNB A;  3KAE A;  4HXI A;  3ZVV A;  5C2Y A;  3MCX A;  4C48 B;  2GRP B;  4XKC A;  3UM2 A;  2AXU A;  3UMV A;  4WNG A;  3CQG B;  2FI7 A;  1IQR A;  4YDO A;  4CGW A;  3UUX A;  1N52 A;  4CRW A;  2DWZ A;  1WG0 A;  3L16 A;  4JHK A;  5CMW A;  2GRL A;  3RRN B;  5J08 A;  3D9N A;  4ANU A;  5CMY A;  2UY1 B;  4UWK A;  3FY4 A;  3MEK A;  4AY6 A;  2WVI A;  2FBN A;  4HNA D;  3U9W A;  2OVF A;  2HM8 A;  3S7B A;  4Q96 A;  2LXL A;  1FCH A;  1QBQ A;  1S64 A;  1N4P A;  1OCZ E;  2OEW A;  4K03 A;  3KS2 A;  2NC9 A;  4LCT A;  4GTM A;  5CRV A;  1HG2 A;  1WY6 A;  4RVB A;  3CR3 A;  1AWC B;  2AW6 A;  4KXK B;  1OT8 A;  3CVN A;  3DSV A;  3CVP A;  3GZ1 A;  3IHV A;  3PZ1 A;  5C1D A;  1UW4 B;  4CT4 A;  3UI2 A;  1Y6I A;  3ASD A;  3EIJ A;  4BTA A;  4UWG A;  2KCK A;  1N4S A;  3Q79 A;  4LNB A;  2DBA A;  3Q49 B;  3ZHE B;  5BNW A;  2J9Q A;  5CRU A;  1OCC E;  3T8M A;  1Z5S C;  3CV0 A;  3TWW A;  4GZD A;  3R9A B;  3UT7 A;  5D66 A;  4PUC A;  5BXO A;  3EU5 A;  1Y8M A;  4UWF A;  1TNY A;  5E75 A;  3QWP A;  3CVW A;  2X6J A;  3I4G A;  4GAA A;  3L22 A;  3W9F A;  2ETC A;  4DX1 A;  3B95 A;  4X8Q A;  3CVQ A;  4PS8 A;  2ION A;  5FQ8 A;  4LEU A;  4TXR A;  2E0I A;  4GPK A;  4ACL A;  2WMO A;  5BW8 C;  4DPR A;  2DVW A;  3ZW3 A;  3UTM A;  1BLX B;  2GRM A;  5AEN A;  2IOS A;  2F8X K;  3BEE A;  4I1O B;  4AM9 A;  4BFR A;  3SZ7 A;  3CGH A;  3FUK A;  3PRZ A;  2RD0 A;  3MKQ A;  3BUA A;  1QYM A;  5LP0 A;  1MX2 A;  4UQY A;  5G05 J;  4KVO A;  3IXE A;  5FIO A;  3CST A;  3E4B A;  1NA0 A;  1RW2 A;  2YNQ A;  4IYP A;  3QOU A;  4AJW A;  4L23 A;  4KBQ A;  3DPD A;  2KAT A;  3PNT B;  5ENS D;  2WXQ A;  3L9T A;  2VQ2 A;  4APF A;  4QQI A;  5BV0 A;  1SW6 A;  3ZKJ A;  3S7D A;  4N3C A;  4RG6 A;  4JHR A;  3FUH A;  3AG2 E;  1ELW A;  3V79 K;  1PAQ A;  2XS8 A;  4EBA A;  5G55 A;  3X2Q E;  4APO A;  4J7W A;  5KJM A;  1E96 B;  3AG4 E;  3MV2 B;  4JVS A;  1HF8 A;  1ZU2 A;  4N3A A;  4G8K A;  3SHF A;  4EZK A;  1N11 A;  1SZA A;  3QK0 A;  4RG9 A;  3FUD A;  4CCA A;  5AAO A;  2QYU A;  1O1T A;  4XX5 A;  1EYH A;  3PZ4 A;  1FVF A;  2YHE A;  4J6I A;  1QNF A;  2P58 C;  4JA9 A;  3ZNG A;  4GZC A;  4HRL A;  4DLQ A;  2UWJ G;  4BX8 A;  2F8Y A;  1BU9 A;  1HU3 A;  4EEC A;  4ATZ D;  1S70 B;  2ETB A;  5T8I A;  3CVL A;  5CHE E;  4MLP A;  1TYQ G;  4OYS A;  3ZN3 A;  2WXM A;  3P1U A;  3U64 A;  2GRR B;  5JJ7 A;  4HVB A;  4HBD A;  4KT6 B;  5JA4 D;  5KWD A;  2L9B A;  2KZT A;  3CHS A;  4L2L A;  1OUV A;  3HVE B;  3WG7 E;  3IBE A;  5EDS A;  3Q5M A;  1OWN A;  3LYA A;  4U7E B;  1ZBP A;  4F1S A;  3D9M A;  3UIP C;  4A3V A;  1JWF A;  4EBA G;  3JUI A;  4WNE A;  5ENT D;  3BU8 A;  3G2S A;  5ANR A;  1KLX A;  2NSZ A;  3UT4 A;  5BXU A;  3KD7 A;  4U04 A;  1IQU A;  3LDZ A;  3SFX A;  4AXH A;  5BV1 A;  4CDR A;  3R7R A;  2PZI A;  3LS8 A;  3B7U X;  4BET A;  3GYZ A;  4K0R A;  4LRZ A;  4OAV B;  4J0U A;  3KEA A;  1E7V A;  4HOT A;  5A7D B;  3B7B A;  4Z68 A;  1Q2Z A;  2WXK A;  3ESL A;  2R59 A;  2Y4T A;  2HE0 A;  4LUN U;  3SBT B;  3N71 A;  1W3B A;  3AS8 A;  4YDY A;  4CGV A;  4ZFH A;  2HR2 A;  3RSE G;  3CSF A;  4B93 B;  4B8C B;  5ANL A;  1WAO 1;  1D8D A;  5AYW D;  3QAR A;  4I2W A;  3UM3 A;  1LD7 A;  2P9N G;  2LAI A;  4C0E A;  3FH8 A;  5A6C A;  5ENR D;  3I5P A;  2MRI A;  2EQX A;  3HXD A;  1NA3 A;  5KJN A;  3GZS A;  2IO2 C;  5G2N A;  1B89 A;  2X6F A;  2OVB A;  1P5Q A;  2IF4 A;  4UI9 J;  4OAU C;  3TXN A;  4NQ0 A;  4U95 D;  1DNP A;  4OVU A;  4ANW A;  1BI8 B;  2KBX A;  4TV3 A;  3S2A A;  1NFI E;  2YHC A;  1VDY A;  1KT1 A;  2B0O E;  2PQN A;  3ASG A;  2KCV A;  1UJK A;  3J5Q B;  5FT9 A;  4CDN A;  3L17 A;  4UI9 C;  4BY6 A;  2BED A;  5H7P A;  4U0Z A;  1OXJ A;  3MGB A;  3PDN A;  2LXM A;  3O4Z A;  3FTU A;  3UIN C;  4BT8 A;  4XI0 A;  3F6Q A;  3IHY A;  5FJY A;  3LVR E;  2A4Z A;  5KNG A;  2ZIR A;  2MYO A;  4N5C A;  2GGF A;  3LY7 A;  5AQ9 A;  5EYP F;  5EKQ D;  3UKR G;  4UQX A;  3Q7F A;  3RK6 A;  3L6A A;  1N9A A;  2A5E A;  3ZYQ A;  4JPS A;  2X6I A;  4FC8 A;  4GB9 A;  3P2B A;  2ZGG A;  3BG0 B;  4TRQ A;  3ZEF A;  4ACK A;  5CBO A;  4HOQ A;  4JB8 P;  2I1K A;  3C3Q A;  3JYS A;  3TAX A;  2FO1 E;  3TL5 A;  1MX6 A;  1H2U A;  3I4R B;  3MKR A;  2FO7 A;  4GTT A;  3PS6 A;  3RO2 A;  4PDX A;  1H6O A;  2KM4 A;  2J08 A;  2MOW A;  4B0Z A;  3EHQ A;  2H6F A;  3C3R A;  4JEU A;  4TUU A;  2BTD A;  1E90 A;  4K5A B;  4KZ0 A;  2MHK A;  2LSU A;  3R7Q A;  4F6R D;  3T9K A; 
#chains in the Genus database with same CATH homology
 1N11 A;  2DZN A;  4BET A;  4BSZ B;  2DZO A;  4OAV B;  5AAO A;  4TUM A;  3V2X A;  1G3N B;  1N0R A;  5CEC B;  4DX5 D;  1DCQ A;  3KEA A;  2BKK B;  5EYL A;  4HNA D;  2V4H C;  3TWS A;  5AAR A;  2RFA A;  5KNH D;  3LJN A;  4K5B A;  2ZGD A;  3V30 A;  3B7B A;  4O1O A;  4Z68 A;  2BKG A;  2DVW A;  3Q9U C;  1K3Z D;  4K5C A;  4U8V D;  4HB5 A;  4YDW A;  3F6Q A;  5AQ7 A;  5AQA A;  1N0Q A;  2JAB A;  3ZNG A;  1OY3 D;  4HRM B;  3UTM A;  2P2C P;  2NYJ A;  4HRL A;  1BLX B;  3DEO A;  2HE0 A;  4U8Y D;  3HG0 D;  5ENP D;  5CBN A;  4G8L A;  1K1B A;  1BD8 A;  2F8X K;  2XZT G;  3NOG D;  5KNG A;  4GMR A;  3JXI A;  1SVX A;  3TWT A;  3NBN B;  2Y0B G;  2PNN A;  1AP7 A;  4YDY A;  2F8Y A;  2MYO A;  2QC9 A;  4NIK A;  3EHR A;  5HRY A;  4ZFH A;  1BU9 A;  4DRX E;  5AQ9 A;  4ATZ D;  5CEA A;  4J8Y A;  5EYP F;  1S70 B;  4CYM D;  4HRN A;  3V2O A;  3TWX A;  4O60 A;  3ZU7 B;  2ETA A;  1TR4 A;  2ETB A;  4B93 B;  4HI8 A;  3TWQ A;  2XZD G;  1QYM A;  2A5E A;  5FIN A;  3HRA A;  1IKN D;  4CZ2 D;  5JMN D;  1MX2 A;  2QYJ A;  1DC2 A;  2V5Q C;  4LNU D;  4ZHB A;  4DUI A;  5HKP A;  5KBA A;  2AJA A;  3IXE A;  5FIO A;  3SO8 A;  1YMP A;  3DEP A;  2ZGG A;  5EID A;  4HBD A;  4DX2 A;  3TWR A;  1K1A A;  2VGE A;  5JA4 D;  3V31 A;  5CBO A;  1UOH A;  4JB8 P;  5KWD A;  3Q9N C;  2F37 A;  2KXP C;  1AWC B;  2FO1 E;  1WDY A;  3AJI A;  1OT8 A;  4HI9 A;  1MX6 A;  4HQD A;  3C5R A;  5ENR D;  2RFM A;  4GPM A;  3UI2 A;  5ENS D;  2L6B A;  1YYH A;  4RLY A;  2XEH A;  4O1P A;  4QFV A;  4U96 D;  4QQI A;  1MX4 A;  4DX6 D;  1SW6 A;  3ZKJ A;  5HS0 A;  1MJ0 A;  5ITZ F;  1YCS B;  2XEE A;  3W9G A;  4C48 B;  3J5P A;  3D9H A;  3EHQ A;  4LSZ E;  4BES A;  1IHB A;  4OAU C;  2XEN A;  3TWW A;  1A5E A;  1D9S A;  3TWV A;  5ENT D;  2Y1L E;  3ZUV B;  3V79 K;  4A63 B;  4U95 D;  5D66 A;  5AN8 A;  4UUC A;  1IXV A;  5BXU A;  5EN5 D;  5AQB A;  5BXO A;  1BI8 B;  2KBX A;  1MYO A;  4K5A B;  4BEP A;  5CED B;  5CER B;  1NFI E;  3AAA C;  4HLL A;  4J7W A;  4LG6 A;  4N5Q A;  3NOC D;  4DX7 D;  3T8K A;  4F1P A;  3JUE A;  2B0O E;  1BI7 B;  2DWZ A;  1WG0 A;  3UXG A;  3JXJ A;  5EIB E;  3W9F A;  2ETC A;  3EU9 A;  4DX1 A;  4G8K A;  5EIL A;  3B95 A;  3TWU A;  3J5Q B;  5ENO D;  4BER A;  4F6R D;  5ENQ D;  2J8S D;  3T9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...