1YYHA

Crystal structure of the human notch 1 ankyrin domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the human Notch 1 ankyrin domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle,transcription
molecule keywords Notch 1, ankyrin domain
total genus 68
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1yyhA00
2BKKB 2B0OE 5CBOA 4DRXE 3W9GA 3V79K 5AN8A 3LJNA 5ENSD 1SW6A 2VGEA 3ZKJA 1K1AA 3T8KA 3T9KA 5ENQD 3TWQA 2F8XK 2Y0BG 3D9HA 4QFVA 4DX6D 4TUMA 5KWDA 4HBDA 5EIBE 4HI8A 2F37A 5EN5D 5CEDB 1N0QA 3TWXA 3V2OA 4O1PA 1BD8A 5KNHD 4RLYA 2DWZA 4HNAD 5AARA 4ATZD 1YMPA 4BESA 4HRNA 3J5QB 1MJ0A 1MX4A 1MX2A 3SO8A 4DUIA 4F1PA 5ITZF 3V2XA 2J8SD 3F6QA 1AP7A 1SVXA 2KXPC 4K5CA 1D9SA 3B7BA 4BETA 1DCQA 3DEOA 1AWCB 4HQDA 4CYMD 4O1OA 4K5AB 2FO1E 2HE0A 2QC9A 3DEPA 4QQIA 3JXJA 4N5QA 5BXUA 1WG0A 2AJAA 2QYJA 2ZGDA 2DVWA 5AQAA 3V30A 4B93B 4YDYA 3TWSA 4BERA 2Y1LE 3AAAC 5FIOA 2A5EA 1N0RA 2KBXA 4DX1A 3TWUA 2F8YA 1MYOA 4YDWA 5CECB 2V5QC 4GPMA 1WDYA 4DX5D 4A63B 5ENTD 2RFAA 2XEEA 4LG6A 3HRAA 5JA4D 3AJIA 1A5EA 4J8YA 3EU9A 3V31A 3Q9NC 1BI7B 3EHRA 4Z68A 5CEAA 1K1BA 4G8LA 4G8KA 5EYLA 4J7WA 2RFMA 3TWWA 3B95A 2MYOA 5EIDA 5KNGA 4O60A 2XZDG 4C48B 1BU9A 4U8YD 4OAUC 1NFIE 2JABA 2DZOA 5HRYA 4F6RD 1BLXB 2NYJA 5D66A 4DX2A 4HB5A 3TWRA 4GMRA 4HRMB 4HRLA 4U8VD 3UI2A 4HLLA 2DZNA 3ZU7B 3ZUVB 1IHBA 3IXEA 4ZFHA 5AAOA 5CERB 1DC2A 5HKPA 3C5RA 1UOHA 4U95D 3HG0D 3KEAA 4LSZE 5AQ7A 1TR4A 2ETBA 3NOGD 3J5PA 1IXVA 4U96D 1OY3D 5HS0A 1YYHA 1K3ZD 4HI9A 5AQBA 2ZGGA 1MX6A 2V4HC 2BKGA 2XZTG 2P2CP 2XENA 4NIKA 5JMND 1IKND 5ENOD 3TWTA 4LNUD 3NOCD 3TWVA 5EILA 4BEPA 4BSZB 3NBNB 1OT8A 4ZHBA 1YCSB 4CZ2D 2PNNA 3UXGA 1QYMA 1N11A 2L6BA 4K5BA 5ENPD 3Q9UC 5EYPF 3JUEA 1S70B 4UUCA 3UTMA 3W9FA 2XEHA 5ENRD 4OAVB 2ETAA 3JXIA 3ZNGA 1G3NB 5BXOA 2ETCA 5AQ9A 3EHQA 4DX7D 5CBNA 5KBAA 1BI8B 4JB8P 5FINA
chains in the Genus database with same CATH superfamily
4J0UA 4LERA 1KZPA 2OCCE 3ZKJA 3T9KA 2Y4TA 3ASOE 2WQHA 4FJZA 3BQOA 1E7UA 3CGHA 3CV0A 5EN5D 1JCSA 4AJWA 3PZDA 1BD8A 5FZRA 1LF8A 4LNGA 5A23A 4DUIA 3LVRE 3J5QB 3FU3A 4K5CA 4FP7A 1DCQA 4GA0A 5KCMA 2X3MA 2L0TB 3ML9A 3JXJA 1N54A 5LX8A 2ZIRA 5AYWD 4I2ZA 2QZAA 3JQ0A 3LCAA 2PQRA 5G04J 3TJPA 2RFAA 3EHRA 1E8ZA 1RZ4A 2RFMA 2J07A 3B95A 3CLJA 4MKTA 5FQ4A 4DI4A 5D66A 2V0PA 4HB5A 2IFUA 3FUNA 3GZ1A 3UI2A 4KBQA 5J08A 3KSQA 1DC2A 3ZYQA 5BV1A 4J8FA 1UOHA 2OVFA 5BPPA 1XNFA 3Q5MA 4UWFA 3EU5A 3FUIA 1OWPA 5AENA 1X5BA 3OTNA 1K3ZD 4N2SA 4I9CA 4GTRA 4GTQA 4GZ5A 4EQFA 4GZCA 3L08A 3Q75A 4GTMA 2J08A 2H6HA 3O4ZA 5EILA 3DSVA 4K5BA 3DPDA 5G05J 2CHWA 1NI1A 3VLFA 3DBSA 3OXLA 4JZYA 4XE0A 5ENRD 3UT8A 2KZTB 2J4DA 2Q7FA 5CBNA 5KBAA 5FINA 3DWLG 3L16A 2WXOA 4DRXE 2JEKA 3ISMC 2PL2A 1N4QA 3FY4A 1UN9A 4M3OA 4GTOA 3D9OA 4UQXA 4BESA 3AG2E 3PRZA 1LTXA 1TYQG 2HM8A 2AXUA 2LAIA 4LEUA 1H6PA 3TXMA 1TEZA 3P1UA 3FUEA 4APOA 2OVBA 4BERA 3S2AA 2OV8A 3BEEA 5BT1A 1MYOA 4APFA 4FLBA 1WDYA 4DX5D 2IJGX 4MBGA 2R02A 4J8YA 4GMLA 4MLPA 3MJWA 5FTPA 4C0MA 5CRVA 3LEWA 5EIDA 3B7RL 3EIJA 3JQ1A 1Q2ZA 1TNBA 2J9QA 4WWPA 4KVOA 1N94A 3C5RA 3KEAA 4LSZE 1TR4A 2KZTA 4BT9A 5B1BE 5CRUA 3AS4A 4CDNA 1DCEA 1MHQA 2VYIA 2XGMA 1OWOA 3D9PA 1K8KG 3ASGA 3NZUA 4JA7A 2IY0C 2XEHA 1B89A 2F0YA 2BKKB 4KYOB 3PE4A 5B3SE 3B7SA 3ULEG 2CFZA 2RKKA 1EYHA 1NZNA 4N3AA 2XQ0A 3TWXA 2FULA 4HNAD 3AS5A 5T8IA 2EIJE 3SO8A 3CEQA 2PM6A 3HHMA 2XEVA 4NQ0A 5LFAA 2KCVA 3MKRA 3ASNE 2LAHA 2FO1E 2HE0A 3AS8A 4QQIA 3UM0A 3V30A 2DYRE 1SZ9A 5JHAA 3AAAC 3FU0A 4EHMA 4DX1A 4N3CA 3QWWA 2EIKE 4GTTA 4DLQA 4FC8A 2DCPA 3RK6A 4BTBA 5AIJA 1MZCA 2IF4A 2XZDG 4XKBA 4U04A 4EPZA 5BNWA 4F6RD 4DX2A 4U8VD 3WG7E 3ZU7B 2LXLA 1H6OA 3L22A 4N3BA 3AG4E 1YYHA 3Q49B 2ZGGA 4U0ZA 1HZ4A 2BKGA 3ZPJA 4OYSA 2GROB 4IRUA 5JMND 4UWLA 4L2YA 4BSZB 3GW4A 1H0AA 3FEXA 4JPSA 1E8XA 4JA9A 5FZSA 4BX8A 2Y69E 3ZXPA 3APDA 3ZVVA 4Q96A 2IO3C 4AVXA 2LUHA 2CHXA 4I1OB 1FT1A 4TUMA 3EUVA 3CK9A 1O1TA 1ZU2A 1HG2A 2FI7A 4EBAA 4F1PA 3DXMG 1N4SA 4AY5A 3RRNB 2VGXA 4BETA 3DEOA 2IONA 4XZ4A 2MRIA 2DIWA 3FDHA 2ZGDA 3PDNA 5FIOA 4JXTA 3TG4A 3IHVA 3I4RB 3QNKA 3MYVA 2LO6A 3HXBA 1NA0A 3SD5A 5CCLA 3SFXA 4N5CA 1NFIE 3OXFA 1JWGA 4GZDA 1SA4A 2NYJA 4HOTA 3QJZA 4A55A 2DZNA 3MEKA 1IHBA 1O1RA 2IU1A 3HYMB 3ASHA 4M7CA 3J5PA 4ACLA 3UM1A 3HXEA 2EQXA 3CSFA 4CGVA 1EF1C 2WMOA 3CVWA 1S70B 3ZN3A 4UWHA 3D9NA 3JXIA 3FH8A 3EHQA 3LYAA 4FA6A 3FU6A 3S7DA 3V79K 2QY7A 4HLEA 2VGYA 2VSXE 4GTSA 3D9HA 4XKCA 5FZQA 2XPIA 4HRNA 3FUFA 4UQZA 5ITZF 5KJNA 1E8YA 4ILIA 2CFUA 3GYZA 2CG3A 2X6JA 2H6IA 3T5VA 2XHEA 3CQGB 3N71A 4BTAA 2XGOA 3ASDA 1JPLA 2UY1B 2FF4A 4GA1A 3E37A 3SGHA 5FWQA 5FQ7A 3ZIMA 1U2VG 3TWWA 4RQIA 5LCWJ 5JHBA 4PH4B 2WXLA 4HVBA 4KMOA 3C3OA 3UT7A 4BY6A 2ILRA 1EDUA 3KD7A 1Z3XA 4J8EA 3G2SA 3Q79A 3HVEA 4JD2G 1UG3A 4BT8A 3PH0C 3PUKA 1W3BA 5IY5E 1SQMA 4CT4A 2RD0A 4UI9J 4CZ2D 1QYMA 4H7YA 3KEZA 4JL0A 4ILHB 3KS2A 1NA3A 3L54A 4FJYA 3QDNA 4CDRA 2FEZA 2VSOE 3ZHEB 3AG3E 4G1TA 3PZ2A 2I9CA 4N39A 3FUKA 2UY1A 3R9AB 1SW6A 3QOUA 2GRLA 2F8XK 4QFVA 2F37A 4GCOA 5A6CA 3S7JA 2FO7A 5BUZA 3DXKG 2DWZA 4RLYA 3F6QA 1D9SA 3RRUA 4I6EA 3EHNA 4NACA 4RSYA 3D9JA 2Y1LE 1HO8A 4UWKA 4NURA 5AJLA 3PNTB 4GPMA 5G55A 2XPZA 4J7WA 5EKQD 3TXNA 3ABKE 2P9PG 4HOQA 2EINE 4HRLA 5H7PA 4CT0A 4MS6A 4EZJA 2PM7A 5AQ7A 3FTZA 1KPSB 2IQCA 4D10C 4N2QA 2WXGA 2QYUA 3ABLE 3TAXA 3D9MA 4U0SA 3SHFA 3TWVA 4B8AA 3DSXA 3UXGA 1JCQA 5ENPD 1D8DA 3HIZA 5CMYA 1VDYA 4DX7D 2P9UG 2IOLA 4F1SA 1TJCA 5D0OD 3SBSA 3W9GA 3C98A 3ESKA 5ENSD 2VGEA 2GGFA 1KZOA 3FTYA 4DX6D 4HI8A 2XPYA 3V2OA 5KJMA 3TL5A 4K0RA 3QAQA 1AP7A 2WVIA 4AXHA 3RAUA 3B7TA 3SI5A 3FUDA 3HXCA 4I9EA 3O48A 4G25A 1U3CA 3G2VA 5FQ6A 2KCLA 2F8YA 4C9BB 3SF4A 2OEVA 3C3QA 3AJIA 3DRAA 3CK8A 2V8SE 4U8YD 2KM4A 2AWIA 3L82A 3DSWA 2M63A 5CHEE 3TWRA 2WM9A 3FP3A 1FPPA 1WY6A 2I6HA 3CVNA 3SBTB 3R7QA 4CGWA 3BG1B 3PEVB 1TN8A 4GTPA 4HFGA 4WNFA 4E6HA 4WNGA 5M72A 3AU4A 3PVLA 3PZ4A 1OT8A 3UM2A 2L6BA 1SA5A 3IBEA 4WWOA 3ZNGA 5B1AE 3ABME 4PDXA 5EX0A 4YDEA 2V5FA 1YA0A 2HR2A 4HORA 4GYWA 5D2MC 5AN8A 3LJNA 1K1AA 1N95A 2Y3AA 5KWDA 1HXIA 3FTXA 2R59A 3ZW3A 5FQ8A 2GRMA 3UINC 1XGWA 2J8SD 4GA2A 1TN6A 3FTVA 4I2WA 4CYMD 4WNDA 2DBAA 3FUJA 3TWSA 4RG9A 2YNQA 3FEYA 4ATGA 4B89A 3TGOA 4G8LA 3CQCB 5KNGA 4FHJA 5JJTA 2FBNA 5DBKA 4WUYA 4TXRA 4XEIG 2OOEA 1GW6A 4HRMB 4L9PA 4IN3B 2AXVA 2NXPA 1OCRE 5CERB 5AAOA 4ZFHA 3NQPA 4Y6WA 4U95D 3PZ3A 1UJKA 3FHEA 1A17A 5CMWA 4GTVA 4IYPA 4GZ3A 1JWFA 3EHMA 1IYGA 1KLXA 1O5MA 5BV0A 3MA5A 3LXUX 4UUCA 2IEJA 1ELWA 4U63A 5AQ9A 1LD7A 5ANLA 3RSEG 1ZBPA 3DSSA 1L5JA 4YVQC 1H2TC 3CVQA 3Q15A 4ANWA 1D8EA 1N0QA 5LCWC 1UW4B 3E4BA 3FULA 3RRMB 4B0ZA 4L1BA 4L2LA 2LSUA 4HQDA 3ZYLA 3ONLA 1OCCE 2Y4UA 2P9NG 4MRUA 4YDYA 2B6CA 3UKUG 4G11A 5D0QD 2KBXA 5CECB 2HYZA 4PUCA 2WXJA 2XEEA 3MZLB 3MX3A 2WXFA 4YVOA 4UI9C 2MYOA 2WXNA 3ASFA 1N9AA 2BEDA 3VTYA 2AVPA 2MHKA 4HS2A 4I43A 1QNFA 4V3IA 4I1AA 1JUQA 3CK7A 2WPVA 3ZFWA 2WXPA 4BX9A 2L6JA 2XRYA 4YNDA 2AW6A 3S7FA 3NOGD 4BWRA 1IXVA 3PE3A 4LNBA 3ZYMA 4I17A 5HQ8A 4K03A 3S7BA 2WXMA 3IV0A 5T3RA 1OWNA 3UM3A 1OCZE 5EYPF 3ESLA 2KCKA 3UQ3A 3U3WA 1H19A 1BI8B 2B0OE 3T5XA 2BF0X 3HXFA 1V55E 1FT2A 1LD8A 1OWLA 1Z5SC 3LJ3A 4Q94A 3T8KA 1KT0A 2VJ8A 2Y0BG 3AG1E 3SFYA 2GRQB 3CHOA 1WM5A 5CEDB 4AIFA 2C0LA 3PS6A 3CR3A 1MJ0A 2GRNB 2KXPC 3B7BA 2GRPB 3EJNA 3E33A 4YDOA 5E76A 1OXJA 4JC8A 2DVWA 4B93B 3LY7A 3OXGA 3CIAA 4ILGA 2HO1A 3IHYA 5C2YA 4U07A 4B8CB 4BSXA 5EYLA 4G8KA 4FHKA 3UUXA 3GZ2A 4DK5A 2PZIA 4GCNA 4GMRA 3IXEA 5ARFA 3UIPC 4A1GA 2WXRA 1MX6A 5T4YA 3U9WA 1E7VA 1IHGA 1HF8A 3BU8A 3AU5A 3RJVA 4G2VA 3I5PA 4AV7A 4U7EB 2R05A 3QWVA 3FUHA 5DIZA 4J8SA 3UPVA 2WXIA 3UTMA 4E85A 5G04C 4GYYA 4OAVB 4JB8P 2KATA 4WAFA 3ML8A 1U3DA 3D9IA 3LPZA 4KVMA 4HXIA 3EDTB 3NAWA 4KZCA 5FT9A 1ZB1A 3B13A 4DPRA 4G23A 4OVVA 3IEGA 3C3RA 3NF1A 1QZ2A 4PS8A 5ARGA 4ME2A 1JCRA 4JEHA 3I4GA 2YHEA 5JA4D 3LY9A 3C72A 4Z68A 5CEAA 2VSNA 4O60A 3ZGQA 5E75A 2WXKA 1PY1A 3HVEB 3L6AA 2DZOA 2DYSE 4EECA 4KT6B 3CVVA 3E30A 4EZLA 3EIQC 3Q7FA 3E34A 1OY3D 5KJLA 3FH5A 3CHPA 4WNEA 4NIKA 3Q73A 2X6KA 2ZU6B 3TWTA 2ZXWE 4X8QA 5G05C 4LNUD 2PQNA 1H6KA 1YCSB 4XX5A 3NZSA 3PZ1A 3LS8A 1G3NB 2ETCA 3WXXA 1MQSA 1QQEA 2KC7A 3UT4A 3FWVA 3MV2B 1X81A 4AM9A 5CBOA 2P9SG 3ZEFA 5ENQD 4WWNA 1TNOA 4HBDA 3RO2A 4ATZD 3KAEA 2L0IA 1FCHA 1MX2A 2H6FA 1HE8A 4OVUA 4A3TA 3SQVA 1TN7A 3Q47B 3FTWA 2QYJA 3TG5A 2QFCA 3G2WA 2VSYA 4GMJA 4A63B 1K1BA 4JW1A 4Q69A 4DJAA 1OUVA 3QKYA 2V4LA 4GZ6A 2WB2A 5C1DA 4G26A 2IO2C 3JCKC 5HRYA 3U64A 4HLLA 2A4ZA 2XCBA 1V54E 1DNPA 1HG5A 4HOSA 1HS6A 2BTDA 3HG0D 2ZISA 3U66A 4ANVA 4HI9A 2V4HC 2XZTG 2P2CP 5G2NA 3LKUA 4TXPA 3ZHEA 4XI0A 3QB2A 4BEPA 4ZHBA 2PNNA 1N11A 4FLHA 4F53A 1FVHA 4I1MA 1ELKA 2WQ7A 4LUNU 3CVXA 3BUAA 2CG2A 3SY2A 3VLEA 3RKVA 5EDSA 4KZ0A 4GB9A 5CCMA 5HI7A 4PS7A 2LSVA 3G2TA 3QK0A 4O1PA 2I1JA 4TV3A 4XIFA 1SVXA 3FTSA 4O1OA 4ANUA 2QC9A 3DEPA 2EILE 4N5QA 5AQAA 2R5SA 2CHZA 4O6FA 1N0RA 4AY6A 3PREA 3PUJA 1UN8A 2GW1A 3RU0A 4LG6A 4ABNA 4U8HA 4GU5A 4UQYA 3V31A 3CHMA 3SFZA 2UWJG 2IOSA 3Q4AB 3OAWA 4FULA 5J90A 1N52A 3URZA 3QARA 3QC1A 1H2UA 3FTUA 2MOWA 1QBQA 1TNZA 5EX3A 2H6GA 3L17A 5HS0A 2BUGA 3K9IA 4URKA 2E0IA 1S63A 4J6IA 3PEUB 4TXQA 2XENA 1NL4A 4P29A 4RVBA 3DPYA 1INZA 3JYSA 3KSLA 3Q9UC 4L7TA 3JUEA 3CHQA 3MGBA 4Y6CA 4H7XA 3GZSA 4UI9K 3NB2A 4DI3A 5EIBE 3D9LA 2XS8A 5KNHD 4G24A 3MKQA 1YMPA 3E32A 4JHKA 1MX4A 2R17C 2NC9A 1AWCB 3CHRA 3APCA 3VTXA 3ENEA 2YHCA 4EZKA 3CHSA 3CSTA 2A5EA 4CCAA 4LRZA 3ONKA 1H2VC 4R7LA 3LVQE 3HRAA 3G2UA 1N4PA 2NSZA 4GAAA 3T8MA 2J09A 4CDMA 4OAUC 1E8WA 3ULYA 2EIME 1E96B 5LP0A 3Q78A 1BLXB 5LOZA 4B94A 3MV3B 3CVPA 2C0MA 3R7RA 3DSUA 5KJKA 3RIBA 5AQBA 4ANXA 5BW8C 4XI9A 1EPUA 4EBAG 5ENNA 1UJJA 5ENOD 4A3VA 1IQRA 1RW2A 3UKRG 4CRWA 3JUIA 4C0EA 2VQ2A 1E90A 4TRQA 4CEMA 2X6HA 3UIOC 5JJ6A 4PS3A 1TNYA 1S0PA 5BXOA 3U4TA 2X6FA 3X2QE 3BG0B 3UX4A 1S64A 3TWQA 2WXQA 4NRHB 1BPOA 3D9KA 5AARA 2LXMA 1HFAA 2WMNA 5A7DB 3B7UX 3V2XA 3FFLA 3HDXA 2LNIA 2I1KA 3SNXA 3UMVA 4JVSA 5BXUA 1WG0A 1PAQA 2WQ6A 3LDZA 2I2OA 4TUUA 2R03A 2P58C 1Z6TA 1Y8MA 5ENTD 3Q9NC 4L23A 1OWMA 2VTBB 1PC2A 3CKBA 3IKOB 3ZXSA 1BU9A 1P5QA 3ZRHA 2JABA 5AJDA 2ONDA 2VTBA 2XS1A 3I3NA 3QWPA 2X6IA 4U96D 4F7AA 1TJFA 4LCTA 1KT1A 1OCOE 1HU3A 2WXHA 1WAO1 3ULQA 3MCXA 3CVUA 1NP7A 3NOCD 4DLOA 3VLDA 3NBNB 4GPKA 3APFA 3L13A 2E2EA 1ELRA 3FH7A 3W9FA 2ETAA 2XGSA 2XRZA 1Y6IA 4J8DA 4AOFA 3LY8A 4UWGA 4AP2A 3L9TA 5FJYA 2XCCA 3RO3A 3FU5A 3SZ7A 2P9KG 4HOUA 4FU3A 4I6JA 2X38A 4AEZC 2J4BA 4K5AB 3FUMA 2AJAA 3DSTA 1O1SA 2J49A 4ACKA 3Q7AA 1IQUA 2C2LA 3TWUA 4YDWA 2A5UA 3P2BA 2P9IG 1N4RA 3HXDA 2V5QC 2YQ8A 4I6GA 4IULA 1DVPA 1A5EA 2VGXB 3EU9A 4U0UA 1BI7B 3MKQB 2RG8A 4RG6A 4JEUA 3CVLA 3PNLB 5JJ7A 4C48B 5ANRA 1SZAA 1TNUA 3ZYKA 4JHJA 2JLBA 3ZUVB 2L9BA 3R9MA 5HKPA 2OEWA 4GYOA 4FADA 3D3MA 4JHRA 2ETBA 4BFRA 4A1SA 1FVFA 3CVYA 4KXKB 1HH8A 3CKCA 1IKND 4F3VA 2R2LA 4W9RA 2YINA 1HX8A 2P9LG 2GRRB 2AXZA 1Z3YA
chains in the Genus database with same CATH topology
2BKKB 2B0OE 5CBOA 4DRXE 3W9GA 3V79K 5AN8A 3LJNA 5ENSD 1SW6A 2VGEA 3ZKJA 1K1AA 3T8KA 3T9KA 5ENQD 3TWQA 2F8XK 2Y0BG 3D9HA 4QFVA 4DX6D 4TUMA 5KWDA 4HBDA 5EIBE 4HI8A 2F37A 5EN5D 5CEDB 1N0QA 3TWXA 3V2OA 4O1PA 1BD8A 5KNHD 4RLYA 2DWZA 4HNAD 5AARA 4ATZD 1YMPA 4BESA 4HRNA 3J5QB 1MJ0A 1MX4A 1MX2A 3SO8A 4DUIA 4F1PA 5ITZF 3V2XA 2J8SD 3F6QA 1AP7A 1SVXA 2KXPC 4K5CA 1D9SA 3B7BA 4BETA 1DCQA 3DEOA 1AWCB 4HQDA 4CYMD 4O1OA 4K5AB 2FO1E 2HE0A 2QC9A 3DEPA 4QQIA 3JXJA 4N5QA 5BXUA 1WG0A 2AJAA 2QYJA 2ZGDA 2DVWA 5AQAA 3V30A 4B93B 4YDYA 3TWSA 4BERA 2Y1LE 3AAAC 5FIOA 2A5EA 1N0RA 2KBXA 4DX1A 3TWUA 2F8YA 1MYOA 4YDWA 5CECB 2V5QC 4GPMA 1WDYA 4DX5D 4A63B 5ENTD 2RFAA 2XEEA 4LG6A 3HRAA 5JA4D 3AJIA 1A5EA 4J8YA 3EU9A 3V31A 3Q9NC 1BI7B 3EHRA 4Z68A 5CEAA 1K1BA 4G8LA 4G8KA 5EYLA 4J7WA 2RFMA 3TWWA 3B95A 2MYOA 5EIDA 5KNGA 4O60A 2XZDG 4C48B 1BU9A 4U8YD 4OAUC 1NFIE 2JABA 2DZOA 5HRYA 4F6RD 1BLXB 2NYJA 5D66A 4DX2A 4HB5A 3TWRA 4GMRA 4HRMB 4HRLA 4U8VD 3UI2A 4HLLA 2DZNA 3ZU7B 3ZUVB 1IHBA 3IXEA 4ZFHA 5AAOA 5CERB 1DC2A 5HKPA 3C5RA 1UOHA 4U95D 3HG0D 3KEAA 4LSZE 5AQ7A 1TR4A 2ETBA 3NOGD 3J5PA 1IXVA 4U96D 1OY3D 5HS0A 1YYHA 1K3ZD 4HI9A 5AQBA 2ZGGA 1MX6A 2V4HC 2BKGA 2XZTG 2P2CP 2XENA 4NIKA 5JMND 1IKND 5ENOD 3TWTA 4LNUD 3NOCD 3TWVA 5EILA 4BEPA 4BSZB 3NBNB 1OT8A 4ZHBA 1YCSB 4CZ2D 2PNNA 3UXGA 1QYMA 1N11A 2L6BA 4K5BA 5ENPD 3Q9UC 5EYPF 3JUEA 1S70B 4UUCA 3UTMA 3W9FA 2XEHA 5ENRD 4OAVB 2ETAA 3JXIA 3ZNGA 1G3NB 5BXOA 2ETCA 5AQ9A 3EHQA 4DX7D 5CBNA 5KBAA 1BI8B 4JB8P 5FINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKK B;  2B0O E;  5CBO A;  4DRX E;  3W9G A;  3V79 K;  5AN8 A;  3LJN A;  5ENS D;  1SW6 A;  2VGE A;  3ZKJ A;  1K1A A;  3T8K A;  3T9K A;  5ENQ D;  3TWQ A;  2F8X K;  2Y0B G;  3D9H A;  4QFV A;  4DX6 D;  4TUM A;  5KWD A;  4HBD A;  5EIB E;  4HI8 A;  2F37 A;  5EN5 D;  5CED B;  1N0Q A;  3TWX A;  3V2O A;  4O1P A;  1BD8 A;  5KNH D;  4RLY A;  2DWZ A;  4HNA D;  5AAR A;  4ATZ D;  1YMP A;  4BES A;  4HRN A;  3J5Q B;  1MJ0 A;  1MX4 A;  1MX2 A;  3SO8 A;  4DUI A;  4F1P A;  5ITZ F;  3V2X A;  2J8S D;  3F6Q A;  1AP7 A;  1SVX A;  2KXP C;  4K5C A;  1D9S A;  3B7B A;  4BET A;  1DCQ A;  3DEO A;  1AWC B;  4HQD A;  4CYM D;  4O1O A;  4K5A B;  2FO1 E;  2HE0 A;  2QC9 A;  3DEP A;  4QQI A;  3JXJ A;  4N5Q A;  5BXU A;  1WG0 A;  2AJA A;  2QYJ A;  2ZGD A;  2DVW A;  5AQA A;  3V30 A;  4B93 B;  4YDY A;  3TWS A;  4BER A;  2Y1L E;  3AAA C;  5FIO A;  2A5E A;  1N0R A;  2KBX A;  4DX1 A;  3TWU A;  2F8Y A;  1MYO A;  4YDW A;  5CEC B;  2V5Q C;  4GPM A;  1WDY A;  4DX5 D;  4A63 B;  5ENT D;  2RFA A;  2XEE A;  4LG6 A;  3HRA A;  5JA4 D;  3AJI A;  1A5E A;  4J8Y A;  3EU9 A;  3V31 A;  3Q9N C;  1BI7 B;  3EHR A;  4Z68 A;  5CEA A;  1K1B A;  4G8L A;  4G8K A;  5EYL A;  4J7W A;  2RFM A;  3TWW A;  3B95 A;  2MYO A;  5EID A;  5KNG A;  4O60 A;  2XZD G;  4C48 B;  1BU9 A;  4U8Y D;  4OAU C;  1NFI E;  2JAB A;  2DZO A;  5HRY A;  4F6R D;  1BLX B;  2NYJ A;  5D66 A;  4DX2 A;  4HB5 A;  3TWR A;  4GMR A;  4HRM B;  4HRL A;  4U8V D;  3UI2 A;  4HLL A;  2DZN A;  3ZU7 B;  3ZUV B;  1IHB A;  3IXE A;  4ZFH A;  5AAO A;  5CER B;  1DC2 A;  5HKP A;  3C5R A;  1UOH A;  4U95 D;  3HG0 D;  3KEA A;  4LSZ E;  5AQ7 A;  1TR4 A;  2ETB A;  3NOG D;  3J5P A;  1IXV A;  4U96 D;  1OY3 D;  5HS0 A;  1YYH A;  1K3Z D;  4HI9 A;  5AQB A;  2ZGG A;  1MX6 A;  2V4H C;  2BKG A;  2XZT G;  2P2C P;  2XEN A;  4NIK A;  5JMN D;  1IKN D;  5ENO D;  3TWT A;  4LNU D;  3NOC D;  3TWV A;  5EIL A;  4BEP A;  4BSZ B;  3NBN B;  1OT8 A;  4ZHB A;  1YCS B;  4CZ2 D;  2PNN A;  3UXG A;  1QYM A;  1N11 A;  2L6B A;  4K5B A;  5ENP D;  3Q9U C;  5EYP F;  3JUE A;  1S70 B;  4UUC A;  3UTM A;  3W9F A;  2XEH A;  5ENR D;  4OAV B;  2ETA A;  3JXI A;  3ZNG A;  1G3N B;  5BXO A;  2ETC A;  5AQ9 A;  3EHQ A;  4DX7 D;  5CBN A;  5KBA A;  1BI8 B;  4JB8 P;  5FIN A; 
#chains in the Genus database with same CATH topology
 4J0U A;  4LER A;  1KZP A;  2OCC E;  3ZKJ A;  3T9K A;  2Y4T A;  3ASO E;  2WQH A;  4FJZ A;  3BQO A;  1E7U A;  3CGH A;  3CV0 A;  5EN5 D;  1JCS A;  4AJW A;  3PZD A;  1BD8 A;  5FZR A;  1LF8 A;  4LNG A;  5A23 A;  4DUI A;  3LVR E;  3J5Q B;  3FU3 A;  4K5C A;  4FP7 A;  1DCQ A;  4GA0 A;  5KCM A;  2X3M A;  2L0T B;  3ML9 A;  3JXJ A;  1N54 A;  5LX8 A;  2ZIR A;  5AYW D;  4I2Z A;  2QZA A;  3JQ0 A;  3LCA A;  2PQR A;  5G04 J;  3TJP A;  2RFA A;  3EHR A;  1E8Z A;  1RZ4 A;  2RFM A;  2J07 A;  3B95 A;  3CLJ A;  4MKT A;  5FQ4 A;  4DI4 A;  5D66 A;  2V0P A;  4HB5 A;  2IFU A;  3FUN A;  3GZ1 A;  3UI2 A;  4KBQ A;  5J08 A;  3KSQ A;  1DC2 A;  3ZYQ A;  5BV1 A;  4J8F A;  1UOH A;  2OVF A;  5BPP A;  1XNF A;  3Q5M A;  4UWF A;  3EU5 A;  3FUI A;  1OWP A;  5AEN A;  1X5B A;  3OTN A;  1K3Z D;  4N2S A;  4I9C A;  4GTR A;  4GTQ A;  4GZ5 A;  4EQF A;  4GZC A;  3L08 A;  3Q75 A;  4GTM A;  2J08 A;  2H6H A;  3O4Z A;  5EIL A;  3DSV A;  4K5B A;  3DPD A;  5G05 J;  2CHW A;  1NI1 A;  3VLF A;  3DBS A;  3OXL A;  4JZY A;  4XE0 A;  5ENR D;  3UT8 A;  2KZT B;  2J4D A;  2Q7F A;  5CBN A;  5KBA A;  5FIN A;  3DWL G;  3L16 A;  2WXO A;  4DRX E;  2JEK A;  3ISM C;  2PL2 A;  1N4Q A;  3FY4 A;  1UN9 A;  4M3O A;  4GTO A;  3D9O A;  4UQX A;  4BES A;  3AG2 E;  3PRZ A;  1LTX A;  1TYQ G;  2HM8 A;  2AXU A;  2LAI A;  4LEU A;  1H6P A;  3TXM A;  1TEZ A;  3P1U A;  3FUE A;  4APO A;  2OVB A;  4BER A;  3S2A A;  2OV8 A;  3BEE A;  5BT1 A;  1MYO A;  4APF A;  4FLB A;  1WDY A;  4DX5 D;  2IJG X;  4MBG A;  2R02 A;  4J8Y A;  4GML A;  4MLP A;  3MJW A;  5FTP A;  4C0M A;  5CRV A;  3LEW A;  5EID A;  3B7R L;  3EIJ A;  3JQ1 A;  1Q2Z A;  1TNB A;  2J9Q A;  4WWP A;  4KVO A;  1N94 A;  3C5R A;  3KEA A;  4LSZ E;  1TR4 A;  2KZT A;  4BT9 A;  5B1B E;  5CRU A;  3AS4 A;  4CDN A;  1DCE A;  1MHQ A;  2VYI A;  2XGM A;  1OWO A;  3D9P A;  1K8K G;  3ASG A;  3NZU A;  4JA7 A;  2IY0 C;  2XEH A;  1B89 A;  2F0Y A;  2BKK B;  4KYO B;  3PE4 A;  5B3S E;  3B7S A;  3ULE G;  2CFZ A;  2RKK A;  1EYH A;  1NZN A;  4N3A A;  2XQ0 A;  3TWX A;  2FUL A;  4HNA D;  3AS5 A;  5T8I A;  2EIJ E;  3SO8 A;  3CEQ A;  2PM6 A;  3HHM A;  2XEV A;  4NQ0 A;  5LFA A;  2KCV A;  3MKR A;  3ASN E;  2LAH A;  2FO1 E;  2HE0 A;  3AS8 A;  4QQI A;  3UM0 A;  3V30 A;  2DYR E;  1SZ9 A;  5JHA A;  3AAA C;  3FU0 A;  4EHM A;  4DX1 A;  4N3C A;  3QWW A;  2EIK E;  4GTT A;  4DLQ A;  4FC8 A;  2DCP A;  3RK6 A;  4BTB A;  5AIJ A;  1MZC A;  2IF4 A;  2XZD G;  4XKB A;  4U04 A;  4EPZ A;  5BNW A;  4F6R D;  4DX2 A;  4U8V D;  3WG7 E;  3ZU7 B;  2LXL A;  1H6O A;  3L22 A;  4N3B A;  3AG4 E;  1YYH A;  3Q49 B;  2ZGG A;  4U0Z A;  1HZ4 A;  2BKG A;  3ZPJ A;  4OYS A;  2GRO B;  4IRU A;  5JMN D;  4UWL A;  4L2Y A;  4BSZ B;  3GW4 A;  1H0A A;  3FEX A;  4JPS A;  1E8X A;  4JA9 A;  5FZS A;  4BX8 A;  2Y69 E;  3ZXP A;  3APD A;  3ZVV A;  4Q96 A;  2IO3 C;  4AVX A;  2LUH A;  2CHX A;  4I1O B;  1FT1 A;  4TUM A;  3EUV A;  3CK9 A;  1O1T A;  1ZU2 A;  1HG2 A;  2FI7 A;  4EBA A;  4F1P A;  3DXM G;  1N4S A;  4AY5 A;  3RRN B;  2VGX A;  4BET A;  3DEO A;  2ION A;  4XZ4 A;  2MRI A;  2DIW A;  3FDH A;  2ZGD A;  3PDN A;  5FIO A;  4JXT A;  3TG4 A;  3IHV A;  3I4R B;  3QNK A;  3MYV A;  2LO6 A;  3HXB A;  1NA0 A;  3SD5 A;  5CCL A;  3SFX A;  4N5C A;  1NFI E;  3OXF A;  1JWG A;  4GZD A;  1SA4 A;  2NYJ A;  4HOT A;  3QJZ A;  4A55 A;  2DZN A;  3MEK A;  1IHB A;  1O1R A;  2IU1 A;  3HYM B;  3ASH A;  4M7C A;  3J5P A;  4ACL A;  3UM1 A;  3HXE A;  2EQX A;  3CSF A;  4CGV A;  1EF1 C;  2WMO A;  3CVW A;  1S70 B;  3ZN3 A;  4UWH A;  3D9N A;  3JXI A;  3FH8 A;  3EHQ A;  3LYA A;  4FA6 A;  3FU6 A;  3S7D A;  3V79 K;  2QY7 A;  4HLE A;  2VGY A;  2VSX E;  4GTS A;  3D9H A;  4XKC A;  5FZQ A;  2XPI A;  4HRN A;  3FUF A;  4UQZ A;  5ITZ F;  5KJN A;  1E8Y A;  4ILI A;  2CFU A;  3GYZ A;  2CG3 A;  2X6J A;  2H6I A;  3T5V A;  2XHE A;  3CQG B;  3N71 A;  4BTA A;  2XGO A;  3ASD A;  1JPL A;  2UY1 B;  2FF4 A;  4GA1 A;  3E37 A;  3SGH A;  5FWQ A;  5FQ7 A;  3ZIM A;  1U2V G;  3TWW A;  4RQI A;  5LCW J;  5JHB A;  4PH4 B;  2WXL A;  4HVB A;  4KMO A;  3C3O A;  3UT7 A;  4BY6 A;  2ILR A;  1EDU A;  3KD7 A;  1Z3X A;  4J8E A;  3G2S A;  3Q79 A;  3HVE A;  4JD2 G;  1UG3 A;  4BT8 A;  3PH0 C;  3PUK A;  1W3B A;  5IY5 E;  1SQM A;  4CT4 A;  2RD0 A;  4UI9 J;  4CZ2 D;  1QYM A;  4H7Y A;  3KEZ A;  4JL0 A;  4ILH B;  3KS2 A;  1NA3 A;  3L54 A;  4FJY A;  3QDN A;  4CDR A;  2FEZ A;  2VSO E;  3ZHE B;  3AG3 E;  4G1T A;  3PZ2 A;  2I9C A;  4N39 A;  3FUK A;  2UY1 A;  3R9A B;  1SW6 A;  3QOU A;  2GRL A;  2F8X K;  4QFV A;  2F37 A;  4GCO A;  5A6C A;  3S7J A;  2FO7 A;  5BUZ A;  3DXK G;  2DWZ A;  4RLY A;  3F6Q A;  1D9S A;  3RRU A;  4I6E A;  3EHN A;  4NAC A;  4RSY A;  3D9J A;  2Y1L E;  1HO8 A;  4UWK A;  4NUR A;  5AJL A;  3PNT B;  4GPM A;  5G55 A;  2XPZ A;  4J7W A;  5EKQ D;  3TXN A;  3ABK E;  2P9P G;  4HOQ A;  2EIN E;  4HRL A;  5H7P A;  4CT0 A;  4MS6 A;  4EZJ A;  2PM7 A;  5AQ7 A;  3FTZ A;  1KPS B;  2IQC A;  4D10 C;  4N2Q A;  2WXG A;  2QYU A;  3ABL E;  3TAX A;  3D9M A;  4U0S A;  3SHF A;  3TWV A;  4B8A A;  3DSX A;  3UXG A;  1JCQ A;  5ENP D;  1D8D A;  3HIZ A;  5CMY A;  1VDY A;  4DX7 D;  2P9U G;  2IOL A;  4F1S A;  1TJC A;  5D0O D;  3SBS A;  3W9G A;  3C98 A;  3ESK A;  5ENS D;  2VGE A;  2GGF A;  1KZO A;  3FTY A;  4DX6 D;  4HI8 A;  2XPY A;  3V2O A;  5KJM A;  3TL5 A;  4K0R A;  3QAQ A;  1AP7 A;  2WVI A;  4AXH A;  3RAU A;  3B7T A;  3SI5 A;  3FUD A;  3HXC A;  4I9E A;  3O48 A;  4G25 A;  1U3C A;  3G2V A;  5FQ6 A;  2KCL A;  2F8Y A;  4C9B B;  3SF4 A;  2OEV A;  3C3Q A;  3AJI A;  3DRA A;  3CK8 A;  2V8S E;  4U8Y D;  2KM4 A;  2AWI A;  3L82 A;  3DSW A;  2M63 A;  5CHE E;  3TWR A;  2WM9 A;  3FP3 A;  1FPP A;  1WY6 A;  2I6H A;  3CVN A;  3SBT B;  3R7Q A;  4CGW A;  3BG1 B;  3PEV B;  1TN8 A;  4GTP A;  4HFG A;  4WNF A;  4E6H A;  4WNG A;  5M72 A;  3AU4 A;  3PVL A;  3PZ4 A;  1OT8 A;  3UM2 A;  2L6B A;  1SA5 A;  3IBE A;  4WWO A;  3ZNG A;  5B1A E;  3ABM E;  4PDX A;  5EX0 A;  4YDE A;  2V5F A;  1YA0 A;  2HR2 A;  4HOR A;  4GYW A;  5D2M C;  5AN8 A;  3LJN A;  1K1A A;  1N95 A;  2Y3A A;  5KWD A;  1HXI A;  3FTX A;  2R59 A;  3ZW3 A;  5FQ8 A;  2GRM A;  3UIN C;  1XGW A;  2J8S D;  4GA2 A;  1TN6 A;  3FTV A;  4I2W A;  4CYM D;  4WND A;  2DBA A;  3FUJ A;  3TWS A;  4RG9 A;  2YNQ A;  3FEY A;  4ATG A;  4B89 A;  3TGO A;  4G8L A;  3CQC B;  5KNG A;  4FHJ A;  5JJT A;  2FBN A;  5DBK A;  4WUY A;  4TXR A;  4XEI G;  2OOE A;  1GW6 A;  4HRM B;  4L9P A;  4IN3 B;  2AXV A;  2NXP A;  1OCR E;  5CER B;  5AAO A;  4ZFH A;  3NQP A;  4Y6W A;  4U95 D;  3PZ3 A;  1UJK A;  3FHE A;  1A17 A;  5CMW A;  4GTV A;  4IYP A;  4GZ3 A;  1JWF A;  3EHM A;  1IYG A;  1KLX A;  1O5M A;  5BV0 A;  3MA5 A;  3LXU X;  4UUC A;  2IEJ A;  1ELW A;  4U63 A;  5AQ9 A;  1LD7 A;  5ANL A;  3RSE G;  1ZBP A;  3DSS A;  1L5J A;  4YVQ C;  1H2T C;  3CVQ A;  3Q15 A;  4ANW A;  1D8E A;  1N0Q A;  5LCW C;  1UW4 B;  3E4B A;  3FUL A;  3RRM B;  4B0Z A;  4L1B A;  4L2L A;  2LSU A;  4HQD A;  3ZYL A;  3ONL A;  1OCC E;  2Y4U A;  2P9N G;  4MRU A;  4YDY A;  2B6C A;  3UKU G;  4G11 A;  5D0Q D;  2KBX A;  5CEC B;  2HYZ A;  4PUC A;  2WXJ A;  2XEE A;  3MZL B;  3MX3 A;  2WXF A;  4YVO A;  4UI9 C;  2MYO A;  2WXN A;  3ASF A;  1N9A A;  2BED A;  3VTY A;  2AVP A;  2MHK A;  4HS2 A;  4I43 A;  1QNF A;  4V3I A;  4I1A A;  1JUQ A;  3CK7 A;  2WPV A;  3ZFW A;  2WXP A;  4BX9 A;  2L6J A;  2XRY A;  4YND A;  2AW6 A;  3S7F A;  3NOG D;  4BWR A;  1IXV A;  3PE3 A;  4LNB A;  3ZYM A;  4I17 A;  5HQ8 A;  4K03 A;  3S7B A;  2WXM A;  3IV0 A;  5T3R A;  1OWN A;  3UM3 A;  1OCZ E;  5EYP F;  3ESL A;  2KCK A;  3UQ3 A;  3U3W A;  1H19 A;  1BI8 B;  2B0O E;  3T5X A;  2BF0 X;  3HXF A;  1V55 E;  1FT2 A;  1LD8 A;  1OWL A;  1Z5S C;  3LJ3 A;  4Q94 A;  3T8K A;  1KT0 A;  2VJ8 A;  2Y0B G;  3AG1 E;  3SFY A;  2GRQ B;  3CHO A;  1WM5 A;  5CED B;  4AIF A;  2C0L A;  3PS6 A;  3CR3 A;  1MJ0 A;  2GRN B;  2KXP C;  3B7B A;  2GRP B;  3EJN A;  3E33 A;  4YDO A;  5E76 A;  1OXJ A;  4JC8 A;  2DVW A;  4B93 B;  3LY7 A;  3OXG A;  3CIA A;  4ILG A;  2HO1 A;  3IHY A;  5C2Y A;  4U07 A;  4B8C B;  4BSX A;  5EYL A;  4G8K A;  4FHK A;  3UUX A;  3GZ2 A;  4DK5 A;  2PZI A;  4GCN A;  4GMR A;  3IXE A;  5ARF A;  3UIP C;  4A1G A;  2WXR A;  1MX6 A;  5T4Y A;  3U9W A;  1E7V A;  1IHG A;  1HF8 A;  3BU8 A;  3AU5 A;  3RJV A;  4G2V A;  3I5P A;  4AV7 A;  4U7E B;  2R05 A;  3QWV A;  3FUH A;  5DIZ A;  4J8S A;  3UPV A;  2WXI A;  3UTM A;  4E85 A;  5G04 C;  4GYY A;  4OAV B;  4JB8 P;  2KAT A;  4WAF A;  3ML8 A;  1U3D A;  3D9I A;  3LPZ A;  4KVM A;  4HXI A;  3EDT B;  3NAW A;  4KZC A;  5FT9 A;  1ZB1 A;  3B13 A;  4DPR A;  4G23 A;  4OVV A;  3IEG A;  3C3R A;  3NF1 A;  1QZ2 A;  4PS8 A;  5ARG A;  4ME2 A;  1JCR A;  4JEH A;  3I4G A;  2YHE A;  5JA4 D;  3LY9 A;  3C72 A;  4Z68 A;  5CEA A;  2VSN A;  4O60 A;  3ZGQ A;  5E75 A;  2WXK A;  1PY1 A;  3HVE B;  3L6A A;  2DZO A;  2DYS E;  4EEC A;  4KT6 B;  3CVV A;  3E30 A;  4EZL A;  3EIQ C;  3Q7F A;  3E34 A;  1OY3 D;  5KJL A;  3FH5 A;  3CHP A;  4WNE A;  4NIK A;  3Q73 A;  2X6K A;  2ZU6 B;  3TWT A;  2ZXW E;  4X8Q A;  5G05 C;  4LNU D;  2PQN A;  1H6K A;  1YCS B;  4XX5 A;  3NZS A;  3PZ1 A;  3LS8 A;  1G3N B;  2ETC A;  3WXX A;  1MQS A;  1QQE A;  2KC7 A;  3UT4 A;  3FWV A;  3MV2 B;  1X81 A;  4AM9 A;  5CBO A;  2P9S G;  3ZEF A;  5ENQ D;  4WWN A;  1TNO A;  4HBD A;  3RO2 A;  4ATZ D;  3KAE A;  2L0I A;  1FCH A;  1MX2 A;  2H6F A;  1HE8 A;  4OVU A;  4A3T A;  3SQV A;  1TN7 A;  3Q47 B;  3FTW A;  2QYJ A;  3TG5 A;  2QFC A;  3G2W A;  2VSY A;  4GMJ A;  4A63 B;  1K1B A;  4JW1 A;  4Q69 A;  4DJA A;  1OUV A;  3QKY A;  2V4L A;  4GZ6 A;  2WB2 A;  5C1D A;  4G26 A;  2IO2 C;  3JCK C;  5HRY A;  3U64 A;  4HLL A;  2A4Z A;  2XCB A;  1V54 E;  1DNP A;  1HG5 A;  4HOS A;  1HS6 A;  2BTD A;  3HG0 D;  2ZIS A;  3U66 A;  4ANV A;  4HI9 A;  2V4H C;  2XZT G;  2P2C P;  5G2N A;  3LKU A;  4TXP A;  3ZHE A;  4XI0 A;  3QB2 A;  4BEP A;  4ZHB A;  2PNN A;  1N11 A;  4FLH A;  4F53 A;  1FVH A;  4I1M A;  1ELK A;  2WQ7 A;  4LUN U;  3CVX A;  3BUA A;  2CG2 A;  3SY2 A;  3VLE A;  3RKV A;  5EDS A;  4KZ0 A;  4GB9 A;  5CCM A;  5HI7 A;  4PS7 A;  2LSV A;  3G2T A;  3QK0 A;  4O1P A;  2I1J A;  4TV3 A;  4XIF A;  1SVX A;  3FTS A;  4O1O A;  4ANU A;  2QC9 A;  3DEP A;  2EIL E;  4N5Q A;  5AQA A;  2R5S A;  2CHZ A;  4O6F A;  1N0R A;  4AY6 A;  3PRE A;  3PUJ A;  1UN8 A;  2GW1 A;  3RU0 A;  4LG6 A;  4ABN A;  4U8H A;  4GU5 A;  4UQY A;  3V31 A;  3CHM A;  3SFZ A;  2UWJ G;  2IOS A;  3Q4A B;  3OAW A;  4FUL A;  5J90 A;  1N52 A;  3URZ A;  3QAR A;  3QC1 A;  1H2U A;  3FTU A;  2MOW A;  1QBQ A;  1TNZ A;  5EX3 A;  2H6G A;  3L17 A;  5HS0 A;  2BUG A;  3K9I A;  4URK A;  2E0I A;  1S63 A;  4J6I A;  3PEU B;  4TXQ A;  2XEN A;  1NL4 A;  4P29 A;  4RVB A;  3DPY A;  1INZ A;  3JYS A;  3KSL A;  3Q9U C;  4L7T A;  3JUE A;  3CHQ A;  3MGB A;  4Y6C A;  4H7X A;  3GZS A;  4UI9 K;  3NB2 A;  4DI3 A;  5EIB E;  3D9L A;  2XS8 A;  5KNH D;  4G24 A;  3MKQ A;  1YMP A;  3E32 A;  4JHK A;  1MX4 A;  2R17 C;  2NC9 A;  1AWC B;  3CHR A;  3APC A;  3VTX A;  3ENE A;  2YHC A;  4EZK A;  3CHS A;  3CST A;  2A5E A;  4CCA A;  4LRZ A;  3ONK A;  1H2V C;  4R7L A;  3LVQ E;  3HRA A;  3G2U A;  1N4P A;  2NSZ A;  4GAA A;  3T8M A;  2J09 A;  4CDM A;  4OAU C;  1E8W A;  3ULY A;  2EIM E;  1E96 B;  5LP0 A;  3Q78 A;  1BLX B;  5LOZ A;  4B94 A;  3MV3 B;  3CVP A;  2C0M A;  3R7R A;  3DSU A;  5KJK A;  3RIB A;  5AQB A;  4ANX A;  5BW8 C;  4XI9 A;  1EPU A;  4EBA G;  5ENN A;  1UJJ A;  5ENO D;  4A3V A;  1IQR A;  1RW2 A;  3UKR G;  4CRW A;  3JUI A;  4C0E A;  2VQ2 A;  1E90 A;  4TRQ A;  4CEM A;  2X6H A;  3UIO C;  5JJ6 A;  4PS3 A;  1TNY A;  1S0P A;  5BXO A;  3U4T A;  2X6F A;  3X2Q E;  3BG0 B;  3UX4 A;  1S64 A;  3TWQ A;  2WXQ A;  4NRH B;  1BPO A;  3D9K A;  5AAR A;  2LXM A;  1HFA A;  2WMN A;  5A7D B;  3B7U X;  3V2X A;  3FFL A;  3HDX A;  2LNI A;  2I1K A;  3SNX A;  3UMV A;  4JVS A;  5BXU A;  1WG0 A;  1PAQ A;  2WQ6 A;  3LDZ A;  2I2O A;  4TUU A;  2R03 A;  2P58 C;  1Z6T A;  1Y8M A;  5ENT D;  3Q9N C;  4L23 A;  1OWM A;  2VTB B;  1PC2 A;  3CKB A;  3IKO B;  3ZXS A;  1BU9 A;  1P5Q A;  3ZRH A;  2JAB A;  5AJD A;  2OND A;  2VTB A;  2XS1 A;  3I3N A;  3QWP A;  2X6I A;  4U96 D;  4F7A A;  1TJF A;  4LCT A;  1KT1 A;  1OCO E;  1HU3 A;  2WXH A;  1WAO 1;  3ULQ A;  3MCX A;  3CVU A;  1NP7 A;  3NOC D;  4DLO A;  3VLD A;  3NBN B;  4GPK A;  3APF A;  3L13 A;  2E2E A;  1ELR A;  3FH7 A;  3W9F A;  2ETA A;  2XGS A;  2XRZ A;  1Y6I A;  4J8D A;  4AOF A;  3LY8 A;  4UWG A;  4AP2 A;  3L9T A;  5FJY A;  2XCC A;  3RO3 A;  3FU5 A;  3SZ7 A;  2P9K G;  4HOU A;  4FU3 A;  4I6J A;  2X38 A;  4AEZ C;  2J4B A;  4K5A B;  3FUM A;  2AJA A;  3DST A;  1O1S A;  2J49 A;  4ACK A;  3Q7A A;  1IQU A;  2C2L A;  3TWU A;  4YDW A;  2A5U A;  3P2B A;  2P9I G;  1N4R A;  3HXD A;  2V5Q C;  2YQ8 A;  4I6G A;  4IUL A;  1DVP A;  1A5E A;  2VGX B;  3EU9 A;  4U0U A;  1BI7 B;  3MKQ B;  2RG8 A;  4RG6 A;  4JEU A;  3CVL A;  3PNL B;  5JJ7 A;  4C48 B;  5ANR A;  1SZA A;  1TNU A;  3ZYK A;  4JHJ A;  2JLB A;  3ZUV B;  2L9B A;  3R9M A;  5HKP A;  2OEW A;  4GYO A;  4FAD A;  3D3M A;  4JHR A;  2ETB A;  4BFR A;  4A1S A;  1FVF A;  3CVY A;  4KXK B;  1HH8 A;  3CKC A;  1IKN D;  4F3V A;  2R2L A;  4W9R A;  2YIN A;  1HX8 A;  2P9L G;  2GRR B;  2AXZ A;  1Z3Y A; 
#chains in the Genus database with same CATH homology
 2BKK B;  2B0O E;  5CBO A;  4DRX E;  3W9G A;  3V79 K;  5AN8 A;  3LJN A;  5ENS D;  1SW6 A;  2VGE A;  3ZKJ A;  1K1A A;  3T8K A;  3T9K A;  5ENQ D;  3TWQ A;  2F8X K;  2Y0B G;  3D9H A;  4QFV A;  4DX6 D;  4TUM A;  5KWD A;  4HBD A;  5EIB E;  4HI8 A;  2F37 A;  5EN5 D;  5CED B;  1N0Q A;  3TWX A;  3V2O A;  4O1P A;  1BD8 A;  5KNH D;  4RLY A;  2DWZ A;  4HNA D;  5AAR A;  4ATZ D;  1YMP A;  4BES A;  4HRN A;  3J5Q B;  1MJ0 A;  1MX4 A;  1MX2 A;  3SO8 A;  4DUI A;  4F1P A;  5ITZ F;  3V2X A;  2J8S D;  3F6Q A;  1AP7 A;  1SVX A;  2KXP C;  4K5C A;  1D9S A;  3B7B A;  4BET A;  1DCQ A;  3DEO A;  1AWC B;  4HQD A;  4CYM D;  4O1O A;  4K5A B;  2FO1 E;  2HE0 A;  2QC9 A;  3DEP A;  4QQI A;  3JXJ A;  4N5Q A;  5BXU A;  1WG0 A;  2AJA A;  2QYJ A;  2ZGD A;  2DVW A;  5AQA A;  3V30 A;  4B93 B;  4YDY A;  3TWS A;  4BER A;  2Y1L E;  3AAA C;  5FIO A;  2A5E A;  1N0R A;  2KBX A;  4DX1 A;  3TWU A;  2F8Y A;  1MYO A;  4YDW A;  5CEC B;  2V5Q C;  4GPM A;  1WDY A;  4DX5 D;  4A63 B;  5ENT D;  2RFA A;  2XEE A;  4LG6 A;  3HRA A;  5JA4 D;  3AJI A;  1A5E A;  4J8Y A;  3EU9 A;  3V31 A;  3Q9N C;  1BI7 B;  3EHR A;  4Z68 A;  5CEA A;  1K1B A;  4G8L A;  4G8K A;  5EYL A;  4J7W A;  2RFM A;  3TWW A;  3B95 A;  2MYO A;  5EID A;  5KNG A;  4O60 A;  2XZD G;  4C48 B;  1BU9 A;  4U8Y D;  4OAU C;  1NFI E;  2JAB A;  2DZO A;  5HRY A;  4F6R D;  1BLX B;  2NYJ A;  5D66 A;  4DX2 A;  4HB5 A;  3TWR A;  4GMR A;  4HRM B;  4HRL A;  4U8V D;  3UI2 A;  4HLL A;  2DZN A;  3ZU7 B;  3ZUV B;  1IHB A;  3IXE A;  4ZFH A;  5AAO A;  5CER B;  1DC2 A;  5HKP A;  3C5R A;  1UOH A;  4U95 D;  3HG0 D;  3KEA A;  4LSZ E;  5AQ7 A;  1TR4 A;  2ETB A;  3NOG D;  3J5P A;  1IXV A;  4U96 D;  1OY3 D;  5HS0 A;  1YYH A;  1K3Z D;  4HI9 A;  5AQB A;  2ZGG A;  1MX6 A;  2V4H C;  2BKG A;  2XZT G;  2P2C P;  2XEN A;  4NIK A;  5JMN D;  1IKN D;  5ENO D;  3TWT A;  4LNU D;  3NOC D;  3TWV A;  5EIL A;  4BEP A;  4BSZ B;  3NBN B;  1OT8 A;  4ZHB A;  1YCS B;  4CZ2 D;  2PNN A;  3UXG A;  1QYM A;  1N11 A;  2L6B A;  4K5B A;  5ENP D;  3Q9U C;  5EYP F;  3JUE A;  1S70 B;  4UUC A;  3UTM A;  3W9F A;  2XEH A;  5ENR D;  4OAV B;  2ETA A;  3JXI A;  3ZNG A;  1G3N B;  5BXO A;  2ETC A;  5AQ9 A;  3EHQ A;  4DX7 D;  5CBN A;  5KBA A;  1BI8 B;  4JB8 P;  5FIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...