1YYVA

Putative transcriptional regulator ytfh from salmonella typhimurium
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
111
Chain Sequence
b'QLREGNLFAEQCPSREVLKHVTSRWGVLILVALRDGTHRFSDLRRMGGVSEMLAQSLQALEQDGFLNRVSYPVVPPHVEYSLTPLGEQVSDVAALADWIELNLPQVLAQRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative transcriptional regulator
publication title X-ray crystal structure of putative transcriptional regulator ytfH from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium
molecule tags Structural genomics, unknown function
total genus 29
structure length 111
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yyvA00
3CO6C 1OR7A 2VOPA 1XDSA 2L54A 1FY7A 3V7RA 2XGXA 1QGPA 2UWMA 3I4PA 3WTVC 4XSXF 1IN5A 2A07F 3WGIA 3F8NA 2F5CA 4PDKA 2V79A 3GLXA 2EFOA 2XRNA 4M9XA 1BJAA 2V1DA 5AIPA 4L0ZB 4MQVA 1KQ9A 3TO9A 1J5YA 4ZZDA 5BQTA 5BPIA 4HYEA 1BI3A 2E1CA 4BXUA 2F5EA 5LHGA 4KN4X 2DI3A 4BQAA 3ELKA 4BHBA 5HLHA 3I58A 3F21A 4KDPA 3QPHA 3F72A 3SZPA 4KMFA 3BOQA 5D8KB 3K1NA 1PP7U 2FBIA 4PGHA 4IF4A 1QNTA 3KLOA 3RDIA 1KU3A 3ECHA 5FLXK 1K7AA 4CICA 2ACJA 2F5FA 3F6VA 1Z9CA 3GVAA 2P5KA 3TKYA 2A68F 4UV9A 1DDNA 2FXAA 2LSOA 3LA2A 5K5OA 3BY6A 3L2CA 3JAMK 4LG0B 1B59A 4EJTA 4RGSA 3FZVA 2Y48A 1ZHFA 2DT5A 1T2KA 2YPRA 1XMKA 3RYPA 2ZNYA 4UNOA 4U0YA 1YW8A 4B09A 4M9SA 4B8XA 3F8FA 4EJVA 1WWXA 1TNSA 1IN6A 2BV6A 2A61A 2ZO4A 4S04A 1HSTA 3GZ5A 2V6CA 3VFZA 1RIOH 2IT0A 3HTSB 4WXDA 2XASA 2WV0A 3HRMA 3WODF 2DLLA 2W24A 2OQGA 1G4DA 4GO1A 1KU7A 4I7HA 2DK5A 4KIGA 1FYKA 2PFBA 1V4RA 4XLNF 3CUQB 2ZBKA 5CVVA 3BJOA 2XAJA 5HS9A 1DPUA 1ZLJA 4HF2A 2P5LC 4ETSA 1L3LA 3OV8A 4CGZA 1FYLA 4AD9A 4WK8F 2VE9A 1SD4A 2A3SA 5JFRA 2VC1A 1ZYRF 4HF1A 1S8NA 3U1DA 2IJLA 4CO8A 2GXBA 1RNLA 2HKXA 2BGCA 3ZMDA 3IRRA 4YFNF 3ZN0A 2ZMEB 2RV8A 2G7HA 5E1XA 2STWA 1CF7A 3WTWC 1IZ1A 2TDXA 1ULYA 5LHIA 1EH6A 1YYVA 1KQ0A 4G8XA 3ISPA 5LGNA 1HKTA 3LSTA 2EFWA 3U2RA 2RGVA 1MDMB 3FMQA 2PG4A 1Z1DA 3J80Z 4HX8A 2EK5A 4AIKA 5FO5A 1LQ1A 2JSCA 4A6DA 2ZNZA 4OINF 3GFJA 3DFGA 1DP7P 4NB5A 3VOEA 2VXZA 2D1VA 5HS8A 2IVMA 1T98A 2YX4A 2K02A 3CO7C 2CG4A 4Y15A 5A2QZ 3E97A 1R00A 4KFCA 2OZUA 2D1HA 1R23A 5EEHA 1O3QA 4LLLA 5H6QA 2DW4A 4L9TA 5CYVA 5DV5A 5E1WA 1T39A 1W5TA 1IN8A 2L4AA 3LAPA 2FBHA 3I0TA 3GX4X 1QBJA 3KP6A 5D4SA 3WTXC 1I5ZA 5ICGA 4O6JA 4GXOA 2RNJA 1WQ2A 1T6SA 4QLCU 2G7UA 5DCMB 2Z3YA 2H94A 1WSUA 3BROA 4FHTA 3QPTA 4ZH4F 3BPVA 5FFZA 5E18F 2XAHA 1HW5A 3Q5FA 5ERIA 3HRTA 2R7FA 1OPCA 2P7CB 4Q5SF 2HEOA 1J2XA 4Q4ZF 2M1BA 4RAYA 3F23A 2C6YA 1P4XA 2P7VB 2HTSA 4CYDA 2HR3A 2EV0A 3I53A 4IRHA 2FRHA 1HSJA 5H6RA 1IW7F 1F9NA 3TOAA 4BNCA 1D8JA 2FU4A 4L9JA 1B9NA 1I1GA 5DUKA 5JHUA 3K9TA 4ON0A 3WTYC 2X4HA 3T0YA 2LF8A 3IKVA 4HDVA 3P9IA 3R61A 4WXHA 5IT9K 2J5OA 3M1EA 3J81Z 4U88A 4PCQA 1S7OA 4R79A 2MBFA 2DPDA 4EM1A 2HYGD 2XUBA 5CJ9A 1XCBA 1YFHA 2QENA 4MGRA 2D45A 3SZTA 1JE8A 3TGNA 1L0OC 3BPXA 3T8TA 3O3KA 5K1YA 1ZRDA 4YG2F 2GQQA 3F8BA 3I5UA 1SD7A 3HRUA 4ZZLA 5K5RA 3HHHA 3MAJA 4P9UA 2IA2A 2GAUA 1GHCA 2HZTA 2Y75A 1UCRA 3RKWA 4CXFA 4U7BA 4N9IA 3ZMUA 5HDKA 5FD6A 3KP4A 5EEGA 3TO6A 3V7SA 2Z99A 1GVJA 4M6XA 1IN4A 5CVRA 4YIIA 2G9WA 3RKYA 1J0RA 1ONVA 4ENMA 3TDUC 4IRIA 2XAQA 2GA1A 1FC3A 1MDMA 1ZREA 3I71A 4M73A 1YW7A 2K86A 4EVIA 3AAFA 3K69A 3D0SA 3ZMSA 3E5UA 1BC7C 3MQ0A 3FWEA 5BMZA 2ISYA 5HOOA 1J75A 3N4MA 1BN5A 1Z6TA 4KT5C 4HW0A 4M71A 3W6KB 4YFXF 2DQLA 2GWRA 2V9VA 1XGSA 3RYRA 1AOYA 1YS7A 4OIOF 3MWMA 2DBBA 5LHHA 4CZZA 2MD5A 3QAHA 3L00A 1MKMA 5J8FA 5BPDA 2VC0A 4KIBA 1XGOA 2QQ9A 4AIHA 1SD6A 5E17F 4KN7X 2ESNA 2NRAC 5DDGA 2MH2A 2A5YB 2W25A 2X0LA 2PBIA 1T0FA 3HIFA 1MJAA 1D5VA 3D5LA 4M72A 2CWEA 1I1SA 3OOPA 2HQNA 1F1ZA 2CO5A 2KRFA 4EV0A 4YIFA 1BBYA 2IA0A 3LWFA 1XDUA 3H3ZA 4F7ZA 1USTA 3GWZA 3O2PE 5L3EA 2KJCA 3GF2A 1Z6RA 4KA4A 2DTRA 2O0YA 2M45A 3GFLA 1TTYA 2RN7A 3QU6A 2RDPA 3K2ZA 4LB6B 1IN7A 5CVJA 3FX3A 2NAZA 5CVUA 4MTDA 3QRFF 4CHUA 2MC3A 1ON2A 2FF4A 3L9FA 1ZGAA 4H0EA 5DD4A 3BJAA 1FZPB 2VOOA 3R60A 5HDGA 1R1UA 2YSRA 2QBYA 1XSDA 1QQIA 5FLXZ 4JBAA 3HSRA 5E8GA 4G7OF 1P6RA 3EUHA 2FA5A 4HDUA 3CUQC 2VBWA 1LJ9A 5D8LB 4TV7A 2M87A 3ABUA 3I59B 4U7DA 3P9CA 4G6QA 4LK1F 2HDCA 1HQCA 3QOPA 3T5XA 1TQPA 4FX4A 2LNBA 1QZZA 3P9KA 3IKTA 3RPUA 3DXJF 2VBZA 4JK1X 1Y0UA 2D2WA 4P5OA 4HV5A 1GXQA 4A0YA 2FQ3A 4WWCA 1LDJA 1YIOA 3L7WA 1FX7A 3ZP5A 1XB4A 3FHZA 4RGXA 1FP2A 3Q9SA 1KA8A 3DPTA 3ZQ7A 1FOKA 4L5IA 1KYWA 4HAMA 3B73A 1TQIA 1FBSA 2IRFG 3JSOA 3V8LA 4GCVA 2QYOA 1KU2A 2OBPA 4OIRF 1SFEA 3LQQA 1W7PB 3WGGA 2ETHA 2WTEA 3IRQA 4WF2A 2O61A 5HVQC 2L3DA 2E1NA 1FT9A 5ILVA 1G6NA 1O7FA 2AXLA 1BI2A 1ZG5A 1F5TA 2XAFA 2M30A 1RUNA 3CLOA 3SQNA 4MQ9F 4NQWA 3WTZA 4O5VA 1UFMA 1XN7A 2ESHA 1R1VA 4ZYEA 3COAC 2ELHA 1SFUA 2VT3A 4L9VA 1PDNC 2H6CA 4IHTA 4KICA 2VN2A 4AWXB 4I01A 2K4BA 3SXYA 5LEKA 2FBKA 3ZMZA 5D5XB 4EQQA 2HQRA 3FF5A 1K6OA 2HS5A 4HOBA 2DFIA 4EGYA 4XBFA 1E2XA 1R22A 3QU3A 4AIJA 4LFUA 1T38A 3I64A 4BAYA 2MLKA 2EFPA 5FGMA 3B02A 2EWNA 2YU3A 1I27A 5JR3A 2H27A 2LDUA 3VEPA 1Z7UA 4PGGA 3F22A 1FP1D 4HLXA 2FNAA 3IL2A 1A04A 1IRFA 4KUMA 4A6EA 3WGHA 4RB1A 1O3SA 3S2WA 1TNTA 2MLGA 5K5QA 4OMZA 4MEYF 4ASNA 2P6TA 1ON1A 3KE2A 2ADUA 2Z9OA 1S7AA 2OZ6A 5ICFA 2KIMA 2EFQA 1WKMA 4UXNA 1IAWA 4L0YB 1G3WA 1OMIA 4BHPA 3PQKA 4OOIA 4HV6A 3F8CA 1S29A 1NHAA 2FSWA 2B0LA 4WX9A 3FXQA 4M74A 4I02A 2K4JA 3FXUA 1K79A 4UVBA 3M7GA 1XGNA 1P2FA 5DEQA 4RB0A 3MEXA 2DO7A 3ZPLA 3CDHA 1FSHA 1BI0A 3WG9A 2Y0MA 4LG0A 2HOEA 4WXCA 4HX7A 4A2UA 4R8HA 1P4AA 3G73A 4ENJA 3K0LA 2BE5F 3RKXA 2GXGA 3U9GA 2QQBA 2L4MA 4KYWA 1GXPA 3E5QA 5JI6A 1FSEA 3TO7A 1UB9A 2PMHA 3REOA 2KIUA 1LDDA 4I0AA 4HLYA 1KYZA 2CSOA 3ERED 2NS0A 5LLQA 4IHSA 4I2OA 1U78A 2EA2A 2PLYA 2XHKA 5KVRA 4KMUX 1VTNC 3DP7A 4XSZF 1H9TA 4G6DA 4OIPF 5IT9Z 1TW3A 4LMYA 4HQMA 4HX4A 1MGTA 2PN6A 2QQAA 4LK0F 3CUQA 1XSXA 4ESFA 3C3WA 5BOXA 3CTAA 2OAZA 3BDDA 2O3FA 2PMUA 2CGPA 3E6DA 1JHHA 2PEXA 3RI4A 4RGRA 1EV7A 2K7LA 3HTUA 2VBYA 4M9ZA 1U3EM 4EM2A 3VODA 5L3GA 2M8EA 4EJOA 2PJPA 3M9AA 3GFMA 1IXRC 2ZCWA 5ED4A 3M8EA 1R58A 4N9HA 4Z2YA 1IXSB 4U0VA 2AS5F 2O03A 1REPC 2ZMEA 4A0XA 2E7XA 2BYVE 4HQEA 3RIRA 5F6FA 1EH8A 5J8CA 4FX0A 1O3TA 5E20A 3KP7A 1ZLKA 3F8MA 2V1UA 1P92A 4RGUA 1J7KA 4M6YA 2VBXA 2MA3A 1LB2A 2DK8A 3L09A 1XGMA 4A0ZA 4D0PA 2RKHA 2H09A 3TOBA 1K78B 2JPCA 1R36A 2ZJ2A 4RAZA 4PZJA 3JSPA 1TW2A 1XCVA 5L3CA 4UVCA 3IC7A 4UVAA 3GO5A 1TQMA 3DF8A 4ZYDA 1FWZA 4HA8A 1U5TC 3GXOA 5F64A 3LFKA 2W84A 3ZN1A 4HBLA 1SMTA 4WCGA 4GYIA 1XSVA 3BJ6A 5D6EA 2M5WA 2UXNA 1IXCA 2FOKA 2ZKZA 2H6BA 3HSFA 1G3SA 3O6BB 2OD5A 2DU9A 2QLZA 4O3MA 2IP2A 3KZYA 1BOAA 1RZ4A 2JTVA 4A12A 1TBXA 1FLIA 4KNYA 4P96A 4Y13A 5IT3A 2LF7A 1R7JA 3V7CA 4LLNA 2EFNA 2GZWA 5DCMA 3ROUA 2R7DA 1ZARA 4XRFA 4QWQA 3NRVA 1CF7B 3KFWX 3WE3A 1W7PD 2BEOA 2GA2A 5H20A 1STZA 1W5SA 2KJBA 5LGTA 1LEAA 3ML6A 3HUGA 1MD0A 4ENKA 3DEUA 3SFZA 4ZYGA 3DQVC 1R5GA 2DAOA 2VODA 3IWFA 2OU2A 2UZKA 3K1MA 2QZ8A 1S6LA 2GIVA 2VE8A 3DKWA 3VB2A 1P4WA 4BHCA 1HKQA 2HTJA 2ISZA 3GFIA 3RJPA 4I98B 1C0WA 1YG2A 3GW2A 2JT1A 1U5TB 3JTGA 4I09A 5J6XA 1R5HA 3TQNA 3KETA 2LKPA 4A5MA 4EJWA 3FM5A 3ABTA 2RVCA 2CW0F 5L3BA 5LEJA 3KP3A 4P9FA 1SMYF 3JAMZ 2W85A 4Y17A 1USSA 1JGSA 4IXAA 5E1ZB 2E7WA 3IWZA 2Q8KA 5FB2A 2NNYA 3WTTC 2HKOA 1ZRFA 1B4AA 5E8IA 5F1RA 4MTEA 2FMLA 1AWCA 3MCZA 3ECOA 3GEZA 1HW1A 3GZ6A 1CGPA 1U8RA 2P6SA 3PFIA 3KEOA 4R1HA 2Q0OA 2R3SA 3NQOA 1DPRA 1YW9A 3BWGA 2J5PA 1KQ8A 4E70A 6PAXA 4IPAA 1EH7A 3V8JA 4GGGA 4EGZA 3HSEA 5FFXA 3JW4A 4UUVA 1LNWA 1YTYA 3QP6A 1HBXG 3KLNA 3WU1B 2Z5UA 1K78A 2JZYA 3NEUA 1ZAOA 3F6OA 2XKOA 1JXSA 4BH9A 3E6BA 4MHGA 2EB7A 1ZG3A 3C18A 2HGCA 3FXRA 4OMYA 2WWYA 2QM3A 1ZRCA 2FE3A 4MNUA 5HS7A 1ODDA 1LVAA 2HWVA 2A6EF 5D5UB 1XD7A 5DYMA 2EV6A 2CQKA 2L01A 1O3RA 3E3VA 5ICCA 2ZFWA 4L18B 2XAGA 3WU0A 1JHFA 3RTRA 5TJJA 5L3FA 5FD5A 5JVTA 1BM9A 2XIGA 2CYYA 1O57A 3G3ZA 2O6GE 4LB5A 3E6MA 1TLHB 3T8RA 5DD8A 3MZHA 3R6SA 3KCCA 1MZBA 4N0BA 1HW2A 3PQJA 1FBUA 1D3YA 5LRRA 1SD5A 5ILUA 1E17A 1B6AA 1LEBA 1S3JA 2KKOA 4KIFA 3HRSA 2OA4A 1FYMA 3LA3A 3N97A 1PUEE 2FEZA 3EQLF 2VT2A 1J59A 4P55A 4MEXF 1YLFA 1Q1HA 3H92A 5HLGA 1B9MA 1IF1A 2EA4A 1W4MA 2K27A 2DQRA 2A6HF 1KGSA 1QZYA 3SHFA 1J9IA 2MH9A 1ZG1A 5KK1A 4A5NA 2P5VA 1U5TA 1OKRA 1OYWA 4EJUA 5LGUA 3CUOA 3JTHA 2OQRA 2ZXJA 3EYIA 3J80K 1BC8C 4RS8A 5BS6A 3C1DA 3EDPA 3V8KA 1WRJA 3FMRA 5L3DA 2Z33A 2JRTA 1IRGA 4G7HF 2STTA 1I6XA 3I59A 3DPLC 1G3TA 5DUIA 1ZGJA 1R1TA 1HXDA 2XV4S 1V3FA 4DQ2A 1X3UA 1ZH5A 3F3XA 2PI0A 3EETA 4YFKF 4JQFA 4LD5A 4AVPA 1FBQA 2IA1A 1F4KA 5A2QK 1BIBA 2A69F 3Q9VA 3R0AA 5CVIA 5D5WB 1UHWA 4GYGA 2O8XA 3J7AO 2FNPA 5HLIA 5CLSA 1IUYA 3I54A 3P7NA 3HYIA 2PQ8A 4LJZF 4NHJA 5AIQA 4BYYA 2JPBA 4XLPF 4Q47A 1BIAA 2Q2EA 2V1XA 2IW5A 1RUOA 2COMA 1Z05A 3WE2A 1YQAA 1B1BA 4ZYHA 1YS6A 2CFXA 2L02A 4UHTA 3E6CC 2XVCA 1W7PA 5D5VB 3T1BA 3HHGA 2VONA 1H0MA 4IRGA 1XMAA 3K1PA 4OIQF 2NYXA 1QPMA 4G94A 4EM0B 3TDZC 2QBYB 2QWWA 3BP8A 3WTSC 2WC2A 2DPUA 2XKPA 4RB3C 4OU0A 4LGWA 4Q48A 1MJ9A 1UHMA 2F5DA 1WI9A 2P4WA 2NNNA 3KZZA 1QO0D 2BBYA 2YR2A 3FM3A 3R4KA 1U2WA 2QVOA 3QP5A 3GYHX 4UV8A 4I0BA 3LQRA 3C7JA 1G3YA 1RI7A 1FPQA 1SAXA 5D4RA 4K2EA 4S05A 3J81K 5LRSA 4L9NA 3ULQB 5ICEA 4EMSA 5ILSA 1Z91A 3M8FA 1U6GA 3LA7A 2YX7A 3IHUA 3LAJA 4U0WA 5HDNA 3FMSA 2EJRA 1H9GA 4G9YA 3KP5A 1LDKB 4G7ZF 2XROA 3CJNA 1OYIA 3E5XA 4IVNA 2FMYA 3V4GA 4DNCA 3MZYA 3GUDA 2RQPA 3MFKA 2F2EA 1ZN2A 5TRDA 5AONA 5DCFA 4HZFA 1HKSA 4FT8A 1DUXC 4ENNA 4L5JA 4RB2C 3HOTA 5LBQA 2P8TA 3DV8A 5D6FA 1O7LA 3HOSA 3BZ6A 3KEQA 4HF0A 3RPQA 3W6JB 3H3UA 1BI1A 4IJAA 4ESBA 1PP8F 1D8KA 3ZMTA 2RC4A 3R0JA 2QUFA 3EYYA 1YO5C 1SFXA 2UXXA 3ZMVA 2IPQX 1KU9A 2EV5A 4LLGF 1OYYA 4ESJA 4CDGA 2HYFA 3WTUC 3KP2A 2W57A 1MJBA 2KIFA 2HFHA 1FNNA
chains in the Genus database with same CATH superfamily
3CO6C 1OR7A 2VOPA 1XDSA 2KP6A 2L54A 3HC7A 3CC2I 5C4JJ 1FY7A 3V7RA 2XGXA 5IP6A 1P7JA 1QGPA 2UWMA 5J1RA 3AL0B 1VQPI 2IXSA 3I4PA 3WTVC 1GLNA 4XSXF 1IN5A 2A07F 3L2QA 3WGIA 3F8NA 5FKKA 2F5CA 4PDKA 3OIQA 2A5WA 2LREA 3GTQJ 3OIPA 2V79A 4HSTA 3GLXA 1VQKI 2EFOA 2XRNA 2CUJA 4M9XA 1VI0A 3TMOA 4XRSA 3L2UA 1BJAA 4Y52J 3WHCA 1I39A 2ZB9A 4CCOA 4D5CA 2DA1A 2VJ5A 9ANTA 2LTPA 2V6EA 4XLEA 2GXAA 2V1DA 4II2A 5AIPA 4BE1A 1OCRH 4BY7J 3EUAA 1GDTA 4DW6A 2F48A 4L0ZB 4MQVA 4Z6YA 1KQ9A 4ZJZA 3TO9A 1J5YA 1VFCA 2ZXHA 4ZZDA 5BQTA 5BPIA 1MSFC 4HYEA 3OR1C 3C2GA 1BI3A 2E1CA 4BXUA 2F5EA 5LHGA 4KN4X 3OSFA 5B3SH 2DI3A 1SVLA 1RKWA 2L9RA 4BQAA 1FMVA 3ELKA 4BHBA 4XK4A 5HLHA 3OYCA 3I58A 3F21A 4IHYA 1F36A 4KDPA 3QPHA 3OSGA 4A3DJ 4V2FA 3F72A 1VQNI 3SZPA 2OF7A 4KMFA 3BOQA 5D8KB 1D1CA 5K7HA 1HF0A 3FKJA 3K1NA 3BG9A 1PP7U 3VSLA 2OJED 2FBIA 3TL4X 3H5AA 4H4KC 2LKSA 4PGHA 4IF4A 1QNTA 1S5LC 3KLOA 2LH9A 2M2EA 3RDIA 1KU3A 3TP0A 3HG9A 3OYIA 3HOYJ 3ECHA 1Y8RB 5FLXK 2K9NA 1K7AA 4BBSJ 4CICA 2NVTJ 2ACJA 2F5FA 3A2KA 1R5ID 3F6VA 1Z9CA 3GVAA 2P5KA 3TKYA 2A68F 4UV9A 2NOGA 1DDNA 2FXAA 2LSOA 1TWGJ 2ELKA 3BY6A 2M9HA 3LA2A 2NVUB 5K5OA 3JAMK 3L2CA 4LG0B 3FDYA 4HSRA 1B59A 2K9QA 4RM2A 4EJTA 4RGSA 3BZCA 3FZVA 2WADA 1X3ZB 2DODA 4IX7A 4E7HA 3OMYA 3PNTA 1ZR4A 2Y48A 1IDYA 3WHBA 1ZHFA 2WB1A 1W1WE 4GDFA 2DT5A 3HXLA 1T2KA 2YPRA 4QIWN 1XMKA 3RYPA 2B7EA 2BVLA 2V26A 2JA7J 2ZNYA 1X1AA 4UNOA 4U0YA 2XF7A 1YW8A 4B09A 4M9SA 4B8XA 1DP3A 3F8FA 1WHUA 3A03A 4EJVA 4XLHA 4N4NB 4F52A 1WWXA 5DTDA 1TNSA 2E36A 1IN6A 2M8GX 1GV2A 2WAQA 2BV6A 3H36A 2A61A 4BJ5C 2ZO4A 4S04A 3HM5A 5EDNA 2DXIA 1HSTA 3FBNB 4E7SA 3GZ5A 2V6CA 3CJQB 3VFZA 1RIOH 4A3EJ 4PFOA 2JSPA 2IT0A 1WJFA 3HTSB 4WXDA 1UHSA 5F0HA 3LSMA 2XASA 3DLAA 4CUGA 2WV0A 1A31A 1A5JA 2X48A 3HRMA 3WODF 2DLLA 2W24A 2OQGA 3BR0A 3DLLF 2E35A 2KPMA 2F4IA 1G4DA 3BG7A 1JTYA 4GO1A 1T33A 1KU7A 4I7HA 4XLAA 2DK5A 4KT6A 4KIGA 4IHWA 1FYKA 4HPQA 1WFXA 2PFBA 1O4XA 3VPRA 1V4RA 4XLNF 2LY9A 1U8BA 3CUQB 2ZBKA 5CVVA 4CYCA 3BJOA 2W7NA 2XAJA 5HS9A 1T95A 3JRCA 3FBIB 1DPUA 3W3CA 3LMMA 1ZLJA 4HF2A 2P5LC 4ETSA 1L3LA 2BY2A 2MW8A 3OV8A 2KMUA 2VB6A 4CGZA 4NC6A 2E60A 4AIDA 1E3PA 1FYLA 4AD9A 4PFPA 4WK8F 5M5WJ 2DJIA 2H8WA 2VE9A 1SD4A 2ECBA 2HQ5A 2XDVA 3QPSA 2A3SA 5JFRA 2VC1A 3DU6A 3G2BA 2VKVA 5BNGA 1ZYRF 5FKNA 1NG6A 3OS0A 3ZGKA 4HF1A 3S3OA 1WI3A 1LFBA 2VXDA 1S8NA 3U1DA 2IJLA 3K7AJ 2DA2A 3M4OJ 4CO8A 2GXBA 1RNLA 2HKXA 2BGCA 1RESA 3ZMDA 4BXXJ 2CQNA 3IRRA 3TBIA 4YFNF 3ZN0A 3SDBA 2YS9A 4RAFA 4QPOA 2ZMEB 2R5ZA 1UAAA 2RV8A 2G7HA 3RQ4A 5E1XA 4IOAF 2MGQA 2STWA 4QPQA 1MBGA 1CF7A 3WTWC 2AQFA 2XSJC 1IZ1A 2TDXA 2ZJRF 1ULYA 2KQRA 1MMAA 3NWSA 1EH6A 5LHIA 1YYVA 1KQ0A 4G8XA 3OYKA 4IHVA 4BJ6C 4IL6C 4BACA 3ISPA 4BEHB 4C2UA 5LGNA 1HKTA 3LSTA 2EFWA 3RSNA 2WB1N 2JRMA 3U2RA 1JT0A 2RGVA 2Z16A 4HRIA 2IGKA 1MDMB 3DU5A 3FMQA 1WGXA 2MABA 2PG4A 1Z1DA 3J80Z 4HX8A 2EK5A 4NDLA 4BJTA 4RDUA 4AIKA 1YIJI 1RRJA 3H0DA 4YEJA 5FO5A 1LQ1A 2JSCA 4F55A 3F0CA 2BW3B 2WAQN 4A6DA 2ECCA 2ZNZA 4OINF 3GFJA 3JRAA 1T8IA 3D5RC 3DFGA 2I10A 1DP7P 1ZKGA 3HL2A 4NB5A 3S15J 1VQ8I 3VOEA 3H5RA 2VXZA 2D1VA 5HS8A 2IVMA 1T98A 4D1QA 2YX4A 5E3LA 2LKXA 3VYSB 4CCLA 2LD5A 2K02A 3CO7C 1I6HJ 1LFUP 3GLLA 2CG4A 1RR8C 3LSPA 3ZQLA 4Y15A 5A2QZ 3E97A 1R00A 3NAUA 2W4SA 2GLOA 4KFCA 2OZUA 3M1CA 1DU6A 3DBHB 2D1HA 5JVGF 1R23A 3OOUA 2BHZA 3BQYA 5EEHA 1Y0NA 2W00A 1O3QA 4LLLA 5H6QA 2DW4A 4L9TA 2FQ4A 5CYVA 5DV5A 5E1WA 1T39A 3CP8A 1W5TA 1IN8A 2L4AA 2LP0A 3LAPA 2FBHA 2CH0A 3I0TA 3GX4X 1Y8QB 4J01A 1QBJA 3CD6I 1XC5A 2QSFX 3KP6A 1XX5A 5EJCA 5D4SA 4CCNA 1I5ZA 3WTXC 5ICGA 4O6JA 4GXOA 3HB9A 2RNJA 2LK2A 1ZELA 1WQ2A 1ETWA 1T6SA 1I50J 1SAUA 4QLCU 2G7UA 5DCMB 3A01B 2Z3YA 2H94A 1WSUA 3BROA 4FHTA 2TCTA 2WAFA 3QPTA 4ZH4F 3BPVA 5FFZA 4LOCA 5E18F 4QSHA 2E71A 1IRXA 4DBRA 3L2VA 2XAHA 4PJ0C 5GPAA 1G59A 1ETVA 3H9QA 1Z0XA 3BG6A 1V5FA 3LL7A 4XORA 1HW5A 3Q5FA 5ERIA 3HRTA 2R7FA 5M3MJ 4GFBA 1OPCA 3ZRGA 2P7CB 4Q5SF 1TWFJ 2DMUA 4I99C 2JUCA 2OTLI 1BW5A 2E2HJ 4CZCA 4LIVA 5IOYA 1U0JA 1Z67A 4A93J 2HEOA 2VL8A 2XF6A 3KPHA 4UY8I 1J2XA 2ID3A 4Q4ZF 1FOXA 3FISA 2GIZA 2M1BA 4RAYA 3AKZA 3F23A 3UKGA 2C6YA 1P4XA 1Z77A 5B5EC 1ZR2A 2P7VB 2HTSA 2DDBA 1MNEA 4CYDA 2HR3A 2EV0A 3I53A 2V4JC 4IRHA 2FRHA 4ZYAA 2CS3A 3G1MA 1HSJA 5H6RA 1IW7F 1X1BA 2ME0A 1F9NA 5EEAA 5CKTA 3AG4H 3TOAA 4BNCA 1QPIA 1D8JA 2FU4A 4L9JA 1LUJB 3ZCOA 1B9NA 4NNJA 1I1GA 5DUKA 3LNQA 3LFUA 4XNFA 5JHUA 1QU3A 3K9TA 2CV2A 2A6TA 4ON0A 3WTYC 2JVHA 2X4HA 3T0YA 2LF8A 3IKVA 4E6KG 3OYEA 3FHNA 4HDVA 1D0XA 3P9IA 3R61A 4WXHA 1JUSA 1FEXA 4B44A 2PJRB 2OV7A 2R7ZJ 5IT9K 2J5OA 3M1EA 3J81Z 3HEFA 4U88A 4BKXA 4PCQA 5DM7F 1S7OA 4R79A 2MBFA 2WV1A 2DPDA 4EM1A 5GTIC 2HYGD 2XUBA 5CJ9A 5E3OA 1XCBA 5FKOA 3CCSI 1YFHA 2QENA 4ZDLA 2XRLA 2JJ7A 4MGRA 2D45A 2VPLA 3SZTA 1JE8A 1YOVB 3I9V2 3TGNA 1L0OC 3BPXA 3T8TA 2AQEA 3O3KA 3MKLA 5K1YA 1ZRDA 4YG2F 1EKEA 3QPLA 4OAZA 3K70D 2GQQA 3F8BA 1NG7A 3I5UA 1QHHD 4HG2A 1DGWY 2M4GA 4BUPA 2BY1A 2CUZA 2DYRH 1SD7A 2FOWA 3DPUA 3HRUA 4IEJA 2LBFB 4ZZLA 5E3NA 3J7ZI 1WJCA 5K5RA 3HHHA 3MAJA 4P9UA 2N8GA 4D5FA 2IA2A 2Z1DA 5K7ZA 1MMGA 2GAUA 1NK2P 1GHCA 2L9NA 4XLCA 1ERDA 2HOSA 3HOZJ 3S32A 2HZTA 3BCAA 2Y75A 3MKYB 1UCRA 4G6TB 4D7MA 3EUKL 3RKWA 3CLQA 1E0EA 4CXFA 5GAHJ 4U7BA 4N9IA 2Y30A 3ZMUA 3JRGA 5HDKA 4HNVA 3AG1H 4I6ZA 4XKVA 5FD6A 1OCZH 3KP4A 1RKTA 3I3LA 5EEGA 1OCTC 3TO6A 2K3PA 2HU9A 2VQHA 3V7SA 2Z99A 3AL0C 1GVJA 3BTLA 4M6XA 2OPTA 1IN4A 5CVRA 3S93A 3CC7I 1IV6A 2BZTA 3BQZA 4YIIA 2G9WA 2FJ1A 2ZJQF 3NARA 3RKYA 3O8GA 3P5JA 1J0RA 1ONVA 2M7BA 1PUFA 1M1EB 4ENMA 2QSHX 3TDUC 4IRIA 2IGMA 2XAQA 2GA1A 1FC3A 1X1PA 4YELA 1MDMA 1ZREA 1U9OA 3I71A 4M73A 1HOMA 1YW7A 2K86A 4EVIA 3AAFA 3K69A 3D0SA 3ZMSA 1R4MB 3Q0VA 3E5UA 3CP2A 4F3QA 3MQ0A 1BC7C 3FWEA 5BMZA 3GTLJ 2ISYA 5HOOA 1J75A 3N4MA 1A6QA 2BW3A 2R92J 5EGOB 1BN5A 1W0TA 3K4BA 1ETOA 1Z6TA 4KT5C 2DFHA 2R5YA 4HW0A 4M71A 3W6KB 5DM6F 2VKEA 1BW6A 4YFXF 2CQQA 1JUMA 2DQLA 3M8JA 2GWRA 4M3DA 1YJNI 2V9VA 1OCPA 1XGSA 3RYRA 2ZXIA 1AOYA 1YS7A 2X6OA 4OIOF 3MWMA 1DGRM 5F0FA 2DBBA 5LHHA 4RM3A 4CZZA 2BY3A 2B9SA 2MD5A 3QAHA 3L00A 1FJLA 4CCJA 1MKMA 1JTXA 3ZQHA 5J8FA 2EPFA 5BPDA 2E34A 2VC0A 4AC0A 1MBKA 3S1MJ 4Y33A 4KIBA 1K83J 1XGOA 2QQ9A 2XGCA 4AIHA 3VYTB 1SD6A 1MMSA 3H0GJ 5E17F 1FIPA 4KN7X 2ESNA 2EIKH 2NRAC 3PNYA 4BY1J 2B63J 2NVQJ 5DDGA 3SJMA 2OCEA 2MH2A 2A5YB 2W25A 3C2HA 4IZZA 3G6EI 3VDXA 2Y9YA 2F4OB 1D1BA 2X0LA 3DBLB 2KISA 2PBIA 1A36A 1T0FA 2LFBA 3TW6A 3HIFA 1MJAA 1D5VA 3D5LA 4M72A 3CESA 2CWEA 1I1SA 2XPVA 3OOPA 2VUMJ 2G0EA 1JKOC 3HPHA 2HQNA 3G1LA 1F1ZA 2CO5A 3CJTB 2WBMA 5JLXA 2EIMH 2KRFA 4EV0A 3A01A 4YIFA 1BBYA 2IS1A 2IA0A 3LWFA 1IGNA 1XDUA 3H3ZA 4F7ZA 2UUZA 1USTA 2DJNA 3GWZA 3O2PE 5L3EA 2KJCA 4BBRJ 1PJRA 3GF2A 2CU7A 1Z6RA 2K40A 3SDGA 4KA4A 1JKRC 1VQMI 2VQLA 5J4YA 1PVEA 2DTRA 2O0YA 1JGGA 2M45A 1FOWA 1TTYA 2RN7A 3GFLA 3SEZA 3QU6A 4F93B 1HA8A 2RDPA 3K2ZA 4LB6B 1TWHJ 4RLQA 2VLAA 1IN7A 5CVJA 3BG3A 2L9SA 2NAZA 3FX3A 4ZC3A 3G4SI 4IQJA 3OS2A 5CVUA 4MTDA 1MBFA 3SFIA 3QRFF 1I3QJ 5HNHA 4HNTA 4CHUA 2MC3A 3BZKA 5EG0B 1ON2A 2FF4A 3H9GA 3L9FA 1WCMJ 4II3A 1ZGAA 4H0EA 1BR4A 1RR7A 1V55H 2QGUA 5DD4A 4AUXA 3OYJA 3BJAA 1FZPB 2QKMB 1QVUA 2VOOA 3M07A 3R60A 4I76A 5HDGA 1R1UA 2YSRA 2O9LA 4BE0A 2QBYA 1XSDA 1QQIA 3DKXA 5FLXZ 4JBAA 2JK3A 3HSRA 5E8GA 3OYBA 1R9TJ 1P6RA 1BJZA 4G7OF 1IO2A 3EUHA 3GMEA 1ZGWA 2FA5A 4HDUA 3CUQC 1QRYA 2VKDA 2E5NA 3D5SC 3Q0WA 2EIJH 3WU2C 2MG4A 3CJRB 3MMYB 2VBWA 1YX5A 1LJ9A 2V7FA 5D8LB 4TV7A 2M87A 5J4VA 3ABUA 3I59B 4U7DA 3U21A 2M7AA 3P9CA 4G6QA 4LK1F 1SANA 2HDCA 4PJLA 3ZQCA 1HQCA 3QOPA 3T5XA 1TQPA 4KITB 1RC9A 4FX4A 2LNBA 1QZZA 3P9KA 3IKTA 3RPUA 3KX2A 2HOAA 1XS9A 2X6XA 1DU0A 3DXJF 1G8XA 2M0CA 3BG5A 3K4MA 2NOJB 4UUSB 2VBZA 2BY0A 2DYSH 4JK1X 3IUOA 5CQGA 1Y0UA 2H1KA 2D2WA 5KCMA 5TGTA 2IGOA 2KRHA 4P1WA 3ZQIA 1LKXA 1MBEA 4E7ZA 4P5OA 2DA5A 4HV5A 2CRGA 3B6CA 1GXQA 4A0YA 2FQ3A 4WWCA 1LDJA 1YIOA 2BOLA 3L7WA 1FX7A 1JJ6C 3K6GA 3ZP5A 1XB4A 3G1OA 3FHZA 1S7EA 2LBFA 5FROA 2NS8A 4RGXA 1FP2A 1E3OC 3Q9SA 1KA8A 3DPTA 3ZQ7A 2ZMEC 1HCRA 1FOKA 4L5IA 3OYMA 1KYWA 4HAMA 4KJZA 4A3IJ 3KIOA 3RZDJ 3OS1A 2BXYA 1X4PA 2AXTC 5IY5H 2ZFUA 2Q2EB 3B73A 1TQIA 2K9LA 1FBSA 2R7OA 3CF5F 2IRFG 3JSOA 3V8LA 2R7SA 3N05A 4GCVA 4A3MJ 2WA0A 2QYOA 1KU2A 2DA3A 2OBPA 2RREA 4OIRF 1HDPA 4RBOA 4FCYA 1MH4A 4HEA2 4BQQA 1SFEA 4FASD 3GCMA 3LQQA 1W7PB 3WGGA 1E3HA 2ETHA 2WTEA 1BA5A 1XG1A 2KFDA 4XOTA 1VQ9I 3IRQA 1ZK8A 1YJWI 4WF2A 1XTAA 2LYCA 1FTZA 2O61A 5F04A 2HVQA 2DMTA 1X1CA 2JA8J 2A05A 4B47A 1MW7A 2DA4A 2BHYA 2L3DA 3TW7A 5HVQC 4M3GA 1VQLI 2E1NA 2F4MB 3OYHA 1FT9A 5ILVA 1G6NA 5EGOA 1O7FA 2AXLA 3OYDA 5IYDJ 3ZQQA 1BI2A 3MD2A 2DCEA 3SYTA 2VASA 3Q3SA 1ZG5A 1F5TA 4C2TA 2XAFA 4UB6C 2M30A 3IAS2 3OWTA 1RUNA 3CLOA 3SQNA 3S1QJ 3IH3A 1FIAA 4MQ9F 1ETKA 1X2NA 3JRHA 1OLTA 4NQWA 5HODA 3WTZA 1TZLA 4O5VA 5M3FJ 1UFMA 1XN7A 5K7FA 2ESHA 1R1VA 4E7IA 1MBJA 4ZYEA 2V9KA 2ELJA 4RLFA 3COAC 3BCBA 2FX0A 3W2WA 1K61A 2ELHA 3OYLA 2HVSA 2XC7A 1SFUA 3MN2A 2VT3A 4B48A 4J00A 3RZOJ 1V5GA 4L9VA 3CCLI 2H6CA 1PDNC 4JX4A 3H1CA 2NXNB 4IHTA 4KICA 4C3HJ 1EF4A 3LOCA 2VQCA 2VN2A 2DT7B 4OAYA 4AWXB 1P7IA 4I01A 2K4BA 1OJLA 3SXYA 2GM4A 5LEKA 5TISC 2FBKA 2X1CA 1SVOA 4B3AA 2HXOA 1UMQA 3K4NA 3ZMZA 1VQ4I 5D5XB 4EQQA 3L1PA 3ZQFA 2HQRA 3FF5A 1K6OA 2HS5A 1D0ZA 2XB0X 4HOBA 1K6YA 2DFIA 4EGYA 4XBFA 4XIDA 4DYCA 1E2XA 1R22A 3QU3A 1WJDA 3AFHA 4AIJA 1XMXA 4LFUA 4XN0A 1T38A 2EZHA 3E0JB 3I64A 1FMWA 5IP9J 1D0YA 4BAYA 1K4SA 2MLKA 2EFPA 3CDIA 5FGMA 3B02A 2EWNA 4XL9A 2YU3A 3PIPF 1I27A 5JR3A 2H27A 2CV1A 2LDUA 4CH7A 3VEPA 1Z7UA 2JN6A 4PGGA 1AKHB 3F22A 1FP1D 4HLXA 4BDYA 4MO7A 1UJ8A 4FE7A 2FNAA 3IL2A 1A04A 1IRFA 4KUMA 1UG2A 4RAGA 4A6EA 1B8IB 3WGHA 4D7NA 4AVZA 4RB1A 1O3SA 4NC8A 3S2WA 3VSKA 1TNTA 2MLGA 3RPUD 5J1YA 4OMZA 5K5QA 4MEYF 4ASNA 2P6TA 1LE8B 2K5CA 5EG0A 1ON1A 3A0BC 5GTHC 4B1RA 3KE2A 3BTCA 2X6WA 2K85A 3PM1A 2ADUA 1IJWC 4NC7A 1S7AA 3ABMH 2OZ6A 5ICFA 1Y1WJ 2KIMA 2Z9OA 3LSIA 2EFQA 2K9MA 2E1OA 1WKMA 4UXNA 1IAWA 1QZEA 2HOTA 4L0YB 1G3WA 1OMIA 4BHPA 1NH3A 3PQKA 4OOIA 4HV6A 3F8CA 3GTPJ 1S29A 4C3IJ 1NHAA 1SC7A 2FSWA 5GPCA 2LLKA 1B72B 2B0LA 2X85A 4WX9A 4PK4A 4XICA 3FXQA 4M74A 3S3NA 3IH4A 4I02A 2K4JA 3FXUA 1K79A 4JP0A 4UVBA 3M7GA 3ASNH 1XGNA 1P2FA 5DEQA 1EJ9A 4RB0A 1Y1VJ 2M4KA 3MEXA 2DO7A 4BE2A 3JR9A 1LPQA 4A3CJ 3KEYA 3ZPLA 3CDHA 1FSHA 1BI0A 5F1JA 2CW7A 2MC4A 2OCCH 5LD2C 4NBQA 1YRNB 3WG9A 2Y0MA 3VYRB 1MIJA 2O5RA 2L0KA 2AHQA 2L5QA 4LG0A 1D1AA 2HOEA 3B6AA 4UUSA 1K4TA 2QA4I 1P9QC 3FXMA 4WXCA 5IYBJ 1SFOJ 4HX7A 4A2UA 4F91B 1TWAJ 1NTCA 4R8HA 5J1UA 2X9DA 1P4AA 2FUG2 1AHDP 2Q1ZB 4MLOA 3FXKA 3G73A 4ZTFA 4ENJA 1G2HA 4B43A 1VQOI 3K0LA 2BE5F 4AM3A 3RKXA 2GXGA 3HUGB 3FXOA 3U9GA 1ENHA 2QQBA 2F6CA 1N77A 2L4MA 4KYWA 1JJ8C 4BL0B 3U1KA 5DS9A 1EA3A 1GXPA 5FLVA 3E5QA 1KZHA 5JI6A 1FSEA 1Q1VA 4EEFG 1J09A 3TO7A 1UB9A 2VPRA 2PMHA 3CMMA 3REOA 2KIUA 3HOXJ 1LDDA 5J3LA 4I0AA 1MMNA 3CCRI 1KYZA 2CSOA 4HLYA 3ERED 2NS0A 5LLQA 2KHMA 3A4CA 2HNHA 4IHSA 4I2OA 4G12A 4QTRA 2EA2A 2CFOA 3CCYA 1U78A 2XHKA 2PLYA 3K2AA 5KVRA 4KMUX 1VTNC 5FKMA 3DP7A 4XSZF 1R6RA 4G6DA 1H9TA 1ETYA 4OIPF 2M34A 5IT9Z 3ASOH 1TW3A 2LMDA 2Y9ZA 4LMYA 4HQMA 4X1EA 4HX4A 1MGTA 2JA5J 2PN6A 2QQAA 1N78A 4DGWB 4LK0F 2HXIA 3CUQA 5H2FC 1BL0A 1FOYA 1XSXA 4DZPA 4ESFA 3C3WA 4XMYA 2E5ZA 3BTIA 5BOXA 3DKYA 2DN0A 3CTAA 2OAZA 1UG0A 2IS4A 3BDDA 2JA2A 3VWBA 2O3FA 2PMUA 3IP4B 2CGPA 1FTTA 4BS9A 1R49A 3E6DA 1JHHA 2W82A 2PEXA 3OR2C 3RI4A 4RGRA 1EV7A 2K7LA 3HTUA 2VBYA 3QQAA 4M9ZA 3K4JA 1U3EM 4EM2A 2KDOA 3VODA 1N25A 5FLMJ 3S2HJ 2JMWA 3ZQGA 3SEQA 5L3GA 2M8EA 2KIQA 4EJOA 2GBYA 1VZ0A 3M9AA 2PJPA 4A3BJ 1GVDA 2DT6A 3GFMA 1IXRC 4IHXA 2ZCWA 5ED4A 3LSRA 3M8EA 1R58A 1GV5A 4N9HA 3J7YJ 4Z2YA 1IXSB 4U0VA 3CDLA 2L2OA 1IUFA 2AS5F 1HC8A 2O03A 2LC2A 1REPC 2ZMEA 4A0XA 2E7XA 2BYVE 3PSIA 4HQEA 2M3AA 3RIRA 3PFYA 5F6FA 1EH8A 5J8CA 4FX0A 1O3TA 5E20A 2IAIA 2ZSHB 2I8DA 1JUPA 3JCUC 3KP7A 4BGDA 3F8MA 1ZLKA 2V1UA 2R7XA 1R71A 4C3JJ 1P92A 4A3JJ 4RGUA 1J7KA 4FE4A 4M6YA 3RQIA 2VBXA 2MA3A 4BEHA 2E2JJ 1RPWA 2DOEA 1LB2A 2DK8A 1Z21A 3L09A 1XGMA 2MYSA 2MFZA 5C4XJ 4A0ZA 4D0PA 2RKHA 1S9HA 2I5UA 2H09A 3FIWA 3TOBA 1K78B 2L7ZA 1W36D 2JPCA 1R36A 1HLVA 2ZJ2A 2CUFA 4RAZA 1QA6A 2JUGA 2VJJA 4PZJA 3CMYA 2X51A 3JSPA 3AG2H 1POGA 3FK7A 2E2IJ 1TW2A 1XCVA 2HDDA 3S2DJ 2VJ4A 3CQZJ 5L3CA 4UVCA 1B8IA 3K4KA 2JWTA 3G71I 1W0UA 4IO9F 3ERMA 4V19K 3OY9A 3IC7A 4UVAA 3FKIJ 2CW8A 2OUMA 3CF2A 3GO5A 1W5CC 1TQMA 4CYCB 2Y0SA 3DF8A 4ZYDA 3A1YA 2GOXB 4LIUA 2DOFA 1FWZA 4HA8A 1U5TC 3GXOA 2R7VA 2HDWA 5F64A 3W6VA 3LFKA 2W84A 3HZJA 3ZN1A 4HBLA 2R7UA 1SMTA 4ZDPA 4YRVA 4WCGA 3HGYA 2E19A 4GYIA 1XSVA 3BJ6A 5D6EA 3X2QH 2M5WA 3I4NJ 5IPAA 2UXNA 1IXCA 3L2WA 5GP9A 2R4GA 2FOKA 2ZKZA 2H6BA 2COBA 3OYAA 5CPRB 3HSFA 1W36C 2IS2A 4XQFA 1G3SA 1B72A 4IKFA 2KRCA 2HPMA 1WH5A 3O6BB 2HZDA 2OD5A 1MSEC 2DU9A 2QLZA 4O3MA 2IP2A 3KZYA 2CUEA 2LY1A 4Y3OA 3DCFA 3UNGC 1BOAA 2CJJA 1APLC 1RZ4A 1ZTRA 2DFFA 2JTVA 3HDDA 2CQXA 3CCUI 2EINH 4A12A 2XGDA 1TBXA 1FLIA 4KNYA 4M6VA 4P96A 4Y13A 3PIOF 1I3AA 4XLFA 3ABLH 1YRNA 1MNMC 3PUFA 1VF9A 5IT3A 2LF7A 1R7JA 3S8PA 3V7CA 3HOWJ 3K4LA 4LLNA 2EFNA 1CQTA 2GZWA 3K4CA 2DA6A 2LG4A 1VQ6I 3TEDA 3DEEA 5DCMA 3ROUA 3W2AA 2R7DA 1ZARA 1Z7LA 2XB5A 4XRFA 3VYUB 2X6YA 1T08B 4QWQA 3NRVA 2WY7Q 1CF7B 3KFWX 3WE3A 1W7PD 3GBGA 1LVKA 2BEOA 2GA2A 4ITVA 5H20A 1STZA 1W5SA 2KJBA 1H8AC 4V2GA 3KZIC 5LGTA 1LEAA 3ML6A 3HUGA 1IDZA 1MD0A 2FD5A 3HJEA 1ITYA 4ENKA 5E3MA 3DEUA 3SFZA 4ZYGA 2HQAA 3DQVC 1R5GA 3QOEA 2DAOA 2VODA 1V5EA 3IWFA 2XF5A 3PUBA 2LR8A 3W2VA 1WZ2A 2OU2A 2UZKA 2X1EA 1YJ9I 3PJRA 2RNGA 3K1MA 2QZ8A 1S6LA 5FKLA 2GIVA 2VE8A 3DKWA 3VB2A 1P4WA 4BHCA 1HKQA 2HTJA 2ISZA 1YHQI 3MVPA 1VQ7I 3GFIA 2M0MA 1Y56A 3RJPA 4I98B 1C0WA 1YG2A 5M5XJ 3GW2A 2DTZA 2JT1A 3GTGJ 1U5TB 3JTGA 4MIMA 4I09A 4X6AJ 1IV8A 2Y31A 5J6XA 4JX5A 1S72I 1R5HA 3DTEA 3LSGA 2V1NA 3H35A 4FQGA 3TQNA 2IEKA 4D9JA 4HNUA 3KETA 1X2MA 3OIOA 4UB8C 2LKPA 4A5MA 5J47A 4EJWA 2DMPA 3FM5A 3HOVJ 3ABTA 4FTHA 2RVCA 2CW0F 2W1OA 4F92B 3SZGA 5L3BA 5LEJA 3KP3A 4P9FA 5HLTA 3S14J 1SMYF 5EZHA 4B4CA 2W85A 4E4HA 3JAMZ 3OL3A 4Y17A 1USSA 3CC4I 4MFEA 2R7WA 1JGSA 2Z2SB 5E79C 2PJRA 1N75A 4IXAA 1A6IA 5E1ZB 3HKZA 4A3LJ 1OISA 2E7WA 4J19A 2KZGA 2Y0SN 3EPZA 3IWZA 4OWRB 2Q8KA 5FB2A 2NNYA 4CSWA 3WTTC 3RKQA 1H88C 2XAUA 3A02A 2HKOA 2QQ8A 4EATA 1NK3P 1ZRFA 3BT9A 3FXJA 1B4AA 3FXLA 2R7QA 3S16J 3NWTA 4C2MJ 3RCOA 5E8IA 5F1RA 2P81A 2O7OA 4MTEA 2FMLA 3PNVA 3QYBA 4A3FJ 1X19A 3QYEA 4N4OB 1AWCA 3MCZA 4XRMA 3ECOA 3GTKJ 4E7JA 2NVYJ 3GEZA 1OQYA 1HW1A 3GZ6A 5C44J 1JI8A 1CGPA 3S3MA 1T56A 5B66C 1U8RA 2P6SA 1IC8A 3PFIA 3KEOA 4R1HA 2Q0OA 4ABZA 2R3SA 3NQOA 1DPRA 1YW9A 2RQQA 3BWGA 2J5PA 3IH2A 2HYJA 1KQ8A 4E70A 3WG7H 6PAXA 1HDDC 1Y39A 4IPAA 4PUSA 3QWLA 1WH7A 3GTJJ 1WJEA 3UR3C 1EH7A 3I4MJ 3V8JA 4GGGA 4EGZA 3HSEA 5FFXA 2H1LA 3JW4A 2OC6A 4UUVA 1LNWA 1YTYA 4AYBA 3QP6A 1HBXG 3KLNA 3WU1B 2Z5UA 1K78A 2JZYA 3NEUA 4E7LA 1ZAOA 3F6OA 3AG3H 2XKOA 2ICWG 2DOAA 3PSFA 1JXSA 3S17J 4BH9A 3E6BA 4MFDA 4MHGA 2QCOA 2EB7A 1ZG3A 5J40A 3JRFA 3C18A 2HGCA 3FXRA 4OMYA 2WWYA 2QM3A 3PO2J 1ZRCA 2FE3A 2O8KA 3H5NA 4MNUA 5HS7A 1ODDA 1LVAA 3ABKH 2VJIA 2HWVA 2A6EF 5D5UB 1VQ5I 1XD7A 5DYMA 1TL8A 3LSHA 2EV6A 2CQKA 2L01A 5EYRA 1O3RA 3E3VA 2V9PA 5ICCA 2ZFWA 4L18B 4PJJA 3H9JA 4PSXA 3FK6A 2XAGA 3WU0A 1JHFA 3RTRA 3H3VK 5TJJA 4DYRA 5L3FA 5FD5A 5JVTA 1BM9A 2XIGA 2CYYA 1O57A 2JA6J 3GTOJ 3G3ZA 3S1RJ 3E7LA 2O6GE 2DA7A 2JVGA 4LB5A 3E6MA 1TLHB 3C2BA 3T8RA 3JRBA 1ZQ3P 4XKCA 5DD8A 4DIQA 4XM3A 2LVSA 1YITI 1QVTA 3DWLE 2ID6A 3MZHA 2DDAA 5EZGA 4KISA 5IP7J 1F43A 3R6SA 4Y4RA 3KCCA 1MZBA 1JT6A 3HKZN 4LG3A 4N0BA 1HW2A 4ANJA 3PQJA 1FBUA 1D3YA 5LRRA 4NUBA 1SD5A 1JKQC 5KNLA 5ILUA 2YU9J 1E17A 1B6AA 3L2RA 4LITA 3IV5A 2QSGX 1OR7C 4BQNA 1LEBA 2ZJPF 1S3JA 1SFKA 2KKOA 3HPGA 4KIFA 2LRDA 3HRSA 2XGEA 2IGNA 2OA4A 1FYMA 1T0FC 3LA3A 1WJ5A 3N97A 2EH3A 1PUEE 2FEZA 2AO9A 3EQLF 3GZNB 2VT2A 1J59A 2P0WA 2R7TA 3OL4A 1RETA 4GRIA 2XSDC 4P55A 4MEXF 5CQEA 5IYCJ 1YLFA 3MKWB 3CCVI 1Q1HA 2EBIA 3H92A 4DOZA 5HLGA 3GTMJ 1SVMA 1B9MA 1UELB 5KAIC 1IF1A 1PUFB 2EA4A 1W4MA 2K27A 2DQRA 2TRTA 3CCJI 2A6HF 1IRZA 2HI3A 1MMDA 3CZ6A 3KYCB 1KGSA 1QZYA 2EQRA 3SHFA 1J9IA 3I55I 2MH9A 4ZTJA 1ZG1A 5KK1A 4A5NA 2P5VA 1X58A 4XR6A 1U5TA 1OKRA 3I56I 1OYWA 4EJUA 5LGUA 4UUTA 3CUOA 4CCKA 3JTHA 2OQRA 1U9NA 2ZXJA 1QHGA 4AYBN 2R5YB 2MD0A 3EYIA 3J80K 1BC8C 3A0HC 4RS8A 1D5YA 5BS6A 3C1DA 3EDPA 3V8KA 1WRJA 3FMRA 4M3BA 3E1SA 3LSJA 5L3DA 2Z33A 2JRTA 1WVRA 2L7MP 1IRGA 4IQ4A 3DBRB 2H8RA 3CCMI 1TP4A 4G7HF 3BR1A 2STTA 3OYFA 1I6XA 3I59A 2BVMA 3OYGA 3DPLC 2PX9A 1G3TA 5DUIA 3HOUJ 1ZGJA 1R1TA 1HXDA 2XV4S 1V3FA 2Y2ZA 3S1NJ 3EUHC 3KYDB 4AU7A 1OCOH 2QEXI 2D5VA 3Q0UA 4DQ2A 1X3UA 1ZH5A 1OFCX 3F3XA 4ZDOA 2E1MC 2L9VA 2PI0A 3EETA 3ESWB 4YFKF 4JQFA 5F27A 4YIRX 2WAEA 4LD5A 4AVPA 2JQ7A 1FBQA 2IA1A 2R7RA 5A2QK 1BIBA 1F4KA 3M3YJ 2A69F 3Q9VA 4JX6A 2WY8Q 3R0AA 5CVIA 5D5WB 1UHWA 1ETXA 3DTKA 4GYGA 2O8XA 3J7AO 2FNPA 5HLIA 2GOMA 5CLSA 4A3GJ 2KDZA 1IUYA 3IAM2 3I54A 3P7NA 3HYIA 4XOPA 2PQ8A 4LJZF 4NHJA 5AIQA 2OTJI 4BYYA 2QKLB 2JPBA 4C9YA 2KT0A 4Y7NJ 2IS6A 1IG7A 4XLPF 4A3KJ 4Q47A 1BIAA 2Q2EA 2V1XA 3DTIA 4U87A 1Z3YA 2IW5A 3V42A 4W1UA 1RUOA 2R93J 2RAEA 2COMA 1V54H 1TT0A 1Z05A 3HBLA 3WE2A 2VKHA 1YQAA 2HVRA 1B1BA 1X1DA 4ZYHA 1PYVA 1YS6A 2CFXA 2L02A 2VQGA 4UHTA 5FRNA 3E6CC 2XVCA 1W7PA 1MH3A 3LSKA 1MNDA 4E7KA 5D5VB 3T1BA 3HHGA 1SEUA 2VONA 4XKBA 4IRGA 2NS7A 1XMAA 3BTJA 3K1PA 1H0MA 4OIQF 2NYXA 4XRSG 2CQ7A 1QPMA 2ME6A 4X0GA 1XPXA 2EZKA 4G94A 2BXZA 3BLYA 4EM0B 5GAGJ 3TDZC 1ACIA 5FJ8J 2QBYB 2QWWA 3BP8A 3WTSC 2WC2A 2DPUA 2PMZA 2XKPA 4RB3C 4OU0A 4LGWA 3BR2A 2LOOA 4FETA 4DYQA 1WJBA 2K9SA 2DMQA 4Q48A 1MJ9A 1WJAA 1VNDA 3DEWA 5KHDA 2KL4A 3HGGA 1YX3A 1UHMA 2E1MB 2EILH 4BU2A 1OCCH 1DQUA 2F5DA 3ONQA 1WI9A 3QODA 2P4WA 4IOCF 2NNNA 2CV0A 3KZZA 1A35A 1QO0D 4M3EA 2BBYA 2YR2A 4XN3A 2IBDA 3OYNA 2KZVA 3FM3A 3R4KA 1U2WA 2QVOA 3KYLA 4JOMA 3QP5A 3GYHX 1X4OA 1BOBA 4UV8A 1BR2A 4I0BA 3K10A 3LQRA 3C7JA 1G3YA 1H89C 1RI7A 1FPQA 4BQOA 1SAXA 5LFAA 2EZLA 3MZ8A 5D4RA 4K2EA 4S05A 3J7AY 1KONA 3J81K 5LRSA 5IOZA 4L9NA 3CCQI 3ULQB 2QF7A 1TWCJ 2UV1A 5ICEA 4EMSA 5ILSA 3BR6A 1Z91A 3M8FA 3ZXSA 5C3EJ 1U6GA 3LA7A 2ZC2A 2VIXA 4B3XA 3ZR8X 2YX7A 3IHUA 2L7KA 4A69C 4CCMA 4U0WA 4XKWA 3JREA 4M3FA 5HDNA 5JLWA 1YI2I 3FMSA 2L7FP 1JKPC 1Z3XA 2EJRA 1H9GA 5HNFA 3PO3J 4G9YA 3KP5A 5F0CA 5GADJ 2R0QC 1LDKB 4G7ZF 2DMNA 2XROA 3CJNA 1ETQA 3F9KA 1OYIA 2DFEA 1TT5B 4PSWA 1MBHA 3E5XA 4IVNA 2FMYA 1LFPA 2X1DA 1AKHA 3V4GA 4DNCA 3MZYA 4BXFA 1YE9A 5B1BH 3GUDA 3MKZA 2XPWA 2RQPA 3MFKA 2F2EA 1WPKA 3O8HA 1ZN2A 5TRDA 5AONA 5EF6A 3K70C 5DCFA 3JRIA 1AU7A 4HZFA 3CMEI 4XONA 1GT0C 3CMAI 2K3FA 4DBQA 3TP3A 1HKSA 2ZSIB 1LE8A 4FT8A 1DUXC 2VI6A 3CCEI 4ENNA 4DJAA 2NVXJ 2ZXWH 4L5JA 4RB2C 3HOTA 1ORKA 5M5YJ 4RMNA 5LBQA 2P8TA 3DV8A 5GAEJ 2YUSA 1UZCA 5D6FA 3JRDA 4DZJA 1O7LA 3HOSA 2KLOA 3BZ6A 1Y6IA 3KEQA 2HPIA 4FISA 4HF0A 1BR1A 3BR5A 3RPQA 3W6JB 4CA0A 2LY2A 4PJNA 3H3UA 4L5EA 3PL8A 1BI1A 4IJAA 4ESBA 2W48A 1PP8F 1D8KA 4S0HB 3D1NI 4C30A 2XPUA 1GUUA 4NQWB 3ZOBA 3ZMTA 5JHFA 5FRMA 2RC4A 3BC8A 2F5VA 5F08A 2PMZN 3R0JA 2QUFA 5KAFC 2EZIA 3EYYA 1AA7A 1YO5C 2Y69H 2MSYA 3QYFA 1SFXA 2UXXA 3ZMVA 4BDZA 1R4NB 2IPQX 4PJMA 1KU9A 2CMPA 2EV5A 4W97A 1TC3C 4LLGF 1OYYA 4ESJA 4CDGA 2HYFA 3WTUC 4JYKA 1X3WB 3KP2A 4RA2A 2R5ZB 2W57A 1MJBA 2KIFA 5B1AH 3LAJA 3BR3A 2HFHA 1FNNA
chains in the Genus database with same CATH topology
3CO6C 1OR7A 2VOPA 1XDSA 2L54A 1FY7A 3V7RA 2XGXA 1QGPA 2UWMA 3I4PA 3WTVC 4XSXF 1IN5A 2A07F 3WGIA 3F8NA 2F5CA 4PDKA 2V79A 3GLXA 2EFOA 2XRNA 4M9XA 1BJAA 2V1DA 5AIPA 4L0ZB 4MQVA 1KQ9A 3TO9A 1J5YA 4ZZDA 5BQTA 5BPIA 4HYEA 1BI3A 2E1CA 4BXUA 2F5EA 5LHGA 4KN4X 2DI3A 4BQAA 3ELKA 4BHBA 5HLHA 3I58A 3F21A 4KDPA 3QPHA 3F72A 3SZPA 4KMFA 3BOQA 5D8KB 3K1NA 1PP7U 2FBIA 4PGHA 4IF4A 1QNTA 3KLOA 3RDIA 1KU3A 3ECHA 5FLXK 1K7AA 4CICA 2ACJA 2F5FA 3F6VA 1Z9CA 3GVAA 2P5KA 3TKYA 2A68F 4UV9A 1DDNA 2FXAA 2LSOA 3LA2A 5K5OA 3BY6A 3L2CA 3JAMK 4LG0B 1B59A 4EJTA 4RGSA 3FZVA 2Y48A 1ZHFA 2DT5A 1T2KA 2YPRA 1XMKA 3RYPA 2ZNYA 4UNOA 4U0YA 1YW8A 4B09A 4M9SA 4B8XA 3F8FA 4EJVA 1WWXA 1TNSA 1IN6A 2BV6A 2A61A 2ZO4A 4S04A 1HSTA 3GZ5A 2V6CA 3VFZA 1RIOH 2IT0A 3HTSB 4WXDA 2XASA 2WV0A 3HRMA 3WODF 2DLLA 2W24A 2OQGA 1G4DA 4GO1A 1KU7A 4I7HA 2DK5A 4KIGA 1FYKA 2PFBA 1V4RA 4XLNF 3CUQB 2ZBKA 5CVVA 3BJOA 2XAJA 5HS9A 1DPUA 1ZLJA 4HF2A 2P5LC 4ETSA 1L3LA 3OV8A 4CGZA 1FYLA 4AD9A 4WK8F 2VE9A 1SD4A 2A3SA 5JFRA 2VC1A 1ZYRF 4HF1A 1S8NA 3U1DA 2IJLA 4CO8A 2GXBA 1RNLA 2HKXA 2BGCA 3ZMDA 3IRRA 4YFNF 3ZN0A 2ZMEB 2RV8A 2G7HA 5E1XA 2STWA 1CF7A 3WTWC 1IZ1A 2TDXA 1ULYA 5LHIA 1EH6A 1YYVA 1KQ0A 4G8XA 3ISPA 5LGNA 1HKTA 3LSTA 2EFWA 3U2RA 2RGVA 1MDMB 3FMQA 2PG4A 1Z1DA 3J80Z 4HX8A 2EK5A 4AIKA 5FO5A 1LQ1A 2JSCA 4A6DA 2ZNZA 4OINF 3GFJA 3DFGA 1DP7P 4NB5A 3VOEA 2VXZA 2D1VA 5HS8A 2IVMA 1T98A 2YX4A 2K02A 3CO7C 2CG4A 4Y15A 5A2QZ 3E97A 1R00A 4KFCA 2OZUA 2D1HA 1R23A 5EEHA 1O3QA 4LLLA 5H6QA 2DW4A 4L9TA 5CYVA 5DV5A 5E1WA 1T39A 1W5TA 1IN8A 2L4AA 3LAPA 2FBHA 3I0TA 3GX4X 1QBJA 3KP6A 5D4SA 3WTXC 1I5ZA 5ICGA 4O6JA 4GXOA 2RNJA 1WQ2A 1T6SA 4QLCU 2G7UA 5DCMB 2Z3YA 2H94A 1WSUA 3BROA 4FHTA 3QPTA 4ZH4F 3BPVA 5FFZA 5E18F 2XAHA 1HW5A 3Q5FA 5ERIA 3HRTA 2R7FA 1OPCA 2P7CB 4Q5SF 2HEOA 1J2XA 4Q4ZF 2M1BA 4RAYA 3F23A 2C6YA 1P4XA 2P7VB 2HTSA 4CYDA 2HR3A 2EV0A 3I53A 4IRHA 2FRHA 1HSJA 5H6RA 1IW7F 1F9NA 3TOAA 4BNCA 1D8JA 2FU4A 4L9JA 1B9NA 1I1GA 5DUKA 5JHUA 3K9TA 4ON0A 3WTYC 2X4HA 3T0YA 2LF8A 3IKVA 4HDVA 3P9IA 3R61A 4WXHA 5IT9K 2J5OA 3M1EA 3J81Z 4U88A 4PCQA 1S7OA 4R79A 2MBFA 2DPDA 4EM1A 2HYGD 2XUBA 5CJ9A 1XCBA 1YFHA 2QENA 4MGRA 2D45A 3SZTA 1JE8A 3TGNA 1L0OC 3BPXA 3T8TA 3O3KA 5K1YA 1ZRDA 4YG2F 2GQQA 3F8BA 3I5UA 1SD7A 3HRUA 4ZZLA 5K5RA 3HHHA 3MAJA 4P9UA 2IA2A 2GAUA 1GHCA 2HZTA 2Y75A 1UCRA 3RKWA 4CXFA 4U7BA 4N9IA 3ZMUA 5HDKA 5FD6A 3KP4A 5EEGA 3TO6A 3V7SA 2Z99A 1GVJA 4M6XA 1IN4A 5CVRA 4YIIA 2G9WA 3RKYA 1J0RA 1ONVA 4ENMA 3TDUC 4IRIA 2XAQA 2GA1A 1FC3A 1MDMA 1ZREA 3I71A 4M73A 1YW7A 2K86A 4EVIA 3AAFA 3K69A 3D0SA 3ZMSA 3E5UA 1BC7C 3MQ0A 3FWEA 5BMZA 2ISYA 5HOOA 1J75A 3N4MA 1BN5A 1Z6TA 4KT5C 4HW0A 4M71A 3W6KB 4YFXF 2DQLA 2GWRA 2V9VA 1XGSA 3RYRA 1AOYA 1YS7A 4OIOF 3MWMA 2DBBA 5LHHA 4CZZA 2MD5A 3QAHA 3L00A 1MKMA 5J8FA 5BPDA 2VC0A 4KIBA 1XGOA 2QQ9A 4AIHA 1SD6A 5E17F 4KN7X 2ESNA 2NRAC 5DDGA 2MH2A 2A5YB 2W25A 2X0LA 2PBIA 1T0FA 3HIFA 1MJAA 1D5VA 3D5LA 4M72A 2CWEA 1I1SA 3OOPA 2HQNA 1F1ZA 2CO5A 2KRFA 4EV0A 4YIFA 1BBYA 2IA0A 3LWFA 1XDUA 3H3ZA 4F7ZA 1USTA 3GWZA 3O2PE 5L3EA 2KJCA 3GF2A 1Z6RA 4KA4A 2DTRA 2O0YA 2M45A 3GFLA 1TTYA 2RN7A 3QU6A 2RDPA 3K2ZA 4LB6B 1IN7A 5CVJA 3FX3A 2NAZA 5CVUA 4MTDA 3QRFF 4CHUA 2MC3A 1ON2A 2FF4A 3L9FA 1ZGAA 4H0EA 5DD4A 3BJAA 1FZPB 2VOOA 3R60A 5HDGA 1R1UA 2YSRA 2QBYA 1XSDA 1QQIA 5FLXZ 4JBAA 3HSRA 5E8GA 4G7OF 1P6RA 3EUHA 2FA5A 4HDUA 3CUQC 2VBWA 1LJ9A 5D8LB 4TV7A 2M87A 3ABUA 3I59B 4U7DA 3P9CA 4G6QA 4LK1F 2HDCA 1HQCA 3QOPA 3T5XA 1TQPA 4FX4A 2LNBA 1QZZA 3P9KA 3IKTA 3RPUA 3DXJF 2VBZA 4JK1X 1Y0UA 2D2WA 4P5OA 4HV5A 1GXQA 4A0YA 2FQ3A 4WWCA 1LDJA 1YIOA 3L7WA 1FX7A 3ZP5A 1XB4A 3FHZA 4RGXA 1FP2A 3Q9SA 1KA8A 3DPTA 3ZQ7A 1FOKA 4L5IA 1KYWA 4HAMA 3B73A 1TQIA 1FBSA 2IRFG 3JSOA 3V8LA 4GCVA 2QYOA 1KU2A 2OBPA 4OIRF 1SFEA 3LQQA 1W7PB 3WGGA 2ETHA 2WTEA 3IRQA 4WF2A 2O61A 5HVQC 2L3DA 2E1NA 1FT9A 5ILVA 1G6NA 1O7FA 2AXLA 1BI2A 1ZG5A 1F5TA 2XAFA 2M30A 1RUNA 3CLOA 3SQNA 4MQ9F 4NQWA 3WTZA 4O5VA 1UFMA 1XN7A 2ESHA 1R1VA 4ZYEA 3COAC 2ELHA 1SFUA 2VT3A 4L9VA 1PDNC 2H6CA 4IHTA 4KICA 2VN2A 4AWXB 4I01A 2K4BA 3SXYA 5LEKA 2FBKA 3ZMZA 5D5XB 4EQQA 2HQRA 3FF5A 1K6OA 2HS5A 4HOBA 2DFIA 4EGYA 4XBFA 1E2XA 1R22A 3QU3A 4AIJA 4LFUA 1T38A 3I64A 4BAYA 2MLKA 2EFPA 5FGMA 3B02A 2EWNA 2YU3A 1I27A 5JR3A 2H27A 2LDUA 3VEPA 1Z7UA 4PGGA 3F22A 1FP1D 4HLXA 2FNAA 3IL2A 1A04A 1IRFA 4KUMA 4A6EA 3WGHA 4RB1A 1O3SA 3S2WA 1TNTA 2MLGA 5K5QA 4OMZA 4MEYF 4ASNA 2P6TA 1ON1A 3KE2A 2ADUA 2Z9OA 1S7AA 2OZ6A 5ICFA 2KIMA 2EFQA 1WKMA 4UXNA 1IAWA 4L0YB 1G3WA 1OMIA 4BHPA 3PQKA 4OOIA 4HV6A 3F8CA 1S29A 1NHAA 2FSWA 2B0LA 4WX9A 3FXQA 4M74A 4I02A 2K4JA 3FXUA 1K79A 4UVBA 3M7GA 1XGNA 1P2FA 5DEQA 4RB0A 3MEXA 2DO7A 3ZPLA 3CDHA 1FSHA 1BI0A 3WG9A 2Y0MA 4LG0A 2HOEA 4WXCA 4HX7A 4A2UA 4R8HA 1P4AA 3G73A 4ENJA 3K0LA 2BE5F 3RKXA 2GXGA 3U9GA 2QQBA 2L4MA 4KYWA 1GXPA 3E5QA 5JI6A 1FSEA 3TO7A 1UB9A 2PMHA 3REOA 2KIUA 1LDDA 4I0AA 4HLYA 1KYZA 2CSOA 3ERED 2NS0A 5LLQA 4IHSA 4I2OA 1U78A 2EA2A 2PLYA 2XHKA 5KVRA 4KMUX 1VTNC 3DP7A 4XSZF 1H9TA 4G6DA 4OIPF 5IT9Z 1TW3A 4LMYA 4HQMA 4HX4A 1MGTA 2PN6A 2QQAA 4LK0F 3CUQA 1XSXA 4ESFA 3C3WA 5BOXA 3CTAA 2OAZA 3BDDA 2O3FA 2PMUA 2CGPA 3E6DA 1JHHA 2PEXA 3RI4A 4RGRA 1EV7A 2K7LA 3HTUA 2VBYA 4M9ZA 1U3EM 4EM2A 3VODA 5L3GA 2M8EA 4EJOA 2PJPA 3M9AA 3GFMA 1IXRC 2ZCWA 5ED4A 3M8EA 1R58A 4N9HA 4Z2YA 1IXSB 4U0VA 2AS5F 2O03A 1REPC 2ZMEA 4A0XA 2E7XA 2BYVE 4HQEA 3RIRA 5F6FA 1EH8A 5J8CA 4FX0A 1O3TA 5E20A 3KP7A 1ZLKA 3F8MA 2V1UA 1P92A 4RGUA 1J7KA 4M6YA 2VBXA 2MA3A 1LB2A 2DK8A 3L09A 1XGMA 4A0ZA 4D0PA 2RKHA 2H09A 3TOBA 1K78B 2JPCA 1R36A 2ZJ2A 4RAZA 4PZJA 3JSPA 1TW2A 1XCVA 5L3CA 4UVCA 3IC7A 4UVAA 3GO5A 1TQMA 3DF8A 4ZYDA 1FWZA 4HA8A 1U5TC 3GXOA 5F64A 3LFKA 2W84A 3ZN1A 4HBLA 1SMTA 4WCGA 4GYIA 1XSVA 3BJ6A 5D6EA 2M5WA 2UXNA 1IXCA 2FOKA 2ZKZA 2H6BA 3HSFA 1G3SA 3O6BB 2OD5A 2DU9A 2QLZA 4O3MA 2IP2A 3KZYA 1BOAA 1RZ4A 2JTVA 4A12A 1TBXA 1FLIA 4KNYA 4P96A 4Y13A 5IT3A 2LF7A 1R7JA 3V7CA 4LLNA 2EFNA 2GZWA 5DCMA 3ROUA 2R7DA 1ZARA 4XRFA 4QWQA 3NRVA 1CF7B 3KFWX 3WE3A 1W7PD 2BEOA 2GA2A 5H20A 1STZA 1W5SA 2KJBA 5LGTA 1LEAA 3ML6A 3HUGA 1MD0A 4ENKA 3DEUA 3SFZA 4ZYGA 3DQVC 1R5GA 2DAOA 2VODA 3IWFA 2OU2A 2UZKA 3K1MA 2QZ8A 1S6LA 2GIVA 2VE8A 3DKWA 3VB2A 1P4WA 4BHCA 1HKQA 2HTJA 2ISZA 3GFIA 3RJPA 4I98B 1C0WA 1YG2A 3GW2A 2JT1A 1U5TB 3JTGA 4I09A 5J6XA 1R5HA 3TQNA 3KETA 2LKPA 4A5MA 4EJWA 3FM5A 3ABTA 2RVCA 2CW0F 5L3BA 5LEJA 3KP3A 4P9FA 1SMYF 3JAMZ 2W85A 4Y17A 1USSA 1JGSA 4IXAA 5E1ZB 2E7WA 3IWZA 2Q8KA 5FB2A 2NNYA 3WTTC 2HKOA 1ZRFA 1B4AA 5E8IA 5F1RA 4MTEA 2FMLA 1AWCA 3MCZA 3ECOA 3GEZA 1HW1A 3GZ6A 1CGPA 1U8RA 2P6SA 3PFIA 3KEOA 4R1HA 2Q0OA 2R3SA 3NQOA 1DPRA 1YW9A 3BWGA 2J5PA 1KQ8A 4E70A 6PAXA 4IPAA 1EH7A 3V8JA 4GGGA 4EGZA 3HSEA 5FFXA 3JW4A 4UUVA 1LNWA 1YTYA 3QP6A 1HBXG 3KLNA 3WU1B 2Z5UA 1K78A 2JZYA 3NEUA 1ZAOA 3F6OA 2XKOA 1JXSA 4BH9A 3E6BA 4MHGA 2EB7A 1ZG3A 3C18A 2HGCA 3FXRA 4OMYA 2WWYA 2QM3A 1ZRCA 2FE3A 4MNUA 5HS7A 1ODDA 1LVAA 2HWVA 2A6EF 5D5UB 1XD7A 5DYMA 2EV6A 2CQKA 2L01A 1O3RA 3E3VA 5ICCA 2ZFWA 4L18B 2XAGA 3WU0A 1JHFA 3RTRA 5TJJA 5L3FA 5FD5A 5JVTA 1BM9A 2XIGA 2CYYA 1O57A 3G3ZA 2O6GE 4LB5A 3E6MA 1TLHB 3T8RA 5DD8A 3MZHA 3R6SA 3KCCA 1MZBA 4N0BA 1HW2A 3PQJA 1FBUA 1D3YA 5LRRA 1SD5A 5ILUA 1E17A 1B6AA 1LEBA 1S3JA 2KKOA 4KIFA 3HRSA 2OA4A 1FYMA 3LA3A 3N97A 1PUEE 2FEZA 3EQLF 2VT2A 1J59A 4P55A 4MEXF 1YLFA 1Q1HA 3H92A 5HLGA 1B9MA 1IF1A 2EA4A 1W4MA 2K27A 2DQRA 2A6HF 1KGSA 1QZYA 3SHFA 1J9IA 2MH9A 1ZG1A 5KK1A 4A5NA 2P5VA 1U5TA 1OKRA 1OYWA 4EJUA 5LGUA 3CUOA 3JTHA 2OQRA 2ZXJA 3EYIA 3J80K 1BC8C 4RS8A 5BS6A 3C1DA 3EDPA 3V8KA 1WRJA 3FMRA 5L3DA 2Z33A 2JRTA 1IRGA 4G7HF 2STTA 1I6XA 3I59A 3DPLC 1G3TA 5DUIA 1ZGJA 1R1TA 1HXDA 2XV4S 1V3FA 4DQ2A 1X3UA 1ZH5A 3F3XA 2PI0A 3EETA 4YFKF 4JQFA 4LD5A 4AVPA 1FBQA 2IA1A 1F4KA 5A2QK 1BIBA 2A69F 3Q9VA 3R0AA 5CVIA 5D5WB 1UHWA 4GYGA 2O8XA 3J7AO 2FNPA 5HLIA 5CLSA 1IUYA 3I54A 3P7NA 3HYIA 2PQ8A 4LJZF 4NHJA 5AIQA 4BYYA 2JPBA 4XLPF 4Q47A 1BIAA 2Q2EA 2V1XA 2IW5A 1RUOA 2COMA 1Z05A 3WE2A 1YQAA 1B1BA 4ZYHA 1YS6A 2CFXA 2L02A 4UHTA 3E6CC 2XVCA 1W7PA 5D5VB 3T1BA 3HHGA 2VONA 1H0MA 4IRGA 1XMAA 3K1PA 4OIQF 2NYXA 1QPMA 4G94A 4EM0B 3TDZC 2QBYB 2QWWA 3BP8A 3WTSC 2WC2A 2DPUA 2XKPA 4RB3C 4OU0A 4LGWA 4Q48A 1MJ9A 1UHMA 2F5DA 1WI9A 2P4WA 2NNNA 3KZZA 1QO0D 2BBYA 2YR2A 3FM3A 3R4KA 1U2WA 2QVOA 3QP5A 3GYHX 4UV8A 4I0BA 3LQRA 3C7JA 1G3YA 1RI7A 1FPQA 1SAXA 5D4RA 4K2EA 4S05A 3J81K 5LRSA 4L9NA 3ULQB 5ICEA 4EMSA 5ILSA 1Z91A 3M8FA 1U6GA 3LA7A 2YX7A 3IHUA 3LAJA 4U0WA 5HDNA 3FMSA 2EJRA 1H9GA 4G9YA 3KP5A 1LDKB 4G7ZF 2XROA 3CJNA 1OYIA 3E5XA 4IVNA 2FMYA 3V4GA 4DNCA 3MZYA 3GUDA 2RQPA 3MFKA 2F2EA 1ZN2A 5TRDA 5AONA 5DCFA 4HZFA 1HKSA 4FT8A 1DUXC 4ENNA 4L5JA 4RB2C 3HOTA 5LBQA 2P8TA 3DV8A 5D6FA 1O7LA 3HOSA 3BZ6A 3KEQA 4HF0A 3RPQA 3W6JB 3H3UA 1BI1A 4IJAA 4ESBA 1PP8F 1D8KA 3ZMTA 2RC4A 3R0JA 2QUFA 3EYYA 1YO5C 1SFXA 2UXXA 3ZMVA 2IPQX 1KU9A 2EV5A 4LLGF 1OYYA 4ESJA 4CDGA 2HYFA 3WTUC 3KP2A 2W57A 1MJBA 2KIFA 2HFHA 1FNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CO6 C;  1OR7 A;  2VOP A;  1XDS A;  2L54 A;  1FY7 A;  3V7R A;  2XGX A;  1QGP A;  2UWM A;  3I4P A;  3WTV C;  4XSX F;  1IN5 A;  2A07 F;  3WGI A;  3F8N A;  2F5C A;  4PDK A;  2V79 A;  3GLX A;  2EFO A;  2XRN A;  4M9X A;  1BJA A;  2V1D A;  5AIP A;  4L0Z B;  4MQV A;  1KQ9 A;  3TO9 A;  1J5Y A;  4ZZD A;  5BQT A;  5BPI A;  4HYE A;  1BI3 A;  2E1C A;  4BXU A;  2F5E A;  5LHG A;  4KN4 X;  2DI3 A;  4BQA A;  3ELK A;  4BHB A;  5HLH A;  3I58 A;  3F21 A;  4KDP A;  3QPH A;  3F72 A;  3SZP A;  4KMF A;  3BOQ A;  5D8K B;  3K1N A;  1PP7 U;  2FBI A;  4PGH A;  4IF4 A;  1QNT A;  3KLO A;  3RDI A;  1KU3 A;  3ECH A;  5FLX K;  1K7A A;  4CIC A;  2ACJ A;  2F5F A;  3F6V A;  1Z9C A;  3GVA A;  2P5K A;  3TKY A;  2A68 F;  4UV9 A;  1DDN A;  2FXA A;  2LSO A;  3LA2 A;  5K5O A;  3BY6 A;  3L2C A;  3JAM K;  4LG0 B;  1B59 A;  4EJT A;  4RGS A;  3FZV A;  2Y48 A;  1ZHF A;  2DT5 A;  1T2K A;  2YPR A;  1XMK A;  3RYP A;  2ZNY A;  4UNO A;  4U0Y A;  1YW8 A;  4B09 A;  4M9S A;  4B8X A;  3F8F A;  4EJV A;  1WWX A;  1TNS A;  1IN6 A;  2BV6 A;  2A61 A;  2ZO4 A;  4S04 A;  1HST A;  3GZ5 A;  2V6C A;  3VFZ A;  1RIO H;  2IT0 A;  3HTS B;  4WXD A;  2XAS A;  2WV0 A;  3HRM A;  3WOD F;  2DLL A;  2W24 A;  2OQG A;  1G4D A;  4GO1 A;  1KU7 A;  4I7H A;  2DK5 A;  4KIG A;  1FYK A;  2PFB A;  1V4R A;  4XLN F;  3CUQ B;  2ZBK A;  5CVV A;  3BJO A;  2XAJ A;  5HS9 A;  1DPU A;  1ZLJ A;  4HF2 A;  2P5L C;  4ETS A;  1L3L A;  3OV8 A;  4CGZ A;  1FYL A;  4AD9 A;  4WK8 F;  2VE9 A;  1SD4 A;  2A3S A;  5JFR A;  2VC1 A;  1ZYR F;  4HF1 A;  1S8N A;  3U1D A;  2IJL A;  4CO8 A;  2GXB A;  1RNL A;  2HKX A;  2BGC A;  3ZMD A;  3IRR A;  4YFN F;  3ZN0 A;  2ZME B;  2RV8 A;  2G7H A;  5E1X A;  2STW A;  1CF7 A;  3WTW C;  1IZ1 A;  2TDX A;  1ULY A;  5LHI A;  1EH6 A;  1YYV A;  1KQ0 A;  4G8X A;  3ISP A;  5LGN A;  1HKT A;  3LST A;  2EFW A;  3U2R A;  2RGV A;  1MDM B;  3FMQ A;  2PG4 A;  1Z1D A;  3J80 Z;  4HX8 A;  2EK5 A;  4AIK A;  5FO5 A;  1LQ1 A;  2JSC A;  4A6D A;  2ZNZ A;  4OIN F;  3GFJ A;  3DFG A;  1DP7 P;  4NB5 A;  3VOE A;  2VXZ A;  2D1V A;  5HS8 A;  2IVM A;  1T98 A;  2YX4 A;  2K02 A;  3CO7 C;  2CG4 A;  4Y15 A;  5A2Q Z;  3E97 A;  1R00 A;  4KFC A;  2OZU A;  2D1H A;  1R23 A;  5EEH A;  1O3Q A;  4LLL A;  5H6Q A;  2DW4 A;  4L9T A;  5CYV A;  5DV5 A;  5E1W A;  1T39 A;  1W5T A;  1IN8 A;  2L4A A;  3LAP A;  2FBH A;  3I0T A;  3GX4 X;  1QBJ A;  3KP6 A;  5D4S A;  3WTX C;  1I5Z A;  5ICG A;  4O6J A;  4GXO A;  2RNJ A;  1WQ2 A;  1T6S A;  4QLC U;  2G7U A;  5DCM B;  2Z3Y A;  2H94 A;  1WSU A;  3BRO A;  4FHT A;  3QPT A;  4ZH4 F;  3BPV A;  5FFZ A;  5E18 F;  2XAH A;  1HW5 A;  3Q5F A;  5ERI A;  3HRT A;  2R7F A;  1OPC A;  2P7C B;  4Q5S F;  2HEO A;  1J2X A;  4Q4Z F;  2M1B A;  4RAY A;  3F23 A;  2C6Y A;  1P4X A;  2P7V B;  2HTS A;  4CYD A;  2HR3 A;  2EV0 A;  3I53 A;  4IRH A;  2FRH A;  1HSJ A;  5H6R A;  1IW7 F;  1F9N A;  3TOA A;  4BNC A;  1D8J A;  2FU4 A;  4L9J A;  1B9N A;  1I1G A;  5DUK A;  5JHU A;  3K9T A;  4ON0 A;  3WTY C;  2X4H A;  3T0Y A;  2LF8 A;  3IKV A;  4HDV A;  3P9I A;  3R61 A;  4WXH A;  5IT9 K;  2J5O A;  3M1E A;  3J81 Z;  4U88 A;  4PCQ A;  1S7O A;  4R79 A;  2MBF A;  2DPD A;  4EM1 A;  2HYG D;  2XUB A;  5CJ9 A;  1XCB A;  1YFH A;  2QEN A;  4MGR A;  2D45 A;  3SZT A;  1JE8 A;  3TGN A;  1L0O C;  3BPX A;  3T8T A;  3O3K A;  5K1Y A;  1ZRD A;  4YG2 F;  2GQQ A;  3F8B A;  3I5U A;  1SD7 A;  3HRU A;  4ZZL A;  5K5R A;  3HHH A;  3MAJ A;  4P9U A;  2IA2 A;  2GAU A;  1GHC A;  2HZT A;  2Y75 A;  1UCR A;  3RKW A;  4CXF A;  4U7B A;  4N9I A;  3ZMU A;  5HDK A;  5FD6 A;  3KP4 A;  5EEG A;  3TO6 A;  3V7S A;  2Z99 A;  1GVJ A;  4M6X A;  1IN4 A;  5CVR A;  4YII A;  2G9W A;  3RKY A;  1J0R A;  1ONV A;  4ENM A;  3TDU C;  4IRI A;  2XAQ A;  2GA1 A;  1FC3 A;  1MDM A;  1ZRE A;  3I71 A;  4M73 A;  1YW7 A;  2K86 A;  4EVI A;  3AAF A;  3K69 A;  3D0S A;  3ZMS A;  3E5U A;  1BC7 C;  3MQ0 A;  3FWE A;  5BMZ A;  2ISY A;  5HOO A;  1J75 A;  3N4M A;  1BN5 A;  1Z6T A;  4KT5 C;  4HW0 A;  4M71 A;  3W6K B;  4YFX F;  2DQL A;  2GWR A;  2V9V A;  1XGS A;  3RYR A;  1AOY A;  1YS7 A;  4OIO F;  3MWM A;  2DBB A;  5LHH A;  4CZZ A;  2MD5 A;  3QAH A;  3L00 A;  1MKM A;  5J8F A;  5BPD A;  2VC0 A;  4KIB A;  1XGO A;  2QQ9 A;  4AIH A;  1SD6 A;  5E17 F;  4KN7 X;  2ESN A;  2NRA C;  5DDG A;  2MH2 A;  2A5Y B;  2W25 A;  2X0L A;  2PBI A;  1T0F A;  3HIF A;  1MJA A;  1D5V A;  3D5L A;  4M72 A;  2CWE A;  1I1S A;  3OOP A;  2HQN A;  1F1Z A;  2CO5 A;  2KRF A;  4EV0 A;  4YIF A;  1BBY A;  2IA0 A;  3LWF A;  1XDU A;  3H3Z A;  4F7Z A;  1UST A;  3GWZ A;  3O2P E;  5L3E A;  2KJC A;  3GF2 A;  1Z6R A;  4KA4 A;  2DTR A;  2O0Y A;  2M45 A;  3GFL A;  1TTY A;  2RN7 A;  3QU6 A;  2RDP A;  3K2Z A;  4LB6 B;  1IN7 A;  5CVJ A;  3FX3 A;  2NAZ A;  5CVU A;  4MTD A;  3QRF F;  4CHU A;  2MC3 A;  1ON2 A;  2FF4 A;  3L9F A;  1ZGA A;  4H0E A;  5DD4 A;  3BJA A;  1FZP B;  2VOO A;  3R60 A;  5HDG A;  1R1U A;  2YSR A;  2QBY A;  1XSD A;  1QQI A;  5FLX Z;  4JBA A;  3HSR A;  5E8G A;  4G7O F;  1P6R A;  3EUH A;  2FA5 A;  4HDU A;  3CUQ C;  2VBW A;  1LJ9 A;  5D8L B;  4TV7 A;  2M87 A;  3ABU A;  3I59 B;  4U7D A;  3P9C A;  4G6Q A;  4LK1 F;  2HDC A;  1HQC A;  3QOP A;  3T5X A;  1TQP A;  4FX4 A;  2LNB A;  1QZZ A;  3P9K A;  3IKT A;  3RPU A;  3DXJ F;  2VBZ A;  4JK1 X;  1Y0U A;  2D2W A;  4P5O A;  4HV5 A;  1GXQ A;  4A0Y A;  2FQ3 A;  4WWC A;  1LDJ A;  1YIO A;  3L7W A;  1FX7 A;  3ZP5 A;  1XB4 A;  3FHZ A;  4RGX A;  1FP2 A;  3Q9S A;  1KA8 A;  3DPT A;  3ZQ7 A;  1FOK A;  4L5I A;  1KYW A;  4HAM A;  3B73 A;  1TQI A;  1FBS A;  2IRF G;  3JSO A;  3V8L A;  4GCV A;  2QYO A;  1KU2 A;  2OBP A;  4OIR F;  1SFE A;  3LQQ A;  1W7P B;  3WGG A;  2ETH A;  2WTE A;  3IRQ A;  4WF2 A;  2O61 A;  5HVQ C;  2L3D A;  2E1N A;  1FT9 A;  5ILV A;  1G6N A;  1O7F A;  2AXL A;  1BI2 A;  1ZG5 A;  1F5T A;  2XAF A;  2M30 A;  1RUN A;  3CLO A;  3SQN A;  4MQ9 F;  4NQW A;  3WTZ A;  4O5V A;  1UFM A;  1XN7 A;  2ESH A;  1R1V A;  4ZYE A;  3COA C;  2ELH A;  1SFU A;  2VT3 A;  4L9V A;  1PDN C;  2H6C A;  4IHT A;  4KIC A;  2VN2 A;  4AWX B;  4I01 A;  2K4B A;  3SXY A;  5LEK A;  2FBK A;  3ZMZ A;  5D5X B;  4EQQ A;  2HQR A;  3FF5 A;  1K6O A;  2HS5 A;  4HOB A;  2DFI A;  4EGY A;  4XBF A;  1E2X A;  1R22 A;  3QU3 A;  4AIJ A;  4LFU A;  1T38 A;  3I64 A;  4BAY A;  2MLK A;  2EFP A;  5FGM A;  3B02 A;  2EWN A;  2YU3 A;  1I27 A;  5JR3 A;  2H27 A;  2LDU A;  3VEP A;  1Z7U A;  4PGG A;  3F22 A;  1FP1 D;  4HLX A;  2FNA A;  3IL2 A;  1A04 A;  1IRF A;  4KUM A;  4A6E A;  3WGH A;  4RB1 A;  1O3S A;  3S2W A;  1TNT A;  2MLG A;  5K5Q A;  4OMZ A;  4MEY F;  4ASN A;  2P6T A;  1ON1 A;  3KE2 A;  2ADU A;  2Z9O A;  1S7A A;  2OZ6 A;  5ICF A;  2KIM A;  2EFQ A;  1WKM A;  4UXN A;  1IAW A;  4L0Y B;  1G3W A;  1OMI A;  4BHP A;  3PQK A;  4OOI A;  4HV6 A;  3F8C A;  1S29 A;  1NHA A;  2FSW A;  2B0L A;  4WX9 A;  3FXQ A;  4M74 A;  4I02 A;  2K4J A;  3FXU A;  1K79 A;  4UVB A;  3M7G A;  1XGN A;  1P2F A;  5DEQ A;  4RB0 A;  3MEX A;  2DO7 A;  3ZPL A;  3CDH A;  1FSH A;  1BI0 A;  3WG9 A;  2Y0M A;  4LG0 A;  2HOE A;  4WXC A;  4HX7 A;  4A2U A;  4R8H A;  1P4A A;  3G73 A;  4ENJ A;  3K0L A;  2BE5 F;  3RKX A;  2GXG A;  3U9G A;  2QQB A;  2L4M A;  4KYW A;  1GXP A;  3E5Q A;  5JI6 A;  1FSE A;  3TO7 A;  1UB9 A;  2PMH A;  3REO A;  2KIU A;  1LDD A;  4I0A A;  4HLY A;  1KYZ A;  2CSO A;  3ERE D;  2NS0 A;  5LLQ A;  4IHS A;  4I2O A;  1U78 A;  2EA2 A;  2PLY A;  2XHK A;  5KVR A;  4KMU X;  1VTN C;  3DP7 A;  4XSZ F;  1H9T A;  4G6D A;  4OIP F;  5IT9 Z;  1TW3 A;  4LMY A;  4HQM A;  4HX4 A;  1MGT A;  2PN6 A;  2QQA A;  4LK0 F;  3CUQ A;  1XSX A;  4ESF A;  3C3W A;  5BOX A;  3CTA A;  2OAZ A;  3BDD A;  2O3F A;  2PMU A;  2CGP A;  3E6D A;  1JHH A;  2PEX A;  3RI4 A;  4RGR A;  1EV7 A;  2K7L A;  3HTU A;  2VBY A;  4M9Z A;  1U3E M;  4EM2 A;  3VOD A;  5L3G A;  2M8E A;  4EJO A;  2PJP A;  3M9A A;  3GFM A;  1IXR C;  2ZCW A;  5ED4 A;  3M8E A;  1R58 A;  4N9H A;  4Z2Y A;  1IXS B;  4U0V A;  2AS5 F;  2O03 A;  1REP C;  2ZME A;  4A0X A;  2E7X A;  2BYV E;  4HQE A;  3RIR A;  5F6F A;  1EH8 A;  5J8C A;  4FX0 A;  1O3T A;  5E20 A;  3KP7 A;  1ZLK A;  3F8M A;  2V1U A;  1P92 A;  4RGU A;  1J7K A;  4M6Y A;  2VBX A;  2MA3 A;  1LB2 A;  2DK8 A;  3L09 A;  1XGM A;  4A0Z A;  4D0P A;  2RKH A;  2H09 A;  3TOB A;  1K78 B;  2JPC A;  1R36 A;  2ZJ2 A;  4RAZ A;  4PZJ A;  3JSP A;  1TW2 A;  1XCV A;  5L3C A;  4UVC A;  3IC7 A;  4UVA A;  3GO5 A;  1TQM A;  3DF8 A;  4ZYD A;  1FWZ A;  4HA8 A;  1U5T C;  3GXO A;  5F64 A;  3LFK A;  2W84 A;  3ZN1 A;  4HBL A;  1SMT A;  4WCG A;  4GYI A;  1XSV A;  3BJ6 A;  5D6E A;  2M5W A;  2UXN A;  1IXC A;  2FOK A;  2ZKZ A;  2H6B A;  3HSF A;  1G3S A;  3O6B B;  2OD5 A;  2DU9 A;  2QLZ A;  4O3M A;  2IP2 A;  3KZY A;  1BOA A;  1RZ4 A;  2JTV A;  4A12 A;  1TBX A;  1FLI A;  4KNY A;  4P96 A;  4Y13 A;  5IT3 A;  2LF7 A;  1R7J A;  3V7C A;  4LLN A;  2EFN A;  2GZW A;  5DCM A;  3ROU A;  2R7D A;  1ZAR A;  4XRF A;  4QWQ A;  3NRV A;  1CF7 B;  3KFW X;  3WE3 A;  1W7P D;  2BEO A;  2GA2 A;  5H20 A;  1STZ A;  1W5S A;  2KJB A;  5LGT A;  1LEA A;  3ML6 A;  3HUG A;  1MD0 A;  4ENK A;  3DEU A;  3SFZ A;  4ZYG A;  3DQV C;  1R5G A;  2DAO A;  2VOD A;  3IWF A;  2OU2 A;  2UZK A;  3K1M A;  2QZ8 A;  1S6L A;  2GIV A;  2VE8 A;  3DKW A;  3VB2 A;  1P4W A;  4BHC A;  1HKQ A;  2HTJ A;  2ISZ A;  3GFI A;  3RJP A;  4I98 B;  1C0W A;  1YG2 A;  3GW2 A;  2JT1 A;  1U5T B;  3JTG A;  4I09 A;  5J6X A;  1R5H A;  3TQN A;  3KET A;  2LKP A;  4A5M A;  4EJW A;  3FM5 A;  3ABT A;  2RVC A;  2CW0 F;  5L3B A;  5LEJ A;  3KP3 A;  4P9F A;  1SMY F;  3JAM Z;  2W85 A;  4Y17 A;  1USS A;  1JGS A;  4IXA A;  5E1Z B;  2E7W A;  3IWZ A;  2Q8K A;  5FB2 A;  2NNY A;  3WTT C;  2HKO A;  1ZRF A;  1B4A A;  5E8I A;  5F1R A;  4MTE A;  2FML A;  1AWC A;  3MCZ A;  3ECO A;  3GEZ A;  1HW1 A;  3GZ6 A;  1CGP A;  1U8R A;  2P6S A;  3PFI A;  3KEO A;  4R1H A;  2Q0O A;  2R3S A;  3NQO A;  1DPR A;  1YW9 A;  3BWG A;  2J5P A;  1KQ8 A;  4E70 A;  6PAX A;  4IPA A;  1EH7 A;  3V8J A;  4GGG A;  4EGZ A;  3HSE A;  5FFX A;  3JW4 A;  4UUV A;  1LNW A;  1YTY A;  3QP6 A;  1HBX G;  3KLN A;  3WU1 B;  2Z5U A;  1K78 A;  2JZY A;  3NEU A;  1ZAO A;  3F6O A;  2XKO A;  1JXS A;  4BH9 A;  3E6B A;  4MHG A;  2EB7 A;  1ZG3 A;  3C18 A;  2HGC A;  3FXR A;  4OMY A;  2WWY A;  2QM3 A;  1ZRC A;  2FE3 A;  4MNU A;  5HS7 A;  1ODD A;  1LVA A;  2HWV A;  2A6E F;  5D5U B;  1XD7 A;  5DYM A;  2EV6 A;  2CQK A;  2L01 A;  1O3R A;  3E3V A;  5ICC A;  2ZFW A;  4L18 B;  2XAG A;  3WU0 A;  1JHF A;  3RTR A;  5TJJ A;  5L3F A;  5FD5 A;  5JVT A;  1BM9 A;  2XIG A;  2CYY A;  1O57 A;  3G3Z A;  2O6G E;  4LB5 A;  3E6M A;  1TLH B;  3T8R A;  5DD8 A;  3MZH A;  3R6S A;  3KCC A;  1MZB A;  4N0B A;  1HW2 A;  3PQJ A;  1FBU A;  1D3Y A;  5LRR A;  1SD5 A;  5ILU A;  1E17 A;  1B6A A;  1LEB A;  1S3J A;  2KKO A;  4KIF A;  3HRS A;  2OA4 A;  1FYM A;  3LA3 A;  3N97 A;  1PUE E;  2FEZ A;  3EQL F;  2VT2 A;  1J59 A;  4P55 A;  4MEX F;  1YLF A;  1Q1H A;  3H92 A;  5HLG A;  1B9M A;  1IF1 A;  2EA4 A;  1W4M A;  2K27 A;  2DQR A;  2A6H F;  1KGS A;  1QZY A;  3SHF A;  1J9I A;  2MH9 A;  1ZG1 A;  5KK1 A;  4A5N A;  2P5V A;  1U5T A;  1OKR A;  1OYW A;  4EJU A;  5LGU A;  3CUO A;  3JTH A;  2OQR A;  2ZXJ A;  3EYI A;  3J80 K;  1BC8 C;  4RS8 A;  5BS6 A;  3C1D A;  3EDP A;  3V8K A;  1WRJ A;  3FMR A;  5L3D A;  2Z33 A;  2JRT A;  1IRG A;  4G7H F;  2STT A;  1I6X A;  3I59 A;  3DPL C;  1G3T A;  5DUI A;  1ZGJ A;  1R1T A;  1HXD A;  2XV4 S;  1V3F A;  4DQ2 A;  1X3U A;  1ZH5 A;  3F3X A;  2PI0 A;  3EET A;  4YFK F;  4JQF A;  4LD5 A;  4AVP A;  1FBQ A;  2IA1 A;  1F4K A;  5A2Q K;  1BIB A;  2A69 F;  3Q9V A;  3R0A A;  5CVI A;  5D5W B;  1UHW A;  4GYG A;  2O8X A;  3J7A O;  2FNP A;  5HLI A;  5CLS A;  1IUY A;  3I54 A;  3P7N A;  3HYI A;  2PQ8 A;  4LJZ F;  4NHJ A;  5AIQ A;  4BYY A;  2JPB A;  4XLP F;  4Q47 A;  1BIA A;  2Q2E A;  2V1X A;  2IW5 A;  1RUO A;  2COM A;  1Z05 A;  3WE2 A;  1YQA A;  1B1B A;  4ZYH A;  1YS6 A;  2CFX A;  2L02 A;  4UHT A;  3E6C C;  2XVC A;  1W7P A;  5D5V B;  3T1B A;  3HHG A;  2VON A;  1H0M A;  4IRG A;  1XMA A;  3K1P A;  4OIQ F;  2NYX A;  1QPM A;  4G94 A;  4EM0 B;  3TDZ C;  2QBY B;  2QWW A;  3BP8 A;  3WTS C;  2WC2 A;  2DPU A;  2XKP A;  4RB3 C;  4OU0 A;  4LGW A;  4Q48 A;  1MJ9 A;  1UHM A;  2F5D A;  1WI9 A;  2P4W A;  2NNN A;  3KZZ A;  1QO0 D;  2BBY A;  2YR2 A;  3FM3 A;  3R4K A;  1U2W A;  2QVO A;  3QP5 A;  3GYH X;  4UV8 A;  4I0B A;  3LQR A;  3C7J A;  1G3Y A;  1RI7 A;  1FPQ A;  1SAX A;  5D4R A;  4K2E A;  4S05 A;  3J81 K;  5LRS A;  4L9N A;  3ULQ B;  5ICE A;  4EMS A;  5ILS A;  1Z91 A;  3M8F A;  1U6G A;  3LA7 A;  2YX7 A;  3IHU A;  3LAJ A;  4U0W A;  5HDN A;  3FMS A;  2EJR A;  1H9G A;  4G9Y A;  3KP5 A;  1LDK B;  4G7Z F;  2XRO A;  3CJN A;  1OYI A;  3E5X A;  4IVN A;  2FMY A;  3V4G A;  4DNC A;  3MZY A;  3GUD A;  2RQP A;  3MFK A;  2F2E A;  1ZN2 A;  5TRD A;  5AON A;  5DCF A;  4HZF A;  1HKS A;  4FT8 A;  1DUX C;  4ENN A;  4L5J A;  4RB2 C;  3HOT A;  5LBQ A;  2P8T A;  3DV8 A;  5D6F A;  1O7L A;  3HOS A;  3BZ6 A;  3KEQ A;  4HF0 A;  3RPQ A;  3W6J B;  3H3U A;  1BI1 A;  4IJA A;  4ESB A;  1PP8 F;  1D8K A;  3ZMT A;  2RC4 A;  3R0J A;  2QUF A;  3EYY A;  1YO5 C;  1SFX A;  2UXX A;  3ZMV A;  2IPQ X;  1KU9 A;  2EV5 A;  4LLG F;  1OYY A;  4ESJ A;  4CDG A;  2HYF A;  3WTU C;  3KP2 A;  2W57 A;  1MJB A;  2KIF A;  2HFH A;  1FNN A; 
#chains in the Genus database with same CATH topology
 3CO6 C;  1OR7 A;  2VOP A;  1XDS A;  2KP6 A;  2L54 A;  3HC7 A;  3CC2 I;  5C4J J;  1FY7 A;  3V7R A;  2XGX A;  5IP6 A;  1P7J A;  1QGP A;  2UWM A;  5J1R A;  3AL0 B;  1VQP I;  2IXS A;  3I4P A;  3WTV C;  1GLN A;  4XSX F;  1IN5 A;  2A07 F;  3L2Q A;  3WGI A;  3F8N A;  5FKK A;  2F5C A;  4PDK A;  3OIQ A;  2A5W A;  2LRE A;  3GTQ J;  3OIP A;  2V79 A;  4HST A;  3GLX A;  1VQK I;  2EFO A;  2XRN A;  2CUJ A;  4M9X A;  1VI0 A;  3TMO A;  4XRS A;  3L2U A;  1BJA A;  4Y52 J;  3WHC A;  1I39 A;  2ZB9 A;  4CCO A;  4D5C A;  2DA1 A;  2VJ5 A;  9ANT A;  2LTP A;  2V6E A;  4XLE A;  2GXA A;  2V1D A;  4II2 A;  5AIP A;  4BE1 A;  1OCR H;  4BY7 J;  3EUA A;  1GDT A;  4DW6 A;  2F48 A;  4L0Z B;  4MQV A;  4Z6Y A;  1KQ9 A;  4ZJZ A;  3TO9 A;  1J5Y A;  1VFC A;  2ZXH A;  4ZZD A;  5BQT A;  5BPI A;  1MSF C;  4HYE A;  3OR1 C;  3C2G A;  1BI3 A;  2E1C A;  4BXU A;  2F5E A;  5LHG A;  4KN4 X;  3OSF A;  5B3S H;  2DI3 A;  1SVL A;  1RKW A;  2L9R A;  4BQA A;  1FMV A;  3ELK A;  4BHB A;  4XK4 A;  5HLH A;  3OYC A;  3I58 A;  3F21 A;  4IHY A;  1F36 A;  4KDP A;  3QPH A;  3OSG A;  4A3D J;  4V2F A;  3F72 A;  1VQN I;  3SZP A;  2OF7 A;  4KMF A;  3BOQ A;  5D8K B;  1D1C A;  5K7H A;  1HF0 A;  3FKJ A;  3K1N A;  3BG9 A;  1PP7 U;  3VSL A;  2OJE D;  2FBI A;  3TL4 X;  3H5A A;  4H4K C;  2LKS A;  4PGH A;  4IF4 A;  1QNT A;  1S5L C;  3KLO A;  2LH9 A;  2M2E A;  3RDI A;  1KU3 A;  3TP0 A;  3HG9 A;  3OYI A;  3HOY J;  3ECH A;  1Y8R B;  5FLX K;  2K9N A;  1K7A A;  4BBS J;  4CIC A;  2NVT J;  2ACJ A;  2F5F A;  3A2K A;  1R5I D;  3F6V A;  1Z9C A;  3GVA A;  2P5K A;  3TKY A;  2A68 F;  4UV9 A;  2NOG A;  1DDN A;  2FXA A;  2LSO A;  1TWG J;  2ELK A;  3BY6 A;  2M9H A;  3LA2 A;  2NVU B;  5K5O A;  3JAM K;  3L2C A;  4LG0 B;  3FDY A;  4HSR A;  1B59 A;  2K9Q A;  4RM2 A;  4EJT A;  4RGS A;  3BZC A;  3FZV A;  2WAD A;  1X3Z B;  2DOD A;  4IX7 A;  4E7H A;  3OMY A;  3PNT A;  1ZR4 A;  2Y48 A;  1IDY A;  3WHB A;  1ZHF A;  2WB1 A;  1W1W E;  4GDF A;  2DT5 A;  3HXL A;  1T2K A;  2YPR A;  4QIW N;  1XMK A;  3RYP A;  2B7E A;  2BVL A;  2V26 A;  2JA7 J;  2ZNY A;  1X1A A;  4UNO A;  4U0Y A;  2XF7 A;  1YW8 A;  4B09 A;  4M9S A;  4B8X A;  1DP3 A;  3F8F A;  1WHU A;  3A03 A;  4EJV A;  4XLH A;  4N4N B;  4F52 A;  1WWX A;  5DTD A;  1TNS A;  2E36 A;  1IN6 A;  2M8G X;  1GV2 A;  2WAQ A;  2BV6 A;  3H36 A;  2A61 A;  4BJ5 C;  2ZO4 A;  4S04 A;  3HM5 A;  5EDN A;  2DXI A;  1HST A;  3FBN B;  4E7S A;  3GZ5 A;  2V6C A;  3CJQ B;  3VFZ A;  1RIO H;  4A3E J;  4PFO A;  2JSP A;  2IT0 A;  1WJF A;  3HTS B;  4WXD A;  1UHS A;  5F0H A;  3LSM A;  2XAS A;  3DLA A;  4CUG A;  2WV0 A;  1A31 A;  1A5J A;  2X48 A;  3HRM A;  3WOD F;  2DLL A;  2W24 A;  2OQG A;  3BR0 A;  3DLL F;  2E35 A;  2KPM A;  2F4I A;  1G4D A;  3BG7 A;  1JTY A;  4GO1 A;  1T33 A;  1KU7 A;  4I7H A;  4XLA A;  2DK5 A;  4KT6 A;  4KIG A;  4IHW A;  1FYK A;  4HPQ A;  1WFX A;  2PFB A;  1O4X A;  3VPR A;  1V4R A;  4XLN F;  2LY9 A;  1U8B A;  3CUQ B;  2ZBK A;  5CVV A;  4CYC A;  3BJO A;  2W7N A;  2XAJ A;  5HS9 A;  1T95 A;  3JRC A;  3FBI B;  1DPU A;  3W3C A;  3LMM A;  1ZLJ A;  4HF2 A;  2P5L C;  4ETS A;  1L3L A;  2BY2 A;  2MW8 A;  3OV8 A;  2KMU A;  2VB6 A;  4CGZ A;  4NC6 A;  2E60 A;  4AID A;  1E3P A;  1FYL A;  4AD9 A;  4PFP A;  4WK8 F;  5M5W J;  2DJI A;  2H8W A;  2VE9 A;  1SD4 A;  2ECB A;  2HQ5 A;  2XDV A;  3QPS A;  2A3S A;  5JFR A;  2VC1 A;  3DU6 A;  3G2B A;  2VKV A;  5BNG A;  1ZYR F;  5FKN A;  1NG6 A;  3OS0 A;  3ZGK A;  4HF1 A;  3S3O A;  1WI3 A;  1LFB A;  2VXD A;  1S8N A;  3U1D A;  2IJL A;  3K7A J;  2DA2 A;  3M4O J;  4CO8 A;  2GXB A;  1RNL A;  2HKX A;  2BGC A;  1RES A;  3ZMD A;  4BXX J;  2CQN A;  3IRR A;  3TBI A;  4YFN F;  3ZN0 A;  3SDB A;  2YS9 A;  4RAF A;  4QPO A;  2ZME B;  2R5Z A;  1UAA A;  2RV8 A;  2G7H A;  3RQ4 A;  5E1X A;  4IOA F;  2MGQ A;  2STW A;  4QPQ A;  1MBG A;  1CF7 A;  3WTW C;  2AQF A;  2XSJ C;  1IZ1 A;  2TDX A;  2ZJR F;  1ULY A;  2KQR A;  1MMA A;  3NWS A;  1EH6 A;  5LHI A;  1YYV A;  1KQ0 A;  4G8X A;  3OYK A;  4IHV A;  4BJ6 C;  4IL6 C;  4BAC A;  3ISP A;  4BEH B;  4C2U A;  5LGN A;  1HKT A;  3LST A;  2EFW A;  3RSN A;  2WB1 N;  2JRM A;  3U2R A;  1JT0 A;  2RGV A;  2Z16 A;  4HRI A;  2IGK A;  1MDM B;  3DU5 A;  3FMQ A;  1WGX A;  2MAB A;  2PG4 A;  1Z1D A;  3J80 Z;  4HX8 A;  2EK5 A;  4NDL A;  4BJT A;  4RDU A;  4AIK A;  1YIJ I;  1RRJ A;  3H0D A;  4YEJ A;  5FO5 A;  1LQ1 A;  2JSC A;  4F55 A;  3F0C A;  2BW3 B;  2WAQ N;  4A6D A;  2ECC A;  2ZNZ A;  4OIN F;  3GFJ A;  3JRA A;  1T8I A;  3D5R C;  3DFG A;  2I10 A;  1DP7 P;  1ZKG A;  3HL2 A;  4NB5 A;  3S15 J;  1VQ8 I;  3VOE A;  3H5R A;  2VXZ A;  2D1V A;  5HS8 A;  2IVM A;  1T98 A;  4D1Q A;  2YX4 A;  5E3L A;  2LKX A;  3VYS B;  4CCL A;  2LD5 A;  2K02 A;  3CO7 C;  1I6H J;  1LFU P;  3GLL A;  2CG4 A;  1RR8 C;  3LSP A;  3ZQL A;  4Y15 A;  5A2Q Z;  3E97 A;  1R00 A;  3NAU A;  2W4S A;  2GLO A;  4KFC A;  2OZU A;  3M1C A;  1DU6 A;  3DBH B;  2D1H A;  5JVG F;  1R23 A;  3OOU A;  2BHZ A;  3BQY A;  5EEH A;  1Y0N A;  2W00 A;  1O3Q A;  4LLL A;  5H6Q A;  2DW4 A;  4L9T A;  2FQ4 A;  5CYV A;  5DV5 A;  5E1W A;  1T39 A;  3CP8 A;  1W5T A;  1IN8 A;  2L4A A;  2LP0 A;  3LAP A;  2FBH A;  2CH0 A;  3I0T A;  3GX4 X;  1Y8Q B;  4J01 A;  1QBJ A;  3CD6 I;  1XC5 A;  2QSF X;  3KP6 A;  1XX5 A;  5EJC A;  5D4S A;  4CCN A;  1I5Z A;  3WTX C;  5ICG A;  4O6J A;  4GXO A;  3HB9 A;  2RNJ A;  2LK2 A;  1ZEL A;  1WQ2 A;  1ETW A;  1T6S A;  1I50 J;  1SAU A;  4QLC U;  2G7U A;  5DCM B;  3A01 B;  2Z3Y A;  2H94 A;  1WSU A;  3BRO A;  4FHT A;  2TCT A;  2WAF A;  3QPT A;  4ZH4 F;  3BPV A;  5FFZ A;  4LOC A;  5E18 F;  4QSH A;  2E71 A;  1IRX A;  4DBR A;  3L2V A;  2XAH A;  4PJ0 C;  5GPA A;  1G59 A;  1ETV A;  3H9Q A;  1Z0X A;  3BG6 A;  1V5F A;  3LL7 A;  4XOR A;  1HW5 A;  3Q5F A;  5ERI A;  3HRT A;  2R7F A;  5M3M J;  4GFB A;  1OPC A;  3ZRG A;  2P7C B;  4Q5S F;  1TWF J;  2DMU A;  4I99 C;  2JUC A;  2OTL I;  1BW5 A;  2E2H J;  4CZC A;  4LIV A;  5IOY A;  1U0J A;  1Z67 A;  4A93 J;  2HEO A;  2VL8 A;  2XF6 A;  3KPH A;  4UY8 I;  1J2X A;  2ID3 A;  4Q4Z F;  1FOX A;  3FIS A;  2GIZ A;  2M1B A;  4RAY A;  3AKZ A;  3F23 A;  3UKG A;  2C6Y A;  1P4X A;  1Z77 A;  5B5E C;  1ZR2 A;  2P7V B;  2HTS A;  2DDB A;  1MNE A;  4CYD A;  2HR3 A;  2EV0 A;  3I53 A;  2V4J C;  4IRH A;  2FRH A;  4ZYA A;  2CS3 A;  3G1M A;  1HSJ A;  5H6R A;  1IW7 F;  1X1B A;  2ME0 A;  1F9N A;  5EEA A;  5CKT A;  3AG4 H;  3TOA A;  4BNC A;  1QPI A;  1D8J A;  2FU4 A;  4L9J A;  1LUJ B;  3ZCO A;  1B9N A;  4NNJ A;  1I1G A;  5DUK A;  3LNQ A;  3LFU A;  4XNF A;  5JHU A;  1QU3 A;  3K9T A;  2CV2 A;  2A6T A;  4ON0 A;  3WTY C;  2JVH A;  2X4H A;  3T0Y A;  2LF8 A;  3IKV A;  4E6K G;  3OYE A;  3FHN A;  4HDV A;  1D0X A;  3P9I A;  3R61 A;  4WXH A;  1JUS A;  1FEX A;  4B44 A;  2PJR B;  2OV7 A;  2R7Z J;  5IT9 K;  2J5O A;  3M1E A;  3J81 Z;  3HEF A;  4U88 A;  4BKX A;  4PCQ A;  5DM7 F;  1S7O A;  4R79 A;  2MBF A;  2WV1 A;  2DPD A;  4EM1 A;  5GTI C;  2HYG D;  2XUB A;  5CJ9 A;  5E3O A;  1XCB A;  5FKO A;  3CCS I;  1YFH A;  2QEN A;  4ZDL A;  2XRL A;  2JJ7 A;  4MGR A;  2D45 A;  2VPL A;  3SZT A;  1JE8 A;  1YOV B;  3I9V 2;  3TGN A;  1L0O C;  3BPX A;  3T8T A;  2AQE A;  3O3K A;  3MKL A;  5K1Y A;  1ZRD A;  4YG2 F;  1EKE A;  3QPL A;  4OAZ A;  3K70 D;  2GQQ A;  3F8B A;  1NG7 A;  3I5U A;  1QHH D;  4HG2 A;  1DGW Y;  2M4G A;  4BUP A;  2BY1 A;  2CUZ A;  2DYR H;  1SD7 A;  2FOW A;  3DPU A;  3HRU A;  4IEJ A;  2LBF B;  4ZZL A;  5E3N A;  3J7Z I;  1WJC A;  5K5R A;  3HHH A;  3MAJ A;  4P9U A;  2N8G A;  4D5F A;  2IA2 A;  2Z1D A;  5K7Z A;  1MMG A;  2GAU A;  1NK2 P;  1GHC A;  2L9N A;  4XLC A;  1ERD A;  2HOS A;  3HOZ J;  3S32 A;  2HZT A;  3BCA A;  2Y75 A;  3MKY B;  1UCR A;  4G6T B;  4D7M A;  3EUK L;  3RKW A;  3CLQ A;  1E0E A;  4CXF A;  5GAH J;  4U7B A;  4N9I A;  2Y30 A;  3ZMU A;  3JRG A;  5HDK A;  4HNV A;  3AG1 H;  4I6Z A;  4XKV A;  5FD6 A;  1OCZ H;  3KP4 A;  1RKT A;  3I3L A;  5EEG A;  1OCT C;  3TO6 A;  2K3P A;  2HU9 A;  2VQH A;  3V7S A;  2Z99 A;  3AL0 C;  1GVJ A;  3BTL A;  4M6X A;  2OPT A;  1IN4 A;  5CVR A;  3S93 A;  3CC7 I;  1IV6 A;  2BZT A;  3BQZ A;  4YII A;  2G9W A;  2FJ1 A;  2ZJQ F;  3NAR A;  3RKY A;  3O8G A;  3P5J A;  1J0R A;  1ONV A;  2M7B A;  1PUF A;  1M1E B;  4ENM A;  2QSH X;  3TDU C;  4IRI A;  2IGM A;  2XAQ A;  2GA1 A;  1FC3 A;  1X1P A;  4YEL A;  1MDM A;  1ZRE A;  1U9O A;  3I71 A;  4M73 A;  1HOM A;  1YW7 A;  2K86 A;  4EVI A;  3AAF A;  3K69 A;  3D0S A;  3ZMS A;  1R4M B;  3Q0V A;  3E5U A;  3CP2 A;  4F3Q A;  3MQ0 A;  1BC7 C;  3FWE A;  5BMZ A;  3GTL J;  2ISY A;  5HOO A;  1J75 A;  3N4M A;  1A6Q A;  2BW3 A;  2R92 J;  5EGO B;  1BN5 A;  1W0T A;  3K4B A;  1ETO A;  1Z6T A;  4KT5 C;  2DFH A;  2R5Y A;  4HW0 A;  4M71 A;  3W6K B;  5DM6 F;  2VKE A;  1BW6 A;  4YFX F;  2CQQ A;  1JUM A;  2DQL A;  3M8J A;  2GWR A;  4M3D A;  1YJN I;  2V9V A;  1OCP A;  1XGS A;  3RYR A;  2ZXI A;  1AOY A;  1YS7 A;  2X6O A;  4OIO F;  3MWM A;  1DGR M;  5F0F A;  2DBB A;  5LHH A;  4RM3 A;  4CZZ A;  2BY3 A;  2B9S A;  2MD5 A;  3QAH A;  3L00 A;  1FJL A;  4CCJ A;  1MKM A;  1JTX A;  3ZQH A;  5J8F A;  2EPF A;  5BPD A;  2E34 A;  2VC0 A;  4AC0 A;  1MBK A;  3S1M J;  4Y33 A;  4KIB A;  1K83 J;  1XGO A;  2QQ9 A;  2XGC A;  4AIH A;  3VYT B;  1SD6 A;  1MMS A;  3H0G J;  5E17 F;  1FIP A;  4KN7 X;  2ESN A;  2EIK H;  2NRA C;  3PNY A;  4BY1 J;  2B63 J;  2NVQ J;  5DDG A;  3SJM A;  2OCE A;  2MH2 A;  2A5Y B;  2W25 A;  3C2H A;  4IZZ A;  3G6E I;  3VDX A;  2Y9Y A;  2F4O B;  1D1B A;  2X0L A;  3DBL B;  2KIS A;  2PBI A;  1A36 A;  1T0F A;  2LFB A;  3TW6 A;  3HIF A;  1MJA A;  1D5V A;  3D5L A;  4M72 A;  3CES A;  2CWE A;  1I1S A;  2XPV A;  3OOP A;  2VUM J;  2G0E A;  1JKO C;  3HPH A;  2HQN A;  3G1L A;  1F1Z A;  2CO5 A;  3CJT B;  2WBM A;  5JLX A;  2EIM H;  2KRF A;  4EV0 A;  3A01 A;  4YIF A;  1BBY A;  2IS1 A;  2IA0 A;  3LWF A;  1IGN A;  1XDU A;  3H3Z A;  4F7Z A;  2UUZ A;  1UST A;  2DJN A;  3GWZ A;  3O2P E;  5L3E A;  2KJC A;  4BBR J;  1PJR A;  3GF2 A;  2CU7 A;  1Z6R A;  2K40 A;  3SDG A;  4KA4 A;  1JKR C;  1VQM I;  2VQL A;  5J4Y A;  1PVE A;  2DTR A;  2O0Y A;  1JGG A;  2M45 A;  1FOW A;  1TTY A;  2RN7 A;  3GFL A;  3SEZ A;  3QU6 A;  4F93 B;  1HA8 A;  2RDP A;  3K2Z A;  4LB6 B;  1TWH J;  4RLQ A;  2VLA A;  1IN7 A;  5CVJ A;  3BG3 A;  2L9S A;  2NAZ A;  3FX3 A;  4ZC3 A;  3G4S I;  4IQJ A;  3OS2 A;  5CVU A;  4MTD A;  1MBF A;  3SFI A;  3QRF F;  1I3Q J;  5HNH A;  4HNT A;  4CHU A;  2MC3 A;  3BZK A;  5EG0 B;  1ON2 A;  2FF4 A;  3H9G A;  3L9F A;  1WCM J;  4II3 A;  1ZGA A;  4H0E A;  1BR4 A;  1RR7 A;  1V55 H;  2QGU A;  5DD4 A;  4AUX A;  3OYJ A;  3BJA A;  1FZP B;  2QKM B;  1QVU A;  2VOO A;  3M07 A;  3R60 A;  4I76 A;  5HDG A;  1R1U A;  2YSR A;  2O9L A;  4BE0 A;  2QBY A;  1XSD A;  1QQI A;  3DKX A;  5FLX Z;  4JBA A;  2JK3 A;  3HSR A;  5E8G A;  3OYB A;  1R9T J;  1P6R A;  1BJZ A;  4G7O F;  1IO2 A;  3EUH A;  3GME A;  1ZGW A;  2FA5 A;  4HDU A;  3CUQ C;  1QRY A;  2VKD A;  2E5N A;  3D5S C;  3Q0W A;  2EIJ H;  3WU2 C;  2MG4 A;  3CJR B;  3MMY B;  2VBW A;  1YX5 A;  1LJ9 A;  2V7F A;  5D8L B;  4TV7 A;  2M87 A;  5J4V A;  3ABU A;  3I59 B;  4U7D A;  3U21 A;  2M7A A;  3P9C A;  4G6Q A;  4LK1 F;  1SAN A;  2HDC A;  4PJL A;  3ZQC A;  1HQC A;  3QOP A;  3T5X A;  1TQP A;  4KIT B;  1RC9 A;  4FX4 A;  2LNB A;  1QZZ A;  3P9K A;  3IKT A;  3RPU A;  3KX2 A;  2HOA A;  1XS9 A;  2X6X A;  1DU0 A;  3DXJ F;  1G8X A;  2M0C A;  3BG5 A;  3K4M A;  2NOJ B;  4UUS B;  2VBZ A;  2BY0 A;  2DYS H;  4JK1 X;  3IUO A;  5CQG A;  1Y0U A;  2H1K A;  2D2W A;  5KCM A;  5TGT A;  2IGO A;  2KRH A;  4P1W A;  3ZQI A;  1LKX A;  1MBE A;  4E7Z A;  4P5O A;  2DA5 A;  4HV5 A;  2CRG A;  3B6C A;  1GXQ A;  4A0Y A;  2FQ3 A;  4WWC A;  1LDJ A;  1YIO A;  2BOL A;  3L7W A;  1FX7 A;  1JJ6 C;  3K6G A;  3ZP5 A;  1XB4 A;  3G1O A;  3FHZ A;  1S7E A;  2LBF A;  5FRO A;  2NS8 A;  4RGX A;  1FP2 A;  1E3O C;  3Q9S A;  1KA8 A;  3DPT A;  3ZQ7 A;  2ZME C;  1HCR A;  1FOK A;  4L5I A;  3OYM A;  1KYW A;  4HAM A;  4KJZ A;  4A3I J;  3KIO A;  3RZD J;  3OS1 A;  2BXY A;  1X4P A;  2AXT C;  5IY5 H;  2ZFU A;  2Q2E B;  3B73 A;  1TQI A;  2K9L A;  1FBS A;  2R7O A;  3CF5 F;  2IRF G;  3JSO A;  3V8L A;  2R7S A;  3N05 A;  4GCV A;  4A3M J;  2WA0 A;  2QYO A;  1KU2 A;  2DA3 A;  2OBP A;  2RRE A;  4OIR F;  1HDP A;  4RBO A;  4FCY A;  1MH4 A;  4HEA 2;  4BQQ A;  1SFE A;  4FAS D;  3GCM A;  3LQQ A;  1W7P B;  3WGG A;  1E3H A;  2ETH A;  2WTE A;  1BA5 A;  1XG1 A;  2KFD A;  4XOT A;  1VQ9 I;  3IRQ A;  1ZK8 A;  1YJW I;  4WF2 A;  1XTA A;  2LYC A;  1FTZ A;  2O61 A;  5F04 A;  2HVQ A;  2DMT A;  1X1C A;  2JA8 J;  2A05 A;  4B47 A;  1MW7 A;  2DA4 A;  2BHY A;  2L3D A;  3TW7 A;  5HVQ C;  4M3G A;  1VQL I;  2E1N A;  2F4M B;  3OYH A;  1FT9 A;  5ILV A;  1G6N A;  5EGO A;  1O7F A;  2AXL A;  3OYD A;  5IYD J;  3ZQQ A;  1BI2 A;  3MD2 A;  2DCE A;  3SYT A;  2VAS A;  3Q3S A;  1ZG5 A;  1F5T A;  4C2T A;  2XAF A;  4UB6 C;  2M30 A;  3IAS 2;  3OWT A;  1RUN A;  3CLO A;  3SQN A;  3S1Q J;  3IH3 A;  1FIA A;  4MQ9 F;  1ETK A;  1X2N A;  3JRH A;  1OLT A;  4NQW A;  5HOD A;  3WTZ A;  1TZL A;  4O5V A;  5M3F J;  1UFM A;  1XN7 A;  5K7F A;  2ESH A;  1R1V A;  4E7I A;  1MBJ A;  4ZYE A;  2V9K A;  2ELJ A;  4RLF A;  3COA C;  3BCB A;  2FX0 A;  3W2W A;  1K61 A;  2ELH A;  3OYL A;  2HVS A;  2XC7 A;  1SFU A;  3MN2 A;  2VT3 A;  4B48 A;  4J00 A;  3RZO J;  1V5G A;  4L9V A;  3CCL I;  2H6C A;  1PDN C;  4JX4 A;  3H1C A;  2NXN B;  4IHT A;  4KIC A;  4C3H J;  1EF4 A;  3LOC A;  2VQC A;  2VN2 A;  2DT7 B;  4OAY A;  4AWX B;  1P7I A;  4I01 A;  2K4B A;  1OJL A;  3SXY A;  2GM4 A;  5LEK A;  5TIS C;  2FBK A;  2X1C A;  1SVO A;  4B3A A;  2HXO A;  1UMQ A;  3K4N A;  3ZMZ A;  1VQ4 I;  5D5X B;  4EQQ A;  3L1P A;  3ZQF A;  2HQR A;  3FF5 A;  1K6O A;  2HS5 A;  1D0Z A;  2XB0 X;  4HOB A;  1K6Y A;  2DFI A;  4EGY A;  4XBF A;  4XID A;  4DYC A;  1E2X A;  1R22 A;  3QU3 A;  1WJD A;  3AFH A;  4AIJ A;  1XMX A;  4LFU A;  4XN0 A;  1T38 A;  2EZH A;  3E0J B;  3I64 A;  1FMW A;  5IP9 J;  1D0Y A;  4BAY A;  1K4S A;  2MLK A;  2EFP A;  3CDI A;  5FGM A;  3B02 A;  2EWN A;  4XL9 A;  2YU3 A;  3PIP F;  1I27 A;  5JR3 A;  2H27 A;  2CV1 A;  2LDU A;  4CH7 A;  3VEP A;  1Z7U A;  2JN6 A;  4PGG A;  1AKH B;  3F22 A;  1FP1 D;  4HLX A;  4BDY A;  4MO7 A;  1UJ8 A;  4FE7 A;  2FNA A;  3IL2 A;  1A04 A;  1IRF A;  4KUM A;  1UG2 A;  4RAG A;  4A6E A;  1B8I B;  3WGH A;  4D7N A;  4AVZ A;  4RB1 A;  1O3S A;  4NC8 A;  3S2W A;  3VSK A;  1TNT A;  2MLG A;  3RPU D;  5J1Y A;  4OMZ A;  5K5Q A;  4MEY F;  4ASN A;  2P6T A;  1LE8 B;  2K5C A;  5EG0 A;  1ON1 A;  3A0B C;  5GTH C;  4B1R A;  3KE2 A;  3BTC A;  2X6W A;  2K85 A;  3PM1 A;  2ADU A;  1IJW C;  4NC7 A;  1S7A A;  3ABM H;  2OZ6 A;  5ICF A;  1Y1W J;  2KIM A;  2Z9O A;  3LSI A;  2EFQ A;  2K9M A;  2E1O A;  1WKM A;  4UXN A;  1IAW A;  1QZE A;  2HOT A;  4L0Y B;  1G3W A;  1OMI A;  4BHP A;  1NH3 A;  3PQK A;  4OOI A;  4HV6 A;  3F8C A;  3GTP J;  1S29 A;  4C3I J;  1NHA A;  1SC7 A;  2FSW A;  5GPC A;  2LLK A;  1B72 B;  2B0L A;  2X85 A;  4WX9 A;  4PK4 A;  4XIC A;  3FXQ A;  4M74 A;  3S3N A;  3IH4 A;  4I02 A;  2K4J A;  3FXU A;  1K79 A;  4JP0 A;  4UVB A;  3M7G A;  3ASN H;  1XGN A;  1P2F A;  5DEQ A;  1EJ9 A;  4RB0 A;  1Y1V J;  2M4K A;  3MEX A;  2DO7 A;  4BE2 A;  3JR9 A;  1LPQ A;  4A3C J;  3KEY A;  3ZPL A;  3CDH A;  1FSH A;  1BI0 A;  5F1J A;  2CW7 A;  2MC4 A;  2OCC H;  5LD2 C;  4NBQ A;  1YRN B;  3WG9 A;  2Y0M A;  3VYR B;  1MIJ A;  2O5R A;  2L0K A;  2AHQ A;  2L5Q A;  4LG0 A;  1D1A A;  2HOE A;  3B6A A;  4UUS A;  1K4T A;  2QA4 I;  1P9Q C;  3FXM A;  4WXC A;  5IYB J;  1SFO J;  4HX7 A;  4A2U A;  4F91 B;  1TWA J;  1NTC A;  4R8H A;  5J1U A;  2X9D A;  1P4A A;  2FUG 2;  1AHD P;  2Q1Z B;  4MLO A;  3FXK A;  3G73 A;  4ZTF A;  4ENJ A;  1G2H A;  4B43 A;  1VQO I;  3K0L A;  2BE5 F;  4AM3 A;  3RKX A;  2GXG A;  3HUG B;  3FXO A;  3U9G A;  1ENH A;  2QQB A;  2F6C A;  1N77 A;  2L4M A;  4KYW A;  1JJ8 C;  4BL0 B;  3U1K A;  5DS9 A;  1EA3 A;  1GXP A;  5FLV A;  3E5Q A;  1KZH A;  5JI6 A;  1FSE A;  1Q1V A;  4EEF G;  1J09 A;  3TO7 A;  1UB9 A;  2VPR A;  2PMH A;  3CMM A;  3REO A;  2KIU A;  3HOX J;  1LDD A;  5J3L A;  4I0A A;  1MMN A;  3CCR I;  1KYZ A;  2CSO A;  4HLY A;  3ERE D;  2NS0 A;  5LLQ A;  2KHM A;  3A4C A;  2HNH A;  4IHS A;  4I2O A;  4G12 A;  4QTR A;  2EA2 A;  2CFO A;  3CCY A;  1U78 A;  2XHK A;  2PLY A;  3K2A A;  5KVR A;  4KMU X;  1VTN C;  5FKM A;  3DP7 A;  4XSZ F;  1R6R A;  4G6D A;  1H9T A;  1ETY A;  4OIP F;  2M34 A;  5IT9 Z;  3ASO H;  1TW3 A;  2LMD A;  2Y9Z A;  4LMY A;  4HQM A;  4X1E A;  4HX4 A;  1MGT A;  2JA5 J;  2PN6 A;  2QQA A;  1N78 A;  4DGW B;  4LK0 F;  2HXI A;  3CUQ A;  5H2F C;  1BL0 A;  1FOY A;  1XSX A;  4DZP A;  4ESF A;  3C3W A;  4XMY A;  2E5Z A;  3BTI A;  5BOX A;  3DKY A;  2DN0 A;  3CTA A;  2OAZ A;  1UG0 A;  2IS4 A;  3BDD A;  2JA2 A;  3VWB A;  2O3F A;  2PMU A;  3IP4 B;  2CGP A;  1FTT A;  4BS9 A;  1R49 A;  3E6D A;  1JHH A;  2W82 A;  2PEX A;  3OR2 C;  3RI4 A;  4RGR A;  1EV7 A;  2K7L A;  3HTU A;  2VBY A;  3QQA A;  4M9Z A;  3K4J A;  1U3E M;  4EM2 A;  2KDO A;  3VOD A;  1N25 A;  5FLM J;  3S2H J;  2JMW A;  3ZQG A;  3SEQ A;  5L3G A;  2M8E A;  2KIQ A;  4EJO A;  2GBY A;  1VZ0 A;  3M9A A;  2PJP A;  4A3B J;  1GVD A;  2DT6 A;  3GFM A;  1IXR C;  4IHX A;  2ZCW A;  5ED4 A;  3LSR A;  3M8E A;  1R58 A;  1GV5 A;  4N9H A;  3J7Y J;  4Z2Y A;  1IXS B;  4U0V A;  3CDL A;  2L2O A;  1IUF A;  2AS5 F;  1HC8 A;  2O03 A;  2LC2 A;  1REP C;  2ZME A;  4A0X A;  2E7X A;  2BYV E;  3PSI A;  4HQE A;  2M3A A;  3RIR A;  3PFY A;  5F6F A;  1EH8 A;  5J8C A;  4FX0 A;  1O3T A;  5E20 A;  2IAI A;  2ZSH B;  2I8D A;  1JUP A;  3JCU C;  3KP7 A;  4BGD A;  3F8M A;  1ZLK A;  2V1U A;  2R7X A;  1R71 A;  4C3J J;  1P92 A;  4A3J J;  4RGU A;  1J7K A;  4FE4 A;  4M6Y A;  3RQI A;  2VBX A;  2MA3 A;  4BEH A;  2E2J J;  1RPW A;  2DOE A;  1LB2 A;  2DK8 A;  1Z21 A;  3L09 A;  1XGM A;  2MYS A;  2MFZ A;  5C4X J;  4A0Z A;  4D0P A;  2RKH A;  1S9H A;  2I5U A;  2H09 A;  3FIW A;  3TOB A;  1K78 B;  2L7Z A;  1W36 D;  2JPC A;  1R36 A;  1HLV A;  2ZJ2 A;  2CUF A;  4RAZ A;  1QA6 A;  2JUG A;  2VJJ A;  4PZJ A;  3CMY A;  2X51 A;  3JSP A;  3AG2 H;  1POG A;  3FK7 A;  2E2I J;  1TW2 A;  1XCV A;  2HDD A;  3S2D J;  2VJ4 A;  3CQZ J;  5L3C A;  4UVC A;  1B8I A;  3K4K A;  2JWT A;  3G71 I;  1W0U A;  4IO9 F;  3ERM A;  4V19 K;  3OY9 A;  3IC7 A;  4UVA A;  3FKI J;  2CW8 A;  2OUM A;  3CF2 A;  3GO5 A;  1W5C C;  1TQM A;  4CYC B;  2Y0S A;  3DF8 A;  4ZYD A;  3A1Y A;  2GOX B;  4LIU A;  2DOF A;  1FWZ A;  4HA8 A;  1U5T C;  3GXO A;  2R7V A;  2HDW A;  5F64 A;  3W6V A;  3LFK A;  2W84 A;  3HZJ A;  3ZN1 A;  4HBL A;  2R7U A;  1SMT A;  4ZDP A;  4YRV A;  4WCG A;  3HGY A;  2E19 A;  4GYI A;  1XSV A;  3BJ6 A;  5D6E A;  3X2Q H;  2M5W A;  3I4N J;  5IPA A;  2UXN A;  1IXC A;  3L2W A;  5GP9 A;  2R4G A;  2FOK A;  2ZKZ A;  2H6B A;  2COB A;  3OYA A;  5CPR B;  3HSF A;  1W36 C;  2IS2 A;  4XQF A;  1G3S A;  1B72 A;  4IKF A;  2KRC A;  2HPM A;  1WH5 A;  3O6B B;  2HZD A;  2OD5 A;  1MSE C;  2DU9 A;  2QLZ A;  4O3M A;  2IP2 A;  3KZY A;  2CUE A;  2LY1 A;  4Y3O A;  3DCF A;  3UNG C;  1BOA A;  2CJJ A;  1APL C;  1RZ4 A;  1ZTR A;  2DFF A;  2JTV A;  3HDD A;  2CQX A;  3CCU I;  2EIN H;  4A12 A;  2XGD A;  1TBX A;  1FLI A;  4KNY A;  4M6V A;  4P96 A;  4Y13 A;  3PIO F;  1I3A A;  4XLF A;  3ABL H;  1YRN A;  1MNM C;  3PUF A;  1VF9 A;  5IT3 A;  2LF7 A;  1R7J A;  3S8P A;  3V7C A;  3HOW J;  3K4L A;  4LLN A;  2EFN A;  1CQT A;  2GZW A;  3K4C A;  2DA6 A;  2LG4 A;  1VQ6 I;  3TED A;  3DEE A;  5DCM A;  3ROU A;  3W2A A;  2R7D A;  1ZAR A;  1Z7L A;  2XB5 A;  4XRF A;  3VYU B;  2X6Y A;  1T08 B;  4QWQ A;  3NRV A;  2WY7 Q;  1CF7 B;  3KFW X;  3WE3 A;  1W7P D;  3GBG A;  1LVK A;  2BEO A;  2GA2 A;  4ITV A;  5H20 A;  1STZ A;  1W5S A;  2KJB A;  1H8A C;  4V2G A;  3KZI C;  5LGT A;  1LEA A;  3ML6 A;  3HUG A;  1IDZ A;  1MD0 A;  2FD5 A;  3HJE A;  1ITY A;  4ENK A;  5E3M A;  3DEU A;  3SFZ A;  4ZYG A;  2HQA A;  3DQV C;  1R5G A;  3QOE A;  2DAO A;  2VOD A;  1V5E A;  3IWF A;  2XF5 A;  3PUB A;  2LR8 A;  3W2V A;  1WZ2 A;  2OU2 A;  2UZK A;  2X1E A;  1YJ9 I;  3PJR A;  2RNG A;  3K1M A;  2QZ8 A;  1S6L A;  5FKL A;  2GIV A;  2VE8 A;  3DKW A;  3VB2 A;  1P4W A;  4BHC A;  1HKQ A;  2HTJ A;  2ISZ A;  1YHQ I;  3MVP A;  1VQ7 I;  3GFI A;  2M0M A;  1Y56 A;  3RJP A;  4I98 B;  1C0W A;  1YG2 A;  5M5X J;  3GW2 A;  2DTZ A;  2JT1 A;  3GTG J;  1U5T B;  3JTG A;  4MIM A;  4I09 A;  4X6A J;  1IV8 A;  2Y31 A;  5J6X A;  4JX5 A;  1S72 I;  1R5H A;  3DTE A;  3LSG A;  2V1N A;  3H35 A;  4FQG A;  3TQN A;  2IEK A;  4D9J A;  4HNU A;  3KET A;  1X2M A;  3OIO A;  4UB8 C;  2LKP A;  4A5M A;  5J47 A;  4EJW A;  2DMP A;  3FM5 A;  3HOV J;  3ABT A;  4FTH A;  2RVC A;  2CW0 F;  2W1O A;  4F92 B;  3SZG A;  5L3B A;  5LEJ A;  3KP3 A;  4P9F A;  5HLT A;  3S14 J;  1SMY F;  5EZH A;  4B4C A;  2W85 A;  4E4H A;  3JAM Z;  3OL3 A;  4Y17 A;  1USS A;  3CC4 I;  4MFE A;  2R7W A;  1JGS A;  2Z2S B;  5E79 C;  2PJR A;  1N75 A;  4IXA A;  1A6I A;  5E1Z B;  3HKZ A;  4A3L J;  1OIS A;  2E7W A;  4J19 A;  2KZG A;  2Y0S N;  3EPZ A;  3IWZ A;  4OWR B;  2Q8K A;  5FB2 A;  2NNY A;  4CSW A;  3WTT C;  3RKQ A;  1H88 C;  2XAU A;  3A02 A;  2HKO A;  2QQ8 A;  4EAT A;  1NK3 P;  1ZRF A;  3BT9 A;  3FXJ A;  1B4A A;  3FXL A;  2R7Q A;  3S16 J;  3NWT A;  4C2M J;  3RCO A;  5E8I A;  5F1R A;  2P81 A;  2O7O A;  4MTE A;  2FML A;  3PNV A;  3QYB A;  4A3F J;  1X19 A;  3QYE A;  4N4O B;  1AWC A;  3MCZ A;  4XRM A;  3ECO A;  3GTK J;  4E7J A;  2NVY J;  3GEZ A;  1OQY A;  1HW1 A;  3GZ6 A;  5C44 J;  1JI8 A;  1CGP A;  3S3M A;  1T56 A;  5B66 C;  1U8R A;  2P6S A;  1IC8 A;  3PFI A;  3KEO A;  4R1H A;  2Q0O A;  4ABZ A;  2R3S A;  3NQO A;  1DPR A;  1YW9 A;  2RQQ A;  3BWG A;  2J5P A;  3IH2 A;  2HYJ A;  1KQ8 A;  4E70 A;  3WG7 H;  6PAX A;  1HDD C;  1Y39 A;  4IPA A;  4PUS A;  3QWL A;  1WH7 A;  3GTJ J;  1WJE A;  3UR3 C;  1EH7 A;  3I4M J;  3V8J A;  4GGG A;  4EGZ A;  3HSE A;  5FFX A;  2H1L A;  3JW4 A;  2OC6 A;  4UUV A;  1LNW A;  1YTY A;  4AYB A;  3QP6 A;  1HBX G;  3KLN A;  3WU1 B;  2Z5U A;  1K78 A;  2JZY A;  3NEU A;  4E7L A;  1ZAO A;  3F6O A;  3AG3 H;  2XKO A;  2ICW G;  2DOA A;  3PSF A;  1JXS A;  3S17 J;  4BH9 A;  3E6B A;  4MFD A;  4MHG A;  2QCO A;  2EB7 A;  1ZG3 A;  5J40 A;  3JRF A;  3C18 A;  2HGC A;  3FXR A;  4OMY A;  2WWY A;  2QM3 A;  3PO2 J;  1ZRC A;  2FE3 A;  2O8K A;  3H5N A;  4MNU A;  5HS7 A;  1ODD A;  1LVA A;  3ABK H;  2VJI A;  2HWV A;  2A6E F;  5D5U B;  1VQ5 I;  1XD7 A;  5DYM A;  1TL8 A;  3LSH A;  2EV6 A;  2CQK A;  2L01 A;  5EYR A;  1O3R A;  3E3V A;  2V9P A;  5ICC A;  2ZFW A;  4L18 B;  4PJJ A;  3H9J A;  4PSX A;  3FK6 A;  2XAG A;  3WU0 A;  1JHF A;  3RTR A;  3H3V K;  5TJJ A;  4DYR A;  5L3F A;  5FD5 A;  5JVT A;  1BM9 A;  2XIG A;  2CYY A;  1O57 A;  2JA6 J;  3GTO J;  3G3Z A;  3S1R J;  3E7L A;  2O6G E;  2DA7 A;  2JVG A;  4LB5 A;  3E6M A;  1TLH B;  3C2B A;  3T8R A;  3JRB A;  1ZQ3 P;  4XKC A;  5DD8 A;  4DIQ A;  4XM3 A;  2LVS A;  1YIT I;  1QVT A;  3DWL E;  2ID6 A;  3MZH A;  2DDA A;  5EZG A;  4KIS A;  5IP7 J;  1F43 A;  3R6S A;  4Y4R A;  3KCC A;  1MZB A;  1JT6 A;  3HKZ N;  4LG3 A;  4N0B A;  1HW2 A;  4ANJ A;  3PQJ A;  1FBU A;  1D3Y A;  5LRR A;  4NUB A;  1SD5 A;  1JKQ C;  5KNL A;  5ILU A;  2YU9 J;  1E17 A;  1B6A A;  3L2R A;  4LIT A;  3IV5 A;  2QSG X;  1OR7 C;  4BQN A;  1LEB A;  2ZJP F;  1S3J A;  1SFK A;  2KKO A;  3HPG A;  4KIF A;  2LRD A;  3HRS A;  2XGE A;  2IGN A;  2OA4 A;  1FYM A;  1T0F C;  3LA3 A;  1WJ5 A;  3N97 A;  2EH3 A;  1PUE E;  2FEZ A;  2AO9 A;  3EQL F;  3GZN B;  2VT2 A;  1J59 A;  2P0W A;  2R7T A;  3OL4 A;  1RET A;  4GRI A;  2XSD C;  4P55 A;  4MEX F;  5CQE A;  5IYC J;  1YLF A;  3MKW B;  3CCV I;  1Q1H A;  2EBI A;  3H92 A;  4DOZ A;  5HLG A;  3GTM J;  1SVM A;  1B9M A;  1UEL B;  5KAI C;  1IF1 A;  1PUF B;  2EA4 A;  1W4M A;  2K27 A;  2DQR A;  2TRT A;  3CCJ I;  2A6H F;  1IRZ A;  2HI3 A;  1MMD A;  3CZ6 A;  3KYC B;  1KGS A;  1QZY A;  2EQR A;  3SHF A;  1J9I A;  3I55 I;  2MH9 A;  4ZTJ A;  1ZG1 A;  5KK1 A;  4A5N A;  2P5V A;  1X58 A;  4XR6 A;  1U5T A;  1OKR A;  3I56 I;  1OYW A;  4EJU A;  5LGU A;  4UUT A;  3CUO A;  4CCK A;  3JTH A;  2OQR A;  1U9N A;  2ZXJ A;  1QHG A;  4AYB N;  2R5Y B;  2MD0 A;  3EYI A;  3J80 K;  1BC8 C;  3A0H C;  4RS8 A;  1D5Y A;  5BS6 A;  3C1D A;  3EDP A;  3V8K A;  1WRJ A;  3FMR A;  4M3B A;  3E1S A;  3LSJ A;  5L3D A;  2Z33 A;  2JRT A;  1WVR A;  2L7M P;  1IRG A;  4IQ4 A;  3DBR B;  2H8R A;  3CCM I;  1TP4 A;  4G7H F;  3BR1 A;  2STT A;  3OYF A;  1I6X A;  3I59 A;  2BVM A;  3OYG A;  3DPL C;  2PX9 A;  1G3T A;  5DUI A;  3HOU J;  1ZGJ A;  1R1T A;  1HXD A;  2XV4 S;  1V3F A;  2Y2Z A;  3S1N J;  3EUH C;  3KYD B;  4AU7 A;  1OCO H;  2QEX I;  2D5V A;  3Q0U A;  4DQ2 A;  1X3U A;  1ZH5 A;  1OFC X;  3F3X A;  4ZDO A;  2E1M C;  2L9V A;  2PI0 A;  3EET A;  3ESW B;  4YFK F;  4JQF A;  5F27 A;  4YIR X;  2WAE A;  4LD5 A;  4AVP A;  2JQ7 A;  1FBQ A;  2IA1 A;  2R7R A;  5A2Q K;  1BIB A;  1F4K A;  3M3Y J;  2A69 F;  3Q9V A;  4JX6 A;  2WY8 Q;  3R0A A;  5CVI A;  5D5W B;  1UHW A;  1ETX A;  3DTK A;  4GYG A;  2O8X A;  3J7A O;  2FNP A;  5HLI A;  2GOM A;  5CLS A;  4A3G J;  2KDZ A;  1IUY A;  3IAM 2;  3I54 A;  3P7N A;  3HYI A;  4XOP A;  2PQ8 A;  4LJZ F;  4NHJ A;  5AIQ A;  2OTJ I;  4BYY A;  2QKL B;  2JPB A;  4C9Y A;  2KT0 A;  4Y7N J;  2IS6 A;  1IG7 A;  4XLP F;  4A3K J;  4Q47 A;  1BIA A;  2Q2E A;  2V1X A;  3DTI A;  4U87 A;  1Z3Y A;  2IW5 A;  3V42 A;  4W1U A;  1RUO A;  2R93 J;  2RAE A;  2COM A;  1V54 H;  1TT0 A;  1Z05 A;  3HBL A;  3WE2 A;  2VKH A;  1YQA A;  2HVR A;  1B1B A;  1X1D A;  4ZYH A;  1PYV A;  1YS6 A;  2CFX A;  2L02 A;  2VQG A;  4UHT A;  5FRN A;  3E6C C;  2XVC A;  1W7P A;  1MH3 A;  3LSK A;  1MND A;  4E7K A;  5D5V B;  3T1B A;  3HHG A;  1SEU A;  2VON A;  4XKB A;  4IRG A;  2NS7 A;  1XMA A;  3BTJ A;  3K1P A;  1H0M A;  4OIQ F;  2NYX A;  4XRS G;  2CQ7 A;  1QPM A;  2ME6 A;  4X0G A;  1XPX A;  2EZK A;  4G94 A;  2BXZ A;  3BLY A;  4EM0 B;  5GAG J;  3TDZ C;  1ACI A;  5FJ8 J;  2QBY B;  2QWW A;  3BP8 A;  3WTS C;  2WC2 A;  2DPU A;  2PMZ A;  2XKP A;  4RB3 C;  4OU0 A;  4LGW A;  3BR2 A;  2LOO A;  4FET A;  4DYQ A;  1WJB A;  2K9S A;  2DMQ A;  4Q48 A;  1MJ9 A;  1WJA A;  1VND A;  3DEW A;  5KHD A;  2KL4 A;  3HGG A;  1YX3 A;  1UHM A;  2E1M B;  2EIL H;  4BU2 A;  1OCC H;  1DQU A;  2F5D A;  3ONQ A;  1WI9 A;  3QOD A;  2P4W A;  4IOC F;  2NNN A;  2CV0 A;  3KZZ A;  1A35 A;  1QO0 D;  4M3E A;  2BBY A;  2YR2 A;  4XN3 A;  2IBD A;  3OYN A;  2KZV A;  3FM3 A;  3R4K A;  1U2W A;  2QVO A;  3KYL A;  4JOM A;  3QP5 A;  3GYH X;  1X4O A;  1BOB A;  4UV8 A;  1BR2 A;  4I0B A;  3K10 A;  3LQR A;  3C7J A;  1G3Y A;  1H89 C;  1RI7 A;  1FPQ A;  4BQO A;  1SAX A;  5LFA A;  2EZL A;  3MZ8 A;  5D4R A;  4K2E A;  4S05 A;  3J7A Y;  1KON A;  3J81 K;  5LRS A;  5IOZ A;  4L9N A;  3CCQ I;  3ULQ B;  2QF7 A;  1TWC J;  2UV1 A;  5ICE A;  4EMS A;  5ILS A;  3BR6 A;  1Z91 A;  3M8F A;  3ZXS A;  5C3E J;  1U6G A;  3LA7 A;  2ZC2 A;  2VIX A;  4B3X A;  3ZR8 X;  2YX7 A;  3IHU A;  2L7K A;  4A69 C;  4CCM A;  4U0W A;  4XKW A;  3JRE A;  4M3F A;  5HDN A;  5JLW A;  1YI2 I;  3FMS A;  2L7F P;  1JKP C;  1Z3X A;  2EJR A;  1H9G A;  5HNF A;  3PO3 J;  4G9Y A;  3KP5 A;  5F0C A;  5GAD J;  2R0Q C;  1LDK B;  4G7Z F;  2DMN A;  2XRO A;  3CJN A;  1ETQ A;  3F9K A;  1OYI A;  2DFE A;  1TT5 B;  4PSW A;  1MBH A;  3E5X A;  4IVN A;  2FMY A;  1LFP A;  2X1D A;  1AKH A;  3V4G A;  4DNC A;  3MZY A;  4BXF A;  1YE9 A;  5B1B H;  3GUD A;  3MKZ A;  2XPW A;  2RQP A;  3MFK A;  2F2E A;  1WPK A;  3O8H A;  1ZN2 A;  5TRD A;  5AON A;  5EF6 A;  3K70 C;  5DCF A;  3JRI A;  1AU7 A;  4HZF A;  3CME I;  4XON A;  1GT0 C;  3CMA I;  2K3F A;  4DBQ A;  3TP3 A;  1HKS A;  2ZSI B;  1LE8 A;  4FT8 A;  1DUX C;  2VI6 A;  3CCE I;  4ENN A;  4DJA A;  2NVX J;  2ZXW H;  4L5J A;  4RB2 C;  3HOT A;  1ORK A;  5M5Y J;  4RMN A;  5LBQ A;  2P8T A;  3DV8 A;  5GAE J;  2YUS A;  1UZC A;  5D6F A;  3JRD A;  4DZJ A;  1O7L A;  3HOS A;  2KLO A;  3BZ6 A;  1Y6I A;  3KEQ A;  2HPI A;  4FIS A;  4HF0 A;  1BR1 A;  3BR5 A;  3RPQ A;  3W6J B;  4CA0 A;  2LY2 A;  4PJN A;  3H3U A;  4L5E A;  3PL8 A;  1BI1 A;  4IJA A;  4ESB A;  2W48 A;  1PP8 F;  1D8K A;  4S0H B;  3D1N I;  4C30 A;  2XPU A;  1GUU A;  4NQW B;  3ZOB A;  3ZMT A;  5JHF A;  5FRM A;  2RC4 A;  3BC8 A;  2F5V A;  5F08 A;  2PMZ N;  3R0J A;  2QUF A;  5KAF C;  2EZI A;  3EYY A;  1AA7 A;  1YO5 C;  2Y69 H;  2MSY A;  3QYF A;  1SFX A;  2UXX A;  3ZMV A;  4BDZ A;  1R4N B;  2IPQ X;  4PJM A;  1KU9 A;  2CMP A;  2EV5 A;  4W97 A;  1TC3 C;  4LLG F;  1OYY A;  4ESJ A;  4CDG A;  2HYF A;  3WTU C;  4JYK A;  1X3W B;  3KP2 A;  4RA2 A;  2R5Z B;  2W57 A;  1MJB A;  2KIF A;  5B1A H;  3LAJ A;  3BR3 A;  2HFH A;  1FNN A; 
#chains in the Genus database with same CATH homology
 3CO6 C;  1OR7 A;  2VOP A;  1XDS A;  2L54 A;  1FY7 A;  3V7R A;  2XGX A;  1QGP A;  2UWM A;  3I4P A;  3WTV C;  4XSX F;  1IN5 A;  2A07 F;  3WGI A;  3F8N A;  2F5C A;  4PDK A;  2V79 A;  3GLX A;  2EFO A;  2XRN A;  4M9X A;  1BJA A;  2V1D A;  5AIP A;  4L0Z B;  4MQV A;  1KQ9 A;  3TO9 A;  1J5Y A;  4ZZD A;  5BQT A;  5BPI A;  4HYE A;  1BI3 A;  2E1C A;  4BXU A;  2F5E A;  5LHG A;  4KN4 X;  2DI3 A;  4BQA A;  3ELK A;  4BHB A;  5HLH A;  3I58 A;  3F21 A;  4KDP A;  3QPH A;  3F72 A;  3SZP A;  4KMF A;  3BOQ A;  5D8K B;  3K1N A;  1PP7 U;  2FBI A;  4PGH A;  4IF4 A;  1QNT A;  3KLO A;  3RDI A;  1KU3 A;  3ECH A;  5FLX K;  1K7A A;  4CIC A;  2ACJ A;  2F5F A;  3F6V A;  1Z9C A;  3GVA A;  2P5K A;  3TKY A;  2A68 F;  4UV9 A;  1DDN A;  2FXA A;  2LSO A;  3LA2 A;  5K5O A;  3BY6 A;  3L2C A;  3JAM K;  4LG0 B;  1B59 A;  4EJT A;  4RGS A;  3FZV A;  2Y48 A;  1ZHF A;  2DT5 A;  1T2K A;  2YPR A;  1XMK A;  3RYP A;  2ZNY A;  4UNO A;  4U0Y A;  1YW8 A;  4B09 A;  4M9S A;  4B8X A;  3F8F A;  4EJV A;  1WWX A;  1TNS A;  1IN6 A;  2BV6 A;  2A61 A;  2ZO4 A;  4S04 A;  1HST A;  3GZ5 A;  2V6C A;  3VFZ A;  1RIO H;  2IT0 A;  3HTS B;  4WXD A;  2XAS A;  2WV0 A;  3HRM A;  3WOD F;  2DLL A;  2W24 A;  2OQG A;  1G4D A;  4GO1 A;  1KU7 A;  4I7H A;  2DK5 A;  4KIG A;  1FYK A;  2PFB A;  1V4R A;  4XLN F;  3CUQ B;  2ZBK A;  5CVV A;  3BJO A;  2XAJ A;  5HS9 A;  1DPU A;  1ZLJ A;  4HF2 A;  2P5L C;  4ETS A;  1L3L A;  3OV8 A;  4CGZ A;  1FYL A;  4AD9 A;  4WK8 F;  2VE9 A;  1SD4 A;  2A3S A;  5JFR A;  2VC1 A;  1ZYR F;  4HF1 A;  1S8N A;  3U1D A;  2IJL A;  4CO8 A;  2GXB A;  1RNL A;  2HKX A;  2BGC A;  3ZMD A;  3IRR A;  4YFN F;  3ZN0 A;  2ZME B;  2RV8 A;  2G7H A;  5E1X A;  2STW A;  1CF7 A;  3WTW C;  1IZ1 A;  2TDX A;  1ULY A;  5LHI A;  1EH6 A;  1YYV A;  1KQ0 A;  4G8X A;  3ISP A;  5LGN A;  1HKT A;  3LST A;  2EFW A;  3U2R A;  2RGV A;  1MDM B;  3FMQ A;  2PG4 A;  1Z1D A;  3J80 Z;  4HX8 A;  2EK5 A;  4AIK A;  5FO5 A;  1LQ1 A;  2JSC A;  4A6D A;  2ZNZ A;  4OIN F;  3GFJ A;  3DFG A;  1DP7 P;  4NB5 A;  3VOE A;  2VXZ A;  2D1V A;  5HS8 A;  2IVM A;  1T98 A;  2YX4 A;  2K02 A;  3CO7 C;  2CG4 A;  4Y15 A;  5A2Q Z;  3E97 A;  1R00 A;  4KFC A;  2OZU A;  2D1H A;  1R23 A;  5EEH A;  1O3Q A;  4LLL A;  5H6Q A;  2DW4 A;  4L9T A;  5CYV A;  5DV5 A;  5E1W A;  1T39 A;  1W5T A;  1IN8 A;  2L4A A;  3LAP A;  2FBH A;  3I0T A;  3GX4 X;  1QBJ A;  3KP6 A;  5D4S A;  3WTX C;  1I5Z A;  5ICG A;  4O6J A;  4GXO A;  2RNJ A;  1WQ2 A;  1T6S A;  4QLC U;  2G7U A;  5DCM B;  2Z3Y A;  2H94 A;  1WSU A;  3BRO A;  4FHT A;  3QPT A;  4ZH4 F;  3BPV A;  5FFZ A;  5E18 F;  2XAH A;  1HW5 A;  3Q5F A;  5ERI A;  3HRT A;  2R7F A;  1OPC A;  2P7C B;  4Q5S F;  2HEO A;  1J2X A;  4Q4Z F;  2M1B A;  4RAY A;  3F23 A;  2C6Y A;  1P4X A;  2P7V B;  2HTS A;  4CYD A;  2HR3 A;  2EV0 A;  3I53 A;  4IRH A;  2FRH A;  1HSJ A;  5H6R A;  1IW7 F;  1F9N A;  3TOA A;  4BNC A;  1D8J A;  2FU4 A;  4L9J A;  1B9N A;  1I1G A;  5DUK A;  5JHU A;  3K9T A;  4ON0 A;  3WTY C;  2X4H A;  3T0Y A;  2LF8 A;  3IKV A;  4HDV A;  3P9I A;  3R61 A;  4WXH A;  5IT9 K;  2J5O A;  3M1E A;  3J81 Z;  4U88 A;  4PCQ A;  1S7O A;  4R79 A;  2MBF A;  2DPD A;  4EM1 A;  2HYG D;  2XUB A;  5CJ9 A;  1XCB A;  1YFH A;  2QEN A;  4MGR A;  2D45 A;  3SZT A;  1JE8 A;  3TGN A;  1L0O C;  3BPX A;  3T8T A;  3O3K A;  5K1Y A;  1ZRD A;  4YG2 F;  2GQQ A;  3F8B A;  3I5U A;  1SD7 A;  3HRU A;  4ZZL A;  5K5R A;  3HHH A;  3MAJ A;  4P9U A;  2IA2 A;  2GAU A;  1GHC A;  2HZT A;  2Y75 A;  1UCR A;  3RKW A;  4CXF A;  4U7B A;  4N9I A;  3ZMU A;  5HDK A;  5FD6 A;  3KP4 A;  5EEG A;  3TO6 A;  3V7S A;  2Z99 A;  1GVJ A;  4M6X A;  1IN4 A;  5CVR A;  4YII A;  2G9W A;  3RKY A;  1J0R A;  1ONV A;  4ENM A;  3TDU C;  4IRI A;  2XAQ A;  2GA1 A;  1FC3 A;  1MDM A;  1ZRE A;  3I71 A;  4M73 A;  1YW7 A;  2K86 A;  4EVI A;  3AAF A;  3K69 A;  3D0S A;  3ZMS A;  3E5U A;  1BC7 C;  3MQ0 A;  3FWE A;  5BMZ A;  2ISY A;  5HOO A;  1J75 A;  3N4M A;  1BN5 A;  1Z6T A;  4KT5 C;  4HW0 A;  4M71 A;  3W6K B;  4YFX F;  2DQL A;  2GWR A;  2V9V A;  1XGS A;  3RYR A;  1AOY A;  1YS7 A;  4OIO F;  3MWM A;  2DBB A;  5LHH A;  4CZZ A;  2MD5 A;  3QAH A;  3L00 A;  1MKM A;  5J8F A;  5BPD A;  2VC0 A;  4KIB A;  1XGO A;  2QQ9 A;  4AIH A;  1SD6 A;  5E17 F;  4KN7 X;  2ESN A;  2NRA C;  5DDG A;  2MH2 A;  2A5Y B;  2W25 A;  2X0L A;  2PBI A;  1T0F A;  3HIF A;  1MJA A;  1D5V A;  3D5L A;  4M72 A;  2CWE A;  1I1S A;  3OOP A;  2HQN A;  1F1Z A;  2CO5 A;  2KRF A;  4EV0 A;  4YIF A;  1BBY A;  2IA0 A;  3LWF A;  1XDU A;  3H3Z A;  4F7Z A;  1UST A;  3GWZ A;  3O2P E;  5L3E A;  2KJC A;  3GF2 A;  1Z6R A;  4KA4 A;  2DTR A;  2O0Y A;  2M45 A;  3GFL A;  1TTY A;  2RN7 A;  3QU6 A;  2RDP A;  3K2Z A;  4LB6 B;  1IN7 A;  5CVJ A;  3FX3 A;  2NAZ A;  5CVU A;  4MTD A;  3QRF F;  4CHU A;  2MC3 A;  1ON2 A;  2FF4 A;  3L9F A;  1ZGA A;  4H0E A;  5DD4 A;  3BJA A;  1FZP B;  2VOO A;  3R60 A;  5HDG A;  1R1U A;  2YSR A;  2QBY A;  1XSD A;  1QQI A;  5FLX Z;  4JBA A;  3HSR A;  5E8G A;  4G7O F;  1P6R A;  3EUH A;  2FA5 A;  4HDU A;  3CUQ C;  2VBW A;  1LJ9 A;  5D8L B;  4TV7 A;  2M87 A;  3ABU A;  3I59 B;  4U7D A;  3P9C A;  4G6Q A;  4LK1 F;  2HDC A;  1HQC A;  3QOP A;  3T5X A;  1TQP A;  4FX4 A;  2LNB A;  1QZZ A;  3P9K A;  3IKT A;  3RPU A;  3DXJ F;  2VBZ A;  4JK1 X;  1Y0U A;  2D2W A;  4P5O A;  4HV5 A;  1GXQ A;  4A0Y A;  2FQ3 A;  4WWC A;  1LDJ A;  1YIO A;  3L7W A;  1FX7 A;  3ZP5 A;  1XB4 A;  3FHZ A;  4RGX A;  1FP2 A;  3Q9S A;  1KA8 A;  3DPT A;  3ZQ7 A;  1FOK A;  4L5I A;  1KYW A;  4HAM A;  3B73 A;  1TQI A;  1FBS A;  2IRF G;  3JSO A;  3V8L A;  4GCV A;  2QYO A;  1KU2 A;  2OBP A;  4OIR F;  1SFE A;  3LQQ A;  1W7P B;  3WGG A;  2ETH A;  2WTE A;  3IRQ A;  4WF2 A;  2O61 A;  5HVQ C;  2L3D A;  2E1N A;  1FT9 A;  5ILV A;  1G6N A;  1O7F A;  2AXL A;  1BI2 A;  1ZG5 A;  1F5T A;  2XAF A;  2M30 A;  1RUN A;  3CLO A;  3SQN A;  4MQ9 F;  4NQW A;  3WTZ A;  4O5V A;  1UFM A;  1XN7 A;  2ESH A;  1R1V A;  4ZYE A;  3COA C;  2ELH A;  1SFU A;  2VT3 A;  4L9V A;  1PDN C;  2H6C A;  4IHT A;  4KIC A;  2VN2 A;  4AWX B;  4I01 A;  2K4B A;  3SXY A;  5LEK A;  2FBK A;  3ZMZ A;  5D5X B;  4EQQ A;  2HQR A;  3FF5 A;  1K6O A;  2HS5 A;  4HOB A;  2DFI A;  4EGY A;  4XBF A;  1E2X A;  1R22 A;  3QU3 A;  4AIJ A;  4LFU A;  1T38 A;  3I64 A;  4BAY A;  2MLK A;  2EFP A;  5FGM A;  3B02 A;  2EWN A;  2YU3 A;  1I27 A;  5JR3 A;  2H27 A;  2LDU A;  3VEP A;  1Z7U A;  4PGG A;  3F22 A;  1FP1 D;  4HLX A;  2FNA A;  3IL2 A;  1A04 A;  1IRF A;  4KUM A;  4A6E A;  3WGH A;  4RB1 A;  1O3S A;  3S2W A;  1TNT A;  2MLG A;  5K5Q A;  4OMZ A;  4MEY F;  4ASN A;  2P6T A;  1ON1 A;  3KE2 A;  2ADU A;  2Z9O A;  1S7A A;  2OZ6 A;  5ICF A;  2KIM A;  2EFQ A;  1WKM A;  4UXN A;  1IAW A;  4L0Y B;  1G3W A;  1OMI A;  4BHP A;  3PQK A;  4OOI A;  4HV6 A;  3F8C A;  1S29 A;  1NHA A;  2FSW A;  2B0L A;  4WX9 A;  3FXQ A;  4M74 A;  4I02 A;  2K4J A;  3FXU A;  1K79 A;  4UVB A;  3M7G A;  1XGN A;  1P2F A;  5DEQ A;  4RB0 A;  3MEX A;  2DO7 A;  3ZPL A;  3CDH A;  1FSH A;  1BI0 A;  3WG9 A;  2Y0M A;  4LG0 A;  2HOE A;  4WXC A;  4HX7 A;  4A2U A;  4R8H A;  1P4A A;  3G73 A;  4ENJ A;  3K0L A;  2BE5 F;  3RKX A;  2GXG A;  3U9G A;  2QQB A;  2L4M A;  4KYW A;  1GXP A;  3E5Q A;  5JI6 A;  1FSE A;  3TO7 A;  1UB9 A;  2PMH A;  3REO A;  2KIU A;  1LDD A;  4I0A A;  4HLY A;  1KYZ A;  2CSO A;  3ERE D;  2NS0 A;  5LLQ A;  4IHS A;  4I2O A;  1U78 A;  2EA2 A;  2PLY A;  2XHK A;  5KVR A;  4KMU X;  1VTN C;  3DP7 A;  4XSZ F;  1H9T A;  4G6D A;  4OIP F;  5IT9 Z;  1TW3 A;  4LMY A;  4HQM A;  4HX4 A;  1MGT A;  2PN6 A;  2QQA A;  4LK0 F;  3CUQ A;  1XSX A;  4ESF A;  3C3W A;  5BOX A;  3CTA A;  2OAZ A;  3BDD A;  2O3F A;  2PMU A;  2CGP A;  3E6D A;  1JHH A;  2PEX A;  3RI4 A;  4RGR A;  1EV7 A;  2K7L A;  3HTU A;  2VBY A;  4M9Z A;  1U3E M;  4EM2 A;  3VOD A;  5L3G A;  2M8E A;  4EJO A;  2PJP A;  3M9A A;  3GFM A;  1IXR C;  2ZCW A;  5ED4 A;  3M8E A;  1R58 A;  4N9H A;  4Z2Y A;  1IXS B;  4U0V A;  2AS5 F;  2O03 A;  1REP C;  2ZME A;  4A0X A;  2E7X A;  2BYV E;  4HQE A;  3RIR A;  5F6F A;  1EH8 A;  5J8C A;  4FX0 A;  1O3T A;  5E20 A;  3KP7 A;  1ZLK A;  3F8M A;  2V1U A;  1P92 A;  4RGU A;  1J7K A;  4M6Y A;  2VBX A;  2MA3 A;  1LB2 A;  2DK8 A;  3L09 A;  1XGM A;  4A0Z A;  4D0P A;  2RKH A;  2H09 A;  3TOB A;  1K78 B;  2JPC A;  1R36 A;  2ZJ2 A;  4RAZ A;  4PZJ A;  3JSP A;  1TW2 A;  1XCV A;  5L3C A;  4UVC A;  3IC7 A;  4UVA A;  3GO5 A;  1TQM A;  3DF8 A;  4ZYD A;  1FWZ A;  4HA8 A;  1U5T C;  3GXO A;  5F64 A;  3LFK A;  2W84 A;  3ZN1 A;  4HBL A;  1SMT A;  4WCG A;  4GYI A;  1XSV A;  3BJ6 A;  5D6E A;  2M5W A;  2UXN A;  1IXC A;  2FOK A;  2ZKZ A;  2H6B A;  3HSF A;  1G3S A;  3O6B B;  2OD5 A;  2DU9 A;  2QLZ A;  4O3M A;  2IP2 A;  3KZY A;  1BOA A;  1RZ4 A;  2JTV A;  4A12 A;  1TBX A;  1FLI A;  4KNY A;  4P96 A;  4Y13 A;  5IT3 A;  2LF7 A;  1R7J A;  3V7C A;  4LLN A;  2EFN A;  2GZW A;  5DCM A;  3ROU A;  2R7D A;  1ZAR A;  4XRF A;  4QWQ A;  3NRV A;  1CF7 B;  3KFW X;  3WE3 A;  1W7P D;  2BEO A;  2GA2 A;  5H20 A;  1STZ A;  1W5S A;  2KJB A;  5LGT A;  1LEA A;  3ML6 A;  3HUG A;  1MD0 A;  4ENK A;  3DEU A;  3SFZ A;  4ZYG A;  3DQV C;  1R5G A;  2DAO A;  2VOD A;  3IWF A;  2OU2 A;  2UZK A;  3K1M A;  2QZ8 A;  1S6L A;  2GIV A;  2VE8 A;  3DKW A;  3VB2 A;  1P4W A;  4BHC A;  1HKQ A;  2HTJ A;  2ISZ A;  3GFI A;  3RJP A;  4I98 B;  1C0W A;  1YG2 A;  3GW2 A;  2JT1 A;  1U5T B;  3JTG A;  4I09 A;  5J6X A;  1R5H A;  3TQN A;  3KET A;  2LKP A;  4A5M A;  4EJW A;  3FM5 A;  3ABT A;  2RVC A;  2CW0 F;  5L3B A;  5LEJ A;  3KP3 A;  4P9F A;  1SMY F;  3JAM Z;  2W85 A;  4Y17 A;  1USS A;  1JGS A;  4IXA A;  5E1Z B;  2E7W A;  3IWZ A;  2Q8K A;  5FB2 A;  2NNY A;  3WTT C;  2HKO A;  1ZRF A;  1B4A A;  5E8I A;  5F1R A;  4MTE A;  2FML A;  1AWC A;  3MCZ A;  3ECO A;  3GEZ A;  1HW1 A;  3GZ6 A;  1CGP A;  1U8R A;  2P6S A;  3PFI A;  3KEO A;  4R1H A;  2Q0O A;  2R3S A;  3NQO A;  1DPR A;  1YW9 A;  3BWG A;  2J5P A;  1KQ8 A;  4E70 A;  6PAX A;  4IPA A;  1EH7 A;  3V8J A;  4GGG A;  4EGZ A;  3HSE A;  5FFX A;  3JW4 A;  4UUV A;  1LNW A;  1YTY A;  3QP6 A;  1HBX G;  3KLN A;  3WU1 B;  2Z5U A;  1K78 A;  2JZY A;  3NEU A;  1ZAO A;  3F6O A;  2XKO A;  1JXS A;  4BH9 A;  3E6B A;  4MHG A;  2EB7 A;  1ZG3 A;  3C18 A;  2HGC A;  3FXR A;  4OMY A;  2WWY A;  2QM3 A;  1ZRC A;  2FE3 A;  4MNU A;  5HS7 A;  1ODD A;  1LVA A;  2HWV A;  2A6E F;  5D5U B;  1XD7 A;  5DYM A;  2EV6 A;  2CQK A;  2L01 A;  1O3R A;  3E3V A;  5ICC A;  2ZFW A;  4L18 B;  2XAG A;  3WU0 A;  1JHF A;  3RTR A;  5TJJ A;  5L3F A;  5FD5 A;  5JVT A;  1BM9 A;  2XIG A;  2CYY A;  1O57 A;  3G3Z A;  2O6G E;  4LB5 A;  3E6M A;  1TLH B;  3T8R A;  5DD8 A;  3MZH A;  3R6S A;  3KCC A;  1MZB A;  4N0B A;  1HW2 A;  3PQJ A;  1FBU A;  1D3Y A;  5LRR A;  1SD5 A;  5ILU A;  1E17 A;  1B6A A;  1LEB A;  1S3J A;  2KKO A;  4KIF A;  3HRS A;  2OA4 A;  1FYM A;  3LA3 A;  3N97 A;  1PUE E;  2FEZ A;  3EQL F;  2VT2 A;  1J59 A;  4P55 A;  4MEX F;  1YLF A;  1Q1H A;  3H92 A;  5HLG A;  1B9M A;  1IF1 A;  2EA4 A;  1W4M A;  2K27 A;  2DQR A;  2A6H F;  1KGS A;  1QZY A;  3SHF A;  1J9I A;  2MH9 A;  1ZG1 A;  5KK1 A;  4A5N A;  2P5V A;  1U5T A;  1OKR A;  1OYW A;  4EJU A;  5LGU A;  3CUO A;  3JTH A;  2OQR A;  2ZXJ A;  3EYI A;  3J80 K;  1BC8 C;  4RS8 A;  5BS6 A;  3C1D A;  3EDP A;  3V8K A;  1WRJ A;  3FMR A;  5L3D A;  2Z33 A;  2JRT A;  1IRG A;  4G7H F;  2STT A;  1I6X A;  3I59 A;  3DPL C;  1G3T A;  5DUI A;  1ZGJ A;  1R1T A;  1HXD A;  2XV4 S;  1V3F A;  4DQ2 A;  1X3U A;  1ZH5 A;  3F3X A;  2PI0 A;  3EET A;  4YFK F;  4JQF A;  4LD5 A;  4AVP A;  1FBQ A;  2IA1 A;  1F4K A;  5A2Q K;  1BIB A;  2A69 F;  3Q9V A;  3R0A A;  5CVI A;  5D5W B;  1UHW A;  4GYG A;  2O8X A;  3J7A O;  2FNP A;  5HLI A;  5CLS A;  1IUY A;  3I54 A;  3P7N A;  3HYI A;  2PQ8 A;  4LJZ F;  4NHJ A;  5AIQ A;  4BYY A;  2JPB A;  4XLP F;  4Q47 A;  1BIA A;  2Q2E A;  2V1X A;  2IW5 A;  1RUO A;  2COM A;  1Z05 A;  3WE2 A;  1YQA A;  1B1B A;  4ZYH A;  1YS6 A;  2CFX A;  2L02 A;  4UHT A;  3E6C C;  2XVC A;  1W7P A;  5D5V B;  3T1B A;  3HHG A;  2VON A;  1H0M A;  4IRG A;  1XMA A;  3K1P A;  4OIQ F;  2NYX A;  1QPM A;  4G94 A;  4EM0 B;  3TDZ C;  2QBY B;  2QWW A;  3BP8 A;  3WTS C;  2WC2 A;  2DPU A;  2XKP A;  4RB3 C;  4OU0 A;  4LGW A;  4Q48 A;  1MJ9 A;  1UHM A;  2F5D A;  1WI9 A;  2P4W A;  2NNN A;  3KZZ A;  1QO0 D;  2BBY A;  2YR2 A;  3FM3 A;  3R4K A;  1U2W A;  2QVO A;  3QP5 A;  3GYH X;  4UV8 A;  4I0B A;  3LQR A;  3C7J A;  1G3Y A;  1RI7 A;  1FPQ A;  1SAX A;  5D4R A;  4K2E A;  4S05 A;  3J81 K;  5LRS A;  4L9N A;  3ULQ B;  5ICE A;  4EMS A;  5ILS A;  1Z91 A;  3M8F A;  1U6G A;  3LA7 A;  2YX7 A;  3IHU A;  3LAJ A;  4U0W A;  5HDN A;  3FMS A;  2EJR A;  1H9G A;  4G9Y A;  3KP5 A;  1LDK B;  4G7Z F;  2XRO A;  3CJN A;  1OYI A;  3E5X A;  4IVN A;  2FMY A;  3V4G A;  4DNC A;  3MZY A;  3GUD A;  2RQP A;  3MFK A;  2F2E A;  1ZN2 A;  5TRD A;  5AON A;  5DCF A;  4HZF A;  1HKS A;  4FT8 A;  1DUX C;  4ENN A;  4L5J A;  4RB2 C;  3HOT A;  5LBQ A;  2P8T A;  3DV8 A;  5D6F A;  1O7L A;  3HOS A;  3BZ6 A;  3KEQ A;  4HF0 A;  3RPQ A;  3W6J B;  3H3U A;  1BI1 A;  4IJA A;  4ESB A;  1PP8 F;  1D8K A;  3ZMT A;  2RC4 A;  3R0J A;  2QUF A;  3EYY A;  1YO5 C;  1SFX A;  2UXX A;  3ZMV A;  2IPQ X;  1KU9 A;  2EV5 A;  4LLG F;  1OYY A;  4ESJ A;  4CDG A;  2HYF A;  3WTU C;  3KP2 A;  2W57 A;  1MJB A;  2KIF A;  2HFH A;  1FNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...