1YYHA

Crystal structure of the human notch 1 ankyrin domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
193
structure length
193
Chain Sequence
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the human Notch 1 ankyrin domain
pubmed doi rcsb
molecule keywords Notch 1, ankyrin domain
molecule tags Cell cycle,transcription
source organism Homo sapiens
total genus 68
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1yyhA00
4ZHBA 5EN5D 3TWXA 1MJ0A 1BLXB 2DZNA 5AQAA 3TWVA 1IKND 3ZU7B 5FIOA 5KNHD 4U96D 4CYMD 4U8VD 1D9SA 1BI7B 4OAVB 3EHQA 2AJAA 4J7WA 5ENOD 4HB5A 5EIBE 4O1OA 2J8SD 5ITZF 2KBXA 3NBNB 5FINA 2ETBA 4HRMB 3ZUVB 2ETCA 5KBAA 5EILA 4ATZD 1IXVA 3V79K 1SVXA 1BI8B 2L6BA 3TWTA 5AQ9A 3ZNGA 1K1AA 3SO8A 5BXUA 2DWZA 3HG0D 4QQIA 5CBOA 4G8LA 5ENRD 3IXEA 4HI9A 2V4HC 3AJIA 1YMPA 1YYHA 4HQDA 4HI8A 5AAOA 4HNAD 3JUEA 1S70B 2B0OE 5ENSD 1MX4A 2F8YA 1N0QA 2NYJA 2ZGGA 5CBNA 5JA4D 3DEOA 2F37A 1NFIE 4YDWA 5CEDB 3TWRA 5CEAA 3Q9NC 4DX5D 4F1PA 3V2XA 3EHRA 3B95A 1WDYA 2A5EA 3HRAA 3J5QB 4O60A 1MYOA 2V5QC 3TWUA 4BETA 2Y1LE 5BXOA 2MYOA 4DX7D 4K5BA 4F6RD 4TUMA 4K5CA 2P2CP 3W9FA 4HLLA 2F8XK 4NIKA 4LNUD 1K3ZD 1OT8A 1K1BA 4Z68A 5CECB 3EU9A 4DRXE 3JXIA 4YDYA 5EYLA 5HKPA 4G8KA 1TR4A 4UUCA 4B93B 4DX2A 2BKGA 4GPMA 3V2OA 5HS0A 1BU9A 1QYMA 1UOHA 2RFMA 2VGEA 2XZDG 4HRLA 4N5QA 2PNNA 3DEPA 1N0RA 5CERB 4O1PA 4RLYA 5KNGA 4U8YD 1DCQA 5AQBA 3UTMA 1AP7A 4HRNA 1WG0A 4A63B 1A5EA 3T8KA 2Y0BG 5AQ7A 1DC2A 4JB8P 4K5AB 1OY3D 2BKKB 2XENA 4ZFHA 3W9GA 1SW6A 4DX6D 2HE0A 3Q9UC 4CZ2D 4DUIA 3D9HA 4J8YA 3UI2A 2JABA 1BD8A 3NOGD 5EIDA 1IHBA 4HBDA 4LSZE 5AN8A 2DVWA 4U95D 3V31A 3TWQA 2FO1E 5KWDA 5ENPD 4BESA 2KXPC 2XEHA 3V30A 2ZGDA 3F6QA 3AAAC 3NOCD 4GMRA 4QFVA 1G3NB 1N11A 4BEPA 2RFAA 4C48B 3LJNA 2XZTG 3ZKJA 4DX1A 3B7BA 5ENTD 1MX2A 2ETAA 3JXJA 2XEEA 3KEAA 3TWSA 2QC9A 3C5RA 4BSZB 1AWCB 3UXGA 3J5PA 5AARA 5D66A 5HRYA 2DZOA 4LG6A 5EYPF 5JMND 2QYJA 1MX6A 3T9KA 4BERA 4OAUC 3TWWA 5ENQD 1YCSB
chains in the Genus database with same CATH superfamily
5T4YA 1ZB1A 1MJ0A 4Q96A 3EUVA 4HFGA 4G1TA 3TAXA 3C3OA 3KEZA 3NAWA 1E7UA 3AG4E 3CVQA 4XI0A 2F0YA 3AS5A 3FU6A 4HS2A 4ACLA 2C0MA 5FQ4A 1PC2A 2WM9A 3IEGA 2F37A 1LD8A 4CGWA 3TWRA 1HH8A 4DX5D 2XEVA 2P9PG 3EHNA 3SFZA 2FI7A 1GW6A 4GYOA 3E30A 1TYQG 1OCOE 3DSUA 5G05C 5G2NA 3Q7AA 3HVEB 3EU9A 3QK0A 3CR3A 4DX2A 3FTVA 1MZCA 5HQ8A 4HOSA 2EILE 2Y3AA 1EPUA 5G55A 2Y4UA 3QARA 4BTBA 4FJYA 4KT6B 3GYZA 2HE0A 1HS6A 2WPVA 3G2TA 3B13A 3D9HA 1KLXA 2ZISA 2WXRA 5KWDA 5ENPD 3FHEA 1EDUA 3LEWA 2KCKA 2X3MA 3G2SA 3KEAA 4DLOA 4IN3B 2IJGX 4LG6A 4OAUC 3D9LA 1MHQA 4G24A 3N71A 3HVEA 2PM7A 4ILGA 4CYMD 2YINA 3HXDA 2RG8A 3KD7A 3I5PA 4O1OA 3D9KA 4DI4A 1Z5SC 5CBOA 2DWZA 3ASFA 3UT7A 3FY4A 4URKA 1Z3XA 3DSXA 1NFIE 5CRVA 5CEAA 4AJWA 3X2QE 2IO2C 1WDYA 1E90A 5FJYA 3LKUA 3LXUX 2YHEA 4GA0A 2PL2A 3JXIA 4MBGA 5LX8A 3FUDA 5G04J 1QQEA 3OXGA 2A4ZA 4N5QA 4HRLA 4G25A 4HVBA 2V0PA 4GPKA 4JEUA 4L7TA 5M72A 4APOA 1E8WA 1AP7A 2E2EA 2WMOA 5B3SE 1HE8A 2BKKB 4I2WA 4PUCA 3ASDA 1IHBA 4GA2A 2VQ2A 1UJJA 4TXPA 4XKCA 3MV3B 3F6QA 3LY8A 2UY1B 1ZU2A 1N11A 4L2LA 5T8IA 2NC9A 4UI9K 4BTAA 2OEVA 3DSSA 1TNYA 2QC9A 3J5PA 2NXPA 3I4RB 2XGSA 5KJMA 3Q5MA 1MQSA 2Q7FA 3TWXA 5AYWD 3DPDA 3T5XA 4JA9A 2XRYA 3SQVA 3S7JA 3HXEA 3FH5A 3ULEG 3VTYA 3LY9A 4JVSA 3RSEG 3D9MA 3MA5A 1IHGA 3ZNGA 5AQ9A 2NSZA 5EX3A 4I17A 3AJIA 5CRUA 3EDTB 4X8QA 3FWVA 4CDRA 5CBNA 1ZBPA 3UMVA 2J09A 3WXXA 3LYAA 5AENA 1JCSA 3J5QB 3HRAA 1S0PA 1TNBA 4J0UA 4DX7D 1XNFA 5DBKA 2I6HA 4JW1A 2WXKA 4GTRA 3TG4A 3CQGB 1BU9A 4I9EA 3SZ7A 3QC1A 4AY6A 4OYSA 3CLJA 4NACA 2LSUA 3ONLA 1BPOA 3SGHA 3Q9UC 1KZPA 4GTOA 3SFYA 4ANUA 4N2SA 4PDXA 2XCBA 4HLEA 2IF4A 4A3VA 4OVUA 2IOSA 1OWLA 4C48B 2MHKA 2ETAA 2PZIA 2IONA 3UQ3A 2X6JA 2QYJA 1MX6A 3C3QA 5BV0A 2AXVA 3U4TA 1UG3A 3TWVA 3AU4A 2A5UA 2VGXA 3ZEFA 2AJAA 3L9TA 2J8SD 2XGMA 2XS8A 3NZUA 3ML8A 3ZIMA 2DCPA 4U7EB 3IV0A 3LDZA 4YNDA 3S7BA 2HR2A 3D3MA 3Q4AB 2V4HC 4B8CB 1MX4A 2R03A 5EKQD 2OV8A 1JCRA 2MOWA 3B7RL 4MS6A 2KM4A 1JWGA 3LJ3A 3FU5A 4K5BA 3C98A 5JJTA 5DIZA 2F8XK 3ZYKA 3Q15A 4NIKA 1K3ZD 4AOFA 4Z68A 1N4QA 2WXJA 4B93B 4BY6A 5HS0A 3DPYA 4CDNA 2RFMA 2XZDG 4R7LA 4ANXA 3L22A 1FVHA 1SA4A 3RK6A 1PY1A 1N9AA 2Y0BG 3FU3A 1JUQA 1NI1A 2GROB 3CHPA 1LF8A 5ARFA 2JABA 3CQCB 4EZLA 1BD8A 5EIDA 5ANLA 3S2AA 3SNXA 3CIAA 3G2UA 3PNTB 4F53A 1MX2A 3MV2B 3DBSA 3SBSA 3TWSA 1VDYA 3C5RA 4U0ZA 5FZQA 4YDOA 2KZTA 3DXMG 1OCCE 4JA7A 4WNGA 2WMNA 4LNBA 1BI7B 3L13A 4J7WA 5FQ6A 5JJ6A 1UN8A 4QQIA 4G8LA 2WXPA 2AVPA 4BT8A 5ENSD 2NYJA 3ZHEB 4Q69A 3CHQA 3LY7A 4AXHA 3CK8A 1MYOA 2V5QC 3ESLA 5IY5E 5A6CA 4JHRA 4C0MA 5FQ8A 3TG5A 1D8DA 1W3BA 1TR4A 3OAWA 3DSVA 4IRUA 2HO1A 1H19A 3DEPA 4N3BA 5CERB 3PNLB 4WWPA 3C3RA 4NQ0A 2P9NG 3AG1E 1WG0A 2VYIA 3B7UX 4L2YA 5ARGA 2OOEA 4CGVA 3IKOB 2KXPC 3ABLE 2X6FA 3Q49B 3AAAC 3DSTA 3E37A 1HZ4A 3B7BA 3QWWA 2YHCA 3K9IA 1OWNA 4FLBA 1TN6A 3EU5A 5D0QD 3UX4A 2VJ8A 3E32A 4U96D 3QJZA 1INZA 3MKQB 4WUYA 2KBXA 3TXMA 3AS4A 4JHJA 3KS2A 1H6PA 3S7FA 1BI8B 5C1DA 4RG6A 3FUMA 4HNAD 2OVBA 3RAUA 4G2VA 4KZCA 4EZJA 4TXQA 1OUVA 4AM9A 4GCNA 1UW4B 4K0RA 3APDA 3PE3A 4L23A 3L82A 1HFAA 4OVVA 4HLLA 3SHFA 3CHOA 2BF0X 4BWRA 4PS3A 2J08A 4G8KA 4BX9A 3NF1A 1H6KA 3GZ2A 4TV3A 4EPZA 1E8ZA 3AS8A 1SA5A 3CHMA 4XIFA 4HOUA 4B89A 4F1SA 3UUXA 3CV0A 3WG7E 1OCRE 2IQCA 4GCOA 1SW6A 5C2YA 4DI3A 1WM5A 3FTZA 4J6IA 3ZYQA 2FO1E 3PRZA 4KZ0A 3SFXA 3UKUG 1RZ4A 4KBQA 4YVQC 4B8AA 2CFZA 2ZU6B 3APCA 2GRPB 3GW4A 2FO7A 1N4RA 5JMND 5LP0A 4KVMA 2X6IA 3JUIA 1Z6TA 3MZLB 5KNHD 2GGFA 4KVOA 4OAVB 1XGWA 4CRWA 4A1GA 1N54A 2LO6A 2I1KA 3SBTB 4ILIA 5BV1A 3RJVA 2YNQA 2OVFA 3V79K 4UWHA 3EIJA 2L0TB 3CKCA 3IXEA 2KC7A 3SF4A 2B0OE 2C2LA 4YDWA 4JPSA 2J07A 4FULA 3V2XA 3OXFA 1HG5A 2WVIA 3TXNA 2PQNA 3CHSA 3ZN3A 1O1SA 5E75A 4JC8A 2EQXA 2WXGA 2AWIA 4GZ3A 5E76A 1DVPA 1QYMA 3R9MA 2Y4TA 2PNNA 5BPPA 4O1PA 4RLYA 3ULQA 3B7SA 4U8YD 2IY0C 4Y6WA 1IYGA 4E6HA 2HM8A 3ABME 1OY3D 2XENA 5D0OD 4MLPA 4FC8A 5CCMA 4YDEA 2RD0A 4I2ZA 2WXQA 4L9PA 3BU8A 3CVVA 4BESA 1OXJA 2WQHA 4Q94A 2LXLA 3Q7FA 2DYRE 3PEVB 3TJPA 3E33A 2DZOA 3T9KA 2WXHA 3UT4A 3LVQE 3L54A 3AG2E 1LD7A 5J90A 2OCCE 3SD5A 3FUEA 3BQOA 4J8EA 1ELWA 1QBQA 3SO8A 3ASGA 5FTPA 4HQDA 4HI8A 3JUEA 2XQ0A 2LAIA 1E8YA 2KATA 3HIZA 4AEZC 3HXBA 5BXOA 1OWPA 4CDMA 3RRNB 5LOZA 3MYVA 3RRMB 1EF1C 5FQ7A 1X81A 2L6JA 3L6AA 4DRXE 3CVWA 1TJFA 4UUCA 3UT8A 4HOQA 2BKGA 2UY1A 1H0AA 3UTMA 1A5EA 3KSQA 5AJLA 1ELKA 4W9RA 4BFRA 4FJZA 4DLQA 1TN8A 4LEUA 4CZ2D 4GTMA 2V5FA 3V30A 4F3VA 4BEPA 4KMOA 3UM1A 3ZXSA 4A3TA 3QDNA 3OTNA 4J8DA 4IULA 4EECA 3VLFA 3UXGA 4H7YA 4A55A 5D66A 3RU0A 3D9PA 1JPLA 2WXIA 2WXLA 1IQRA 3ULYA 3PUJA 5EIBE 3RO2A 1YA0A 4EZKA 3PVLA 2IFUA 5FINA 2XPZA 4XKBA 1ELRA 5BXUA 4CT4A 2E0IA 3KAEA 1YMPA 4FADA 3QWVA 3PS6A 3FH7A 3PE4A 4GU5A 4F1PA 3KSLA 4G23A 2LAHA 4LRZA 2WXNA 3ASHA 4N3AA 1FT2A 1B89A 4GTVA 3B7TA 4FLHA 2WXMA 1FPPA 2EIJE 3EIQC 3D9OA 1UJKA 3FUNA 3MJWA 3Q78A 1TNZA 5T3RA 2WB2A 2AXZA 2I1JA 5CHEE 5AQBA 1DCQA 4HRNA 4LERA 3CVNA 3PH0C 3FH8A 5A23A 2WXOA 4YVOA 1RW2A 3MGBA 2I2OA 3VLEA 4F7AA 4MKTA 2IOLA 3Q73A 4N2QA 4UWFA 4E85A 4U04A 4G26A 4JD2G 4C0EA 3ZKJA 3RRUA 3PZ1A 4I6GA 1UN9A 4RSYA 4V3IA 3U64A 4TUUA 3ZYLA 2VGYA 2J49A 1SZAA 4ZHBA 3U3WA 5B1AE 1E7VA 2KCVA 3FTSA 1H2UA 4HB5A 3L17A 3DRAA 2ZXWE 4GTQA 3NBNB 2H6IA 1HX8A 1NZNA 4L1BA 2L6BA 3HG0D 1N95A 3CVXA 4BSXA 4UWKA 4EQFA 2FEZA 4WNDA 1S70B 2F8YA 2PM6A 4G11A 3ASNE 4GMJA 3Q9NC 3JQ0A 4GZCA 3Q79A 4RG9A 2H6HA 2A5EA 1HU3A 4KXKB 1P5QA 4JL0A 3UM3A 4ME2A 4MRUA 3CHRA 4LCTA 1WY6A 5FT9A 5CECB 3CSTA 4J8SA 3ZW3A 5EYLA 5HKPA 3U66A 4GPMA 5KJLA 2R5SA 1UOHA 3R9AB 4XZ4A 3PZ3A 1E8XA 1EYHA 2JLBA 1H6OA 3UI2A 3TGOA 3PZ4A 1NP7A 2VTBB 5KJNA 3FTYA 4ATGA 2V8SE 3MX3A 1Q2ZA 4KYOB 4JXTA 3FFLA 3JXJA 4WNFA 3OXLA 5EYPF 2GRLA 5A7DB 5ENNA 5CCLA 4H7XA 5H7PA 4Y6CA 1IKND 3FDHA 5FIOA 4HXIA 3ZYMA 3AG3E 3ZHEA 1DCEA 1Z3YA 5EDSA 4GAAA 4HRMB 3QKYA 4WAFA 2H6GA 4ATZD 3HXCA 3TWTA 3PEUB 4I1MA 2YQ8A 5J08A 3FP3A 3Q75A 3G2WA 4AIFA 3CVUA 4FA6A 4PS8A 2MYOA 4PS7A 3W9FA 4XI9A 4WWNA 1OT8A 1PAQA 2P9SG 2AXUA 2CHZA 2X6HA 3CVLA 2P9UG 2VGEA 4NRHB 4JZYA 1QNFA 3JQ1A 4DJAA 3T8KA 3UKRG 4ZFHA 3HHMA 4I1OB 2VSNA 4BX8A 3D9JA 3PUKA 2R05A 4LSZE 3CK9A 3TWQA 4LUNU 3ISMC 4AY5A 2EIME 4QFVA 3BG1B 3MKQA 3FUIA 4M3OA 3FUKA 4DX1A 3UPVA 1AWCB 2R59A 3DWLG 2P9KG 2FF4A 4U8VD 2J4BA 4PH4B 1X5BA 5KBAA 3T8MA 4XEIG 5EILA 2DIWA 2P9LG 3NZSA 3RKVA 3G2VA 4ILHB 3PZDA 4RQIA 1HXIA 3R7QA 3IHVA 4GYYA 1HG2A 4UI9C 4UWLA 4U8HA 3I4GA 4BETA 4DPRA 4WWOA 3EJNA 4GZ6A 2CHXA 4U63A 4LNUD 2VSOE 3QAQA 4A1SA 3ESKA 5AIJA 2P9IG 2R02A 1S64A 1N0RA 2H6FA 3L08A 1O1TA 1Y8MA 3SI5A 4J8YA 3NOGD 1KT1A 4XX5A 5AN8A 2J4DA 1SZ9A 2GRRB 4JEHA 5LCWJ 3BG0B 4GYWA 1G3NB 1NL4A 4D10C 4EHMA 5FWQA 4K03A 2RKKA 2LUHA 2X38A 2WQ7A 5ENQD 5CEDB 2CG2A 3FUJA 3LS8A 3I3NA 4DK5A 1TN7A 4EBAG 1D9SA 2XS1A 2FULA 2OEWA 4HOTA 2GRQB 3CEQA 2WXFA 2IU1A 1OWOA 1SVXA 2CG3A 1K1AA 2GRNB 4HI9A 4I6EA 2CFUA 4I1AA 5AAOA 3UM0A 1N0QA 2ZGGA 3ZVVA 3E4BA 3CVYA 5BUZA 3B95A 4O60A 3ZGQA 4AP2A 1NA3A 3FEXA 4C9BB 3O4ZA 4TUMA 4K5CA 2P2CP 5CMYA 3FEYA 3MCXA 4BT9A 3VLDA 5BNWA 1JCQA 4EBAA 2VSYA 2AW6A 1TJCA 1U3CA 3R7RA 1KT0A 2ONDA 3APFA 3Q47B 2P58C 1H2VC 3W9GA 2QZAA 4UQZA 5JHAA 4FP7A 4U95D 2ZGDA 3NOCD 2I9CA 4GMRA 3FULA 2RFAA 2XZTG 1FT1A 1LTXA 2BEDA 3LCAA 2XEEA 3QWPA 2MRIA 3FUFA 1YCSB 2LNIA 2XPYA 4UQXA 3MKRA 4APFA 4CEMA 2XCCA 3VTXA 1TNOA 4B0ZA 4N39A 5HI7A 4AVXA 3QB2A 1FVFA 1N52A 4FU3A 2VGXB 3EHRA 3URZA 3UIOC 3CKBA 3DXKG 1N4SA 1JWFA 3TL5A 3JYSA 4XE0A 5CMWA 4U07A 3IBEA 1KPSB 3SY2A 4UQYA 4O6FA 2X6KA 4YDYA 4TRQA 5ANRA 3V2OA 3HYMB 3JCKC 2UWJG 2L0IA 4ABNA 3FTXA 3NB2A 4JB8P 5JHBA 1U3DA 3CSFA 4GA1A 1NA0A 2LXMA 4DX6D 4DUIA 1E96B 2PQRA 5D2MC 2DVWA 1A17A 2V4LA 3ZPJA 1K8KG 4M7CA 5KJKA 3O48A 4GZDA 3FU0A 2XRZA 1TNUA 2B6CA 2KCLA 3CVPA 1DNPA 2CHWA 5LCWC 3TWWA 4TXRA 1D8EA 1HO8A 2ZIRA 2DZNA 1BLXB 5AQAA 4GTSA 4RVBA 3EHQA 2QY7A 5ENOD 5ITZF 3FTUA 3ASOE 1V54E 1IXVA 4I9CA 2BTDA 2KZTB 1L5JA 1Y6IA 1YYHA 3MEKA 4LNGA 5JA4D 1N94A 1KZOA 4ACKA 1FCHA 5G05J 4CCAA 2IO3C 1QZ2A 4I43A 2VSXE 4CT0A 2DYSE 3TWUA 5JJ7A 3RO3A 4ANWA 2Y1LE 2BUGA 4GZ5A 4WNEA 3ONKA 5G04C 4B94A 4UI9J 4F6RD 1WAO1 4UWGA 3PDNA 2JEKA 3PZ2A 3EHMA 2EIKE 3HDXA 5KCMA 4U0SA 2Y69E 2J9QA 3GZ1A 2LSVA 3ML9A 2L9BA 5AQ7A 1DC2A 1OWMA 1H2TC 4FHJA 4JHKA 2C0LA 1TEZA 3AU5A 4N5CA 2EINE 3ZFWA 2XEHA 4ANVA 3ENEA 1N4PA 2GRMA 4J8FA 3CK7A 4GMLA 3ZXPA 3UM2A 4BSZB 2IEJA 2R17C 5EN5D 4GTPA 3ZU7B 1O5MA 3ZRHA 2WQ6A 2DBAA 2HYZA 3RIBA 5BW8C 2ETBA 3ZUVB 2ETCA 3P2BA 3FTWA 3PREA 5ENRD 4FHKA 5AJDA 5B1BE 3BEEA 3ABKE 3DEOA 1HF8A 3C72A 1SQMA 3CGHA 5FZRA 2QFCA 3LPZA 3UIPC 3FUHA 2ILRA 3E34A 3HXFA 5FZSA 3T5VA 3QOUA 3P1UA 3QNKA 1K1BA 2M63A 4AV7A 4I6JA 4HORA 2FBNA 2R2LA 2VTBA 4GTTA 4U0UA 3UINC 3D9IA 3L16A 4P29A 2XPIA 1S63A 5KNGA 3S7DA 1O1RA 4N3CA 5LFAA 5EX0A 4NURA 4A63B 1IQUA 4GB9A 4K5AB 3IHYA 2GW1A 2XHEA 3D9NA 1U2VG 3BUAA 3U9WA 4HBDA 3V31A 1OCZE 2XGOA 3GZSA 4IYPA 3LJNA 1V55E 5ENTD 3NQPA 2QYUA 3LVRE 5BT1A 5AARA 5HRYA 3DSWA 4BERA
chains in the Genus database with same CATH topology
4ZHBA 5EN5D 3TWXA 1MJ0A 1BLXB 2DZNA 5AQAA 3TWVA 1IKND 3ZU7B 5FIOA 5KNHD 4U96D 4CYMD 4U8VD 1D9SA 1BI7B 4OAVB 3EHQA 2AJAA 4J7WA 5ENOD 4HB5A 5EIBE 4O1OA 2J8SD 5ITZF 2KBXA 3NBNB 5FINA 2ETBA 4HRMB 3ZUVB 2ETCA 5KBAA 5EILA 4ATZD 1IXVA 3V79K 1SVXA 1BI8B 2L6BA 3TWTA 5AQ9A 3ZNGA 1K1AA 3SO8A 5BXUA 2DWZA 3HG0D 4QQIA 5CBOA 4G8LA 5ENRD 3IXEA 4HI9A 2V4HC 3AJIA 1YMPA 1YYHA 4HQDA 4HI8A 5AAOA 4HNAD 3JUEA 1S70B 2B0OE 5ENSD 1MX4A 2F8YA 1N0QA 2NYJA 2ZGGA 5CBNA 5JA4D 3DEOA 2F37A 1NFIE 4YDWA 5CEDB 3TWRA 5CEAA 3Q9NC 4DX5D 4F1PA 3V2XA 3EHRA 3B95A 1WDYA 2A5EA 3HRAA 3J5QB 4O60A 1MYOA 2V5QC 3TWUA 4BETA 2Y1LE 5BXOA 2MYOA 4DX7D 4K5BA 4F6RD 4TUMA 4K5CA 2P2CP 3W9FA 4HLLA 2F8XK 4NIKA 4LNUD 1K3ZD 1OT8A 1K1BA 4Z68A 5CECB 3EU9A 4DRXE 3JXIA 4YDYA 5EYLA 5HKPA 4G8KA 1TR4A 4UUCA 4B93B 4DX2A 2BKGA 4GPMA 3V2OA 5HS0A 1BU9A 1QYMA 1UOHA 2RFMA 2VGEA 2XZDG 4HRLA 4N5QA 2PNNA 3DEPA 1N0RA 5CERB 4O1PA 4RLYA 5KNGA 4U8YD 1DCQA 5AQBA 3UTMA 1AP7A 4HRNA 1WG0A 4A63B 1A5EA 3T8KA 2Y0BG 5AQ7A 1DC2A 4JB8P 4K5AB 1OY3D 2BKKB 2XENA 4ZFHA 3W9GA 1SW6A 4DX6D 2HE0A 3Q9UC 4CZ2D 4DUIA 3D9HA 4J8YA 3UI2A 2JABA 1BD8A 3NOGD 5EIDA 1IHBA 4HBDA 4LSZE 5AN8A 2DVWA 4U95D 3V31A 3TWQA 2FO1E 5KWDA 5ENPD 4BESA 2KXPC 2XEHA 3V30A 2ZGDA 3F6QA 3AAAC 3NOCD 4GMRA 4QFVA 1G3NB 1N11A 4BEPA 2RFAA 4C48B 3LJNA 2XZTG 3ZKJA 4DX1A 3B7BA 5ENTD 1MX2A 2ETAA 3JXJA 2XEEA 3KEAA 3TWSA 2QC9A 3C5RA 4BSZB 1AWCB 3UXGA 3J5PA 5AARA 5D66A 5HRYA 2DZOA 4LG6A 5EYPF 5JMND 2QYJA 1MX6A 3T9KA 4BERA 4OAUC 3TWWA 5ENQD 1YCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHB A;  5EN5 D;  3TWX A;  1MJ0 A;  1BLX B;  2DZN A;  5AQA A;  3TWV A;  1IKN D;  3ZU7 B;  5FIO A;  5KNH D;  4U96 D;  4CYM D;  4U8V D;  1D9S A;  1BI7 B;  4OAV B;  3EHQ A;  2AJA A;  4J7W A;  5ENO D;  4HB5 A;  5EIB E;  4O1O A;  2J8S D;  5ITZ F;  2KBX A;  3NBN B;  5FIN A;  2ETB A;  4HRM B;  3ZUV B;  2ETC A;  5KBA A;  5EIL A;  4ATZ D;  1IXV A;  3V79 K;  1SVX A;  1BI8 B;  2L6B A;  3TWT A;  5AQ9 A;  3ZNG A;  1K1A A;  3SO8 A;  5BXU A;  2DWZ A;  3HG0 D;  4QQI A;  5CBO A;  4G8L A;  5ENR D;  3IXE A;  4HI9 A;  2V4H C;  3AJI A;  1YMP A;  1YYH A;  4HQD A;  4HI8 A;  5AAO A;  4HNA D;  3JUE A;  1S70 B;  2B0O E;  5ENS D;  1MX4 A;  2F8Y A;  1N0Q A;  2NYJ A;  2ZGG A;  5CBN A;  5JA4 D;  3DEO A;  2F37 A;  1NFI E;  4YDW A;  5CED B;  3TWR A;  5CEA A;  3Q9N C;  4DX5 D;  4F1P A;  3V2X A;  3EHR A;  3B95 A;  1WDY A;  2A5E A;  3HRA A;  3J5Q B;  4O60 A;  1MYO A;  2V5Q C;  3TWU A;  4BET A;  2Y1L E;  5BXO A;  2MYO A;  4DX7 D;  4K5B A;  4F6R D;  4TUM A;  4K5C A;  2P2C P;  3W9F A;  4HLL A;  2F8X K;  4NIK A;  4LNU D;  1K3Z D;  1OT8 A;  1K1B A;  4Z68 A;  5CEC B;  3EU9 A;  4DRX E;  3JXI A;  4YDY A;  5EYL A;  5HKP A;  4G8K A;  1TR4 A;  4UUC A;  4B93 B;  4DX2 A;  2BKG A;  4GPM A;  3V2O A;  5HS0 A;  1BU9 A;  1QYM A;  1UOH A;  2RFM A;  2VGE A;  2XZD G;  4HRL A;  4N5Q A;  2PNN A;  3DEP A;  1N0R A;  5CER B;  4O1P A;  4RLY A;  5KNG A;  4U8Y D;  1DCQ A;  5AQB A;  3UTM A;  1AP7 A;  4HRN A;  1WG0 A;  4A63 B;  1A5E A;  3T8K A;  2Y0B G;  5AQ7 A;  1DC2 A;  4JB8 P;  4K5A B;  1OY3 D;  2BKK B;  2XEN A;  4ZFH A;  3W9G A;  1SW6 A;  4DX6 D;  2HE0 A;  3Q9U C;  4CZ2 D;  4DUI A;  3D9H A;  4J8Y A;  3UI2 A;  2JAB A;  1BD8 A;  3NOG D;  5EID A;  1IHB A;  4HBD A;  4LSZ E;  5AN8 A;  2DVW A;  4U95 D;  3V31 A;  3TWQ A;  2FO1 E;  5KWD A;  5ENP D;  4BES A;  2KXP C;  2XEH A;  3V30 A;  2ZGD A;  3F6Q A;  3AAA C;  3NOC D;  4GMR A;  4QFV A;  1G3N B;  1N11 A;  4BEP A;  2RFA A;  4C48 B;  3LJN A;  2XZT G;  3ZKJ A;  4DX1 A;  3B7B A;  5ENT D;  1MX2 A;  2ETA A;  3JXJ A;  2XEE A;  3KEA A;  3TWS A;  2QC9 A;  3C5R A;  4BSZ B;  1AWC B;  3UXG A;  3J5P A;  5AAR A;  5D66 A;  5HRY A;  2DZO A;  4LG6 A;  5EYP F;  5JMN D;  2QYJ A;  1MX6 A;  3T9K A;  4BER A;  4OAU C;  3TWW A;  5ENQ D;  1YCS B; 
#chains in the Genus database with same CATH topology
 5T4Y A;  1ZB1 A;  1MJ0 A;  4Q96 A;  3EUV A;  4HFG A;  4G1T A;  3TAX A;  3C3O A;  3KEZ A;  3NAW A;  1E7U A;  3AG4 E;  3CVQ A;  4XI0 A;  2F0Y A;  3AS5 A;  3FU6 A;  4HS2 A;  4ACL A;  2C0M A;  5FQ4 A;  1PC2 A;  2WM9 A;  3IEG A;  2F37 A;  1LD8 A;  4CGW A;  3TWR A;  1HH8 A;  4DX5 D;  2XEV A;  2P9P G;  3EHN A;  3SFZ A;  2FI7 A;  1GW6 A;  4GYO A;  3E30 A;  1TYQ G;  1OCO E;  3DSU A;  5G05 C;  5G2N A;  3Q7A A;  3HVE B;  3EU9 A;  3QK0 A;  3CR3 A;  4DX2 A;  3FTV A;  1MZC A;  5HQ8 A;  4HOS A;  2EIL E;  2Y3A A;  1EPU A;  5G55 A;  2Y4U A;  3QAR A;  4BTB A;  4FJY A;  4KT6 B;  3GYZ A;  2HE0 A;  1HS6 A;  2WPV A;  3G2T A;  3B13 A;  3D9H A;  1KLX A;  2ZIS A;  2WXR A;  5KWD A;  5ENP D;  3FHE A;  1EDU A;  3LEW A;  2KCK A;  2X3M A;  3G2S A;  3KEA A;  4DLO A;  4IN3 B;  2IJG X;  4LG6 A;  4OAU C;  3D9L A;  1MHQ A;  4G24 A;  3N71 A;  3HVE A;  2PM7 A;  4ILG A;  4CYM D;  2YIN A;  3HXD A;  2RG8 A;  3KD7 A;  3I5P A;  4O1O A;  3D9K A;  4DI4 A;  1Z5S C;  5CBO A;  2DWZ A;  3ASF A;  3UT7 A;  3FY4 A;  4URK A;  1Z3X A;  3DSX A;  1NFI E;  5CRV A;  5CEA A;  4AJW A;  3X2Q E;  2IO2 C;  1WDY A;  1E90 A;  5FJY A;  3LKU A;  3LXU X;  2YHE A;  4GA0 A;  2PL2 A;  3JXI A;  4MBG A;  5LX8 A;  3FUD A;  5G04 J;  1QQE A;  3OXG A;  2A4Z A;  4N5Q A;  4HRL A;  4G25 A;  4HVB A;  2V0P A;  4GPK A;  4JEU A;  4L7T A;  5M72 A;  4APO A;  1E8W A;  1AP7 A;  2E2E A;  2WMO A;  5B3S E;  1HE8 A;  2BKK B;  4I2W A;  4PUC A;  3ASD A;  1IHB A;  4GA2 A;  2VQ2 A;  1UJJ A;  4TXP A;  4XKC A;  3MV3 B;  3F6Q A;  3LY8 A;  2UY1 B;  1ZU2 A;  1N11 A;  4L2L A;  5T8I A;  2NC9 A;  4UI9 K;  4BTA A;  2OEV A;  3DSS A;  1TNY A;  2QC9 A;  3J5P A;  2NXP A;  3I4R B;  2XGS A;  5KJM A;  3Q5M A;  1MQS A;  2Q7F A;  3TWX A;  5AYW D;  3DPD A;  3T5X A;  4JA9 A;  2XRY A;  3SQV A;  3S7J A;  3HXE A;  3FH5 A;  3ULE G;  3VTY A;  3LY9 A;  4JVS A;  3RSE G;  3D9M A;  3MA5 A;  1IHG A;  3ZNG A;  5AQ9 A;  2NSZ A;  5EX3 A;  4I17 A;  3AJI A;  5CRU A;  3EDT B;  4X8Q A;  3FWV A;  4CDR A;  5CBN A;  1ZBP A;  3UMV A;  2J09 A;  3WXX A;  3LYA A;  5AEN A;  1JCS A;  3J5Q B;  3HRA A;  1S0P A;  1TNB A;  4J0U A;  4DX7 D;  1XNF A;  5DBK A;  2I6H A;  4JW1 A;  2WXK A;  4GTR A;  3TG4 A;  3CQG B;  1BU9 A;  4I9E A;  3SZ7 A;  3QC1 A;  4AY6 A;  4OYS A;  3CLJ A;  4NAC A;  2LSU A;  3ONL A;  1BPO A;  3SGH A;  3Q9U C;  1KZP A;  4GTO A;  3SFY A;  4ANU A;  4N2S A;  4PDX A;  2XCB A;  4HLE A;  2IF4 A;  4A3V A;  4OVU A;  2IOS A;  1OWL A;  4C48 B;  2MHK A;  2ETA A;  2PZI A;  2ION A;  3UQ3 A;  2X6J A;  2QYJ A;  1MX6 A;  3C3Q A;  5BV0 A;  2AXV A;  3U4T A;  1UG3 A;  3TWV A;  3AU4 A;  2A5U A;  2VGX A;  3ZEF A;  2AJA A;  3L9T A;  2J8S D;  2XGM A;  2XS8 A;  3NZU A;  3ML8 A;  3ZIM A;  2DCP A;  4U7E B;  3IV0 A;  3LDZ A;  4YND A;  3S7B A;  2HR2 A;  3D3M A;  3Q4A B;  2V4H C;  4B8C B;  1MX4 A;  2R03 A;  5EKQ D;  2OV8 A;  1JCR A;  2MOW A;  3B7R L;  4MS6 A;  2KM4 A;  1JWG A;  3LJ3 A;  3FU5 A;  4K5B A;  3C98 A;  5JJT A;  5DIZ A;  2F8X K;  3ZYK A;  3Q15 A;  4NIK A;  1K3Z D;  4AOF A;  4Z68 A;  1N4Q A;  2WXJ A;  4B93 B;  4BY6 A;  5HS0 A;  3DPY A;  4CDN A;  2RFM A;  2XZD G;  4R7L A;  4ANX A;  3L22 A;  1FVH A;  1SA4 A;  3RK6 A;  1PY1 A;  1N9A A;  2Y0B G;  3FU3 A;  1JUQ A;  1NI1 A;  2GRO B;  3CHP A;  1LF8 A;  5ARF A;  2JAB A;  3CQC B;  4EZL A;  1BD8 A;  5EID A;  5ANL A;  3S2A A;  3SNX A;  3CIA A;  3G2U A;  3PNT B;  4F53 A;  1MX2 A;  3MV2 B;  3DBS A;  3SBS A;  3TWS A;  1VDY A;  3C5R A;  4U0Z A;  5FZQ A;  4YDO A;  2KZT A;  3DXM G;  1OCC E;  4JA7 A;  4WNG A;  2WMN A;  4LNB A;  1BI7 B;  3L13 A;  4J7W A;  5FQ6 A;  5JJ6 A;  1UN8 A;  4QQI A;  4G8L A;  2WXP A;  2AVP A;  4BT8 A;  5ENS D;  2NYJ A;  3ZHE B;  4Q69 A;  3CHQ A;  3LY7 A;  4AXH A;  3CK8 A;  1MYO A;  2V5Q C;  3ESL A;  5IY5 E;  5A6C A;  4JHR A;  4C0M A;  5FQ8 A;  3TG5 A;  1D8D A;  1W3B A;  1TR4 A;  3OAW A;  3DSV A;  4IRU A;  2HO1 A;  1H19 A;  3DEP A;  4N3B A;  5CER B;  3PNL B;  4WWP A;  3C3R A;  4NQ0 A;  2P9N G;  3AG1 E;  1WG0 A;  2VYI A;  3B7U X;  4L2Y A;  5ARG A;  2OOE A;  4CGV A;  3IKO B;  2KXP C;  3ABL E;  2X6F A;  3Q49 B;  3AAA C;  3DST A;  3E37 A;  1HZ4 A;  3B7B A;  3QWW A;  2YHC A;  3K9I A;  1OWN A;  4FLB A;  1TN6 A;  3EU5 A;  5D0Q D;  3UX4 A;  2VJ8 A;  3E32 A;  4U96 D;  3QJZ A;  1INZ A;  3MKQ B;  4WUY A;  2KBX A;  3TXM A;  3AS4 A;  4JHJ A;  3KS2 A;  1H6P A;  3S7F A;  1BI8 B;  5C1D A;  4RG6 A;  3FUM A;  4HNA D;  2OVB A;  3RAU A;  4G2V A;  4KZC A;  4EZJ A;  4TXQ A;  1OUV A;  4AM9 A;  4GCN A;  1UW4 B;  4K0R A;  3APD A;  3PE3 A;  4L23 A;  3L82 A;  1HFA A;  4OVV A;  4HLL A;  3SHF A;  3CHO A;  2BF0 X;  4BWR A;  4PS3 A;  2J08 A;  4G8K A;  4BX9 A;  3NF1 A;  1H6K A;  3GZ2 A;  4TV3 A;  4EPZ A;  1E8Z A;  3AS8 A;  1SA5 A;  3CHM A;  4XIF A;  4HOU A;  4B89 A;  4F1S A;  3UUX A;  3CV0 A;  3WG7 E;  1OCR E;  2IQC A;  4GCO A;  1SW6 A;  5C2Y A;  4DI3 A;  1WM5 A;  3FTZ A;  4J6I A;  3ZYQ A;  2FO1 E;  3PRZ A;  4KZ0 A;  3SFX A;  3UKU G;  1RZ4 A;  4KBQ A;  4YVQ C;  4B8A A;  2CFZ A;  2ZU6 B;  3APC A;  2GRP B;  3GW4 A;  2FO7 A;  1N4R A;  5JMN D;  5LP0 A;  4KVM A;  2X6I A;  3JUI A;  1Z6T A;  3MZL B;  5KNH D;  2GGF A;  4KVO A;  4OAV B;  1XGW A;  4CRW A;  4A1G A;  1N54 A;  2LO6 A;  2I1K A;  3SBT B;  4ILI A;  5BV1 A;  3RJV A;  2YNQ A;  2OVF A;  3V79 K;  4UWH A;  3EIJ A;  2L0T B;  3CKC A;  3IXE A;  2KC7 A;  3SF4 A;  2B0O E;  2C2L A;  4YDW A;  4JPS A;  2J07 A;  4FUL A;  3V2X A;  3OXF A;  1HG5 A;  2WVI A;  3TXN A;  2PQN A;  3CHS A;  3ZN3 A;  1O1S A;  5E75 A;  4JC8 A;  2EQX A;  2WXG A;  2AWI A;  4GZ3 A;  5E76 A;  1DVP A;  1QYM A;  3R9M A;  2Y4T A;  2PNN A;  5BPP A;  4O1P A;  4RLY A;  3ULQ A;  3B7S A;  4U8Y D;  2IY0 C;  4Y6W A;  1IYG A;  4E6H A;  2HM8 A;  3ABM E;  1OY3 D;  2XEN A;  5D0O D;  4MLP A;  4FC8 A;  5CCM A;  4YDE A;  2RD0 A;  4I2Z A;  2WXQ A;  4L9P A;  3BU8 A;  3CVV A;  4BES A;  1OXJ A;  2WQH A;  4Q94 A;  2LXL A;  3Q7F A;  2DYR E;  3PEV B;  3TJP A;  3E33 A;  2DZO A;  3T9K A;  2WXH A;  3UT4 A;  3LVQ E;  3L54 A;  3AG2 E;  1LD7 A;  5J90 A;  2OCC E;  3SD5 A;  3FUE A;  3BQO A;  4J8E A;  1ELW A;  1QBQ A;  3SO8 A;  3ASG A;  5FTP A;  4HQD A;  4HI8 A;  3JUE A;  2XQ0 A;  2LAI A;  1E8Y A;  2KAT A;  3HIZ A;  4AEZ C;  3HXB A;  5BXO A;  1OWP A;  4CDM A;  3RRN B;  5LOZ A;  3MYV A;  3RRM B;  1EF1 C;  5FQ7 A;  1X81 A;  2L6J A;  3L6A A;  4DRX E;  3CVW A;  1TJF A;  4UUC A;  3UT8 A;  4HOQ A;  2BKG A;  2UY1 A;  1H0A A;  3UTM A;  1A5E A;  3KSQ A;  5AJL A;  1ELK A;  4W9R A;  4BFR A;  4FJZ A;  4DLQ A;  1TN8 A;  4LEU A;  4CZ2 D;  4GTM A;  2V5F A;  3V30 A;  4F3V A;  4BEP A;  4KMO A;  3UM1 A;  3ZXS A;  4A3T A;  3QDN A;  3OTN A;  4J8D A;  4IUL A;  4EEC A;  3VLF A;  3UXG A;  4H7Y A;  4A55 A;  5D66 A;  3RU0 A;  3D9P A;  1JPL A;  2WXI A;  2WXL A;  1IQR A;  3ULY A;  3PUJ A;  5EIB E;  3RO2 A;  1YA0 A;  4EZK A;  3PVL A;  2IFU A;  5FIN A;  2XPZ A;  4XKB A;  1ELR A;  5BXU A;  4CT4 A;  2E0I A;  3KAE A;  1YMP A;  4FAD A;  3QWV A;  3PS6 A;  3FH7 A;  3PE4 A;  4GU5 A;  4F1P A;  3KSL A;  4G23 A;  2LAH A;  4LRZ A;  2WXN A;  3ASH A;  4N3A A;  1FT2 A;  1B89 A;  4GTV A;  3B7T A;  4FLH A;  2WXM A;  1FPP A;  2EIJ E;  3EIQ C;  3D9O A;  1UJK A;  3FUN A;  3MJW A;  3Q78 A;  1TNZ A;  5T3R A;  2WB2 A;  2AXZ A;  2I1J A;  5CHE E;  5AQB A;  1DCQ A;  4HRN A;  4LER A;  3CVN A;  3PH0 C;  3FH8 A;  5A23 A;  2WXO A;  4YVO A;  1RW2 A;  3MGB A;  2I2O A;  3VLE A;  4F7A A;  4MKT A;  2IOL A;  3Q73 A;  4N2Q A;  4UWF A;  4E85 A;  4U04 A;  4G26 A;  4JD2 G;  4C0E A;  3ZKJ A;  3RRU A;  3PZ1 A;  4I6G A;  1UN9 A;  4RSY A;  4V3I A;  3U64 A;  4TUU A;  3ZYL A;  2VGY A;  2J49 A;  1SZA A;  4ZHB A;  3U3W A;  5B1A E;  1E7V A;  2KCV A;  3FTS A;  1H2U A;  4HB5 A;  3L17 A;  3DRA A;  2ZXW E;  4GTQ A;  3NBN B;  2H6I A;  1HX8 A;  1NZN A;  4L1B A;  2L6B A;  3HG0 D;  1N95 A;  3CVX A;  4BSX A;  4UWK A;  4EQF A;  2FEZ A;  4WND A;  1S70 B;  2F8Y A;  2PM6 A;  4G11 A;  3ASN E;  4GMJ A;  3Q9N C;  3JQ0 A;  4GZC A;  3Q79 A;  4RG9 A;  2H6H A;  2A5E A;  1HU3 A;  4KXK B;  1P5Q A;  4JL0 A;  3UM3 A;  4ME2 A;  4MRU A;  3CHR A;  4LCT A;  1WY6 A;  5FT9 A;  5CEC B;  3CST A;  4J8S A;  3ZW3 A;  5EYL A;  5HKP A;  3U66 A;  4GPM A;  5KJL A;  2R5S A;  1UOH A;  3R9A B;  4XZ4 A;  3PZ3 A;  1E8X A;  1EYH A;  2JLB A;  1H6O A;  3UI2 A;  3TGO A;  3PZ4 A;  1NP7 A;  2VTB B;  5KJN A;  3FTY A;  4ATG A;  2V8S E;  3MX3 A;  1Q2Z A;  4KYO B;  4JXT A;  3FFL A;  3JXJ A;  4WNF A;  3OXL A;  5EYP F;  2GRL A;  5A7D B;  5ENN A;  5CCL A;  4H7X A;  5H7P A;  4Y6C A;  1IKN D;  3FDH A;  5FIO A;  4HXI A;  3ZYM A;  3AG3 E;  3ZHE A;  1DCE A;  1Z3Y A;  5EDS A;  4GAA A;  4HRM B;  3QKY A;  4WAF A;  2H6G A;  4ATZ D;  3HXC A;  3TWT A;  3PEU B;  4I1M A;  2YQ8 A;  5J08 A;  3FP3 A;  3Q75 A;  3G2W A;  4AIF A;  3CVU A;  4FA6 A;  4PS8 A;  2MYO A;  4PS7 A;  3W9F A;  4XI9 A;  4WWN A;  1OT8 A;  1PAQ A;  2P9S G;  2AXU A;  2CHZ A;  2X6H A;  3CVL A;  2P9U G;  2VGE A;  4NRH B;  4JZY A;  1QNF A;  3JQ1 A;  4DJA A;  3T8K A;  3UKR G;  4ZFH A;  3HHM A;  4I1O B;  2VSN A;  4BX8 A;  3D9J A;  3PUK A;  2R05 A;  4LSZ E;  3CK9 A;  3TWQ A;  4LUN U;  3ISM C;  4AY5 A;  2EIM E;  4QFV A;  3BG1 B;  3MKQ A;  3FUI A;  4M3O A;  3FUK A;  4DX1 A;  3UPV A;  1AWC B;  2R59 A;  3DWL G;  2P9K G;  2FF4 A;  4U8V D;  2J4B A;  4PH4 B;  1X5B A;  5KBA A;  3T8M A;  4XEI G;  5EIL A;  2DIW A;  2P9L G;  3NZS A;  3RKV A;  3G2V A;  4ILH B;  3PZD A;  4RQI A;  1HXI A;  3R7Q A;  3IHV A;  4GYY A;  1HG2 A;  4UI9 C;  4UWL A;  4U8H A;  3I4G A;  4BET A;  4DPR A;  4WWO A;  3EJN A;  4GZ6 A;  2CHX A;  4U63 A;  4LNU D;  2VSO E;  3QAQ A;  4A1S A;  3ESK A;  5AIJ A;  2P9I G;  2R02 A;  1S64 A;  1N0R A;  2H6F A;  3L08 A;  1O1T A;  1Y8M A;  3SI5 A;  4J8Y A;  3NOG D;  1KT1 A;  4XX5 A;  5AN8 A;  2J4D A;  1SZ9 A;  2GRR B;  4JEH A;  5LCW J;  3BG0 B;  4GYW A;  1G3N B;  1NL4 A;  4D10 C;  4EHM A;  5FWQ A;  4K03 A;  2RKK A;  2LUH A;  2X38 A;  2WQ7 A;  5ENQ D;  5CED B;  2CG2 A;  3FUJ A;  3LS8 A;  3I3N A;  4DK5 A;  1TN7 A;  4EBA G;  1D9S A;  2XS1 A;  2FUL A;  2OEW A;  4HOT A;  2GRQ B;  3CEQ A;  2WXF A;  2IU1 A;  1OWO A;  1SVX A;  2CG3 A;  1K1A A;  2GRN B;  4HI9 A;  4I6E A;  2CFU A;  4I1A A;  5AAO A;  3UM0 A;  1N0Q A;  2ZGG A;  3ZVV A;  3E4B A;  3CVY A;  5BUZ A;  3B95 A;  4O60 A;  3ZGQ A;  4AP2 A;  1NA3 A;  3FEX A;  4C9B B;  3O4Z A;  4TUM A;  4K5C A;  2P2C P;  5CMY A;  3FEY A;  3MCX A;  4BT9 A;  3VLD A;  5BNW A;  1JCQ A;  4EBA A;  2VSY A;  2AW6 A;  1TJC A;  1U3C A;  3R7R A;  1KT0 A;  2OND A;  3APF A;  3Q47 B;  2P58 C;  1H2V C;  3W9G A;  2QZA A;  4UQZ A;  5JHA A;  4FP7 A;  4U95 D;  2ZGD A;  3NOC D;  2I9C A;  4GMR A;  3FUL A;  2RFA A;  2XZT G;  1FT1 A;  1LTX A;  2BED A;  3LCA A;  2XEE A;  3QWP A;  2MRI A;  3FUF A;  1YCS B;  2LNI A;  2XPY A;  4UQX A;  3MKR A;  4APF A;  4CEM A;  2XCC A;  3VTX A;  1TNO A;  4B0Z A;  4N39 A;  5HI7 A;  4AVX A;  3QB2 A;  1FVF A;  1N52 A;  4FU3 A;  2VGX B;  3EHR A;  3URZ A;  3UIO C;  3CKB A;  3DXK G;  1N4S A;  1JWF A;  3TL5 A;  3JYS A;  4XE0 A;  5CMW A;  4U07 A;  3IBE A;  1KPS B;  3SY2 A;  4UQY A;  4O6F A;  2X6K A;  4YDY A;  4TRQ A;  5ANR A;  3V2O A;  3HYM B;  3JCK C;  2UWJ G;  2L0I A;  4ABN A;  3FTX A;  3NB2 A;  4JB8 P;  5JHB A;  1U3D A;  3CSF A;  4GA1 A;  1NA0 A;  2LXM A;  4DX6 D;  4DUI A;  1E96 B;  2PQR A;  5D2M C;  2DVW A;  1A17 A;  2V4L A;  3ZPJ A;  1K8K G;  4M7C A;  5KJK A;  3O48 A;  4GZD A;  3FU0 A;  2XRZ A;  1TNU A;  2B6C A;  2KCL A;  3CVP A;  1DNP A;  2CHW A;  5LCW C;  3TWW A;  4TXR A;  1D8E A;  1HO8 A;  2ZIR A;  2DZN A;  1BLX B;  5AQA A;  4GTS A;  4RVB A;  3EHQ A;  2QY7 A;  5ENO D;  5ITZ F;  3FTU A;  3ASO E;  1V54 E;  1IXV A;  4I9C A;  2BTD A;  2KZT B;  1L5J A;  1Y6I A;  1YYH A;  3MEK A;  4LNG A;  5JA4 D;  1N94 A;  1KZO A;  4ACK A;  1FCH A;  5G05 J;  4CCA A;  2IO3 C;  1QZ2 A;  4I43 A;  2VSX E;  4CT0 A;  2DYS E;  3TWU A;  5JJ7 A;  3RO3 A;  4ANW A;  2Y1L E;  2BUG A;  4GZ5 A;  4WNE A;  3ONK A;  5G04 C;  4B94 A;  4UI9 J;  4F6R D;  1WAO 1;  4UWG A;  3PDN A;  2JEK A;  3PZ2 A;  3EHM A;  2EIK E;  3HDX A;  5KCM A;  4U0S A;  2Y69 E;  2J9Q A;  3GZ1 A;  2LSV A;  3ML9 A;  2L9B A;  5AQ7 A;  1DC2 A;  1OWM A;  1H2T C;  4FHJ A;  4JHK A;  2C0L A;  1TEZ A;  3AU5 A;  4N5C A;  2EIN E;  3ZFW A;  2XEH A;  4ANV A;  3ENE A;  1N4P A;  2GRM A;  4J8F A;  3CK7 A;  4GML A;  3ZXP A;  3UM2 A;  4BSZ B;  2IEJ A;  2R17 C;  5EN5 D;  4GTP A;  3ZU7 B;  1O5M A;  3ZRH A;  2WQ6 A;  2DBA A;  2HYZ A;  3RIB A;  5BW8 C;  2ETB A;  3ZUV B;  2ETC A;  3P2B A;  3FTW A;  3PRE A;  5ENR D;  4FHK A;  5AJD A;  5B1B E;  3BEE A;  3ABK E;  3DEO A;  1HF8 A;  3C72 A;  1SQM A;  3CGH A;  5FZR A;  2QFC A;  3LPZ A;  3UIP C;  3FUH A;  2ILR A;  3E34 A;  3HXF A;  5FZS A;  3T5V A;  3QOU A;  3P1U A;  3QNK A;  1K1B A;  2M63 A;  4AV7 A;  4I6J A;  4HOR A;  2FBN A;  2R2L A;  2VTB A;  4GTT A;  4U0U A;  3UIN C;  3D9I A;  3L16 A;  4P29 A;  2XPI A;  1S63 A;  5KNG A;  3S7D A;  1O1R A;  4N3C A;  5LFA A;  5EX0 A;  4NUR A;  4A63 B;  1IQU A;  4GB9 A;  4K5A B;  3IHY A;  2GW1 A;  2XHE A;  3D9N A;  1U2V G;  3BUA A;  3U9W A;  4HBD A;  3V31 A;  1OCZ E;  2XGO A;  3GZS A;  4IYP A;  3LJN A;  1V55 E;  5ENT D;  3NQP A;  2QYU A;  3LVR E;  5BT1 A;  5AAR A;  5HRY A;  3DSW A;  4BER A; 
#chains in the Genus database with same CATH homology
 4ZHB A;  5EN5 D;  3TWX A;  1MJ0 A;  1BLX B;  2DZN A;  5AQA A;  3TWV A;  1IKN D;  3ZU7 B;  5FIO A;  5KNH D;  4U96 D;  4CYM D;  4U8V D;  1D9S A;  1BI7 B;  4OAV B;  3EHQ A;  2AJA A;  4J7W A;  5ENO D;  4HB5 A;  5EIB E;  4O1O A;  2J8S D;  5ITZ F;  2KBX A;  3NBN B;  5FIN A;  2ETB A;  4HRM B;  3ZUV B;  2ETC A;  5KBA A;  5EIL A;  4ATZ D;  1IXV A;  3V79 K;  1SVX A;  1BI8 B;  2L6B A;  3TWT A;  5AQ9 A;  3ZNG A;  1K1A A;  3SO8 A;  5BXU A;  2DWZ A;  3HG0 D;  4QQI A;  5CBO A;  4G8L A;  5ENR D;  3IXE A;  4HI9 A;  2V4H C;  3AJI A;  1YMP A;  1YYH A;  4HQD A;  4HI8 A;  5AAO A;  4HNA D;  3JUE A;  1S70 B;  2B0O E;  5ENS D;  1MX4 A;  2F8Y A;  1N0Q A;  2NYJ A;  2ZGG A;  5CBN A;  5JA4 D;  3DEO A;  2F37 A;  1NFI E;  4YDW A;  5CED B;  3TWR A;  5CEA A;  3Q9N C;  4DX5 D;  4F1P A;  3V2X A;  3EHR A;  3B95 A;  1WDY A;  2A5E A;  3HRA A;  3J5Q B;  4O60 A;  1MYO A;  2V5Q C;  3TWU A;  4BET A;  2Y1L E;  5BXO A;  2MYO A;  4DX7 D;  4K5B A;  4F6R D;  4TUM A;  4K5C A;  2P2C P;  3W9F A;  4HLL A;  2F8X K;  4NIK A;  4LNU D;  1K3Z D;  1OT8 A;  1K1B A;  4Z68 A;  5CEC B;  3EU9 A;  4DRX E;  3JXI A;  4YDY A;  5EYL A;  5HKP A;  4G8K A;  1TR4 A;  4UUC A;  4B93 B;  4DX2 A;  2BKG A;  4GPM A;  3V2O A;  5HS0 A;  1BU9 A;  1QYM A;  1UOH A;  2RFM A;  2VGE A;  2XZD G;  4HRL A;  4N5Q A;  2PNN A;  3DEP A;  1N0R A;  5CER B;  4O1P A;  4RLY A;  5KNG A;  4U8Y D;  1DCQ A;  5AQB A;  3UTM A;  1AP7 A;  4HRN A;  1WG0 A;  4A63 B;  1A5E A;  3T8K A;  2Y0B G;  5AQ7 A;  1DC2 A;  4JB8 P;  4K5A B;  1OY3 D;  2BKK B;  2XEN A;  4ZFH A;  3W9G A;  1SW6 A;  4DX6 D;  2HE0 A;  3Q9U C;  4CZ2 D;  4DUI A;  3D9H A;  4J8Y A;  3UI2 A;  2JAB A;  1BD8 A;  3NOG D;  5EID A;  1IHB A;  4HBD A;  4LSZ E;  5AN8 A;  2DVW A;  4U95 D;  3V31 A;  3TWQ A;  2FO1 E;  5KWD A;  5ENP D;  4BES A;  2KXP C;  2XEH A;  3V30 A;  2ZGD A;  3F6Q A;  3AAA C;  3NOC D;  4GMR A;  4QFV A;  1G3N B;  1N11 A;  4BEP A;  2RFA A;  4C48 B;  3LJN A;  2XZT G;  3ZKJ A;  4DX1 A;  3B7B A;  5ENT D;  1MX2 A;  2ETA A;  3JXJ A;  2XEE A;  3KEA A;  3TWS A;  2QC9 A;  3C5R A;  4BSZ B;  1AWC B;  3UXG A;  3J5P A;  5AAR A;  5D66 A;  5HRY A;  2DZO A;  4LG6 A;  5EYP F;  5JMN D;  2QYJ A;  1MX6 A;  3T9K A;  4BER A;  4OAU C;  3TWW A;  5ENQ D;  1YCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...