1YYHA

Crystal structure of the human notch 1 ankyrin domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Notch 1, ankyrin domain
publication title High-resolution crystal structure of the human Notch 1 ankyrin domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle,transcription
total genus 68
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1yyhA00
1OY3D 4U96D 4OAVB 5FIOA 5HKPA 5AN8A 2J8SD 4J8YA 1YMPA 1SVXA 2DVWA 4BESA 5KBAA 2A5EA 1IKND 3NOGD 5CBNA 3D9HA 4BERA 3W9FA 1G3NB 3ZNGA 2KBXA 1NFIE 1BI8B 4HI9A 5BXUA 3AJIA 3ZKJA 3TWUA 2ETAA 3W9GA 3T8KA 5JA4D 1MX6A 1MX4A 3SO8A 4A63B 3V31A 3V2OA 1BU9A 4K5BA 4OAUC 4F1PA 4Z68A 5ENQD 3TWVA 1K1BA 1TR4A 5JMND 3ZU7B 4CZ2D 4G8KA 3TWTA 5CEAA 2P2CP 3UXGA 2KXPC 3B7BA 3V30A 5D66A 2AJAA 5CEDB 3JUEA 5ENRD 4HBDA 3DEOA 1DCQA 5EIBE 2VGEA 2XENA 2Y1LE 2XEHA 4HRLA 4JB8P 3V2XA 3TWXA 3C5RA 4GPMA 4HB5A 4HNAD 3TWQA 3UTMA 3JXJA 2NYJA 4HRNA 2DZNA 1IHBA 3IXEA 1MYOA 4UUCA 2RFMA 3Q9UC 5ENTD 5EYPF 1K1AA 2ETCA 5AQBA 4K5AB 4HI8A 4ZHBA 1AP7A 2ZGDA 3F6QA 5AQ9A 2Y0BG 4DX6D 5CBOA 3TWWA 1MX2A 4NIKA 4O1PA 3T9KA 2MYOA 4K5CA 2BKKB 5ENOD 1D9SA 1WG0A 5AAOA 5CERB 2JABA 1YYHA 4DX1A 1BLXB 1A5EA 1S70B 1DC2A 4G8LA 4LSZE 2F37A 3EHQA 5FINA 2PNNA 2DWZA 4B93B 1WDYA 5ITZF 4HRMB 5AQAA 5KWDA 1K3ZD 3V79K 1IXVA 1AWCB 3JXIA 1YCSB 4LG6A 1QYMA 5CECB 2XZTG 3EHRA 4J7WA 4TUMA 2RFAA 5ENPD 4DUIA 3J5QB 2FO1E 3NBNB 5EN5D 4DX5D 2QYJA 2QC9A 2F8YA 3KEAA 4CYMD 3Q9NC 2L6BA 4ATZD 5ENSD 3UI2A 2V4HC 2ETBA 3B95A 5AQ7A 3NOCD 3TWRA 4F6RD 4QFVA 4YDYA 2V5QC 5EYLA 1BI7B 4HLLA 4GMRA 4U8YD 4U95D 5AARA 4BEPA 2F8XK 1BD8A 1MJ0A 4QQIA 1N0QA 3EU9A 2B0OE 2XZDG 1SW6A 4O60A 4BSZB 4O1OA 2XEEA 4HQDA 4DX7D 1UOHA 3J5PA 3LJNA 3DEPA 5EILA 1OT8A 4ZFHA 3TWSA 5KNHD 4BETA 3ZUVB 4U8VD 1N11A 3HRAA 4YDWA 1N0RA 4N5QA 2DZOA 5EIDA 4RLYA 5HS0A 2HE0A 4LNUD 5KNGA 2BKGA 4C48B 3HG0D 4DRXE 2ZGGA 5HRYA 4DX2A 3AAAC 5BXOA
chains in the Genus database with same CATH superfamily
2WQ6A 2AW6A 1E8XA 4K03A 2RKKA 3DSVA 1P5QA 3CKBA 4U8HA 3C98A 2A5EA 5FZQA 2JLBA 1HFAA 3ZKJA 4N3CA 2ETAA 3GYZA 3V31A 3U64A 3ZU7B 3PS6A 3IHYA 1O1RA 2LXMA 4GZ3A 3E34A 4GCNA 1N94A 2Y1LE 3ULYA 4HRLA 2GRMA 1H6PA 3FTZA 5FQ8A 1MYOA 4GA2A 2P9KG 1AP7A 4EPZA 3T9KA 3PRZA 4OYSA 2R03A 3D3MA 5ENOD 2WXIA 1QZ2A 3FTYA 3UKUG 3T8MA 3ABLE 4GMJA 3KEAA 4Y6CA 1D8DA 3DSWA 1EF1C 3B7UX 3LS8A 3AG3E 4C0EA 1FVHA 4JHJA 2KCVA 2X6KA 3EU9A 5ENNA 3QWWA 3ML8A 5EILA 1OT8A 2WMOA 3AS5A 5D0OD 5KJMA 2IY0C 2XPYA 3FU6A 1V54E 4TRQA 5HS0A 5M72A 1OUVA 4J8EA 2J8SD 2KZTB 3NOGD 2MRIA 3QOUA 3S7DA 3ZNGA 4JPSA 3CSTA 5H7PA 3RO2A 3ZFWA 1HE8A 3DPYA 4F3VA 4GYWA 2OEWA 2J49A 1TJFA 2Q7FA 1N52A 3QARA 5LCWJ 2XENA 2IU1A 5G04J 3ZEFA 3Q9UC 2CHWA 3B7SA 2ETCA 5AQBA 4KXKB 3FHEA 2LSUA 4GTQA 4WNGA 3AU5A 1YYHA 3CV0A 3CVUA 2YINA 2GW1A 3MV3B 4FU3A 3D9KA 2ZIRA 4G24A 3Q78A 2OOEA 2FO1E 3EIQC 3FDHA 4DI3A 4G1TA 3FTVA 3TWRA 3NOCD 3B7RL 4J8SA 5ARGA 1MZCA 1BD8A 1N0QA 4PUCA 4MBGA 2WXQA 4URKA 3U66A 4C0MA 4I43A 3DSXA 3SNXA 5JJ7A 1E96B 4GTTA 4BETA 5JJ6A 1PC2A 5EIDA 3E32A 2DYRE 2MOWA 1OY3D 4Y6WA 5FIOA 5HKPA 4I9CA 2XCCA 3Q73A 2GRPB 2PQNA 4BTAA 3IHVA 4UWLA 3MGBA 1UN9A 3PVLA 2E0IA 3LY9A 4GZ5A 1KPSB 3TXNA 1HS6A 5ENQD 1UG3A 4B89A 4JA9A 4WWPA 2CFZA 1KZPA 4EQFA 2H6GA 3TWQA 2BF0X 3KS2A 5ENTD 2V0PA 3APCA 5FQ7A 4YDEA 4N3BA 1EYHA 2P58C 4M3OA 1X81A 2V4LA 2F37A 1DVPA 2E2EA 2PL2A 4K0RA 3EDTB 2DYSE 3CVLA 5ANLA 1DCEA 3CHRA 3LY7A 3BU8A 4Q96A 3HXCA 2F8XK 3TGOA 3CVXA 3PNLB 1IQUA 1VDYA 4N2QA 5KCMA 4DX7D 2VSNA 4JW1A 3EIJA 2X6HA 4RLYA 2H6FA 4PS3A 2EQXA 3LXUX 4AY5A 3G2SA 2L9BA 5BUZA 5AN8A 3R7QA 2HR2A 4TV3A 4APOA 1E90A 5LCWC 1HU3A 4DI4A 4KT6B 1G3NB 3FY4A 3UKRG 3S7BA 3QKYA 5G04C 4AVXA 3S7FA 5JMND 4A3TA 5CEAA 4BY6A 2IJGX 3MYVA 3UXGA 4V3IA 4KVOA 3NAWA 4GPKA 3JUIA 4FA6A 3E37A 3DEOA 2VGEA 3V2XA 3AG4E 3ZHEB 2RFMA 1TN8A 3LKUA 1XGWA 2X3MA 2ZGDA 3GZ2A 4LUNU 2L0TB 1HXIA 1OCRE 4IN3B 1Y6IA 3KSLA 1EDUA 1U2VG 3EHQA 3CR3A 2J07A 2MHKA 1JWFA 3CVNA 2UY1B 4N3AA 2QZAA 3CIAA 4TUMA 3QDNA 3RO3A 4JL0A 4U7EB 4CDNA 5A23A 1BPOA 3B95A 2WVIA 4MLPA 4JXTA 4KYOB 1E8WA 4O60A 2P9LG 4AM9A 3FUIA 3BQOA 1QNFA 4CT0A 4DLQA 3E4BA 2X6JA 1S0PA 3FH5A 4U0ZA 4A1SA 3LPZA 3CVVA 5T3RA 5T8IA 3UT4A 1Q2ZA 3RSEG 1JCQA 4WNEA 4ILHB 2WXOA 3E30A 2I6HA 4FC8A 1S63A 3MA5A 3U3WA 3LY8A 4YDOA 3PZ4A 4RG9A 1Z5SC 4I6GA 4OAUC 2CFUA 3PH0C 1ZBPA 2IOLA 1E8ZA 3UIOC 1WAO1 5C2YA 4HOSA 1IHGA 3RRUA 1TEZA 2RD0A 1JPLA 2NYJA 3DBSA 3RRNB 1NA0A 5KJKA 2NSZA 3TXMA 1N54A 3F6QA 4DX6D 4NIKA 4L23A 3MX3A 1DC2A 3GZSA 1HO8A 5FT9A 3ZN3A 3DXKG 3Q7FA 4I2ZA 1UJKA 3FUFA 4ILIA 3UI2A 3ZGQA 1HG5A 4QFVA 4YDYA 1SZAA 2V5QC 5B1BE 3SZ7A 3OAWA 5G55A 1OWMA 5IY5E 4IULA 3HXFA 3RRMB 4EZLA 4MRUA 4YNDA 4EBAA 3ZUVB 1TNBA 3AAAC 4F1SA 3O48A 3X2QE 2BKGA 2ZGGA 2XGSA 3NBNB 4U96D 4LRZA 5DBKA 5CCLA 4AY6A 2ONDA 5HQ8A 4EHMA 2LAHA 3CHPA 2XQ0A 3TWUA 3U9WA 4LNBA 5JJTA 4NURA 3QWPA 1NL4A 3ASFA 1MX4A 2J08A 3FEYA 1ELRA 4CZ2D 3CHOA 4AIFA 2J09A 3ONLA 3JUEA 3DSTA 4FHKA 2CHXA 1L5JA 2XRYA 4HLEA 3IXEA 4UUCA 3FTWA 3CLJA 3C3OA 4ZHBA 1N4PA 4AP2A 4O1PA 3SHFA 5BNWA 2XPZA 3UPVA 4NACA 4EBAG 1W3BA 1O5MA 3ZW3A 2XS8A 3HXDA 2IO3C 1OCOE 2LUHA 1YCSB 2XGOA 3SF4A 2QY7A 4OVVA 4DX5D 3MKRA 4GTVA 1K8KG 5AQ7A 3PE3A 4U95D 2VTBA 3UT8A 1NA3A 1LD7A 3DSSA 2WXPA 1N4RA 3CVYA 4MS6A 3TAXA 1HZ4A 4JZYA 5JHBA 4G11A 2EIJE 3K9IA 2A5UA 1RW2A 3ZXPA 4AV7A 1N0RA 2AXUA 3UUXA 2ILRA 3B13A 4DX2A 5AYWD 4APFA 4GTRA 5KBAA 4BTBA 3SFZA 3G2VA 3DSUA 1NFIE 4HI9A 4ANVA 1H0AA 3T8KA 2C2LA 1E8YA 3SY2A 2GRQB 4Z68A 4HS2A 3R7RA 1K1BA 1FCHA 1MHQA 4BX8A 3UINC 4N5CA 3B7TA 4J8FA 1PAQA 4HB5A 3LYAA 4I1MA 3CK7A 1H6OA 2C0MA 1IHBA 3HIZA 1OWLA 5EDSA 3ASOE 4H7XA 5AAOA 3NF1A 4LSZE 3HVEA 3JYSA 2XEVA 4DJAA 5KWDA 1K3ZD 4LNGA 5BW8C 3AS8A 4TXQA 5EN5D 3C3QA 2F8YA 5LP0A 1S64A 3SBTB 2YQ8A 5EYLA 4HFGA 4N2SA 4B8AA 5EKQD 3FTSA 2VQ2A 1ZB1A 5CCMA 3PEVB 2V5FA 3Q7AA 1TNUA 4HOTA 1Z3YA 2IFUA 3HRAA 3L9TA 3JCKC 3NZSA 4L1BA 4N5QA 3KD7A 4LNUD 2WXKA 3ONKA 2JEKA 4I6JA 3OXLA 1IKND 2HO1A 1TYQG 3MCXA 5BPPA 5KJNA 4J8DA 4ANUA 5BXUA 4ABNA 1MX6A 3SO8A 2AXVA 3I4GA 4IYPA 1SA4A 3RAUA 5LX8A 3PZ2A 3I4RB 4CCAA 3QJZA 4AJWA 5ARFA 3AG1E 2GRLA 4GTOA 5D66A 1DCQA 5EIBE 5BV0A 4JVSA 3UTMA 3ASHA 2J9QA 1ELWA 3UMVA 4KBQA 3FTXA 2DZNA 3I3NA 1N9AA 4CDRA 2NXPA 4EZJA 2QYUA 5FQ4A 5AQ9A 5CBOA 3TWWA 1WG0A 2P9SG 3SBSA 5A6CA 2DCPA 1B89A 2IO2C 3JQ0A 1QBQA 3ZYMA 4XE0A 5J08A 4B93B 1WDYA 5AQAA 3ESKA 5ENPD 2J4DA 3J5QB 3CSFA 4C9BB 3FULA 3LEWA 2Y4TA 3WXXA 4ILGA 4CGVA 5AJLA 3SD5A 5AARA 3IEGA 5DIZA 3FUHA 4GA1A 2XEEA 5B3SE 4KVMA 3DEPA 2B6CA 3EHMA 1A17A 2X6FA 2Y3AA 5KNGA 3HG0D 3ZIMA 3BG1B 1QQEA 4GZDA 2Y4UA 4PH4B 1HH8A 2DVWA 4UWHA 3BG0B 2KBXA 2WXGA 2VSOE 2EILE 3UM0A 3T5XA 3APDA 2P2CP 1OWOA 3V30A 2HYZA 2R05A 2XS1A 4EECA 1Z6TA 4HBDA 2XEHA 2KATA 3C5RA 4XZ4A 1UN8A 5CMYA 4JD2G 3VLFA 2CG2A 1Z3XA 2WXHA 3Q79A 3UQ3A 1PY1A 4FADA 2LAIA 4G23A 4UQXA 1NZNA 3ABME 3L54A 3SI5A 4DX1A 1BLXB 1A5EA 4XKCA 2WXMA 3QWVA 3CK8A 2RG8A 3FTUA 5B1AE 1FVFA 4F53A 5CECB 3EHRA 3QAQA 2I2OA 3PZDA 4I9EA 4TUUA 3ESLA 2FBNA 3VLDA 1INZA 4CYMD 4MKTA 4ATZD 4I17A 1O1SA 2YHCA 4GAAA 3HXEA 2V8SE 3AU4A 4U63A 1MJ0A 4XKBA 2HM8A 2H6IA 5G2NA 4O1OA 4B0ZA 3VTXA 1OWNA 4U8VD 3SGHA 3ZVVA 1NI1A 4DPRA 3MKQA 4YDWA 1XNFA 2VYIA 4DRXE 4GZ6A 1N4QA 4J8YA 3UX4A 1H2VC 3L17A 1SVXA 4BT8A 3D9HA 1H2UA 3MV2B 2GRNB 3W9FA 2J4BA 2VGXA 4W9RA 2NC9A 3MKQB 3W9GA 1YA0A 3QC1A 4K5BA 3URZA 4WNDA 4G8KA 2KC7A 5D2MC 2P9IG 3CQCB 3TWXA 3IV0A 4B8CB 3L16A 3ENEA 4ACKA 3UT7A 4G25A 2PM7A 4K5AB 3FUKA 2BKKB 3CHSA 5CERB 3D9OA 1OCCE 3ZYLA 1S70B 3PDNA 2VJ8A 3RK6A 2DWZA 5ITZF 3C3RA 4GZCA 2WM9A 2RFAA 3E33A 3UM2A 4CDMA 3R9MA 4I6EA 1U3CA 5BT1A 2A4ZA 3DPDA 4L2YA 1EPUA 4TXPA 4GMRA 3LJ3A 1SA5A 1WM5A 2I1KA 5D0QD 4BSZB 3CHMA 1KZOA 4A1GA 3NB2A 3ZYKA 1SZ9A 4GYYA 4LCTA 2FULA 3LVRE 3Q47B 1IYGA 4AXHA 1LF8A 2CG3A 3FWVA 4WAFA 4BERA 3FP3A 3Q5MA 1BI8B 3Q4AB 1H6KA 3AJIA 2C0LA 1O1TA 3HXBA 3FUJA 5JA4D 1TNZA 1ELKA 3V2OA 3VTYA 1TR4A 4CT4A 2VGYA 5FZSA 3D9LA 3FU5A 2H6HA 2P9PG 5AENA 3AS4A 5CEDB 3D9NA 4JB8P 3ULQA 3JXJA 1LTXA 4BFRA 4R7LA 4GCOA 5EYPF 1K1AA 3Q15A 1GW6A 4OVUA 2FF4A 2MYOA 4UQZA 2R02A 4GTMA 3UM3A 2PNNA 2IOSA 1IXVA 4JA7A 2P9UG 4LG6A 1QYMA 3O4ZA 1UW4B 4J7WA 4EZKA 4UQYA 4JC8A 5E76A 1OCZE 3CVWA 3C72A 1KLXA 1BI7B 2XCBA 4XI9A 3I5PA 4ANXA 2WQ7A 4F7AA 4E6HA 4XIFA 3FUEA 2DZOA 3TL5A 5HRYA 4BSXA 5BV1A 3CHQA 3NQPA 2XPIA 1YMPA 2WB2A 4KZ0A 3ZYQA 4DLOA 1RZ4A 5LOZA 4CGWA 2X6IA 4HORA 1FT1A 3FH7A 4A63B 2L0IA 2PZIA 2OCCE 3TJPA 4J6IA 3FH8A 1KT1A 3WG7E 2AWIA 3B7BA 4UWFA 4A55A 2VTBB 3DXMG 3FEXA 3RIBA 2I1JA 5ENRD 3FUMA 2LNIA 4Q94A 2GROB 1MQSA 3G2UA 4PS7A 1JCRA 2FEZA 3L13A 1U3DA 3ML9A 5CMWA 1MX2A 3L6AA 4K5CA 4CEMA 1D9SA 3LVQE 1D8EA 2KZTA 1HF8A 4CRWA 4FLBA 1IQRA 3ZPJA 3CVPA 3PUKA 4E85A 1FPPA 2VSXE 2QC9A 3Q9NC 3D9PA 4O6FA 3SFYA 4AEZC 3G2TA 3N71A 3FU3A 4GB9A 5AIJA 2UWJG 3UIPC 4GMLA 3ZXSA 5EX3A 3LJNA 3ZRHA 4XI0A 4YVOA 1HX8A 2XHEA 4RG6A 5G05J 3HVEB 4ATGA 3L82A 3D9JA 4FULA 3OXFA 4GTSA 4FJYA 3SFXA 5ANRA 1HG2A 1UJJA 1TNYA 2IEJA 4F1PA 4WWNA 1TN7A 2OVFA 3ISMC 1E7VA 2KCKA 2AJAA 4G2VA 4GPMA 4FJZA 5CHEE 4HRNA 3PNTB 1NP7A 4RVBA 2Y0BG 1V55E 2R59A 3CQGB 1X5BA 1TNOA 2M63A 2WXFA 3HHMA 2XZTG 2XGMA 4GA0A 4RQIA 3FU0A 3Q49B 4H7YA 3T5VA 3U4TA 3TG5A 2V4HC 3EUVA 1ZU2A 2OVBA 1N4SA 3KSQA 3CGHA 2CHZA 5C1DA 4HXIA 3KEZA 1UOHA 4ZFHA 1Y8MA 3FFLA 2WXLA 5EX0A 4C48B 4D10C 4WNFA 3R9AB 2WMNA 4BT9A 5J90A 4BESA 4KZCA 5CBNA 3L22A 2EIME 2GGFA 4DK5A 4LERA 4GYOA 4U0UA 5A7DB 2BEDA 1H19A 2KXPC 3EHNA 2WXRA 2R17C 2BTDA 3LDZA 3RKVA 2DIWA 3UM1A 4GU5A 3MZLB 1JWGA 1KT0A 2EIKE 2L6JA 1JCSA 5CRUA 4ANWA 4X8QA 3OTNA 2LSVA 2IONA 2WXNA 2VSYA 3S7JA 4B94A 4I1OB 5FINA 2WPVA 4FP7A 2R2LA 4HRMB 3V79K 1AWCB 4UWGA 2QYJA 4NRHB 2FO7A 2L6BA 5FTPA 4HVBA 4FLHA 1DNPA 1FT2A 4FHJA 4U8YD 5FJYA 3L08A 5G05C 4JHKA 2Y69E 2XZDG 4UI9J 2PM6A 3ZHEA 5KNHD 3ABKE 3GW4A 4P29A 3TG4A 3BUAA 1SQMA 3CKCA 5HI7A 1TN6A 4OAVB 2DBAA 3PZ3A 4N39A 3QK0A 3KAEA 1TJCA 4IRUA 3PE4A 3QNKA 4L2LA 4YVQC 3RU0A 2IF4A 3P1UA 4ME2A 2LXLA 1JUQA 2UY1A 3ASNE 3PZ1A 2GRRB 3TWVA 4UI9K 3Q75A 3TWTA 4KMOA 2KCLA 4BWRA 2I9CA 1WY6A 3RJVA 4WWOA 3SQVA 2KM4A 2ZU6B 4M7CA 3OXGA 4XX5A 3AG2E 4J0UA 3DWLG 3FUDA 5AJDA 3QB2A 3ASDA 5KJLA 4AOFA 4U07A 3JXIA 3HYMB 5FWQA 4DUIA 2VGXB 4HOUA 3NZUA 3D9MA 2FI7A 5ENSD 2LO6A 4A3VA 4WUYA 3G2WA 4F6RD 2AVPA 3MEKA 3JQ1A 4JEUA 4Q69A 2ZISA 3VLEA 1SW6A 3MJWA 3EU5A 4L7TA 3IKOB 3APFA 3BEEA 4G26A 4BX9A 3PEUB 1LD8A 2HE0A 1E7UA 2P9NG 3S2AA 4UWKA 1N95A 5T4YA 3HDXA 3LCAA 4NQ0A 3GZ1A 1H2TC 2WQHA 1BU9A 3CVQA 2ZXWE 5E75A 5FZRA 4I1AA 5FQ6A 1OXJA 2BUGA 4JHRA 3P2BA 4HNAD 2WXJA 4ACLA 4JEHA 5JHAA 4XEIG 4PS8A 2X38A 2OEVA 4HI8A 4U04A 4TXRA 2JABA 4HOQA 4GTPA 4G8LA 5LFAA 4UI9C 2XRZA 3IBEA 4RSYA 1OWPA 2AXZA 3EJNA 5CRVA 2ETBA 2YHEA 3DRAA 4HLLA 4BEPA 3ULEG 2YNQA 2EINE 3PUJA 4U0SA 4QQIA 3PREA 4PDXA 3ASGA 2B0OE 4L9PA 2OV8A 2PQRA 4LEUA 4HQDA 3FUNA 3J5PA 3TWSA 2F0YA 1N11A 2R5SA 3D9IA 3CEQA 3CK9A 2QFCA 4I2WA 2IQCA 5BXOA
chains in the Genus database with same CATH topology
1OY3D 4U96D 4OAVB 5FIOA 5HKPA 5AN8A 2J8SD 4J8YA 1YMPA 1SVXA 2DVWA 4BESA 5KBAA 2A5EA 1IKND 3NOGD 5CBNA 3D9HA 4BERA 3W9FA 1G3NB 3ZNGA 2KBXA 1NFIE 1BI8B 4HI9A 5BXUA 3AJIA 3ZKJA 3TWUA 2ETAA 3W9GA 3T8KA 5JA4D 1MX6A 1MX4A 3SO8A 4A63B 3V31A 3V2OA 1BU9A 4K5BA 4OAUC 4F1PA 4Z68A 5ENQD 3TWVA 1K1BA 1TR4A 5JMND 3ZU7B 4CZ2D 4G8KA 3TWTA 5CEAA 2P2CP 3UXGA 2KXPC 3B7BA 3V30A 5D66A 2AJAA 5CEDB 3JUEA 5ENRD 4HBDA 3DEOA 1DCQA 5EIBE 2VGEA 2XENA 2Y1LE 2XEHA 4HRLA 4JB8P 3V2XA 3TWXA 3C5RA 4GPMA 4HB5A 4HNAD 3TWQA 3UTMA 3JXJA 2NYJA 4HRNA 2DZNA 1IHBA 3IXEA 1MYOA 4UUCA 2RFMA 3Q9UC 5ENTD 5EYPF 1K1AA 2ETCA 5AQBA 4K5AB 4HI8A 4ZHBA 1AP7A 2ZGDA 3F6QA 5AQ9A 2Y0BG 4DX6D 5CBOA 3TWWA 1MX2A 4NIKA 4O1PA 3T9KA 2MYOA 4K5CA 2BKKB 5ENOD 1D9SA 1WG0A 5AAOA 5CERB 2JABA 1YYHA 4DX1A 1BLXB 1A5EA 1S70B 1DC2A 4G8LA 4LSZE 2F37A 3EHQA 5FINA 2PNNA 2DWZA 4B93B 1WDYA 5ITZF 4HRMB 5AQAA 5KWDA 1K3ZD 3V79K 1IXVA 1AWCB 3JXIA 1YCSB 4LG6A 1QYMA 5CECB 2XZTG 3EHRA 4J7WA 4TUMA 2RFAA 5ENPD 4DUIA 3J5QB 2FO1E 3NBNB 5EN5D 4DX5D 2QYJA 2QC9A 2F8YA 3KEAA 4CYMD 3Q9NC 2L6BA 4ATZD 5ENSD 3UI2A 2V4HC 2ETBA 3B95A 5AQ7A 3NOCD 3TWRA 4F6RD 4QFVA 4YDYA 2V5QC 5EYLA 1BI7B 4HLLA 4GMRA 4U8YD 4U95D 5AARA 4BEPA 2F8XK 1BD8A 1MJ0A 4QQIA 1N0QA 3EU9A 2B0OE 2XZDG 1SW6A 4O60A 4BSZB 4O1OA 2XEEA 4HQDA 4DX7D 1UOHA 3J5PA 3LJNA 3DEPA 5EILA 1OT8A 4ZFHA 3TWSA 5KNHD 4BETA 3ZUVB 4U8VD 1N11A 3HRAA 4YDWA 1N0RA 4N5QA 2DZOA 5EIDA 4RLYA 5HS0A 2HE0A 4LNUD 5KNGA 2BKGA 4C48B 3HG0D 4DRXE 2ZGGA 5HRYA 4DX2A 3AAAC 5BXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OY3 D;  4U96 D;  4OAV B;  5FIO A;  5HKP A;  5AN8 A;  2J8S D;  4J8Y A;  1YMP A;  1SVX A;  2DVW A;  4BES A;  5KBA A;  2A5E A;  1IKN D;  3NOG D;  5CBN A;  3D9H A;  4BER A;  3W9F A;  1G3N B;  3ZNG A;  2KBX A;  1NFI E;  1BI8 B;  4HI9 A;  5BXU A;  3AJI A;  3ZKJ A;  3TWU A;  2ETA A;  3W9G A;  3T8K A;  5JA4 D;  1MX6 A;  1MX4 A;  3SO8 A;  4A63 B;  3V31 A;  3V2O A;  1BU9 A;  4K5B A;  4OAU C;  4F1P A;  4Z68 A;  5ENQ D;  3TWV A;  1K1B A;  1TR4 A;  5JMN D;  3ZU7 B;  4CZ2 D;  4G8K A;  3TWT A;  5CEA A;  2P2C P;  3UXG A;  2KXP C;  3B7B A;  3V30 A;  5D66 A;  2AJA A;  5CED B;  3JUE A;  5ENR D;  4HBD A;  3DEO A;  1DCQ A;  5EIB E;  2VGE A;  2XEN A;  2Y1L E;  2XEH A;  4HRL A;  4JB8 P;  3V2X A;  3TWX A;  3C5R A;  4GPM A;  4HB5 A;  4HNA D;  3TWQ A;  3UTM A;  3JXJ A;  2NYJ A;  4HRN A;  2DZN A;  1IHB A;  3IXE A;  1MYO A;  4UUC A;  2RFM A;  3Q9U C;  5ENT D;  5EYP F;  1K1A A;  2ETC A;  5AQB A;  4K5A B;  4HI8 A;  4ZHB A;  1AP7 A;  2ZGD A;  3F6Q A;  5AQ9 A;  2Y0B G;  4DX6 D;  5CBO A;  3TWW A;  1MX2 A;  4NIK A;  4O1P A;  3T9K A;  2MYO A;  4K5C A;  2BKK B;  5ENO D;  1D9S A;  1WG0 A;  5AAO A;  5CER B;  2JAB A;  1YYH A;  4DX1 A;  1BLX B;  1A5E A;  1S70 B;  1DC2 A;  4G8L A;  4LSZ E;  2F37 A;  3EHQ A;  5FIN A;  2PNN A;  2DWZ A;  4B93 B;  1WDY A;  5ITZ F;  4HRM B;  5AQA A;  5KWD A;  1K3Z D;  3V79 K;  1IXV A;  1AWC B;  3JXI A;  1YCS B;  4LG6 A;  1QYM A;  5CEC B;  2XZT G;  3EHR A;  4J7W A;  4TUM A;  2RFA A;  5ENP D;  4DUI A;  3J5Q B;  2FO1 E;  3NBN B;  5EN5 D;  4DX5 D;  2QYJ A;  2QC9 A;  2F8Y A;  3KEA A;  4CYM D;  3Q9N C;  2L6B A;  4ATZ D;  5ENS D;  3UI2 A;  2V4H C;  2ETB A;  3B95 A;  5AQ7 A;  3NOC D;  3TWR A;  4F6R D;  4QFV A;  4YDY A;  2V5Q C;  5EYL A;  1BI7 B;  4HLL A;  4GMR A;  4U8Y D;  4U95 D;  5AAR A;  4BEP A;  2F8X K;  1BD8 A;  1MJ0 A;  4QQI A;  1N0Q A;  3EU9 A;  2B0O E;  2XZD G;  1SW6 A;  4O60 A;  4BSZ B;  4O1O A;  2XEE A;  4HQD A;  4DX7 D;  1UOH A;  3J5P A;  3LJN A;  3DEP A;  5EIL A;  1OT8 A;  4ZFH A;  3TWS A;  5KNH D;  4BET A;  3ZUV B;  4U8V D;  1N11 A;  3HRA A;  4YDW A;  1N0R A;  4N5Q A;  2DZO A;  5EID A;  4RLY A;  5HS0 A;  2HE0 A;  4LNU D;  5KNG A;  2BKG A;  4C48 B;  3HG0 D;  4DRX E;  2ZGG A;  5HRY A;  4DX2 A;  3AAA C;  5BXO A; 
#chains in the Genus database with same CATH topology
 2WQ6 A;  2AW6 A;  1E8X A;  4K03 A;  2RKK A;  3DSV A;  1P5Q A;  3CKB A;  4U8H A;  3C98 A;  2A5E A;  5FZQ A;  2JLB A;  1HFA A;  3ZKJ A;  4N3C A;  2ETA A;  3GYZ A;  3V31 A;  3U64 A;  3ZU7 B;  3PS6 A;  3IHY A;  1O1R A;  2LXM A;  4GZ3 A;  3E34 A;  4GCN A;  1N94 A;  2Y1L E;  3ULY A;  4HRL A;  2GRM A;  1H6P A;  3FTZ A;  5FQ8 A;  1MYO A;  4GA2 A;  2P9K G;  1AP7 A;  4EPZ A;  3T9K A;  3PRZ A;  4OYS A;  2R03 A;  3D3M A;  5ENO D;  2WXI A;  1QZ2 A;  3FTY A;  3UKU G;  3T8M A;  3ABL E;  4GMJ A;  3KEA A;  4Y6C A;  1D8D A;  3DSW A;  1EF1 C;  3B7U X;  3LS8 A;  3AG3 E;  4C0E A;  1FVH A;  4JHJ A;  2KCV A;  2X6K A;  3EU9 A;  5ENN A;  3QWW A;  3ML8 A;  5EIL A;  1OT8 A;  2WMO A;  3AS5 A;  5D0O D;  5KJM A;  2IY0 C;  2XPY A;  3FU6 A;  1V54 E;  4TRQ A;  5HS0 A;  5M72 A;  1OUV A;  4J8E A;  2J8S D;  2KZT B;  3NOG D;  2MRI A;  3QOU A;  3S7D A;  3ZNG A;  4JPS A;  3CST A;  5H7P A;  3RO2 A;  3ZFW A;  1HE8 A;  3DPY A;  4F3V A;  4GYW A;  2OEW A;  2J49 A;  1TJF A;  2Q7F A;  1N52 A;  3QAR A;  5LCW J;  2XEN A;  2IU1 A;  5G04 J;  3ZEF A;  3Q9U C;  2CHW A;  3B7S A;  2ETC A;  5AQB A;  4KXK B;  3FHE A;  2LSU A;  4GTQ A;  4WNG A;  3AU5 A;  1YYH A;  3CV0 A;  3CVU A;  2YIN A;  2GW1 A;  3MV3 B;  4FU3 A;  3D9K A;  2ZIR A;  4G24 A;  3Q78 A;  2OOE A;  2FO1 E;  3EIQ C;  3FDH A;  4DI3 A;  4G1T A;  3FTV A;  3TWR A;  3NOC D;  3B7R L;  4J8S A;  5ARG A;  1MZC A;  1BD8 A;  1N0Q A;  4PUC A;  4MBG A;  2WXQ A;  4URK A;  3U66 A;  4C0M A;  4I43 A;  3DSX A;  3SNX A;  5JJ7 A;  1E96 B;  4GTT A;  4BET A;  5JJ6 A;  1PC2 A;  5EID A;  3E32 A;  2DYR E;  2MOW A;  1OY3 D;  4Y6W A;  5FIO A;  5HKP A;  4I9C A;  2XCC A;  3Q73 A;  2GRP B;  2PQN A;  4BTA A;  3IHV A;  4UWL A;  3MGB A;  1UN9 A;  3PVL A;  2E0I A;  3LY9 A;  4GZ5 A;  1KPS B;  3TXN A;  1HS6 A;  5ENQ D;  1UG3 A;  4B89 A;  4JA9 A;  4WWP A;  2CFZ A;  1KZP A;  4EQF A;  2H6G A;  3TWQ A;  2BF0 X;  3KS2 A;  5ENT D;  2V0P A;  3APC A;  5FQ7 A;  4YDE A;  4N3B A;  1EYH A;  2P58 C;  4M3O A;  1X81 A;  2V4L A;  2F37 A;  1DVP A;  2E2E A;  2PL2 A;  4K0R A;  3EDT B;  2DYS E;  3CVL A;  5ANL A;  1DCE A;  3CHR A;  3LY7 A;  3BU8 A;  4Q96 A;  3HXC A;  2F8X K;  3TGO A;  3CVX A;  3PNL B;  1IQU A;  1VDY A;  4N2Q A;  5KCM A;  4DX7 D;  2VSN A;  4JW1 A;  3EIJ A;  2X6H A;  4RLY A;  2H6F A;  4PS3 A;  2EQX A;  3LXU X;  4AY5 A;  3G2S A;  2L9B A;  5BUZ A;  5AN8 A;  3R7Q A;  2HR2 A;  4TV3 A;  4APO A;  1E90 A;  5LCW C;  1HU3 A;  4DI4 A;  4KT6 B;  1G3N B;  3FY4 A;  3UKR G;  3S7B A;  3QKY A;  5G04 C;  4AVX A;  3S7F A;  5JMN D;  4A3T A;  5CEA A;  4BY6 A;  2IJG X;  3MYV A;  3UXG A;  4V3I A;  4KVO A;  3NAW A;  4GPK A;  3JUI A;  4FA6 A;  3E37 A;  3DEO A;  2VGE A;  3V2X A;  3AG4 E;  3ZHE B;  2RFM A;  1TN8 A;  3LKU A;  1XGW A;  2X3M A;  2ZGD A;  3GZ2 A;  4LUN U;  2L0T B;  1HXI A;  1OCR E;  4IN3 B;  1Y6I A;  3KSL A;  1EDU A;  1U2V G;  3EHQ A;  3CR3 A;  2J07 A;  2MHK A;  1JWF A;  3CVN A;  2UY1 B;  4N3A A;  2QZA A;  3CIA A;  4TUM A;  3QDN A;  3RO3 A;  4JL0 A;  4U7E B;  4CDN A;  5A23 A;  1BPO A;  3B95 A;  2WVI A;  4MLP A;  4JXT A;  4KYO B;  1E8W A;  4O60 A;  2P9L G;  4AM9 A;  3FUI A;  3BQO A;  1QNF A;  4CT0 A;  4DLQ A;  3E4B A;  2X6J A;  1S0P A;  3FH5 A;  4U0Z A;  4A1S A;  3LPZ A;  3CVV A;  5T3R A;  5T8I A;  3UT4 A;  1Q2Z A;  3RSE G;  1JCQ A;  4WNE A;  4ILH B;  2WXO A;  3E30 A;  2I6H A;  4FC8 A;  1S63 A;  3MA5 A;  3U3W A;  3LY8 A;  4YDO A;  3PZ4 A;  4RG9 A;  1Z5S C;  4I6G A;  4OAU C;  2CFU A;  3PH0 C;  1ZBP A;  2IOL A;  1E8Z A;  3UIO C;  1WAO 1;  5C2Y A;  4HOS A;  1IHG A;  3RRU A;  1TEZ A;  2RD0 A;  1JPL A;  2NYJ A;  3DBS A;  3RRN B;  1NA0 A;  5KJK A;  2NSZ A;  3TXM A;  1N54 A;  3F6Q A;  4DX6 D;  4NIK A;  4L23 A;  3MX3 A;  1DC2 A;  3GZS A;  1HO8 A;  5FT9 A;  3ZN3 A;  3DXK G;  3Q7F A;  4I2Z A;  1UJK A;  3FUF A;  4ILI A;  3UI2 A;  3ZGQ A;  1HG5 A;  4QFV A;  4YDY A;  1SZA A;  2V5Q C;  5B1B E;  3SZ7 A;  3OAW A;  5G55 A;  1OWM A;  5IY5 E;  4IUL A;  3HXF A;  3RRM B;  4EZL A;  4MRU A;  4YND A;  4EBA A;  3ZUV B;  1TNB A;  3AAA C;  4F1S A;  3O48 A;  3X2Q E;  2BKG A;  2ZGG A;  2XGS A;  3NBN B;  4U96 D;  4LRZ A;  5DBK A;  5CCL A;  4AY6 A;  2OND A;  5HQ8 A;  4EHM A;  2LAH A;  3CHP A;  2XQ0 A;  3TWU A;  3U9W A;  4LNB A;  5JJT A;  4NUR A;  3QWP A;  1NL4 A;  3ASF A;  1MX4 A;  2J08 A;  3FEY A;  1ELR A;  4CZ2 D;  3CHO A;  4AIF A;  2J09 A;  3ONL A;  3JUE A;  3DST A;  4FHK A;  2CHX A;  1L5J A;  2XRY A;  4HLE A;  3IXE A;  4UUC A;  3FTW A;  3CLJ A;  3C3O A;  4ZHB A;  1N4P A;  4AP2 A;  4O1P A;  3SHF A;  5BNW A;  2XPZ A;  3UPV A;  4NAC A;  4EBA G;  1W3B A;  1O5M A;  3ZW3 A;  2XS8 A;  3HXD A;  2IO3 C;  1OCO E;  2LUH A;  1YCS B;  2XGO A;  3SF4 A;  2QY7 A;  4OVV A;  4DX5 D;  3MKR A;  4GTV A;  1K8K G;  5AQ7 A;  3PE3 A;  4U95 D;  2VTB A;  3UT8 A;  1NA3 A;  1LD7 A;  3DSS A;  2WXP A;  1N4R A;  3CVY A;  4MS6 A;  3TAX A;  1HZ4 A;  4JZY A;  5JHB A;  4G11 A;  2EIJ E;  3K9I A;  2A5U A;  1RW2 A;  3ZXP A;  4AV7 A;  1N0R A;  2AXU A;  3UUX A;  2ILR A;  3B13 A;  4DX2 A;  5AYW D;  4APF A;  4GTR A;  5KBA A;  4BTB A;  3SFZ A;  3G2V A;  3DSU A;  1NFI E;  4HI9 A;  4ANV A;  1H0A A;  3T8K A;  2C2L A;  1E8Y A;  3SY2 A;  2GRQ B;  4Z68 A;  4HS2 A;  3R7R A;  1K1B A;  1FCH A;  1MHQ A;  4BX8 A;  3UIN C;  4N5C A;  3B7T A;  4J8F A;  1PAQ A;  4HB5 A;  3LYA A;  4I1M A;  3CK7 A;  1H6O A;  2C0M A;  1IHB A;  3HIZ A;  1OWL A;  5EDS A;  3ASO E;  4H7X A;  5AAO A;  3NF1 A;  4LSZ E;  3HVE A;  3JYS A;  2XEV A;  4DJA A;  5KWD A;  1K3Z D;  4LNG A;  5BW8 C;  3AS8 A;  4TXQ A;  5EN5 D;  3C3Q A;  2F8Y A;  5LP0 A;  1S64 A;  3SBT B;  2YQ8 A;  5EYL A;  4HFG A;  4N2S A;  4B8A A;  5EKQ D;  3FTS A;  2VQ2 A;  1ZB1 A;  5CCM A;  3PEV B;  2V5F A;  3Q7A A;  1TNU A;  4HOT A;  1Z3Y A;  2IFU A;  3HRA A;  3L9T A;  3JCK C;  3NZS A;  4L1B A;  4N5Q A;  3KD7 A;  4LNU D;  2WXK A;  3ONK A;  2JEK A;  4I6J A;  3OXL A;  1IKN D;  2HO1 A;  1TYQ G;  3MCX A;  5BPP A;  5KJN A;  4J8D A;  4ANU A;  5BXU A;  4ABN A;  1MX6 A;  3SO8 A;  2AXV A;  3I4G A;  4IYP A;  1SA4 A;  3RAU A;  5LX8 A;  3PZ2 A;  3I4R B;  4CCA A;  3QJZ A;  4AJW A;  5ARF A;  3AG1 E;  2GRL A;  4GTO A;  5D66 A;  1DCQ A;  5EIB E;  5BV0 A;  4JVS A;  3UTM A;  3ASH A;  2J9Q A;  1ELW A;  3UMV A;  4KBQ A;  3FTX A;  2DZN A;  3I3N A;  1N9A A;  4CDR A;  2NXP A;  4EZJ A;  2QYU A;  5FQ4 A;  5AQ9 A;  5CBO A;  3TWW A;  1WG0 A;  2P9S G;  3SBS A;  5A6C A;  2DCP A;  1B89 A;  2IO2 C;  3JQ0 A;  1QBQ A;  3ZYM A;  4XE0 A;  5J08 A;  4B93 B;  1WDY A;  5AQA A;  3ESK A;  5ENP D;  2J4D A;  3J5Q B;  3CSF A;  4C9B B;  3FUL A;  3LEW A;  2Y4T A;  3WXX A;  4ILG A;  4CGV A;  5AJL A;  3SD5 A;  5AAR A;  3IEG A;  5DIZ A;  3FUH A;  4GA1 A;  2XEE A;  5B3S E;  4KVM A;  3DEP A;  2B6C A;  3EHM A;  1A17 A;  2X6F A;  2Y3A A;  5KNG A;  3HG0 D;  3ZIM A;  3BG1 B;  1QQE A;  4GZD A;  2Y4U A;  4PH4 B;  1HH8 A;  2DVW A;  4UWH A;  3BG0 B;  2KBX A;  2WXG A;  2VSO E;  2EIL E;  3UM0 A;  3T5X A;  3APD A;  2P2C P;  1OWO A;  3V30 A;  2HYZ A;  2R05 A;  2XS1 A;  4EEC A;  1Z6T A;  4HBD A;  2XEH A;  2KAT A;  3C5R A;  4XZ4 A;  1UN8 A;  5CMY A;  4JD2 G;  3VLF A;  2CG2 A;  1Z3X A;  2WXH A;  3Q79 A;  3UQ3 A;  1PY1 A;  4FAD A;  2LAI A;  4G23 A;  4UQX A;  1NZN A;  3ABM E;  3L54 A;  3SI5 A;  4DX1 A;  1BLX B;  1A5E A;  4XKC A;  2WXM A;  3QWV A;  3CK8 A;  2RG8 A;  3FTU A;  5B1A E;  1FVF A;  4F53 A;  5CEC B;  3EHR A;  3QAQ A;  2I2O A;  3PZD A;  4I9E A;  4TUU A;  3ESL A;  2FBN A;  3VLD A;  1INZ A;  4CYM D;  4MKT A;  4ATZ D;  4I17 A;  1O1S A;  2YHC A;  4GAA A;  3HXE A;  2V8S E;  3AU4 A;  4U63 A;  1MJ0 A;  4XKB A;  2HM8 A;  2H6I A;  5G2N A;  4O1O A;  4B0Z A;  3VTX A;  1OWN A;  4U8V D;  3SGH A;  3ZVV A;  1NI1 A;  4DPR A;  3MKQ A;  4YDW A;  1XNF A;  2VYI A;  4DRX E;  4GZ6 A;  1N4Q A;  4J8Y A;  3UX4 A;  1H2V C;  3L17 A;  1SVX A;  4BT8 A;  3D9H A;  1H2U A;  3MV2 B;  2GRN B;  3W9F A;  2J4B A;  2VGX A;  4W9R A;  2NC9 A;  3MKQ B;  3W9G A;  1YA0 A;  3QC1 A;  4K5B A;  3URZ A;  4WND A;  4G8K A;  2KC7 A;  5D2M C;  2P9I G;  3CQC B;  3TWX A;  3IV0 A;  4B8C B;  3L16 A;  3ENE A;  4ACK A;  3UT7 A;  4G25 A;  2PM7 A;  4K5A B;  3FUK A;  2BKK B;  3CHS A;  5CER B;  3D9O A;  1OCC E;  3ZYL A;  1S70 B;  3PDN A;  2VJ8 A;  3RK6 A;  2DWZ A;  5ITZ F;  3C3R A;  4GZC A;  2WM9 A;  2RFA A;  3E33 A;  3UM2 A;  4CDM A;  3R9M A;  4I6E A;  1U3C A;  5BT1 A;  2A4Z A;  3DPD A;  4L2Y A;  1EPU A;  4TXP A;  4GMR A;  3LJ3 A;  1SA5 A;  1WM5 A;  2I1K A;  5D0Q D;  4BSZ B;  3CHM A;  1KZO A;  4A1G A;  3NB2 A;  3ZYK A;  1SZ9 A;  4GYY A;  4LCT A;  2FUL A;  3LVR E;  3Q47 B;  1IYG A;  4AXH A;  1LF8 A;  2CG3 A;  3FWV A;  4WAF A;  4BER A;  3FP3 A;  3Q5M A;  1BI8 B;  3Q4A B;  1H6K A;  3AJI A;  2C0L A;  1O1T A;  3HXB A;  3FUJ A;  5JA4 D;  1TNZ A;  1ELK A;  3V2O A;  3VTY A;  1TR4 A;  4CT4 A;  2VGY A;  5FZS A;  3D9L A;  3FU5 A;  2H6H A;  2P9P G;  5AEN A;  3AS4 A;  5CED B;  3D9N A;  4JB8 P;  3ULQ A;  3JXJ A;  1LTX A;  4BFR A;  4R7L A;  4GCO A;  5EYP F;  1K1A A;  3Q15 A;  1GW6 A;  4OVU A;  2FF4 A;  2MYO A;  4UQZ A;  2R02 A;  4GTM A;  3UM3 A;  2PNN A;  2IOS A;  1IXV A;  4JA7 A;  2P9U G;  4LG6 A;  1QYM A;  3O4Z A;  1UW4 B;  4J7W A;  4EZK A;  4UQY A;  4JC8 A;  5E76 A;  1OCZ E;  3CVW A;  3C72 A;  1KLX A;  1BI7 B;  2XCB A;  4XI9 A;  3I5P A;  4ANX A;  2WQ7 A;  4F7A A;  4E6H A;  4XIF A;  3FUE A;  2DZO A;  3TL5 A;  5HRY A;  4BSX A;  5BV1 A;  3CHQ A;  3NQP A;  2XPI A;  1YMP A;  2WB2 A;  4KZ0 A;  3ZYQ A;  4DLO A;  1RZ4 A;  5LOZ A;  4CGW A;  2X6I A;  4HOR A;  1FT1 A;  3FH7 A;  4A63 B;  2L0I A;  2PZI A;  2OCC E;  3TJP A;  4J6I A;  3FH8 A;  1KT1 A;  3WG7 E;  2AWI A;  3B7B A;  4UWF A;  4A55 A;  2VTB B;  3DXM G;  3FEX A;  3RIB A;  2I1J A;  5ENR D;  3FUM A;  2LNI A;  4Q94 A;  2GRO B;  1MQS A;  3G2U A;  4PS7 A;  1JCR A;  2FEZ A;  3L13 A;  1U3D A;  3ML9 A;  5CMW A;  1MX2 A;  3L6A A;  4K5C A;  4CEM A;  1D9S A;  3LVQ E;  1D8E A;  2KZT A;  1HF8 A;  4CRW A;  4FLB A;  1IQR A;  3ZPJ A;  3CVP A;  3PUK A;  4E85 A;  1FPP A;  2VSX E;  2QC9 A;  3Q9N C;  3D9P A;  4O6F A;  3SFY A;  4AEZ C;  3G2T A;  3N71 A;  3FU3 A;  4GB9 A;  5AIJ A;  2UWJ G;  3UIP C;  4GML A;  3ZXS A;  5EX3 A;  3LJN A;  3ZRH A;  4XI0 A;  4YVO A;  1HX8 A;  2XHE A;  4RG6 A;  5G05 J;  3HVE B;  4ATG A;  3L82 A;  3D9J A;  4FUL A;  3OXF A;  4GTS A;  4FJY A;  3SFX A;  5ANR A;  1HG2 A;  1UJJ A;  1TNY A;  2IEJ A;  4F1P A;  4WWN A;  1TN7 A;  2OVF A;  3ISM C;  1E7V A;  2KCK A;  2AJA A;  4G2V A;  4GPM A;  4FJZ A;  5CHE E;  4HRN A;  3PNT B;  1NP7 A;  4RVB A;  2Y0B G;  1V55 E;  2R59 A;  3CQG B;  1X5B A;  1TNO A;  2M63 A;  2WXF A;  3HHM A;  2XZT G;  2XGM A;  4GA0 A;  4RQI A;  3FU0 A;  3Q49 B;  4H7Y A;  3T5V A;  3U4T A;  3TG5 A;  2V4H C;  3EUV A;  1ZU2 A;  2OVB A;  1N4S A;  3KSQ A;  3CGH A;  2CHZ A;  5C1D A;  4HXI A;  3KEZ A;  1UOH A;  4ZFH A;  1Y8M A;  3FFL A;  2WXL A;  5EX0 A;  4C48 B;  4D10 C;  4WNF A;  3R9A B;  2WMN A;  4BT9 A;  5J90 A;  4BES A;  4KZC A;  5CBN A;  3L22 A;  2EIM E;  2GGF A;  4DK5 A;  4LER A;  4GYO A;  4U0U A;  5A7D B;  2BED A;  1H19 A;  2KXP C;  3EHN A;  2WXR A;  2R17 C;  2BTD A;  3LDZ A;  3RKV A;  2DIW A;  3UM1 A;  4GU5 A;  3MZL B;  1JWG A;  1KT0 A;  2EIK E;  2L6J A;  1JCS A;  5CRU A;  4ANW A;  4X8Q A;  3OTN A;  2LSV A;  2ION A;  2WXN A;  2VSY A;  3S7J A;  4B94 A;  4I1O B;  5FIN A;  2WPV A;  4FP7 A;  2R2L A;  4HRM B;  3V79 K;  1AWC B;  4UWG A;  2QYJ A;  4NRH B;  2FO7 A;  2L6B A;  5FTP A;  4HVB A;  4FLH A;  1DNP A;  1FT2 A;  4FHJ A;  4U8Y D;  5FJY A;  3L08 A;  5G05 C;  4JHK A;  2Y69 E;  2XZD G;  4UI9 J;  2PM6 A;  3ZHE A;  5KNH D;  3ABK E;  3GW4 A;  4P29 A;  3TG4 A;  3BUA A;  1SQM A;  3CKC A;  5HI7 A;  1TN6 A;  4OAV B;  2DBA A;  3PZ3 A;  4N39 A;  3QK0 A;  3KAE A;  1TJC A;  4IRU A;  3PE4 A;  3QNK A;  4L2L A;  4YVQ C;  3RU0 A;  2IF4 A;  3P1U A;  4ME2 A;  2LXL A;  1JUQ A;  2UY1 A;  3ASN E;  3PZ1 A;  2GRR B;  3TWV A;  4UI9 K;  3Q75 A;  3TWT A;  4KMO A;  2KCL A;  4BWR A;  2I9C A;  1WY6 A;  3RJV A;  4WWO A;  3SQV A;  2KM4 A;  2ZU6 B;  4M7C A;  3OXG A;  4XX5 A;  3AG2 E;  4J0U A;  3DWL G;  3FUD A;  5AJD A;  3QB2 A;  3ASD A;  5KJL A;  4AOF A;  4U07 A;  3JXI A;  3HYM B;  5FWQ A;  4DUI A;  2VGX B;  4HOU A;  3NZU A;  3D9M A;  2FI7 A;  5ENS D;  2LO6 A;  4A3V A;  4WUY A;  3G2W A;  4F6R D;  2AVP A;  3MEK A;  3JQ1 A;  4JEU A;  4Q69 A;  2ZIS A;  3VLE A;  1SW6 A;  3MJW A;  3EU5 A;  4L7T A;  3IKO B;  3APF A;  3BEE A;  4G26 A;  4BX9 A;  3PEU B;  1LD8 A;  2HE0 A;  1E7U A;  2P9N G;  3S2A A;  4UWK A;  1N95 A;  5T4Y A;  3HDX A;  3LCA A;  4NQ0 A;  3GZ1 A;  1H2T C;  2WQH A;  1BU9 A;  3CVQ A;  2ZXW E;  5E75 A;  5FZR A;  4I1A A;  5FQ6 A;  1OXJ A;  2BUG A;  4JHR A;  3P2B A;  4HNA D;  2WXJ A;  4ACL A;  4JEH A;  5JHA A;  4XEI G;  4PS8 A;  2X38 A;  2OEV A;  4HI8 A;  4U04 A;  4TXR A;  2JAB A;  4HOQ A;  4GTP A;  4G8L A;  5LFA A;  4UI9 C;  2XRZ A;  3IBE A;  4RSY A;  1OWP A;  2AXZ A;  3EJN A;  5CRV A;  2ETB A;  2YHE A;  3DRA A;  4HLL A;  4BEP A;  3ULE G;  2YNQ A;  2EIN E;  3PUJ A;  4U0S A;  4QQI A;  3PRE A;  4PDX A;  3ASG A;  2B0O E;  4L9P A;  2OV8 A;  2PQR A;  4LEU A;  4HQD A;  3FUN A;  3J5P A;  3TWS A;  2F0Y A;  1N11 A;  2R5S A;  3D9I A;  3CEQ A;  3CK9 A;  2QFC A;  4I2W A;  2IQC A;  5BXO A; 
#chains in the Genus database with same CATH homology
 1OY3 D;  4U96 D;  4OAV B;  5FIO A;  5HKP A;  5AN8 A;  2J8S D;  4J8Y A;  1YMP A;  1SVX A;  2DVW A;  4BES A;  5KBA A;  2A5E A;  1IKN D;  3NOG D;  5CBN A;  3D9H A;  4BER A;  3W9F A;  1G3N B;  3ZNG A;  2KBX A;  1NFI E;  1BI8 B;  4HI9 A;  5BXU A;  3AJI A;  3ZKJ A;  3TWU A;  2ETA A;  3W9G A;  3T8K A;  5JA4 D;  1MX6 A;  1MX4 A;  3SO8 A;  4A63 B;  3V31 A;  3V2O A;  1BU9 A;  4K5B A;  4OAU C;  4F1P A;  4Z68 A;  5ENQ D;  3TWV A;  1K1B A;  1TR4 A;  5JMN D;  3ZU7 B;  4CZ2 D;  4G8K A;  3TWT A;  5CEA A;  2P2C P;  3UXG A;  2KXP C;  3B7B A;  3V30 A;  5D66 A;  2AJA A;  5CED B;  3JUE A;  5ENR D;  4HBD A;  3DEO A;  1DCQ A;  5EIB E;  2VGE A;  2XEN A;  2Y1L E;  2XEH A;  4HRL A;  4JB8 P;  3V2X A;  3TWX A;  3C5R A;  4GPM A;  4HB5 A;  4HNA D;  3TWQ A;  3UTM A;  3JXJ A;  2NYJ A;  4HRN A;  2DZN A;  1IHB A;  3IXE A;  1MYO A;  4UUC A;  2RFM A;  3Q9U C;  5ENT D;  5EYP F;  1K1A A;  2ETC A;  5AQB A;  4K5A B;  4HI8 A;  4ZHB A;  1AP7 A;  2ZGD A;  3F6Q A;  5AQ9 A;  2Y0B G;  4DX6 D;  5CBO A;  3TWW A;  1MX2 A;  4NIK A;  4O1P A;  3T9K A;  2MYO A;  4K5C A;  2BKK B;  5ENO D;  1D9S A;  1WG0 A;  5AAO A;  5CER B;  2JAB A;  1YYH A;  4DX1 A;  1BLX B;  1A5E A;  1S70 B;  1DC2 A;  4G8L A;  4LSZ E;  2F37 A;  3EHQ A;  5FIN A;  2PNN A;  2DWZ A;  4B93 B;  1WDY A;  5ITZ F;  4HRM B;  5AQA A;  5KWD A;  1K3Z D;  3V79 K;  1IXV A;  1AWC B;  3JXI A;  1YCS B;  4LG6 A;  1QYM A;  5CEC B;  2XZT G;  3EHR A;  4J7W A;  4TUM A;  2RFA A;  5ENP D;  4DUI A;  3J5Q B;  2FO1 E;  3NBN B;  5EN5 D;  4DX5 D;  2QYJ A;  2QC9 A;  2F8Y A;  3KEA A;  4CYM D;  3Q9N C;  2L6B A;  4ATZ D;  5ENS D;  3UI2 A;  2V4H C;  2ETB A;  3B95 A;  5AQ7 A;  3NOC D;  3TWR A;  4F6R D;  4QFV A;  4YDY A;  2V5Q C;  5EYL A;  1BI7 B;  4HLL A;  4GMR A;  4U8Y D;  4U95 D;  5AAR A;  4BEP A;  2F8X K;  1BD8 A;  1MJ0 A;  4QQI A;  1N0Q A;  3EU9 A;  2B0O E;  2XZD G;  1SW6 A;  4O60 A;  4BSZ B;  4O1O A;  2XEE A;  4HQD A;  4DX7 D;  1UOH A;  3J5P A;  3LJN A;  3DEP A;  5EIL A;  1OT8 A;  4ZFH A;  3TWS A;  5KNH D;  4BET A;  3ZUV B;  4U8V D;  1N11 A;  3HRA A;  4YDW A;  1N0R A;  4N5Q A;  2DZO A;  5EID A;  4RLY A;  5HS0 A;  2HE0 A;  4LNU D;  5KNG A;  2BKG A;  4C48 B;  3HG0 D;  4DRX E;  2ZGG A;  5HRY A;  4DX2 A;  3AAA C;  5BXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...