1YYHA

Crystal structure of the human notch 1 ankyrin domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Notch 1, ankyrin domain
publication title High-resolution crystal structure of the human Notch 1 ankyrin domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle,transcription
total genus 68
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1yyhA00
2B0OE 5ENPD 2A5EA 3AAAC 2V5QC 1BI8B 2DZOA 5ENTD 1IKND 5AQBA 5CEDB 4RLYA 3TWXA 4F1PA 4K5BA 2PNNA 4BESA 3W9GA 1D9SA 4O60A 1G3NB 3TWUA 4DX7D 4UUCA 1K1AA 2V4HC 4J7WA 4DUIA 3NOGD 5KWDA 4DX2A 1WG0A 2XZDG 2BKGA 1AWCB 3TWWA 5KNHD 3EHRA 4LG6A 4NIKA 1MJ0A 4HQDA 5EIDA 3V79K 1WDYA 3ZUVB 3V2OA 3TWQA 4OAUC 3ZKJA 2Y0BG 3EU9A 3D9HA 5D66A 3UXGA 3NBNB 5JA4D 2XZTG 3LJNA 1S70B 5EILA 4GPMA 4HRLA 5EN5D 1BLXB 2F8XK 2NYJA 3B7BA 4HRNA 1A5EA 3HRAA 4LSZE 4HRMB 4LNUD 5EIBE 4BSZB 1YCSB 5CBOA 3V30A 5JMND 4OAVB 2DVWA 2ETAA 1QYMA 2XENA 3ZU7B 4BEPA 5BXUA 3F6QA 5EYPF 3DEOA 4HBDA 5FINA 4HLLA 3V31A 5ENQD 3V2XA 3KEAA 2ETCA 1MX2A 1YMPA 4JB8P 2AJAA 1BI7B 4CYMD 4BETA 4CZ2D 3HG0D 4O1OA 4O1PA 2VGEA 2RFMA 2XEHA 4F6RD 2F8YA 2ZGGA 2J8SD 2JABA 3JXIA 5AQAA 5CERB 1NFIE 1MX6A 5HKPA 2RFAA 3TWVA 4DX6D 1K1BA 3NOCD 2MYOA 1SVXA 2P2CP 3T8KA 1TR4A 4U95D 4G8KA 1YYHA 3DEPA 2DWZA 3C5RA 4U8YD 3T9KA 3J5PA 3EHQA 2F37A 5ITZF 5AAOA 1DC2A 4U96D 3TWRA 2Y1LE 3UTMA 5BXOA 4GMRA 3JUEA 4QQIA 2KXPC 2DZNA 2KBXA 4HNAD 4B93B 3IXEA 2QYJA 1N11A 5CEAA 4ZFHA 4DRXE 1OY3D 2HE0A 4DX5D 1IXVA 3ZNGA 4YDYA 5KNGA 2XEEA 5ENSD 3Q9NC 3UI2A 4J8YA 4G8LA 5HRYA 1OT8A 3AJIA 5AARA 3J5QB 4QFVA 2ETBA 1DCQA 3Q9UC 4HI9A 5KBAA 1BD8A 1AP7A 1MYOA 3W9FA 1UOHA 2FO1E 3SO8A 2ZGDA 5AQ7A 5AQ9A 5CECB 4K5CA 4ZHBA 4BERA 5AN8A 5CBNA 5EYLA 2QC9A 3TWSA 4Z68A 4HI8A 5ENOD 2L6BA 1SW6A 4ATZD 4N5QA 1MX4A 1N0QA 5FIOA 4K5AB 3TWTA 1N0RA 4TUMA 4U8VD 4HB5A 5ENRD 5HS0A 4A63B 1BU9A 4DX1A 4YDWA 1K3ZD 2BKKB 3B95A 3JXJA 4C48B 1IHBA
chains in the Genus database with same CATH superfamily
3G2UA 2AW6A 2IO2C 4I43A 4KVMA 3DSWA 3NZUA 1WDYA 3PE3A 4Y6WA 1FVFA 4AVXA 1O5MA 3U4TA 4J6IA 3BG0B 2WXQA 3UM3A 5M72A 5EIBE 3QWPA 1YCSB 3D3MA 3SD5A 5HQ8A 3UIPC 4GA2A 1MHQA 3ZU7B 5EYPF 4N3BA 4GPKA 3ZYMA 3UIOC 1EYHA 2RG8A 3CVXA 4U0ZA 1NFIE 1NA0A 3LY7A 4B8CB 4HLEA 3LPZA 3CHSA 1E8WA 3UT7A 4U96D 3TWRA 3EJNA 5DBKA 2XCBA 5FZRA 3IHVA 4JA9A 2P58C 3ONLA 2V4LA 5AARA 4C0EA 3PZ3A 2WQ7A 4WWOA 2CHZA 4EZLA 3PDNA 1X81A 4FHKA 2KCKA 2VGXA 1HF8A 3CKBA 2L6BA 5E76A 5JJ7A 3L9TA 4HOUA 4BT9A 4A63B 4UWGA 4C48B 2YHEA 3SNXA 1N54A 1HZ4A 4ANUA 3RKVA 5D0OD 1D9SA 3EIQC 4UWHA 3CK8A 2B6CA 1UN9A 3HXEA 5KWDA 1WG0A 4G26A 2BKGA 3UUXA 2IF4A 2WPVA 4NIKA 2WXPA 3V2OA 3VLEA 4GTOA 3N71A 4FLHA 3TXNA 1BLXB 4GMLA 4PS8A 3RO3A 5BW8C 4BX8A 1B89A 3QJZA 2X6FA 1D8EA 1U3DA 3TGOA 3SHFA 4CZ2D 4I6EA 3U66A 3VTXA 2WXJA 4I6GA 4DPRA 2P2CP 4FA6A 3OXGA 1TNBA 1YYHA 3QAQA 3HYMB 3CVPA 1IQUA 1FVHA 4DI4A 2OVFA 3D9OA 2Y1LE 1PY1A 4HVBA 4O6FA 5BPPA 4ZFHA 4DK5A 1IXVA 3LYAA 2XEEA 3FU5A 3QWVA 2P9IG 2R02A 3CVQA 4QFVA 4AJWA 4LNGA 1BD8A 3MV3B 1E7VA 3Q73A 4L23A 4MLPA 4XE0A 3ESKA 1UJKA 4HORA 1HX8A 2CG2A 3APFA 2KC7A 1HS6A 2M63A 3GZSA 1BI8B 5LP0A 3Q75A 3UKRG 2DZOA 1IKND 1KT1A 5AQBA 2BF0X 3MCXA 3FUKA 3PE4A 2V4HC 4XKCA 1H19A 3NOGD 1FT2A 1BPOA 4LG6A 4A3TA 4CEMA 2J08A 4XZ4A 2LSUA 2EIME 4XI9A 3HXDA 3EHNA 3DWLG 3D9MA 3HRAA 2LUHA 3VTYA 1HH8A 3L82A 5LFAA 4LCTA 5KCMA 4GU5A 2CHWA 2VSYA 3D9LA 5KJMA 4KMOA 1N4SA 5HKPA 2R5SA 5IY5E 4XIFA 3HXCA 3S7BA 3CHPA 2IQCA 3UQ3A 4ILIA 3OXLA 4XKBA 5AJLA 4GYYA 4BWRA 1ELKA 4BY6A 3RO2A 3ABME 5AIJA 4RQIA 2H6FA 4EZKA 2QY7A 4GA1A 4M7CA 3ML8A 5LX8A 1QBQA 4K03A 4JA7A 4WWNA 2OV8A 3RRMB 3VLFA 5CBNA 3UPVA 5FZSA 1HFAA 1Z3YA 1SW6A 4ACLA 5CMWA 3DRAA 5FIOA 4K5AB 4Q69A 2PL2A 1JCQA 2C0LA 3E4BA 2B0OE 3D9JA 3OAWA 5ARFA 4RLYA 1Z5SC 4BESA 3W9GA 1SA4A 3ULYA 4AV7A 5CCLA 3FDHA 4CRWA 4RG9A 4BTBA 3EHRA 4EZJA 5B1AE 3QK0A 1KLXA 2Y0BG 5D66A 3D9IA 4U8HA 1NP7A 2NYJA 4GZCA 3CEQA 5CBOA 4BEPA 1Y6IA 1PAQA 4I2ZA 3KEAA 4L2LA 2H6IA 4LUNU 1U3CA 2DBAA 2DWZA 3DPDA 4U8YD 3ZYQA 3URZA 3SBTB 1EDUA 2IFUA 5AYWD 1P5QA 2KXPC 4JHKA 3NAWA 2XPIA 4HNAD 4YDOA 3CQCB 3JQ0A 2HE0A 1LD7A 1XNFA 2HR2A 5KBAA 3CQGB 4N2QA 3PZ1A 2ZGDA 4A3VA 3RSEG 4BERA 4J8DA 3Q47B 5JHBA 4K0RA 1TN7A 4N39A 3CVWA 3BQOA 3IHYA 4U0UA 1K3ZD 3TWXA 2HYZA 3FUEA 2V5QC 3CK9A 2VGYA 4E85A 2PQRA 2F0YA 2OCCE 1G3NB 5ANLA 3L54A 2P9KG 4ILGA 3ZRHA 4TUUA 3DXMG 3E34A 5G04C 1OCCE 3FUIA 4HOSA 2NXPA 1EF1C 4GZ5A 1EPUA 3CGHA 3D9KA 4MRUA 3ML9A 5JJTA 5J08A 2ETAA 1QYMA 5C1DA 4EBAG 3RU0A 1U2VG 4HLLA 2ETCA 1Y8MA 1Q2ZA 4O1PA 3B7TA 3I4RB 2RFAA 3TWVA 4CDNA 4CGVA 2WVIA 3T8KA 3UM1A 3LJ3A 2IU1A 3DEPA 2LXLA 1JCRA 4AXHA 3FH8A 2CFZA 1HG5A 1E8YA 2CFUA 4BSXA 5FQ6A 3PZDA 1OWOA 2X38A 4GTQA 2XEVA 2XQ0A 3FWVA 1NZNA 3S7DA 4GAAA 2V8SE 2WXGA 5FQ7A 3Q9UC 3PZ4A 5ENNA 4XEIG 4A1SA 3ULQA 4JVSA 3SBSA 3FUDA 5JHAA 1RZ4A 4GTMA 3ABKE 1N0QA 4J0UA 5HS0A 2X6IA 5ENPD 2A5EA 4R7LA 5CRUA 4K5BA 4BFRA 3ZN3A 4UUCA 2L0IA 3ZW3A 2R03A 3Q4AB 5EIDA 1QZ2A 2RKKA 4AP2A 3NB2A 2IONA 3CHQA 1TYQG 4HRMB 1E8ZA 1S63A 2J4BA 3IV0A 2I2OA 4GTSA 4JB8P 2GGFA 2F8YA 2ZGGA 3CVNA 3MJWA 3U3WA 1UW4B 1XGWA 3T9KA 5LOZA 3EHQA 3CSFA 4HOQA 3SY2A 1S64A 5FT9A 1OCOE 2ZIRA 3VLDA 4B94A 3LVRE 4NACA 3CIAA 3DBSA 5ENSD 3FTSA 3DSSA 3FU6A 5G55A 4EQFA 3KSLA 1DCQA 3HVEB 4YNDA 3SO8A 4K5CA 4GZ3A 2UY1A 4UQZA 4FJZA 3FUMA 2LO6A 1E8XA 1X5BA 4JW1A 3C3QA 2GRLA 2WXLA 5D0QD 2AXVA 4WUYA 2XRYA 3B95A 2P9LG 3FY4A 2ILRA 1TNZA 2AXUA 1MZCA 1NL4A 3S7JA 1JCSA 2J49A 4GB9A 1N94A 3DSUA 3CLJA 2WXMA 2MHKA 3S7FA 5T8IA 2R2LA 4ILHB 3TWQA 3LVQE 3CKCA 4FJYA 1FT1A 1ZU2A 2MOWA 2BTDA 1UG3A 4HRNA 2EILE 5JMND 3FTVA 2FBNA 2WMOA 4HBDA 3QOUA 5ENQD 3FTWA 2AJAA 4CGWA 2RFMA 3E32A 4CDMA 5BV0A 2MYOA 4D10C 4U95D 4G8KA 2F37A 2XPZA 4APOA 4PDXA 4ACKA 2LAHA 4RVBA 3FEXA 3S2AA 3IXEA 3ISMC 3KEZA 1VDYA 5G04J 2KM4A 1HE8A 1TN8A 2FO7A 2OOEA 4C0MA 5HRYA 2P9UG 4FC8A 1AP7A 3W9FA 3QNKA 1JWFA 3E30A 3AG3E 4A55A 4JC8A 3KAEA 4Z68A 4U0SA 1HO8A 1OUVA 1JPLA 1LTXA 2CG3A 5FZQA 4DJAA 1N0RA 2LAIA 3PREA 4JXTA 3GZ2A 2X6JA 3E33A 3MKQA 4CT0A 4C9BB 4P29A 1UN8A 3FUJA 4AM9A 3T5VA 2XCCA 1H0AA 1GW6A 1TJCA 3CVUA 4Q94A 4ABNA 4J8EA 1FPPA 3HIZA 2I1KA 5KNHD 4PS7A 3X2QE 2L9BA 3DSXA 5BT1A 4OAUC 3EU9A 2WXNA 1S70B 4LNUD 4BX9A 2DYSE 2H6GA 1HU3A 3B7UX 1OCZE 4F53A 2P9SG 2RD0A 5BXUA 3ASNE 4F3VA 5AENA 1BI7B 4L1BA 2VGEA 4ATGA 1MX6A 3SQVA 5CMYA 3HDXA 1V55E 3P1UA 5BNWA 1WY6A 2FULA 1JUQA 2YQ8A 3SFYA 1INZA 3PNTB 4YDEA 3B7RL 4DRXE 2OEVA 2JEKA 3LKUA 4U63A 1WAO1 3UI2A 1Z3XA 2EIJE 2WB2A 4HI9A 3Q7AA 3HXFA 3JCKC 4CDRA 5AQ7A 2Y69E 3D9NA 5FQ4A 4N5CA 2QC9A 3UM0A 1TNUA 2WXRA 3AS4A 1O1TA 3BG1B 2BKKB 1N9AA 3UT8A 2UY1B 3ASOE 3AG2E 3AAAC 2FF4A 1D8DA 3U64A 3CVVA 4G2VA 3FULA 3UM2A 4U04A 3CVYA 4EPZA 1E7UA 4GZDA 5G05C 2F8XK 4CT4A 2VTBA 1A5EA 2VGXB 2AXZA 4I6JA 3SFXA 4GTRA 5A6CA 3T5XA 3ASHA 4HXIA 1V54E 4LNBA 3AS5A 5T3RA 2ZISA 1KZOA 2J8SD 1A17A 3FU3A 3RAUA 5KJKA 1H2TC 3SF4A 3QC1A 3C5RA 3I5PA 4BT8A 1QNFA 3SZ7A 2YNQA 4HOTA 3MV2B 4UWKA 3JYSA 1OY3D 1OCRE 5A7DB 3UINC 2XS1A 3Q9NC 3J5QB 1Z6TA 2EQXA 2KATA 2YHCA 5CHEE 2PM6A 2XPYA 3APDA 5B3SE 3FU0A 4GTVA 4ATZD 5EDSA 5C2YA 4G23A 4MBGA 3FTYA 1BU9A 4AEZC 3IBEA 4APFA 2IJGX 4WWPA 1IHBA 3JQ1A 4JEUA 2L0TB 3MYVA 3TG4A 1N4QA 3MX3A 4J7WA 3SFZA 4DX2A 4G11A 3FP3A 3ZKJA 2KCLA 4J8FA 3D9HA 3ESLA 5EILA 4HRLA 3ZGQA 3B7BA 4DLOA 2PQNA 1HXIA 3V30A 4WNGA 3FTZA 3DEOA 3V31A 1YMPA 2L6JA 3HHMA 3TJPA 5FTPA 1DCEA 3IKOB 4GYWA 3UMVA 5LCWC 5ITZF 4LEUA 5BXOA 2XGOA 3L13A 2WXHA 1TJFA 1HG2A 1N4PA 4KBQA 5KNGA 4ANVA 2PZIA 4FHJA 3L16A 3JUIA 4KXKB 4GA0A 3ZHEA 4DLQA 2R05A 2AWIA 1K8KG 3QB2A 3KD7A 3TWSA 3ASFA 5KJNA 4N5QA 4IRUA 3ZXPA 1SA5A 2XS8A 4IYPA 1SZ9A 2X3MA 4O60A 3ULEG 3TWUA 1K1AA 2EINE 4DUIA 2KZTA 2XZDG 3DSVA 3LXUX 3TWWA 1MJ0A 4HQDA 3LS8A 4BTAA 3APCA 3TAXA 3C98A 3LJNA 5FQ8A 4GCNA 3PNLB 2OVBA 1OWMA 2E2EA 5A23A 3PRZA 1NA3A 2YINA 2XENA 3GYZA 5CRVA 5FINA 3KSQA 3AS8A 4UWFA 2DYRE 4B89A 1TNOA 2X6HA 2CHXA 4V3IA 2QYUA 1NI1A 4UQXA 3TL5A 5J90A 3SGHA 5AJDA 4ME2A 2J9QA 3RJVA 5T4YA 3CR3A 3J5PA 3MEKA 1N4RA 3RRUA 1N95A 4Q96A 4I17A 3EDTB 2V5FA 4OYSA 4I9EA 2A4ZA 4X8QA 5G05J 2IEJA 3CSTA 2WM9A 3Q7FA 4EHMA 1UOHA 3K9IA 3L08A 2WXOA 2WXKA 4MS6A 3LY8A 5AN8A 2Y4UA 2WXIA 3WG7E 4ANWA 1LF8A 2GRQB 3ENEA 4HB5A 3JXJA 4NRHB 3CV0A 1JWGA 4ANXA 4KT6B 4XI0A 3FUHA 4I1OB 1H2VC 3V79K 3UXGA 3FTXA 5JA4D 5EN5D 4HFGA 3ASDA 2LNIA 4BSZB 2WMNA 4GTPA 3ZYLA 2AVPA 1KZPA 5FJYA 1MX2A 1S0PA 4UQYA 2I9CA 4CYMD 3HG0D 4URKA 4RSYA 2JABA 3JXIA 4DI3A 5EX0A 3UKUG 2BEDA 2WQ6A 2BUGA 3Q15A 4LERA 4EBAA 3AG4E 4FLBA 3UTMA 1SQMA 4B93B 1N11A 3ZNGA 3EUVA 3L22A 4B0ZA 3Q5MA 3DXKG 4TV3A 1IQRA 3QKYA 3E37A 4G1TA 3UX4A 1TN6A 4AOFA 2VJ8A 3BEEA 3AU4A 4M3OA 2C2LA 4I9CA 1E96B 5ENRD 3ZHEB 1ZB1A 1TEZA 3U9WA 2R59A 5CEDB 4UI9K 5LCWJ 2WXFA 3RRNB 5EKQD 4KYOB 4JPSA 3SI5A 3ZEFA 3CHMA 1AWCB 1L5JA 3EU5A 3ZUVB 4JL0A 2EIKE 3R9MA 4Y6CA 3ASGA 3Q49B 3FTUA 2KZTB 3MKRA 2XGMA 2J4DA 2DVWA 3HXBA 4L7TA 5KJLA 5FWQA 3V2XA 3D9PA 3PEVB 4H7YA 2PM7A 1YA0A 4O1OA 3LY9A 2XEHA 1MQSA 3L6AA 1W3BA 2QFCA 3DSTA 4IN3B 3ZVVA 4N3AA 1SZAA 4EECA 2NC9A 4N2SA 4YVOA 2QZAA 2LXMA 2Y3AA 3QDNA 1DVPA 3G2SA 5AAOA 4YVQC 2Q7FA 5B1BE 4QQIA 3TXMA 2LSVA 2DZNA 4FU3A 5CEAA 3KS2A 4DX5D 4L9PA 3DPYA 4U07A 4UI9C 1IYGA 3I4GA 4WNEA 4PH4B 4IULA 5AQ9A 5CECB 3PH0C 3NZSA 3ZFWA 2ONDA 4KZ0A 3CHRA 2IY0C 3IEGA 5ENOD 2ZU6B 5ARGA 3RIBA 4TUMA 2VQ2A 3ABLE 4DX1A 3CVLA 3PS6A 4RG6A 3C3OA 3EHMA 3O48A 5HI7A 4JZYA 4G24A 3QARA 2I1JA 3O4ZA 4GTTA 3L17A 2GRPB 3FEYA 2DCPA 1H2UA 3PZ2A 1ELRA 4WAFA 2HO1A 4GZ6A 3B13A 3NBNB 2XZTG 4JHJA 4CCAA 2C0MA 4E6HA 3QWWA 1OWPA 3LEWA 3FFLA 2OEWA 3F6QA 3OTNA 3R9AB 4GYOA 5JJ6A 5BUZA 4BETA 1TNYA 4A1GA 2WQHA 4UWLA 4DX6D 4FP7A 3PUKA 4N3CA 5CCMA 2VSNA 2VYIA 2H6HA 1IHGA 4GMRA 3Q78A 3WXXA 2P9PG 1OT8A 1FCHA 2FO1E 1OWLA 4XX5A 1KPSB 1OWNA 2FEZA 3TWTA 3ONKA 3PVLA 2V0PA 3PUJA 2UWJG 1O1SA 1N52A 3FUFA 3C72A 1KT0A 3ZXSA 4MKTA 3PEUB 2JLBA 4F1PA 1H6OA 4OVUA 4H7XA 4DX7D 3AU5A 4OVVA 1LD8A 2IOSA 4I1MA 4LRZA 3P2BA 4AY6A 4LSZE 1ZBPA 3FH5A 5D2MC 4OAVB 2IO3C 3T8MA 3HVEA 4TXQA 2J09A 3MKQB 3UT4A 2I6HA 4F6RD 5AQAA 5CERB 1E90A 3NOCD 1QQEA 3CK7A 1TR4A 4TXRA 2GRNB 1RW2A 3R7RA 4NURA 4FADA 2Y4TA 3FHEA 4FULA 3BU8A 2KBXA 1O1RA 3EIJA 3GZ1A 2E0IA 2P9NG 2XHEA 3RK6A 4J8YA 4B8AA 2GW1A 4G25A 4G8LA 3AJIA 4WNDA 2ETBA 3Q79A 3ZPJA 1H6KA 4ZHBA 5EYLA 3NF1A 5EX3A 4I2WA 3LDZA 4HI8A 4F1SA 3MGBA 3MA5A 4U8VD 1WM5A 4YDWA 3OXFA 4KVOA 3G2WA 1DNPA 2GRRB 3MZLB 5ENTD 3LCAA 4W9RA 2PNNA 2KCVA 4JEHA 5E75A 2HM8A 2ZXWE 5H7PA 2MRIA 3TG5A 4J8SA 4GPMA 4KZCA 3C3RA 4UI9J 2VSOE 1H6PA 4AY5A 2R17C 3BUAA 2DIWA 2J07A 4PS3A 3ZYKA 2A5UA 4GCOA 1UJJA 3G2VA 4NQ0A 4AIFA 4L2YA 3NQPA 4JD2G 2GRMA 2IOLA 1PC2A 2XGSA 5ANRA 1K1BA 1ELWA 1SVXA 4JHRA 4TXPA 5G2NA 2XRZA 2VSXE 4F7AA 4U7EB 1DC2A 2NSZA 3JUEA 4PUCA 2GROB 3FH7A 3FUNA 4WNFA 5BV1A 2QYJA 1OXJA 3R7QA 2VTBB 3G2TA 4YDYA 4TRQA 3AG1E 1MYOA 2X6KA 4HS2A 3I3NA 3B7SA 4I1AA 1MX4A 3CHOA 5DIZA 3ZIMA 2FI7A 4GMJA 3GW4A
chains in the Genus database with same CATH topology
2B0OE 5ENPD 2A5EA 3AAAC 2V5QC 1BI8B 2DZOA 5ENTD 1IKND 5AQBA 5CEDB 4RLYA 3TWXA 4F1PA 4K5BA 2PNNA 4BESA 3W9GA 1D9SA 4O60A 1G3NB 3TWUA 4DX7D 4UUCA 1K1AA 2V4HC 4J7WA 4DUIA 3NOGD 5KWDA 4DX2A 1WG0A 2XZDG 2BKGA 1AWCB 3TWWA 5KNHD 3EHRA 4LG6A 4NIKA 1MJ0A 4HQDA 5EIDA 3V79K 1WDYA 3ZUVB 3V2OA 3TWQA 4OAUC 3ZKJA 2Y0BG 3EU9A 3D9HA 5D66A 3UXGA 3NBNB 5JA4D 2XZTG 3LJNA 1S70B 5EILA 4GPMA 4HRLA 5EN5D 1BLXB 2F8XK 2NYJA 3B7BA 4HRNA 1A5EA 3HRAA 4LSZE 4HRMB 4LNUD 5EIBE 4BSZB 1YCSB 5CBOA 3V30A 5JMND 4OAVB 2DVWA 2ETAA 1QYMA 2XENA 3ZU7B 4BEPA 5BXUA 3F6QA 5EYPF 3DEOA 4HBDA 5FINA 4HLLA 3V31A 5ENQD 3V2XA 3KEAA 2ETCA 1MX2A 1YMPA 4JB8P 2AJAA 1BI7B 4CYMD 4BETA 4CZ2D 3HG0D 4O1OA 4O1PA 2VGEA 2RFMA 2XEHA 4F6RD 2F8YA 2ZGGA 2J8SD 2JABA 3JXIA 5AQAA 5CERB 1NFIE 1MX6A 5HKPA 2RFAA 3TWVA 4DX6D 1K1BA 3NOCD 2MYOA 1SVXA 2P2CP 3T8KA 1TR4A 4U95D 4G8KA 1YYHA 3DEPA 2DWZA 3C5RA 4U8YD 3T9KA 3J5PA 3EHQA 2F37A 5ITZF 5AAOA 1DC2A 4U96D 3TWRA 2Y1LE 3UTMA 5BXOA 4GMRA 3JUEA 4QQIA 2KXPC 2DZNA 2KBXA 4HNAD 4B93B 3IXEA 2QYJA 1N11A 5CEAA 4ZFHA 4DRXE 1OY3D 2HE0A 4DX5D 1IXVA 3ZNGA 4YDYA 5KNGA 2XEEA 5ENSD 3Q9NC 3UI2A 4J8YA 4G8LA 5HRYA 1OT8A 3AJIA 5AARA 3J5QB 4QFVA 2ETBA 1DCQA 3Q9UC 4HI9A 5KBAA 1BD8A 1AP7A 1MYOA 3W9FA 1UOHA 2FO1E 3SO8A 2ZGDA 5AQ7A 5AQ9A 5CECB 4K5CA 4ZHBA 4BERA 5AN8A 5CBNA 5EYLA 2QC9A 3TWSA 4Z68A 4HI8A 5ENOD 2L6BA 1SW6A 4ATZD 4N5QA 1MX4A 1N0QA 5FIOA 4K5AB 3TWTA 1N0RA 4TUMA 4U8VD 4HB5A 5ENRD 5HS0A 4A63B 1BU9A 4DX1A 4YDWA 1K3ZD 2BKKB 3B95A 3JXJA 4C48B 1IHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0O E;  5ENP D;  2A5E A;  3AAA C;  2V5Q C;  1BI8 B;  2DZO A;  5ENT D;  1IKN D;  5AQB A;  5CED B;  4RLY A;  3TWX A;  4F1P A;  4K5B A;  2PNN A;  4BES A;  3W9G A;  1D9S A;  4O60 A;  1G3N B;  3TWU A;  4DX7 D;  4UUC A;  1K1A A;  2V4H C;  4J7W A;  4DUI A;  3NOG D;  5KWD A;  4DX2 A;  1WG0 A;  2XZD G;  2BKG A;  1AWC B;  3TWW A;  5KNH D;  3EHR A;  4LG6 A;  4NIK A;  1MJ0 A;  4HQD A;  5EID A;  3V79 K;  1WDY A;  3ZUV B;  3V2O A;  3TWQ A;  4OAU C;  3ZKJ A;  2Y0B G;  3EU9 A;  3D9H A;  5D66 A;  3UXG A;  3NBN B;  5JA4 D;  2XZT G;  3LJN A;  1S70 B;  5EIL A;  4GPM A;  4HRL A;  5EN5 D;  1BLX B;  2F8X K;  2NYJ A;  3B7B A;  4HRN A;  1A5E A;  3HRA A;  4LSZ E;  4HRM B;  4LNU D;  5EIB E;  4BSZ B;  1YCS B;  5CBO A;  3V30 A;  5JMN D;  4OAV B;  2DVW A;  2ETA A;  1QYM A;  2XEN A;  3ZU7 B;  4BEP A;  5BXU A;  3F6Q A;  5EYP F;  3DEO A;  4HBD A;  5FIN A;  4HLL A;  3V31 A;  5ENQ D;  3V2X A;  3KEA A;  2ETC A;  1MX2 A;  1YMP A;  4JB8 P;  2AJA A;  1BI7 B;  4CYM D;  4BET A;  4CZ2 D;  3HG0 D;  4O1O A;  4O1P A;  2VGE A;  2RFM A;  2XEH A;  4F6R D;  2F8Y A;  2ZGG A;  2J8S D;  2JAB A;  3JXI A;  5AQA A;  5CER B;  1NFI E;  1MX6 A;  5HKP A;  2RFA A;  3TWV A;  4DX6 D;  1K1B A;  3NOC D;  2MYO A;  1SVX A;  2P2C P;  3T8K A;  1TR4 A;  4U95 D;  4G8K A;  1YYH A;  3DEP A;  2DWZ A;  3C5R A;  4U8Y D;  3T9K A;  3J5P A;  3EHQ A;  2F37 A;  5ITZ F;  5AAO A;  1DC2 A;  4U96 D;  3TWR A;  2Y1L E;  3UTM A;  5BXO A;  4GMR A;  3JUE A;  4QQI A;  2KXP C;  2DZN A;  2KBX A;  4HNA D;  4B93 B;  3IXE A;  2QYJ A;  1N11 A;  5CEA A;  4ZFH A;  4DRX E;  1OY3 D;  2HE0 A;  4DX5 D;  1IXV A;  3ZNG A;  4YDY A;  5KNG A;  2XEE A;  5ENS D;  3Q9N C;  3UI2 A;  4J8Y A;  4G8L A;  5HRY A;  1OT8 A;  3AJI A;  5AAR A;  3J5Q B;  4QFV A;  2ETB A;  1DCQ A;  3Q9U C;  4HI9 A;  5KBA A;  1BD8 A;  1AP7 A;  1MYO A;  3W9F A;  1UOH A;  2FO1 E;  3SO8 A;  2ZGD A;  5AQ7 A;  5AQ9 A;  5CEC B;  4K5C A;  4ZHB A;  4BER A;  5AN8 A;  5CBN A;  5EYL A;  2QC9 A;  3TWS A;  4Z68 A;  4HI8 A;  5ENO D;  2L6B A;  1SW6 A;  4ATZ D;  4N5Q A;  1MX4 A;  1N0Q A;  5FIO A;  4K5A B;  3TWT A;  1N0R A;  4TUM A;  4U8V D;  4HB5 A;  5ENR D;  5HS0 A;  4A63 B;  1BU9 A;  4DX1 A;  4YDW A;  1K3Z D;  2BKK B;  3B95 A;  3JXJ A;  4C48 B;  1IHB A; 
#chains in the Genus database with same CATH topology
 3G2U A;  2AW6 A;  2IO2 C;  4I43 A;  4KVM A;  3DSW A;  3NZU A;  1WDY A;  3PE3 A;  4Y6W A;  1FVF A;  4AVX A;  1O5M A;  3U4T A;  4J6I A;  3BG0 B;  2WXQ A;  3UM3 A;  5M72 A;  5EIB E;  3QWP A;  1YCS B;  3D3M A;  3SD5 A;  5HQ8 A;  3UIP C;  4GA2 A;  1MHQ A;  3ZU7 B;  5EYP F;  4N3B A;  4GPK A;  3ZYM A;  3UIO C;  1EYH A;  2RG8 A;  3CVX A;  4U0Z A;  1NFI E;  1NA0 A;  3LY7 A;  4B8C B;  4HLE A;  3LPZ A;  3CHS A;  1E8W A;  3UT7 A;  4U96 D;  3TWR A;  3EJN A;  5DBK A;  2XCB A;  5FZR A;  3IHV A;  4JA9 A;  2P58 C;  3ONL A;  2V4L A;  5AAR A;  4C0E A;  3PZ3 A;  2WQ7 A;  4WWO A;  2CHZ A;  4EZL A;  3PDN A;  1X81 A;  4FHK A;  2KCK A;  2VGX A;  1HF8 A;  3CKB A;  2L6B A;  5E76 A;  5JJ7 A;  3L9T A;  4HOU A;  4BT9 A;  4A63 B;  4UWG A;  4C48 B;  2YHE A;  3SNX A;  1N54 A;  1HZ4 A;  4ANU A;  3RKV A;  5D0O D;  1D9S A;  3EIQ C;  4UWH A;  3CK8 A;  2B6C A;  1UN9 A;  3HXE A;  5KWD A;  1WG0 A;  4G26 A;  2BKG A;  3UUX A;  2IF4 A;  2WPV A;  4NIK A;  2WXP A;  3V2O A;  3VLE A;  4GTO A;  3N71 A;  4FLH A;  3TXN A;  1BLX B;  4GML A;  4PS8 A;  3RO3 A;  5BW8 C;  4BX8 A;  1B89 A;  3QJZ A;  2X6F A;  1D8E A;  1U3D A;  3TGO A;  3SHF A;  4CZ2 D;  4I6E A;  3U66 A;  3VTX A;  2WXJ A;  4I6G A;  4DPR A;  2P2C P;  4FA6 A;  3OXG A;  1TNB A;  1YYH A;  3QAQ A;  3HYM B;  3CVP A;  1IQU A;  1FVH A;  4DI4 A;  2OVF A;  3D9O A;  2Y1L E;  1PY1 A;  4HVB A;  4O6F A;  5BPP A;  4ZFH A;  4DK5 A;  1IXV A;  3LYA A;  2XEE A;  3FU5 A;  3QWV A;  2P9I G;  2R02 A;  3CVQ A;  4QFV A;  4AJW A;  4LNG A;  1BD8 A;  3MV3 B;  1E7V A;  3Q73 A;  4L23 A;  4MLP A;  4XE0 A;  3ESK A;  1UJK A;  4HOR A;  1HX8 A;  2CG2 A;  3APF A;  2KC7 A;  1HS6 A;  2M63 A;  3GZS A;  1BI8 B;  5LP0 A;  3Q75 A;  3UKR G;  2DZO A;  1IKN D;  1KT1 A;  5AQB A;  2BF0 X;  3MCX A;  3FUK A;  3PE4 A;  2V4H C;  4XKC A;  1H19 A;  3NOG D;  1FT2 A;  1BPO A;  4LG6 A;  4A3T A;  4CEM A;  2J08 A;  4XZ4 A;  2LSU A;  2EIM E;  4XI9 A;  3HXD A;  3EHN A;  3DWL G;  3D9M A;  3HRA A;  2LUH A;  3VTY A;  1HH8 A;  3L82 A;  5LFA A;  4LCT A;  5KCM A;  4GU5 A;  2CHW A;  2VSY A;  3D9L A;  5KJM A;  4KMO A;  1N4S A;  5HKP A;  2R5S A;  5IY5 E;  4XIF A;  3HXC A;  3S7B A;  3CHP A;  2IQC A;  3UQ3 A;  4ILI A;  3OXL A;  4XKB A;  5AJL A;  4GYY A;  4BWR A;  1ELK A;  4BY6 A;  3RO2 A;  3ABM E;  5AIJ A;  4RQI A;  2H6F A;  4EZK A;  2QY7 A;  4GA1 A;  4M7C A;  3ML8 A;  5LX8 A;  1QBQ A;  4K03 A;  4JA7 A;  4WWN A;  2OV8 A;  3RRM B;  3VLF A;  5CBN A;  3UPV A;  5FZS A;  1HFA A;  1Z3Y A;  1SW6 A;  4ACL A;  5CMW A;  3DRA A;  5FIO A;  4K5A B;  4Q69 A;  2PL2 A;  1JCQ A;  2C0L A;  3E4B A;  2B0O E;  3D9J A;  3OAW A;  5ARF A;  4RLY A;  1Z5S C;  4BES A;  3W9G A;  1SA4 A;  3ULY A;  4AV7 A;  5CCL A;  3FDH A;  4CRW A;  4RG9 A;  4BTB A;  3EHR A;  4EZJ A;  5B1A E;  3QK0 A;  1KLX A;  2Y0B G;  5D66 A;  3D9I A;  4U8H A;  1NP7 A;  2NYJ A;  4GZC A;  3CEQ A;  5CBO A;  4BEP A;  1Y6I A;  1PAQ A;  4I2Z A;  3KEA A;  4L2L A;  2H6I A;  4LUN U;  1U3C A;  2DBA A;  2DWZ A;  3DPD A;  4U8Y D;  3ZYQ A;  3URZ A;  3SBT B;  1EDU A;  2IFU A;  5AYW D;  1P5Q A;  2KXP C;  4JHK A;  3NAW A;  2XPI A;  4HNA D;  4YDO A;  3CQC B;  3JQ0 A;  2HE0 A;  1LD7 A;  1XNF A;  2HR2 A;  5KBA A;  3CQG B;  4N2Q A;  3PZ1 A;  2ZGD A;  4A3V A;  3RSE G;  4BER A;  4J8D A;  3Q47 B;  5JHB A;  4K0R A;  1TN7 A;  4N39 A;  3CVW A;  3BQO A;  3IHY A;  4U0U A;  1K3Z D;  3TWX A;  2HYZ A;  3FUE A;  2V5Q C;  3CK9 A;  2VGY A;  4E85 A;  2PQR A;  2F0Y A;  2OCC E;  1G3N B;  5ANL A;  3L54 A;  2P9K G;  4ILG A;  3ZRH A;  4TUU A;  3DXM G;  3E34 A;  5G04 C;  1OCC E;  3FUI A;  4HOS A;  2NXP A;  1EF1 C;  4GZ5 A;  1EPU A;  3CGH A;  3D9K A;  4MRU A;  3ML9 A;  5JJT A;  5J08 A;  2ETA A;  1QYM A;  5C1D A;  4EBA G;  3RU0 A;  1U2V G;  4HLL A;  2ETC A;  1Y8M A;  1Q2Z A;  4O1P A;  3B7T A;  3I4R B;  2RFA A;  3TWV A;  4CDN A;  4CGV A;  2WVI A;  3T8K A;  3UM1 A;  3LJ3 A;  2IU1 A;  3DEP A;  2LXL A;  1JCR A;  4AXH A;  3FH8 A;  2CFZ A;  1HG5 A;  1E8Y A;  2CFU A;  4BSX A;  5FQ6 A;  3PZD A;  1OWO A;  2X38 A;  4GTQ A;  2XEV A;  2XQ0 A;  3FWV A;  1NZN A;  3S7D A;  4GAA A;  2V8S E;  2WXG A;  5FQ7 A;  3Q9U C;  3PZ4 A;  5ENN A;  4XEI G;  4A1S A;  3ULQ A;  4JVS A;  3SBS A;  3FUD A;  5JHA A;  1RZ4 A;  4GTM A;  3ABK E;  1N0Q A;  4J0U A;  5HS0 A;  2X6I A;  5ENP D;  2A5E A;  4R7L A;  5CRU A;  4K5B A;  4BFR A;  3ZN3 A;  4UUC A;  2L0I A;  3ZW3 A;  2R03 A;  3Q4A B;  5EID A;  1QZ2 A;  2RKK A;  4AP2 A;  3NB2 A;  2ION A;  3CHQ A;  1TYQ G;  4HRM B;  1E8Z A;  1S63 A;  2J4B A;  3IV0 A;  2I2O A;  4GTS A;  4JB8 P;  2GGF A;  2F8Y A;  2ZGG A;  3CVN A;  3MJW A;  3U3W A;  1UW4 B;  1XGW A;  3T9K A;  5LOZ A;  3EHQ A;  3CSF A;  4HOQ A;  3SY2 A;  1S64 A;  5FT9 A;  1OCO E;  2ZIR A;  3VLD A;  4B94 A;  3LVR E;  4NAC A;  3CIA A;  3DBS A;  5ENS D;  3FTS A;  3DSS A;  3FU6 A;  5G55 A;  4EQF A;  3KSL A;  1DCQ A;  3HVE B;  4YND A;  3SO8 A;  4K5C A;  4GZ3 A;  2UY1 A;  4UQZ A;  4FJZ A;  3FUM A;  2LO6 A;  1E8X A;  1X5B A;  4JW1 A;  3C3Q A;  2GRL A;  2WXL A;  5D0Q D;  2AXV A;  4WUY A;  2XRY A;  3B95 A;  2P9L G;  3FY4 A;  2ILR A;  1TNZ A;  2AXU A;  1MZC A;  1NL4 A;  3S7J A;  1JCS A;  2J49 A;  4GB9 A;  1N94 A;  3DSU A;  3CLJ A;  2WXM A;  2MHK A;  3S7F A;  5T8I A;  2R2L A;  4ILH B;  3TWQ A;  3LVQ E;  3CKC A;  4FJY A;  1FT1 A;  1ZU2 A;  2MOW A;  2BTD A;  1UG3 A;  4HRN A;  2EIL E;  5JMN D;  3FTV A;  2FBN A;  2WMO A;  4HBD A;  3QOU A;  5ENQ D;  3FTW A;  2AJA A;  4CGW A;  2RFM A;  3E32 A;  4CDM A;  5BV0 A;  2MYO A;  4D10 C;  4U95 D;  4G8K A;  2F37 A;  2XPZ A;  4APO A;  4PDX A;  4ACK A;  2LAH A;  4RVB A;  3FEX A;  3S2A A;  3IXE A;  3ISM C;  3KEZ A;  1VDY A;  5G04 J;  2KM4 A;  1HE8 A;  1TN8 A;  2FO7 A;  2OOE A;  4C0M A;  5HRY A;  2P9U G;  4FC8 A;  1AP7 A;  3W9F A;  3QNK A;  1JWF A;  3E30 A;  3AG3 E;  4A55 A;  4JC8 A;  3KAE A;  4Z68 A;  4U0S A;  1HO8 A;  1OUV A;  1JPL A;  1LTX A;  2CG3 A;  5FZQ A;  4DJA A;  1N0R A;  2LAI A;  3PRE A;  4JXT A;  3GZ2 A;  2X6J A;  3E33 A;  3MKQ A;  4CT0 A;  4C9B B;  4P29 A;  1UN8 A;  3FUJ A;  4AM9 A;  3T5V A;  2XCC A;  1H0A A;  1GW6 A;  1TJC A;  3CVU A;  4Q94 A;  4ABN A;  4J8E A;  1FPP A;  3HIZ A;  2I1K A;  5KNH D;  4PS7 A;  3X2Q E;  2L9B A;  3DSX A;  5BT1 A;  4OAU C;  3EU9 A;  2WXN A;  1S70 B;  4LNU D;  4BX9 A;  2DYS E;  2H6G A;  1HU3 A;  3B7U X;  1OCZ E;  4F53 A;  2P9S G;  2RD0 A;  5BXU A;  3ASN E;  4F3V A;  5AEN A;  1BI7 B;  4L1B A;  2VGE A;  4ATG A;  1MX6 A;  3SQV A;  5CMY A;  3HDX A;  1V55 E;  3P1U A;  5BNW A;  1WY6 A;  2FUL A;  1JUQ A;  2YQ8 A;  3SFY A;  1INZ A;  3PNT B;  4YDE A;  3B7R L;  4DRX E;  2OEV A;  2JEK A;  3LKU A;  4U63 A;  1WAO 1;  3UI2 A;  1Z3X A;  2EIJ E;  2WB2 A;  4HI9 A;  3Q7A A;  3HXF A;  3JCK C;  4CDR A;  5AQ7 A;  2Y69 E;  3D9N A;  5FQ4 A;  4N5C A;  2QC9 A;  3UM0 A;  1TNU A;  2WXR A;  3AS4 A;  1O1T A;  3BG1 B;  2BKK B;  1N9A A;  3UT8 A;  2UY1 B;  3ASO E;  3AG2 E;  3AAA C;  2FF4 A;  1D8D A;  3U64 A;  3CVV A;  4G2V A;  3FUL A;  3UM2 A;  4U04 A;  3CVY A;  4EPZ A;  1E7U A;  4GZD A;  5G05 C;  2F8X K;  4CT4 A;  2VTB A;  1A5E A;  2VGX B;  2AXZ A;  4I6J A;  3SFX A;  4GTR A;  5A6C A;  3T5X A;  3ASH A;  4HXI A;  1V54 E;  4LNB A;  3AS5 A;  5T3R A;  2ZIS A;  1KZO A;  2J8S D;  1A17 A;  3FU3 A;  3RAU A;  5KJK A;  1H2T C;  3SF4 A;  3QC1 A;  3C5R A;  3I5P A;  4BT8 A;  1QNF A;  3SZ7 A;  2YNQ A;  4HOT A;  3MV2 B;  4UWK A;  3JYS A;  1OY3 D;  1OCR E;  5A7D B;  3UIN C;  2XS1 A;  3Q9N C;  3J5Q B;  1Z6T A;  2EQX A;  2KAT A;  2YHC A;  5CHE E;  2PM6 A;  2XPY A;  3APD A;  5B3S E;  3FU0 A;  4GTV A;  4ATZ D;  5EDS A;  5C2Y A;  4G23 A;  4MBG A;  3FTY A;  1BU9 A;  4AEZ C;  3IBE A;  4APF A;  2IJG X;  4WWP A;  1IHB A;  3JQ1 A;  4JEU A;  2L0T B;  3MYV A;  3TG4 A;  1N4Q A;  3MX3 A;  4J7W A;  3SFZ A;  4DX2 A;  4G11 A;  3FP3 A;  3ZKJ A;  2KCL A;  4J8F A;  3D9H A;  3ESL A;  5EIL A;  4HRL A;  3ZGQ A;  3B7B A;  4DLO A;  2PQN A;  1HXI A;  3V30 A;  4WNG A;  3FTZ A;  3DEO A;  3V31 A;  1YMP A;  2L6J A;  3HHM A;  3TJP A;  5FTP A;  1DCE A;  3IKO B;  4GYW A;  3UMV A;  5LCW C;  5ITZ F;  4LEU A;  5BXO A;  2XGO A;  3L13 A;  2WXH A;  1TJF A;  1HG2 A;  1N4P A;  4KBQ A;  5KNG A;  4ANV A;  2PZI A;  4FHJ A;  3L16 A;  3JUI A;  4KXK B;  4GA0 A;  3ZHE A;  4DLQ A;  2R05 A;  2AWI A;  1K8K G;  3QB2 A;  3KD7 A;  3TWS A;  3ASF A;  5KJN A;  4N5Q A;  4IRU A;  3ZXP A;  1SA5 A;  2XS8 A;  4IYP A;  1SZ9 A;  2X3M A;  4O60 A;  3ULE G;  3TWU A;  1K1A A;  2EIN E;  4DUI A;  2KZT A;  2XZD G;  3DSV A;  3LXU X;  3TWW A;  1MJ0 A;  4HQD A;  3LS8 A;  4BTA A;  3APC A;  3TAX A;  3C98 A;  3LJN A;  5FQ8 A;  4GCN A;  3PNL B;  2OVB A;  1OWM A;  2E2E A;  5A23 A;  3PRZ A;  1NA3 A;  2YIN A;  2XEN A;  3GYZ A;  5CRV A;  5FIN A;  3KSQ A;  3AS8 A;  4UWF A;  2DYR E;  4B89 A;  1TNO A;  2X6H A;  2CHX A;  4V3I A;  2QYU A;  1NI1 A;  4UQX A;  3TL5 A;  5J90 A;  3SGH A;  5AJD A;  4ME2 A;  2J9Q A;  3RJV A;  5T4Y A;  3CR3 A;  3J5P A;  3MEK A;  1N4R A;  3RRU A;  1N95 A;  4Q96 A;  4I17 A;  3EDT B;  2V5F A;  4OYS A;  4I9E A;  2A4Z A;  4X8Q A;  5G05 J;  2IEJ A;  3CST A;  2WM9 A;  3Q7F A;  4EHM A;  1UOH A;  3K9I A;  3L08 A;  2WXO A;  2WXK A;  4MS6 A;  3LY8 A;  5AN8 A;  2Y4U A;  2WXI A;  3WG7 E;  4ANW A;  1LF8 A;  2GRQ B;  3ENE A;  4HB5 A;  3JXJ A;  4NRH B;  3CV0 A;  1JWG A;  4ANX A;  4KT6 B;  4XI0 A;  3FUH A;  4I1O B;  1H2V C;  3V79 K;  3UXG A;  3FTX A;  5JA4 D;  5EN5 D;  4HFG A;  3ASD A;  2LNI A;  4BSZ B;  2WMN A;  4GTP A;  3ZYL A;  2AVP A;  1KZP A;  5FJY A;  1MX2 A;  1S0P A;  4UQY A;  2I9C A;  4CYM D;  3HG0 D;  4URK A;  4RSY A;  2JAB A;  3JXI A;  4DI3 A;  5EX0 A;  3UKU G;  2BED A;  2WQ6 A;  2BUG A;  3Q15 A;  4LER A;  4EBA A;  3AG4 E;  4FLB A;  3UTM A;  1SQM A;  4B93 B;  1N11 A;  3ZNG A;  3EUV A;  3L22 A;  4B0Z A;  3Q5M A;  3DXK G;  4TV3 A;  1IQR A;  3QKY A;  3E37 A;  4G1T A;  3UX4 A;  1TN6 A;  4AOF A;  2VJ8 A;  3BEE A;  3AU4 A;  4M3O A;  2C2L A;  4I9C A;  1E96 B;  5ENR D;  3ZHE B;  1ZB1 A;  1TEZ A;  3U9W A;  2R59 A;  5CED B;  4UI9 K;  5LCW J;  2WXF A;  3RRN B;  5EKQ D;  4KYO B;  4JPS A;  3SI5 A;  3ZEF A;  3CHM A;  1AWC B;  1L5J A;  3EU5 A;  3ZUV B;  4JL0 A;  2EIK E;  3R9M A;  4Y6C A;  3ASG A;  3Q49 B;  3FTU A;  2KZT B;  3MKR A;  2XGM A;  2J4D A;  2DVW A;  3HXB A;  4L7T A;  5KJL A;  5FWQ A;  3V2X A;  3D9P A;  3PEV B;  4H7Y A;  2PM7 A;  1YA0 A;  4O1O A;  3LY9 A;  2XEH A;  1MQS A;  3L6A A;  1W3B A;  2QFC A;  3DST A;  4IN3 B;  3ZVV A;  4N3A A;  1SZA A;  4EEC A;  2NC9 A;  4N2S A;  4YVO A;  2QZA A;  2LXM A;  2Y3A A;  3QDN A;  1DVP A;  3G2S A;  5AAO A;  4YVQ C;  2Q7F A;  5B1B E;  4QQI A;  3TXM A;  2LSV A;  2DZN A;  4FU3 A;  5CEA A;  3KS2 A;  4DX5 D;  4L9P A;  3DPY A;  4U07 A;  4UI9 C;  1IYG A;  3I4G A;  4WNE A;  4PH4 B;  4IUL A;  5AQ9 A;  5CEC B;  3PH0 C;  3NZS A;  3ZFW A;  2OND A;  4KZ0 A;  3CHR A;  2IY0 C;  3IEG A;  5ENO D;  2ZU6 B;  5ARG A;  3RIB A;  4TUM A;  2VQ2 A;  3ABL E;  4DX1 A;  3CVL A;  3PS6 A;  4RG6 A;  3C3O A;  3EHM A;  3O48 A;  5HI7 A;  4JZY A;  4G24 A;  3QAR A;  2I1J A;  3O4Z A;  4GTT A;  3L17 A;  2GRP B;  3FEY A;  2DCP A;  1H2U A;  3PZ2 A;  1ELR A;  4WAF A;  2HO1 A;  4GZ6 A;  3B13 A;  3NBN B;  2XZT G;  4JHJ A;  4CCA A;  2C0M A;  4E6H A;  3QWW A;  1OWP A;  3LEW A;  3FFL A;  2OEW A;  3F6Q A;  3OTN A;  3R9A B;  4GYO A;  5JJ6 A;  5BUZ A;  4BET A;  1TNY A;  4A1G A;  2WQH A;  4UWL A;  4DX6 D;  4FP7 A;  3PUK A;  4N3C A;  5CCM A;  2VSN A;  2VYI A;  2H6H A;  1IHG A;  4GMR A;  3Q78 A;  3WXX A;  2P9P G;  1OT8 A;  1FCH A;  2FO1 E;  1OWL A;  4XX5 A;  1KPS B;  1OWN A;  2FEZ A;  3TWT A;  3ONK A;  3PVL A;  2V0P A;  3PUJ A;  2UWJ G;  1O1S A;  1N52 A;  3FUF A;  3C72 A;  1KT0 A;  3ZXS A;  4MKT A;  3PEU B;  2JLB A;  4F1P A;  1H6O A;  4OVU A;  4H7X A;  4DX7 D;  3AU5 A;  4OVV A;  1LD8 A;  2IOS A;  4I1M A;  4LRZ A;  3P2B A;  4AY6 A;  4LSZ E;  1ZBP A;  3FH5 A;  5D2M C;  4OAV B;  2IO3 C;  3T8M A;  3HVE A;  4TXQ A;  2J09 A;  3MKQ B;  3UT4 A;  2I6H A;  4F6R D;  5AQA A;  5CER B;  1E90 A;  3NOC D;  1QQE A;  3CK7 A;  1TR4 A;  4TXR A;  2GRN B;  1RW2 A;  3R7R A;  4NUR A;  4FAD A;  2Y4T A;  3FHE A;  4FUL A;  3BU8 A;  2KBX A;  1O1R A;  3EIJ A;  3GZ1 A;  2E0I A;  2P9N G;  2XHE A;  3RK6 A;  4J8Y A;  4B8A A;  2GW1 A;  4G25 A;  4G8L A;  3AJI A;  4WND A;  2ETB A;  3Q79 A;  3ZPJ A;  1H6K A;  4ZHB A;  5EYL A;  3NF1 A;  5EX3 A;  4I2W A;  3LDZ A;  4HI8 A;  4F1S A;  3MGB A;  3MA5 A;  4U8V D;  1WM5 A;  4YDW A;  3OXF A;  4KVO A;  3G2W A;  1DNP A;  2GRR B;  3MZL B;  5ENT D;  3LCA A;  4W9R A;  2PNN A;  2KCV A;  4JEH A;  5E75 A;  2HM8 A;  2ZXW E;  5H7P A;  2MRI A;  3TG5 A;  4J8S A;  4GPM A;  4KZC A;  3C3R A;  4UI9 J;  2VSO E;  1H6P A;  4AY5 A;  2R17 C;  3BUA A;  2DIW A;  2J07 A;  4PS3 A;  3ZYK A;  2A5U A;  4GCO A;  1UJJ A;  3G2V A;  4NQ0 A;  4AIF A;  4L2Y A;  3NQP A;  4JD2 G;  2GRM A;  2IOL A;  1PC2 A;  2XGS A;  5ANR A;  1K1B A;  1ELW A;  1SVX A;  4JHR A;  4TXP A;  5G2N A;  2XRZ A;  2VSX E;  4F7A A;  4U7E B;  1DC2 A;  2NSZ A;  3JUE A;  4PUC A;  2GRO B;  3FH7 A;  3FUN A;  4WNF A;  5BV1 A;  2QYJ A;  1OXJ A;  3R7Q A;  2VTB B;  3G2T A;  4YDY A;  4TRQ A;  3AG1 E;  1MYO A;  2X6K A;  4HS2 A;  3I3N A;  3B7S A;  4I1A A;  1MX4 A;  3CHO A;  5DIZ A;  3ZIM A;  2FI7 A;  4GMJ A;  3GW4 A; 
#chains in the Genus database with same CATH homology
 2B0O E;  5ENP D;  2A5E A;  3AAA C;  2V5Q C;  1BI8 B;  2DZO A;  5ENT D;  1IKN D;  5AQB A;  5CED B;  4RLY A;  3TWX A;  4F1P A;  4K5B A;  2PNN A;  4BES A;  3W9G A;  1D9S A;  4O60 A;  1G3N B;  3TWU A;  4DX7 D;  4UUC A;  1K1A A;  2V4H C;  4J7W A;  4DUI A;  3NOG D;  5KWD A;  4DX2 A;  1WG0 A;  2XZD G;  2BKG A;  1AWC B;  3TWW A;  5KNH D;  3EHR A;  4LG6 A;  4NIK A;  1MJ0 A;  4HQD A;  5EID A;  3V79 K;  1WDY A;  3ZUV B;  3V2O A;  3TWQ A;  4OAU C;  3ZKJ A;  2Y0B G;  3EU9 A;  3D9H A;  5D66 A;  3UXG A;  3NBN B;  5JA4 D;  2XZT G;  3LJN A;  1S70 B;  5EIL A;  4GPM A;  4HRL A;  5EN5 D;  1BLX B;  2F8X K;  2NYJ A;  3B7B A;  4HRN A;  1A5E A;  3HRA A;  4LSZ E;  4HRM B;  4LNU D;  5EIB E;  4BSZ B;  1YCS B;  5CBO A;  3V30 A;  5JMN D;  4OAV B;  2DVW A;  2ETA A;  1QYM A;  2XEN A;  3ZU7 B;  4BEP A;  5BXU A;  3F6Q A;  5EYP F;  3DEO A;  4HBD A;  5FIN A;  4HLL A;  3V31 A;  5ENQ D;  3V2X A;  3KEA A;  2ETC A;  1MX2 A;  1YMP A;  4JB8 P;  2AJA A;  1BI7 B;  4CYM D;  4BET A;  4CZ2 D;  3HG0 D;  4O1O A;  4O1P A;  2VGE A;  2RFM A;  2XEH A;  4F6R D;  2F8Y A;  2ZGG A;  2J8S D;  2JAB A;  3JXI A;  5AQA A;  5CER B;  1NFI E;  1MX6 A;  5HKP A;  2RFA A;  3TWV A;  4DX6 D;  1K1B A;  3NOC D;  2MYO A;  1SVX A;  2P2C P;  3T8K A;  1TR4 A;  4U95 D;  4G8K A;  1YYH A;  3DEP A;  2DWZ A;  3C5R A;  4U8Y D;  3T9K A;  3J5P A;  3EHQ A;  2F37 A;  5ITZ F;  5AAO A;  1DC2 A;  4U96 D;  3TWR A;  2Y1L E;  3UTM A;  5BXO A;  4GMR A;  3JUE A;  4QQI A;  2KXP C;  2DZN A;  2KBX A;  4HNA D;  4B93 B;  3IXE A;  2QYJ A;  1N11 A;  5CEA A;  4ZFH A;  4DRX E;  1OY3 D;  2HE0 A;  4DX5 D;  1IXV A;  3ZNG A;  4YDY A;  5KNG A;  2XEE A;  5ENS D;  3Q9N C;  3UI2 A;  4J8Y A;  4G8L A;  5HRY A;  1OT8 A;  3AJI A;  5AAR A;  3J5Q B;  4QFV A;  2ETB A;  1DCQ A;  3Q9U C;  4HI9 A;  5KBA A;  1BD8 A;  1AP7 A;  1MYO A;  3W9F A;  1UOH A;  2FO1 E;  3SO8 A;  2ZGD A;  5AQ7 A;  5AQ9 A;  5CEC B;  4K5C A;  4ZHB A;  4BER A;  5AN8 A;  5CBN A;  5EYL A;  2QC9 A;  3TWS A;  4Z68 A;  4HI8 A;  5ENO D;  2L6B A;  1SW6 A;  4ATZ D;  4N5Q A;  1MX4 A;  1N0Q A;  5FIO A;  4K5A B;  3TWT A;  1N0R A;  4TUM A;  4U8V D;  4HB5 A;  5ENR D;  5HS0 A;  4A63 B;  1BU9 A;  4DX1 A;  4YDW A;  1K3Z D;  2BKK B;  3B95 A;  3JXJ A;  4C48 B;  1IHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...