1YYVA

Putative transcriptional regulator ytfh from salmonella typhimurium
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
114
structure length
111
Chain Sequence
QLREGNLFAEQCPSREVLKHVTSRWGVLILVALRDGTHRFSDLRRMGGVSEMLAQSLQALEQDGFLNRVSYPVVPPHVEYSLTPLGEQVSDVAALADWIELNLPQVLAQRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative transcriptional regulator
publication title X-ray crystal structure of putative transcriptional regulator ytfH from Salmonella typhimurium.
rcsb
source organism Salmonella typhimurium
molecule tags Structural genomics, unknown function
total genus 29
structure length 111
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1yyvA00
2IA2A 5ICEA 1YW9A 1W5SA 2PBIA 3ULQB 4KMUX 4YIIA 4MTDA 4RGUA 3WTZA 5K1YA 3B73A 4HA8A 1ZRFA 1FX7A 3IHUA 2F5CA 4A5MA 5DUKA 1UHMA 4ETSA 2DPUA 1K7AA 4EGZA 4BAYA 3FMQA 4CICA 2NRAC 2ISZA 4ZZLA 4G7OF 2YU3A 3GEZA 2HYGD 4EMSA 3B02A 4G7ZF 3J81K 5FO5A 4MQVA 5D6EA 2DQLA 1WSUA 1S6LA 2FEZA 3M8FA 3I5UA 1JXSA 1ODDA 1FBQA 2PN6A 4LGWA 3H3UA 1FSHA 2FOKA 3FMRA 3W6JB 2NYXA 3R0AA 3GUDA 1YLFA 3K2ZA 2KIFA 2FMYA 3ZQ7A 4HQMA 3KEQA 1BI2A 1T38A 3M1EA 4AIJA 3S2WA 3J81Z 2M87A 3GFJA 2J5OA 3QAHA 3ZMUA 2C6YA 1G3YA 1F5TA 3ERED 2PFBA 4I98B 3LQQA 4LG0A 5CLSA 2Z5UA 4WX9A 1IRGA 3GFLA 2JSCA 1NHAA 3GWZA 1FC3A 4B8XA 4KMFA 2UXNA 1J0RA 5LEJA 2A6HF 5L3GA 1SD6A 3KP3A 3AAFA 1H9TA 1Z6RA 4AVPA 3PFIA 3GF2A 4HF2A 4ZYDA 3DP7A 2CSOA 1LDKB 2HKXA 2TDXA 4HDVA 2OU2A 2VBXA 2LNBA 5HVQC 2PMUA 1XN7A 1RUOA 1HQCA 4HDUA 2IP2A 5D4RA 4P5OA 2O61A 2XVCA 4KIFA 1MDMA 2W25A 4KT5C 1ULYA 4OOIA 4EJOA 2UZKA 2ETHA 3HOTA 1D5VA 5E17F 3RKWA 2ZMEA 2DW4A 1TTYA 4HQEA 4KDPA 2HFHA 2R7DA 1LEAA 4KYWA 1TLHB 2A6EF 2P6SA 1R00A 3I58A 1A04A 2VC0A 2P5VA 5TJJA 3VB2A 1TNTA 3R4KA 2W85A 2LF8A 2YX7A 2W24A 2FRHA 3F8BA 4R79A 1R22A 2L3DA 2H6BA 2P8TA 2EFNA 2RQPA 1KU9A 3R60A 4G94A 4S05A 2QBYB 2VOOA 4WXHA 2H6CA 1P4WA 2Z99A 3V8LA 2COMA 1S29A 5D5WB 3IRQA 2YX4A 2HGCA 1K6OA 1BN5A 2DAOA 1OMIA 2PI0A 1DDNA 1U5TA 1AWCA 3ZN0A 3FF5A 2NS0A 2QYOA 1QNTA 2WV0A 3ECOA 3RPQA 1ZN2A 3WTTC 4ENJA 4ZZDA 3HOSA 2HS5A 3JW4A 5JFRA 1HBXG 1ZLKA 2BEOA 3V7CA 1IXCA 1F9NA 2NNNA 3I4PA 5D5XB 1DPUA 1Z05A 4ESBA 4KIGA 4OIOF 5CVRA 2OQRA 1SFXA 4DQ2A 1J2XA 1Z91A 2Q8KA 2HYFA 5HOOA 1KYWA 4HX4A 4G9YA 2JT1A 3MAJA 2E7WA 2RVCA 4YFKF 4EGYA 5L3FA 3EDPA 3NEUA 4P55A 5BPIA 4XLNF 5LRSA 2ADUA 1LVAA 5AIQA 2FBHA 2FNAA 1OKRA 5HS7A 4OMYA 2P5LC 2GQQA 2JZYA 5HLIA 1EV7A 3CUQC 1K78A 1MGTA 2VBWA 1SFUA 2GAUA 5LRRA 1R23A 4CGZA 3EUHA 2OD5A 4I02A 5HDNA 2KRFA 2P6TA 5L3BA 4ZH4F 5LHHA 4HV6A 3VODA 4CDGA 2EFQA 3BROA 2XGXA 4FHTA 4BYYA 2ZNZA 1YW8A 1Q1HA 1FSEA 2J5PA 1ZLJA 3BJ6A 4LLGF 1LNWA 3EYYA 3MZHA 5H6RA 3QP6A 4N9IA 3P9IA 5CVUA 2VT2A 2HTSA 4Q5SF 1I1GA 1U6GA 1FOKA 4BQAA 3FZVA 2YPRA 2PQ8A 4KNYA 3K1NA 4RAYA 3HRSA 4CZZA 3RI4A 2VC1A 3ABTA 1V3FA 1KQ0A 3KZZA 4ESJA 2HOEA 5JI6A 4A2UA 1B6AA 1J7KA 2JRTA 1KYZA 2VOPA 5K5OA 1BBYA 3GXOA 1J59A 1T6SA 1GXPA 5HDKA 3I0TA 2Q2EA 3E3VA 3JSPA 2XAFA 3P7NA 4Z2YA 1ZHFA 3NQOA 4UV8A 5DUIA 2EV0A 3CDHA 1XGOA 5CVJA 4YFNF 3WTXC 1YTYA 2CWEA 5F6FA 1T2KA 5H20A 3WE3A 2RC4A 1S8NA 2FE3A 1O7LA 1T0FA 4NQWA 3I53A 2MH2A 1IAWA 3IWFA 3O6BB 3U9GA 3ZMTA 1XCVA 3O2PE 1BOAA 4WK8F 1FYMA 5ICGA 1B1BA 3FXRA 4P9FA 3Q5FA 1XB4A 2DI3A 1YIOA 4UVCA 2GXBA 2XASA 3HTSB 3I59A 4RS8A 3WGHA 3ROUA 1PUEE 4U0YA 3DEUA 1UHWA 1RZ4A 4EJUA 2X0LA 3DPLC 3HSEA 3MZYA 1IXRC 3F3XA 2ISYA 4HX7A 2L02A 1I5ZA 2P5KA 3C18A 3HSRA 4OINF 4HLXA 5ICCA 2FQ3A 4L5IA 4A0YA 3E5XA 4LMYA 3BWGA 2O03A 3F8NA 3PQJA 3MQ0A 5ICFA 4UVAA 1P6RA 2QZ8A 5BQTA 4WF2A 3KEOA 4ENMA 2STWA 1QBJA 1G4DA 5E1XA 2KJBA 3IKVA 1EH7A 3HYIA 1HW2A 1MJBA 1T98A 3VEPA 4M9XA 2NAZA 4JK1X 1QZZA 1ZYRF 1HSJA 3OV8A 2VE9A 1B59A 1C0WA 2FA5A 4DNCA 1IF1A 3H92A 3C3WA 3E6CC 3T8RA 3TOBA 1H9GA 1O57A 4RGSA 2CYYA 4EVIA 2IT0A 4PGGA 5D5VB 4RB3C 5IT3A 5D5UB 2W57A 3IL2A 1BJAA 4HF1A 1IZ1A 1FPQA 1FBUA 2H94A 1IN7A 4BHCA 4L18B 4IHSA 4WWCA 2FSWA 5DCMB 3VFZA 2HZTA 2MBFA 1MZBA 2RN7A 2ZCWA 4OIQF 1P4AA 5LGNA 3HUGA 4O6JA 3GZ6A 2QLZA 3J7AO 2E1NA 3WGIA 4AWXB 3CLOA 1ONVA 4FT8A 2DBBA 1IN5A 1BI1A 2PLYA 4RGRA 3LWFA 2JPCA 3MWMA 4TV7A 1TW2A 2O3FA 1SFEA 1H0MA 4HLYA 5FB2A 3LAPA 1RI7A 3R0JA 3E5QA 4A12A 1X3UA 3ECHA 2ZO4A 2DFIA 5LBQA 1KU3A 1MJAA 4MQ9F 1USSA 5BMZA 5LHIA 5ILVA 2HQRA 4IRGA 1BI3A 1ZRDA 3MEXA 4OMZA 1IN8A 1SD5A 2X4HA 1Z9CA 4YFXF 5ILUA 4QLCU 5E18F 3CUQA 2XKOA 3IKTA 5E8IA 4H0EA 2EWNA 2LSOA 3ZMZA 1TW3A 3E6BA 2L54A 1R1TA 1W7PA 2VODA 4MNUA 2A69F 1O3SA 1STZA 4EM1A 1JHHA 1SD7A 4RGXA 3I71A 4PGHA 4R1HA 1D3YA 2VN2A 3F8MA 1ZARA 4QWQA 1R1UA 2KJCA 3WTVC 1LEBA 1LB2A 2PMHA 2V1UA 2F2EA 3LA2A 5D6FA 5HDGA 4HAMA 2V9VA 4R8HA 2A68F 3HSFA 3RPUA 4NB5A 3KZYA 4LK1F 5BPDA 1XSVA 4IRHA 3T8TA 1IRFA 2ZKZA 3FHZA 4LG0B 5F1RA 2XRNA 4XLPF 2O0YA 2EFWA 4ESFA 2L4MA 2VBZA 3CTAA 4UNOA 3QP5A 3GYHX 2LDUA 3V7SA 1HW5A 3FMSA 3DQVC 1D8KA 3T1BA 1P2FA 2QVOA 3TQNA 1FBSA 4EQQA 3REOA 4P9UA 4L0YB 1J75A 1YG2A 1PDNC 5F64A 3FWEA 4LK0F 3FXUA 2DT5A 3F6OA 2IA1A 1T39A 3L7WA 4HW0A 4G6QA 3JTGA 1OYYA 2MLKA 5H6QA 1MDMB 4M6XA 5LEKA 3F8FA 1KU7A 4BHPA 1PP8F 1KU2A 3KP5A 3RDIA 1YO5C 1LJ9A 2ZMEB 4MGRA 4LB6B 4XSZF 5EEGA 2RGVA 1I27A 3WTYC 5HS8A 3BDDA 4GGGA 4EJVA 5D4SA 3RKXA 1OR7A 1YW7A 5FGMA 4RAZA 1RNLA 1F4KA 4ZYGA 1J5YA 1XCBA 1UCRA 1HW1A 3CUOA 3K69A 2K02A 4O3MA 3HRTA 1FT9A 3SXYA 4MEXF 2XAQA 3HHHA 3JAMK 4FX4A 4ZYEA 4GYGA 4I2OA 2RV8A 1U3EM 2IA0A 1P92A 3GFIA 2M5WA 1U5TB 1CF7A 3WTWC 3NRVA 3DPTA 2OAZA 3BY6A 2DU9A 3FM3A 3GW2A 3E97A 4CYDA 5FLXK 5IT9Z 3KETA 4L0ZB 4RB2C 2FBKA 2EB7A 3JAMZ 1R58A 4IHTA 2ACJA 3GFMA 4FX0A 2EA2A 1OYIA 3L09A 2HWVA 2ZXJA 1D8JA 3L2CA 1WRJA 3G3ZA 4EV0A 5LLQA 4UV9A 5E8GA 5JVTA 3LSTA 3W6KB 1O7FA 2GWRA 3FXQA 4U88A 1TQIA 1FYLA 3P9CA 3F21A 3ABUA 3KLOA 4CXFA 5FLXZ 2P4WA 1QZYA 2R3SA 4UUVA 2GXGA 4LFUA 2KIMA 2V79A 4A0ZA 2GZWA 2VBYA 1SMYF 4OU0A 3ML6A 2IVMA 1TQMA 3WTSC 3KLNA 1U78A 1HKTA 4ZYHA 3F8CA 2Z9OA 3Q9VA 2CQKA 4GXOA 2XHKA 1BC8C 2QQBA 2STTA 2P7CB 4U0WA 4CO8A 5FD6A 5LHGA 5JR3A 1W5TA 1EH6A 4P96A 4YIFA 2XAGA 3IC7A 5LGTA 2L4AA 1KGSA 1L0OC 3QPHA 2HEOA 2FMLA 2JPBA 3KP6A 4MTEA 5BOXA 3M8EA 3ZP5A 5E1WA 2O8XA 3GO5A 2IW5A 5E20A 2R7FA 2HDCA 3FX3A 4PCQA 1GHCA 2UXXA 3SZTA 1RUNA 5L3DA 3F23A 3JSOA 2Z3YA 3Q9SA 4HV5A 3QU3A 1HSTA 5CYVA 4U7BA 5EEHA 1SAXA 2VT3A 2QQ9A 1R1VA 2ZNYA 3I64A 2QWWA 2YR2A 5BS6A 5K5RA 2FBIA 3JTHA 5D8KB 3LA7A 2KKOA 1ZG1A 5KK1A 2G7UA 2K4JA 5DD4A 2BYVE 3CO7C 1QQIA 1G3SA 4GO1A 3TO9A 3SQNA 1ZGAA 4D0PA 4EJWA 2W84A 3J80Z 5DDGA 4IPAA 2D2WA 3EETA 1PP7U 3WGGA 2WC2A 1ZRCA 1WI9A 2CW0F 3ZMDA 2IPQX 1DUXC 4CHUA 2B0LA 3D0SA 5J8FA 3BP8A 2XV4S 4S04A 1R5HA 1K79A 3MFKA 1XMAA 4HX8A 5JHUA 3KP7A 2BV6A 1QO0D 5CVIA 1HKQA 1U8RA 4KFCA 2RDPA 3ZMSA 5HLGA 2XAHA 4KA4A 3DV8A 1KQ8A 3COAC 2KIUA 1JE8A 3U2RA 1AOYA 2XAJA 5DD8A 1FLIA 2CFXA 2OBPA 4Y17A 2VXZA 3V7RA 2G7HA 3DFGA 3N97A 3HTUA 2V1DA 3RIRA 3I59B 3M9AA 2MA3A 4A5NA 2E1CA 3GZ5A 1XDUA 4XRFA 4HZFA 1S3JA 1YS7A 3L9FA 1QGPA 3E6MA 4AD9A 4A6DA 2PJPA 4RB0A 5CVVA 3TO6A 3HHGA 3HIFA 5HS9A 4G8XA 4KN4X 4EJTA 2F5FA 1LQ1A 2FNPA 3SZPA 4OIPF 4Q4ZF 3V8KA 1XGMA 2WWYA 3R6SA 1TBXA 1U2WA 6PAXA 3HRMA 5DYMA 1TNSA 2OQGA 2YSRA 1O3TA 1EH8A 3QOPA 4BH9A 1O3QA 1XGNA 2XIGA 3LA3A 3BPVA 3VOEA 2O6GE 3F22A 2CGPA 4A0XA 3QU6A 3SFZA 2AXLA 4E70A 2RNJA 3QPTA 2HR3A 4LLLA 3K0LA 2GIVA 3LAJA 2MH9A 3TDZC 3PQKA 1ZH5A 1FWZA 5J6XA 3WE2A 1RIOH 3KE2A 1R5GA 5LGUA 4WXDA 2H27A 4LD5A 1VTNC 1G6NA 3CJNA 4L9NA 4L9TA 3ZPLA 4L5JA 1O3RA 1Z1DA 2M45A 3HRUA 4XSXF 1BIBA 1FP2A 1USTA 2K7LA 3EYIA 1XDSA 3R61A 1Z7UA 2ZFWA 5AIPA 4M9ZA 3U1DA 2QBYA 1KA8A 3RYRA 1E17A 2JTVA 4Y13A 5DEQA 3BZ6A 3IWZA 2ZBKA 2FXAA 1TQPA 4I0AA 2D45A 3WG9A 2MD5A 2D1HA 4AIKA 4L9JA 3FM5A 2H09A 3WU1B 3ISPA 2P7VB 1BIAA 2MC3A 3D5LA 3KP2A 4Q48A 3DKWA 2XUBA 4M74A 2EJRA 1BC7C 3P9KA 5L3EA 5DCFA 1S7AA 2BGCA 3V4GA 2QUFA 2IRFG 4AIHA 1BM9A 1W7PD 3WODF 3ZMVA 1XMKA 3CUQB 1FNNA 4N0BA 4BXUA 1S7OA 3E6DA 1W7PB 3TGNA 3DF8A 5DV5A 2EV6A 3F72A 1DPRA 1SD4A 1IN4A 1BI0A 2K4BA 4I01A 1B4AA 1ZREA 1ZAOA 3C1DA 2M30A 3I54A 1UFMA 2HKOA 3BJOA 4G6DA 2A3SA 3TKYA 1ZG5A 4YG2F 2DTRA 1FZPB 4LLNA 4IRIA 3L00A 3F6VA 2OZ6A 4KUMA 4JBAA 3BPXA 1IN6A 2A07F 3GX4X 2M8EA 3KCCA 4PZJA 1XSXA 2DK8A 5HLHA 3ELKA 1ON1A 5ED4A 1XSDA 2NNYA 2Y75A 2WTEA 3RKYA 4LB5A 1OYWA 3LQRA 5L3CA 2EFOA 2DO7A 4LJZF 2L01A 2K27A 1QPMA 2FF4A 1I6XA 5ILSA 5A2QK 1YS6A 2EA4A 2RKHA 2OA4A 1JGSA 5CJ9A 2V6CA 5J8CA 2AS5F 3C7JA 4B09A 4O5VA 2ELHA 1YFHA 4GYIA 2PG4A 4I7HA 4WCGA 4RB1A 2BBYA 5IT9K 4F7ZA 5K5QA 1IUYA 4ENNA 3EQLF 3V8JA 1ON2A 4JQFA 4IF4A 3BJAA 2VONA 2UWMA 4ON0A 5A2QZ 1LDDA 3CO6C 2Y48A 1IW7F 1G3TA 3G73A 4MHGA 1P4XA 3M7GA 1SMTA 3O3KA 1OPCA 3SHFA 5FFXA 1YQAA 1IXSB 4BNCA 4M73A 1WQ2A 2VE8A 4I0BA 1LDJA 4M9SA 2EFPA 2PEXA 1J9IA 4U0VA 2M1BA 4M72A 1L3LA 1GXQA 2ESHA 4M6YA 3TO7A 3RTRA 3KP4A 1G3WA 3MCZA 2LKPA 2FU4A 4ENKA 4HYEA 1REPC 5FFZA 2ZJ2A 2CG4A 1E2XA 3N4MA 2DK5A 1MD0A 1DP7P 2A61A 2MLGA 4EM2A 2IJLA 2GA2A 2DQRA 3QRFF 4XBFA 1HKSA 1HXDA 3K1MA 2DLLA 4I09A 1MKMA 1CF7B 2XKPA 4IXAA 2ESNA 5KVRA 1K78B 1B9NA 3T5XA 4UVBA 4NHJA 3T0YA 2Z33A 1FP1D 4M71A 2OZUA 3RJPA 1V4RA 1XGSA 1R7JA 3TOAA 4N9HA 1UB9A 2LF7A 2HTJA 5AONA 1I1SA 3LFKA 2QM3A 4EM0B 3DXJF 2F5DA 1CGPA 3J80K 1KQ9A 1WKMA 4A6EA 3GVAA 1JHFA 3BOQA 4BHBA 1B9MA 4Y15A 3E5UA 1U5TC 4UXNA 2Q0OA 2XROA 4G7HF 1F1ZA 4KN7X 2HQNA 5TRDA 5FD5A 4KICA 1Z6TA 4WXCA 2DPDA 2G9WA 3OOPA 1MJ9A 3K9TA 4GCVA 2CO5A 4IJAA 2E7XA 3ZN1A 4Q47A 1ZGJA 2EV5A 2Y0MA 1FY7A 4IVNA 2F5EA 2QQAA 2QENA 4K2EA 4HOBA 1R36A 1W4MA 3RYPA 2D1VA 1Y0UA 2EK5A 1WWXA 3WTUC 4HBLA 4L9VA 3TDUC 3IRRA 4ASNA 2V1XA 5DCMA 4U7DA 4PDKA 3H3ZA 4OIRF 5D8LB 2BE5F 1FYKA 5E1ZB 1YYVA 1GVJA 2GA1A 3K1PA 4KIBA 4HF0A 2K86A 1ZG3A 3KFWX 2A5YB 5ERIA 1XD7A 4UHTA 3GLXA 4MEYF 3WU0A
chains in the Genus database with same CATH superfamily
4KJZA 5FKNA 1N75A 2Y9ZA 2R4GA 2IA2A 5ICEA 2CFOA 1YW9A 1W5SA 2PBIA 3ULQB 2BHYA 2KIQA 1R4MB 3OR1C 4KMUX 4YIIA 4MTDA 4RGUA 1T33A 3WTZA 5K1YA 3B6AA 3EUHC 2AQFA 3B73A 3OIOA 4ZYAA 4HA8A 3DLAA 1ZRFA 1FX7A 3IHUA 2F5CA 4DZPA 5EDNA 4A5MA 2O7OA 3JRIA 1YJNI 5DUKA 1UHMA 4ETSA 2QKLB 3H36A 1RRJA 3KYDB 3CDLA 3OYLA 2DPUA 1K7AA 4EGZA 4BAYA 5EZGA 3FMQA 1Z67A 2VQGA 4CICA 4I6ZA 2ID6A 2NRAC 2ISZA 4ZZLA 4G7OF 2YU3A 3GEZA 2WA0A 2HYGD 2IEKA 4EMSA 1HCRA 2Y0SN 3B02A 2OUMA 4G7ZF 1YX5A 3J81K 5FO5A 4MQVA 5D6EA 1JTYA 4B4CA 5GP9A 2DQLA 4NC7A 2ZC2A 1Z0XA 3UR3C 1WSUA 1S6LA 3GZNB 2FEZA 3M8FA 3I5UA 1R9TJ 1JXSA 1MIJA 1ODDA 2KT0A 1FBQA 3S3NA 2I10A 4N4NB 2EZLA 5IPAA 1IC8A 3CMMA 1SFKA 2PN6A 3RSNA 2F4MB 4IQ4A 4BU2A 2XRLA 5J3LA 1QVUA 4LGWA 2YU9J 4DYRA 1MBGA 3H3UA 1FSHA 2FOKA 3FMRA 5EG0B 2K3PA 2NYXA 3W6JB 3R0AA 3GUDA 2DOAA 2CW7A 1YLFA 3K2ZA 2KIFA 2FMYA 3BR5A 4C2TA 3G4SI 4XM3A 3ZQ7A 2QSHX 3C2HA 4HQMA 4BKXA 2LVSA 3KEQA 2GBYA 3CCLI 2UUZA 1BI2A 3BG9A 1T38A 2DA3A 3M1EA 3OYFA 4OWRB 4AIJA 2EINH 3S2WA 3J81Z 4E7HA 2B7EA 2M87A 3GFJA 1I3QJ 3M8JA 3JRBA 2J5OA 3QAHA 2FUG2 3BR2A 2R7WA 3GCMA 3ZMUA 2C6YA 1G3YA 2VQLA 5FROA 3TW7A 2XGEA 1NH3A 3HOUJ 1F5TA 3CCQI 1MBJA 4CA0A 3ERED 1MSFC 2PMZA 3KZIC 4F92B 2PFBA 4ZJZA 4I98B 3LQQA 4LG0A 5CLSA 1OCOH 2Z5UA 3V42A 4WX9A 3AG2H 3CDIA 2HVQA 4D9JA 1IRGA 2V7FA 3GFLA 2JSCA 2HPIA 1DP3A 2QSGX 1LE8B 2JA6J 1NHAA 3TP3A 3GWZA 1FC3A 1DGRM 3D5RC 2LBFA 4B8XA 2H1LA 4KMFA 2KFDA 2UXNA 3LSHA 3HUGB 1J0RA 3C2GA 5LEJA 1V54H 4Z6YA 2DJIA 2A6HF 2ZJRF 1T0FC 2K3FA 5L3GA 3FISA 1SD6A 1AHDP 2V26A 3KP3A 1QA6A 3AAFA 1J09A 2EILH 3HBLA 2WAQA 1H9TA 4RM2A 1TT5B 3K6GA 3H5AA 1Z6RA 4AVPA 3PFIA 1GVDA 2M9HA 3GF2A 4BGDA 4HF2A 4ZYDA 4M6VA 1H88C 4AC0A 3VYSB 3DP7A 4A3LJ 1Y6IA 2BW3A 1VNDA 3JRFA 2CSOA 1LDKB 2HKXA 2EZIA 2TDXA 4BY7J 4HDVA 2OU2A 2VBXA 3BQYA 2LNBA 4BJ5C 2JA8J 2D5VA 5HVQC 2PMUA 1XN7A 1RUOA 1HQCA 2E19A 4HDUA 2IP2A 4XQFA 4D7NA 4P5OA 5D4RA 1YRNA 2O61A 3HOYJ 4HSTA 2GLOA 2XVCA 4KIFA 1MDMA 2W25A 4KT5C 1ULYA 4OOIA 1IO2A 2ZSHB 4RLQA 4EJOA 5IP9J 2UZKA 1S72I 2JA7J 2ETHA 1NK3P 3HOTA 1D5VA 2K9LA 2KRCA 3FIWA 3OWTA 5E17F 2IBDA 2NS7A 3RKWA 3PIPF 3FK6A 5E3MA 2ZMEA 1OFCX 2DW4A 5GTIC 1Z21A 1TTYA 2BXYA 4HQEA 1HF0A 4KDPA 2BY0A 2HFHA 3RKQA 3BZKA 2R7DA 1LEAA 3VDXA 4KYWA 1TLHB 2A6EF 3GBGA 2P6SA 5B3SH 3HKZA 4KISA 1RC9A 4HSRA 2MFZA 1R00A 3I58A 1A04A 3M4OJ 2VC0A 2P5VA 2ICWG 5TJJA 3VB2A 1TNTA 3R4KA 4II3A 2W85A 2E5ZA 2LF8A 2YX7A 2W24A 3HPHA 3HL2A 2FRHA 3F8BA 3TL4X 4R79A 1ETOA 4XL9A 1R22A 2L3DA 2K9QA 2H6BA 1A31A 4GFBA 2P8TA 2EFNA 2RQPA 1Y56A 2HQ5A 1KU9A 3R60A 4E7ZA 4G94A 1R71A 4S05A 4CCKA 2QBYB 2VOOA 4WXHA 3S1NJ 2HOSA 4FETA 3G2BA 4E7SA 2H6CA 2LKXA 2X1EA 2IGMA 1P4WA 3M1CA 3QYFA 2Z99A 3V8LA 2DFHA 2COMA 1S29A 1D0YA 3K2AA 2HDWA 3W3CA 5D5WB 3IRQA 2YX4A 2HGCA 4M3DA 1BN5A 4RDUA 1K6OA 2DAOA 1OMIA 2BZTA 2PI0A 2JUGA 1DDNA 1T56A 1U5TA 1AWCA 3DCFA 3ZN0A 1JI8A 3FF5A 2NS0A 5H2FC 2QYOA 1LVKA 1QNTA 2QEXI 4J01A 1X1BA 2WV0A 4Y7NJ 3ECOA 3RPQA 3F9KA 1ZN2A 1LFUP 3WTTC 1FIPA 3FXMA 2FOWA 1K61A 4IHVA 4BY1J 4ENJA 4ZZDA 4XNFA 3HOSA 3A01B 2HS5A 4BE2A 2GIZA 3JW4A 5JFRA 1TWCJ 1HBXG 2E2HJ 3CP8A 1ZLKA 2BEOA 1ETYA 3V7CA 1IXCA 2BY3A 4JP0A 3CCYA 3CZ6A 4XN0A 5E3OA 3S3OA 3AG4H 1VQKI 3IUOA 2E1OA 1F9NA 2CQXA 2F5VA 1JUMA 1JKPC 3JRDA 2MG4A 2NNNA 3I4PA 5J1UA 5GAHJ 2ME6A 5D5XB 1DPUA 1Z05A 4ESBA 2VPLA 4KIGA 1JT6A 2VKEA 1Y39A 4OIOF 3WG7H 5CVRA 2OQRA 4M3FA 3FXOA 1SFXA 4A3FJ 4DQ2A 3U21A 3HOWJ 1J2XA 1Z91A 2Q8KA 2HYFA 1N78A 5HOOA 1KYWA 3S8PA 1O4XA 2F4IA 4HX4A 3LOCA 4G9YA 2JT1A 3MAJA 1SAUA 2E7WA 2RVCA 4YFKF 1XC5A 4EGYA 2PJRA 1RKTA 5L3FA 4XICA 5LFAA 3EDPA 4B43A 2BOLA 3NEUA 4P55A 3CMEI 3RZDJ 2XC7A 2JSPA 5BPIA 3RZOJ 2WADA 4XLNF 1HDDC 4Y52J 2V1NA 4XOPA 5C44J 5LRSA 2ADUA 2HVSA 4U87A 1LVAA 3KEYA 4A3IJ 3GTKJ 5AIQA 1A5JA 2FD5A 2FBHA 1AKHB 1EF4A 3FKJA 2FNAA 1OKRA 5HS7A 4OMYA 4CYCB 2P5LC 2CH0A 1FIAA 3DTIA 2GQQA 2E1MB 2DMTA 2JZYA 3PNYA 5IY5H 4PFOA 2LG4A 2Y0SA 5HLIA 3CCSI 1EV7A 1QHHD 2LYCA 3CUQC 3JRGA 2EZHA 2OC6A 3H35A 4HNUA 2LH9A 2Z2SB 1ORKA 1K78A 3DEEA 1FMWA 3HDDA 1MGTA 3CF2A 2NXNB 3H3VK 2WBMA 1F43A 2VBWA 2BVLA 1SFUA 2GAUA 5LRRA 1R23A 1SVMA 3EUHA 4CGZA 2OD5A 4I02A 5HDNA 2KRFA 3KX2A 2O9LA 2P6TA 4JX4A 3DU6A 4XKBA 1ITYA 5L3BA 4ZH4F 3HGGA 1IRXA 2N8GA 4HV6A 5LHHA 3VODA 4CDGA 2OCEA 3WHCA 2EFQA 2GXAA 3BROA 2XGXA 4FHTA 2V9KA 4MFDA 4BYYA 1LUJB 2QGUA 2ZNZA 5EYRA 1H8AC 1YW8A 2ZXIA 4DIQA 1Q1HA 3DBLB 1FSEA 2W4SA 2R92J 4E7LA 2J5PA 5B66C 4JOMA 1ZLJA 2LY2A 3IH4A 2CV2A 3BJ6A 4LLGF 1B72B 1LNWA 3M07A 3EYYA 1IV6A 5EGOA 1UG0A 1X4OA 2DOFA 3MZHA 5H6RA 3QP6A 4N9IA 3P9IA 5CVUA 5F0FA 2VT2A 2HTSA 2XGCA 1V5EA 2LP0A 4PJLA 2IS1A 1OCCH 4Q5SF 1I1GA 3X2QH 1U6GA 1FOKA 1TL8A 2E34A 3MMYB 2VJIA 3HZJA 4FTHA 1I3AA 3FZVA 3OYHA 2YPRA 3DEWA 4BQAA 4XKCA 2PQ8A 3OSGA 4KNYA 2JA5J 1X2MA 3K1NA 4V2FA 4RAYA 3OYCA 5GAEJ 3HRSA 4CZZA 3RI4A 2VC1A 3ABTA 1HA8A 1V3FA 1KQ0A 5IYDJ 2RQQA 4YRVA 1YITI 1ETQA 3KZZA 2E2IJ 4ESJA 2HOEA 5JI6A 3DBHB 4A2UA 1B6AA 4KT6A 1J7KA 1A6IA 1K4TA 2JRTA 1QU3A 1KYZA 2VOPA 3Q0WA 5K5OA 1BBYA 3HEFA 2VPRA 2KPMA 5J4VA 3GXOA 2XB0X 1J59A 1T6SA 4C3JJ 1GXPA 5HDKA 3I0TA 2Q2EA 3E3VA 3JSPA 2XAFA 4BL0B 3P7NA 4Z2YA 1ZHFA 1LPQA 3NQOA 3H9GA 4UV8A 5DUIA 2EV0A 3CDHA 5CQGA 1XGOA 2NOJB 5CVJA 3BTIA 1K6YA 2QSFX 3UKGA 4YFNF 3WTXC 1YTYA 2CWEA 5F6FA 2WB1N 2ZB9A 1T2KA 5H20A 3HB9A 1HDPA 2VJJA 3WE3A 2RC4A 5FKLA 5J1RA 2E60A 1S8NA 2FE3A 4RLFA 1O7LA 1T0FA 4NQWA 3I53A 2MH2A 1IAWA 3IWFA 3O6BB 3I4NJ 3U9GA 3ZMTA 1XCVA 3O2PE 1BOAA 4WK8F 4N4OB 5ICGA 4BUPA 2X48A 4ZTFA 1FYMA 1B1BA 4AM3A 3FXRA 4B48A 3IH3A 3AKZA 5IOYA 4P9FA 3Q5FA 4NNJA 1Y8RB 1GDTA 4QIWN 3AG3H 1JKOC 3L2UA 3SFIA 1XB4A 2DI3A 1YIOA 3EPZA 4UVCA 3Q0UA 4A3GJ 2GXBA 1FTTA 2XASA 3MVPA 2VB6A 3HJEA 3HTSB 3I59A 1MNDA 1P9QC 1EA3A 3OYMA 4RS8A 3WGHA 1OR7C 3ROUA 1PUEE 4U0YA 3KIOA 3BCAA 3DEUA 1UHWA 1RZ4A 1WJAA 4EJUA 2X0LA 3OYNA 3DPLC 3GTMJ 3HSEA 3MZYA 1IXRC 3F3XA 2ISYA 2F4OB 4HX7A 5EEAA 3SJMA 2L02A 1I5ZA 2P5KA 3C18A 3HSRA 2X1CA 4OINF 4HLXA 5ICCA 5CKTA 2FQ3A 4L5IA 4A0YA 3E5XA 4LMYA 3BWGA 3GTQJ 2O03A 1V5GA 3ZQIA 3F8NA 3FXJA 3LSMA 2MW8A 3PQJA 1NG7A 3MQ0A 5ICFA 1UHSA 4UVAA 1P6RA 2QZ8A 1OJLA 4CCOA 5BQTA 2A05A 2K85A 3HM5A 4WF2A 2L9VA 2O8KA 3KEOA 4ENMA 2STWA 1QBJA 2Y30A 1G4DA 3A02A 1SANA 2YS9A 2ZSIB 5E1XA 2KJBA 2IGOA 1Z77A 1D1BA 3TBIA 2XSDC 3AL0B 4IL6C 3IKVA 3L2VA 4FQGA 1EH7A 1E3OC 3HYIA 4BJTA 1HW2A 3S2DJ 1MJBA 2ZXHA 1T98A 3VEPA 4M9XA 5HODA 2LOOA 1VQ8I 2NAZA 2QF7A 4JK1X 1UZCA 4PJ0C 3OYAA 1QZZA 1ZYRF 2JMWA 3IAS2 4Y3OA 2QA4I 1JT0A 1HSJA 3OV8A 2VE9A 1B59A 3A2KA 9ANTA 3Q3SA 3WU2C 1C0WA 2Q1ZB 5M5WJ 2FA5A 3L1PA 1MMNA 4DNCA 5E3LA 1Y8QB 3TMOA 1IF1A 1ACIA 3H92A 3C3WA 3E6CC 3T8RA 3TOBA 4AVZA 2DT6A 2EPFA 3K4LA 1H9GA 1O57A 3BT9A 5JHFA 4RGSA 2VIXA 2CYYA 2Z1DA 4EVIA 1ETXA 4UB8C 2IT0A 4PGGA 2KZGA 5D5VB 2DCEA 4RB3C 3ERMA 4ANJA 3CJQB 5IT3A 1MNEA 5D5UB 2W57A 3IL2A 2X6XA 1MMSA 1BJAA 4B44A 4HF1A 2M4GA 1RESA 3A03A 2A6TA 2X6OA 3PSIA 1IZ1A 1FPQA 3HOXJ 1FBUA 2H94A 5F08A 2VKVA 2VUMJ 2NVYJ 1IN7A 4BHCA 1WJDA 4L18B 1AA7A 4WWCA 4IHSA 2HVRA 2FSWA 4HPQA 5DCMB 3VFZA 2HZTA 2MBFA 1MZBA 2RN7A 2ZCWA 2DMNA 3LSIA 4OIQF 2M2EA 1P4AA 1WH7A 3OOUA 3HUGA 4O6JA 5LGNA 3GZ6A 2QLZA 3J7AO 2E1NA 1F36A 1OQYA 2Y2ZA 3WGIA 4AWXB 4UUSB 3CLOA 3E7LA 1W5CC 3H9QA 5FKOA 1ONVA 5J40A 4FT8A 3H5RA 2DBBA 1YHQI 4AU7A 1IN5A 3CMAI 2XF6A 1BW5A 1BI1A 1S7EA 2PLYA 1ZGWA 4RGRA 1PVEA 2Y9YA 3LWFA 2JRMA 3BG3A 2R5YB 2H8WA 2JPCA 3MWMA 3U1KA 4TV7A 4PJMA 4XLAA 5IYBJ 4IKFA 3FXKA 3UNGC 2NOGA 4MFEA 1TW2A 2O3FA 1SFEA 3K4MA 2CUFA 1H0MA 3OS1A 2ELJA 4HLYA 2VI6A 1DGWY 3NARA 2DMPA 5FB2A 5DS9A 2X6YA 3LAPA 1RI7A 3R0JA 2L9NA 3E5QA 4A12A 1X3UA 4HEA2 3ECHA 3SYTA 1UAAA 2ZO4A 2DFIA 3K4KA 5LBQA 1KU3A 1MJAA 4MQ9F 2HDDA 2VJ4A 1USSA 1VQ7I 5BMZA 5LHIA 1CQTA 3EUKL 5ILVA 2LREA 2HQRA 4IRGA 3DPUA 1BI3A 1ZRDA 3H0DA 4E4HA 3MEXA 4OMZA 1IN8A 2NVXJ 1U9NA 1SD5A 4DOZA 2X4HA 1Z9CA 2CQ7A 4YFXF 5ILUA 4QLCU 2DMQA 5E18F 3CUQA 2XKOA 3IKTA 4UB6C 4JX5A 5E8IA 4H0EA 3PFYA 2EWNA 2LSOA 3ZMZA 1TW3A 3E6BA 2L54A 1R1TA 4XORA 3CJRB 1W7PA 4XR6A 2R7QA 1WH5A 2VODA 3B6CA 3D1NI 4MNUA 2A69F 1O3SA 1STZA 2VASA 3C2BA 4EM1A 3ABMH 1JHHA 1SD7A 2NVUB 4HNVA 4RGXA 3I71A 4PGHA 4RA2A 4R1HA 1D3YA 4DYCA 3F0CA 2VN2A 3F8MA 1ZARA 4QWQA 3E1SA 5BNGA 1R1UA 1EJ9A 2KJCA 3WTVC 4DJAA 1LEBA 4GRIA 1LB2A 3FXLA 3TEDA 2PMHA 2K9MA 2O5RA 2V1UA 1WFXA 2F2EA 3CCJI 2BY2A 2M7AA 3A1YA 2CUEA 3LA2A 2LLKA 2K5CA 4FE7A 5D6FA 3K4JA 5HDGA 5JVGF 1NTCA 4HAMA 2M0MA 2V9VA 2CU7A 3OL3A 1RKWA 4R8HA 1XS9A 2A68F 3HSFA 3RPUA 1XX5A 4NB5A 3KZYA 4LK1F 3ZQFA 3S32A 5BPDA 4HNTA 3CESA 1XSVA 4IRHA 1U8BA 3T8TA 1IRFA 2ZKZA 2OJED 3FHZA 4LG0B 3LSRA 5F1RA 2XRNA 4XLPF 2O0YA 1VQ5I 2EFWA 1NK2P 4ESFA 2DYSH 1DQUA 2L4MA 1H89C 1B8IA 2R7SA 2L7KA 1X3WB 2VBZA 2LBFB 3CTAA 4UNOA 2CUJA 2KL4A 3QP5A 3GYHX 2LDUA 3V7SA 3JREA 1WJFA 1HW5A 3FMSA 1TWFJ 2LK2A 3DQVC 3LFUA 1D8KA 3H0GJ 3T1BA 4FE4A 3CMYA 1JKRC 1VQPI 1P2FA 2DDAA 1PUFB 2QVOA 2WAFA 3TQNA 4A3MJ 1FBSA 4EQQA 1X2NA 1ZTRA 1VQ6I 3REOA 4P9UA 3FBIB 4L0YB 2VKHA 4IO9F 1Z3XA 5KNLA 3JRCA 1J75A 1YG2A 1PDNC 5F64A 2IGNA 3FWEA 2BW3B 2QCOA 4LK0F 3FXUA 2DT5A 2LC2A 3F6OA 3LL7A 1RR8C 2IA1A 3PJRA 3CCUI 1T39A 3S2HJ 2XDVA 1VQ4I 2HZDA 2F48A 1VFCA 3L7WA 2FJ1A 3L2WA 2W7NA 2LD5A 2MABA 4HW0A 5KAIC 2CQQA 4G6QA 3JTGA 1OCPA 1OYYA 2NVTJ 1TC3C 1VQLI 2K40A 3JR9A 1YRNB 3ZQQA 3QQAA 2MLKA 4GDFA 1UMQA 4PFPA 5H6QA 1MDMB 1I6HJ 4BEHA 4M6XA 5LEKA 3F8FA 1KU7A 1Y0NA 4BHPA 4IQJA 1PP8F 1KU2A 3KP5A 3RDIA 4L5EA 1YO5C 1LJ9A 2ZMEB 1FOYA 3H1CA 4BQQA 2GM4A 4MGRA 3BR1A 2R5ZB 4AUXA 2ELKA 4EATA 3RCOA 1NG6A 5E79C 3HPGA 2CQNA 2NS8A 1ZKGA 2WAEA 4LB6B 4G6TB 4XSZF 5EEGA 1X1AA 3BLYA 2M34A 2RGVA 4UY8I 4P1WA 1YJ9I 3CCMI 1HLVA 1I27A 3WTYC 3AFHA 3K4CA 5HS8A 3BDDA 1W0UA 3L2RA 5M3FJ 4GGGA 4PSWA 4D7MA 2K9NA 4EJVA 5D4SA 3RKXA 1OR7A 1YW7A 2DA1A 3BG5A 4IEJA 1N25A 4QSHA 4MO7A 2ECCA 1D1AA 5FGMA 4RAZA 5JLXA 3CCVI 1RNLA 1F4KA 3BTLA 3SEZA 1J5YA 4ZYGA 1PJRA 1MBEA 1XCBA 5IP6A 1UCRA 5LD2C 5B5EC 5J4YA 3GTOJ 1HW1A 2E36A 2KRHA 3CUOA 3QOEA 3K69A 2K02A 4O3MA 1GUUA 2MC4A 2MGQA 3HRTA 2ZJQF 4NC6A 4D1QA 1FT9A 2V9PA 3SXYA 1D5YA 4MEXF 2XAQA 3HHHA 4F55A 4AYBN 4LIVA 3LSKA 3JAMK 1XPXA 4FX4A 4ZYEA 4GYGA 2E2JJ 1B72A 4I2OA 2RV8A 1XTAA 3HOZJ 2R7OA 4BBRJ 1XMXA 4FASD 1U3EM 2K9SA 5HNFA 2IA0A 3OL4A 1P92A 3GFIA 2M5WA 4CZCA 1G2HA 1U5TB 3H5NA 1CF7A 1QHGA 2BHZA 5B1AH 3WTWC 3NRVA 1OLTA 3DPTA 2OAZA 1JKQC 4EEFG 2DTZA 3BY6A 2DU9A 1D1CA 1R4NB 2GOXB 3FM3A 3I56I 1ZQ3P 3W2AA 3GW2A 2IS2A 1WJEA 3E97A 3G71I 4CYDA 1W36C 3OYIA 5FLXK 3J7YJ 3CCEI 1YX3A 5IT9Z 3OY9A 3KETA 3MKLA 4L0ZB 1U9OA 4RB2C 1WJBA 1IGNA 2FBKA 2EB7A 4CCNA 3JAMZ 1R58A 4I99C 2P0WA 2WY7Q 4IHTA 2R7VA 2ACJA 3GFMA 4FX0A 3MKYB 2EA2A 1X1DA 1OYIA 2HOTA 3L09A 2DT7B 2HWVA 4BBSJ 2ZXJA 1D8JA 2V4JC 3L2CA 4B47A 2VQHA 1WRJA 3QPLA 4Y4RA 2IXSA 3G3ZA 4EV0A 5LLQA 1U0JA 4UV9A 5E8GA 5JVTA 3IAM2 3ZXSA 3TW6A 1R5ID 3LSTA 3K70D 3CC2I 1O7FA 3W6KB 1N77A 1E3PA 1UJ8A 2GWRA 2LFBA 3FXQA 4V2GA 4C3HJ 3ZGKA 4U88A 1P7IA 3J7AY 1TQIA 3IV5A 2LKSA 3CF5F 1FYLA 3P9CA 3F21A 2DDBA 3JCUC 3ABUA 3KLOA 2Y31A 5HNHA 2PJRB 4J00A 4CXFA 2R7UA 4M3BA 2DXIA 2DA6A 5FLXZ 2P4WA 3CP2A 1QZYA 5FKMA 3K4BA 2DN0A 3SDBA 2R3SA 4QTRA 4UUVA 1K4SA 2GXGA 2A5WA 4LFUA 2KIMA 2V79A 4A0ZA 2XB5A 1V55H 2GZWA 2GOMA 2OF7A 2VBYA 1SMYF 2L2OA 2VLAA 4OU0A 3ML6A 2IVMA 1TQMA 3WTSC 3MZ8A 4DBRA 3VPRA 3KLNA 1U78A 1HKTA 4ZYHA 4X0GA 1ETWA 3PIOF 3F8CA 3VYTB 2Z9OA 3PM1A 1G8XA 3Q9VA 3GLLA 2CQKA 3PO3J 4FISA 2M7BA 4GXOA 3S1QJ 2LY9A 4DW6A 2XHKA 1HOMA 1BC8C 2QQBA 2IGKA 2STTA 3P5JA 2R93J 2P7CB 4A3CJ 4U0WA 4LITA 4PK4A 1Q1VA 2XF5A 1S5LC 4CO8A 5FD6A 3A0HC 4F93B 5LHGA 5JR3A 2JQ7A 3G1OA 1W5TA 1EH6A 2M8GX 1WVRA 3PUFA 4P96A 5B1BH 3S93A 3SZGA 4YIFA 2X1DA 2JA2A 2XAGA 3IC7A 3VYUB 5M3MJ 4BQNA 4BDZA 2EH3A 5LGTA 2L4AA 1KGSA 1L0OC 3QPHA 2HEOA 2FMLA 5EZHA 3ZQLA 3S1RJ 2JPBA 3KP6A 4MTEA 1QVTA 5BOXA 2MD0A 3DWLE 3LSGA 3M8EA 3TP0A 1MBHA 1KONA 3ZP5A 5E1WA 2O8XA 3GO5A 3VSLA 2IW5A 5F27A 5E20A 2JK3A 2R7FA 2HDCA 3FX3A 3BR6A 3BQZA 1V5FA 4RBOA 4PCQA 1GHCA 2UXXA 3SZTA 1RUNA 5EGOB 3OYEA 5L3DA 3F23A 2E1MC 3JSOA 4XRSA 2Z3YA 3Q9SA 4HV5A 3GMEA 3QU3A 1HSTA 1HC8A 1ERDA 5CYVA 4U7BA 5EEHA 1SAXA 1BR4A 4DBQA 4QPQA 2VT3A 3RQ4A 2QQ9A 4ZDLA 1R1VA 4PSXA 4YELA 2ZNYA 3I64A 2V6EA 4A3BJ 2QWWA 2YR2A 3OMYA 5BS6A 5K5RA 1X1PA 2FBIA 3ESWB 3JTHA 3MN2A 5D8KB 3S15J 3LA7A 2KKOA 4F3QA 2DMUA 4YIRX 1OCTC 1D0ZA 1ZG1A 5KK1A 2G7UA 4XKWA 1BL0A 4XN3A 2K4JA 2X6WA 5DD4A 2BYVE 1RR7A 4BQOA 2E35A 1FOWA 1MMAA 2LMDA 3CO7C 1QQIA 1SC7A 1G3SA 5C4XJ 3DKYA 3ZOBA 3QYEA 4GO1A 3TO9A 3SQNA 1DU0A 1ZGAA 4D0PA 1WZ2A 2AQEA 1Y1WJ 5FLMJ 3E0JB 4EJWA 2L7MP 2W84A 3J80Z 5DDGA 4IPAA 4D5CA 2D2WA 3ZQCA 2DYRH 1FMVA 3S16J 2CV1A 1TWGJ 3EETA 2W48A 1PP7U 2KDOA 1A35A 3WGGA 2WC2A 1ZRCA 3FBNB 1A6QA 5C4JJ 1A36A 1WI9A 2CW0F 4ZC3A 3ZMDA 4F52A 2IPQX 1DUXC 4CHUA 2B0LA 3D0SA 1Y1VJ 2AXTC 4CSWA 3BP8A 2XV4S 5J8FA 4S04A 5FRMA 2FX0A 1R5HA 3EUAA 1K79A 2DA7A 2R7RA 2VJ5A 3HG9A 3MFKA 1XMAA 4ZTJA 4ABZA 4HX8A 5JHUA 1BJZA 3KP7A 4G12A 2BV6A 3HOVJ 1RPWA 1QO0D 5CVIA 3OS0A 1HKQA 1U8RA 4KFCA 2RDPA 3ASOH 3ZMSA 5HLGA 2XAHA 5EG0A 4KA4A 4NQWB 3DV8A 2HPMA 1KQ8A 3LSPA 2HYJA 3COAC 2WV1A 2KIUA 1JE8A 3U2RA 5GPCA 1AOYA 2XAJA 1GT0C 1RETA 1G59A 4C9YA 4ZDOA 3DTEA 5DD8A 2R5YA 1FLIA 2CFXA 2OBPA 4Y17A 1IV8A 2XGDA 3DKXA 2VXZA 3V7RA 3O8HA 2G7HA 5FRNA 5TISC 3BG7A 3DFGA 4IZZA 3N97A 4LOCA 4DZJA 3HTUA 1BR2A 2LRDA 1SFOJ 2BXZA 5K7HA 2V1DA 3RIRA 2CW8A 3I59B 1VF9A 3K7AJ 5K7ZA 3M9AA 1SVOA 2MA3A 4E6KG 2HXIA 4J19A 2P81A 4JX6A 1BA5A 2RREA 1JGGA 3BTJA 4A5NA 4PUSA 2E1CA 4IHYA 3GZ5A 1XDUA 4XRFA 5K7FA 4HZFA 2Z16A 1YIJI 4IOCF 1VQ9I 1S3JA 1YS7A 3L9FA 1QGPA 4XRMA 3E6MA 4AD9A 1LE8A 4BS9A 4A6DA 1YOVB 2PJPA 2DJNA 5TGTA 2CUZA 4RB0A 4Y33A 5CVVA 3TO6A 3HHGA 3HIFA 5HS9A 4IHXA 4G8XA 1QRYA 5F04A 2QKMB 4M3EA 4AYBA 3GTJJ 4KN4X 4EJTA 2F5FA 1LQ1A 2FNPA 3SZPA 4OIPF 4Q4ZF 3V8KA 2Y69H 1MMDA 1XGMA 4CCJA 1I50J 2WWYA 1VQMI 3M3YJ 3R6SA 1TBXA 3CLQA 1U2WA 3HC7A 3CC7I 6PAXA 3W6VA 3FK7A 3HRMA 5IOZA 5DYMA 5E3NA 1TNSA 2OQGA 2YSRA 1O3TA 4IOAF 1EH8A 3QOPA 5KCMA 4BH9A 1APLC 2E71A 1O3QA 1XGNA 2XIGA 3QYBA 2LR8A 4BXXJ 3LA3A 3BPVA 2DFFA 3VOEA 3ZRGA 2O6GE 1T95A 3F22A 3DBRB 2CGPA 4A0XA 3QU6A 4E7IA 3SFZA 2AXLA 4E70A 2RNJA 2YUSA 1P7JA 3G1MA 3OR2C 2ZJPF 3QPTA 5JLWA 2HR3A 4LLLA 3SDGA 3K0LA 2RNGA 4NBQA 2GIVA 3LAJA 1IDZA 2MH9A 3NWTA 5KAFC 4BACA 1GV5A 2EQRA 3OYGA 3JRHA 3TDZC 4IX7A 4XMYA 5C3EJ 3PQKA 3QODA 1FWZA 4W1UA 3OYDA 1ZH5A 5J6XA 2MYSA 1TP4A 4E7JA 1WGXA 4XIDA 2KISA 3WE2A 2X9DA 3KE2A 4QPOA 1RIOH 1R5GA 1MW7A 5LGUA 1W0TA 4WXDA 3AL0C 2CV0A 2H27A 4LD5A 2XPWA 1VTNC 1G6NA 2BY1A 3CJNA 4L9NA 1IRZA 3DTKA 4L9TA 4YEJA 3ZPLA 1ZELA 1ZR4A 2COBA 1TT0A 4L5JA 1PUFA 1Z1DA 1O3RA 3AG1H 2M45A 4A69C 1WI3A 5GADJ 3HRUA 1FEXA 4XSXF 4AIDA 1WJ5A 1BIBA 2HI3A 1FP2A 1USTA 2K7LA 3EYIA 1XDSA 2X51A 3R61A 1Z7UA 2ZFWA 5AIPA 4M9ZA 3D5SC 3U1DA 4LIUA 2QBYA 1KA8A 3RYRA 1VQNI 1E17A 3K4NA 2JTVA 4DGWB 1JUPA 4Y13A 5DEQA 1D0XA 1R6RA 3BZ6A 3IWZA 4RAGA 3ZQHA 2DA5A 2ZBKA 4XONA 2L7ZA 1BW6A 3NWSA 2EIKH 4XOTA 2FXAA 2ZXWH 2VXDA 1TQPA 4I0AA 2D45A 3I3LA 1LFPA 3WG9A 1UG2A 2MD5A 2D1HA 4AIKA 4MLOA 5GPAA 1JJ8C 4L9JA 3FM5A 2H09A 3WU1B 3OSFA 3IH2A 3ISPA 1TZLA 2P7VB 1BIAA 2MC3A 3D5LA 2KLOA 3KP2A 4Q48A 5DM6F 3DKWA 2XUBA 2R5ZA 4M74A 4JYKA 2EJRA 2M0CA 3A01A 1BC7C 2HOAA 3P9KA 5L3EA 4I76A 5DCFA 3ZR8X 1WHUA 1S7AA 2WB1A 2BGCA 2RAEA 3V4GA 2QUFA 2IRFG 3N05A 4AIHA 3QPSA 1BM9A 1W7PD 3WODF 3ZMVA 1XMKA 1W36D 3CUQB 4XK4A 1FNNA 3SEQA 1VI0A 4N0BA 4BDYA 2ECBA 2XPUA 5EF6A 5GAGJ 5DTDA 1VZ0A 4BXUA 1S7OA 3E6DA 3Q0VA 1W7PB 4X1EA 3TGNA 3DF8A 5DV5A 2EV6A 3F72A 2JN6A 1DPRA 2L5QA 1SD4A 1IN4A 2H1KA 1MBFA 1WJCA 1BI0A 2K4BA 4I01A 4NDLA 1B4AA 1ZREA 1ZAOA 3BC8A 3C1DA 2IS4A 2M30A 3I54A 1UFMA 2HKOA 5HLTA 3RQIA 3BJOA 4G6DA 4S0HB 2A3SA 3TKYA 1ZG5A 5CPRB 4YG2F 5J1YA 2DTRA 2F6CA 2KZVA 1FZPB 4LLNA 4IRIA 3L00A 3F6VA 2OZ6A 4KUMA 4JBAA 3RPUD 1X4PA 3BPXA 1IN6A 2A07F 4D5FA 2ZFUA 3GX4X 2M8EA 3KCCA 1YI2I 2KMUA 4F91B 4PZJA 1XSXA 2DK8A 3PNVA 5HLHA 1SEUA 3ELKA 1AKHA 1ON1A 5ED4A 1XSDA 2NNYA 2R7XA 4CYCA 1EKEA 2L9SA 2Y75A 2WTEA 3G1LA 3RKYA 2PX9A 3OIQA 4XLFA 4LB5A 1OYWA 3LQRA 5L3CA 5F0CA 4XLEA 2EFOA 2DO7A 4LJZF 2L01A 2ID3A 2JUCA 4ITVA 2K27A 1QPMA 2FF4A 1MNMC 1TWHJ 1I6XA 3DU5A 5CQEA 2HU9A 5ILSA 2M4KA 3S14J 3QWLA 1B8IB 5A2QK 1YJWI 4V19K 3LMMA 1MH4A 1YS6A 2EA4A 2CRGA 2RKHA 3BCBA 2OA4A 3W2VA 1T08B 1JGSA 5CJ9A 2L9RA 2DA2A 2V6CA 2XSJC 5M5YJ 5J8CA 2AS5F 2X85A 3I4MJ 4C2MJ 3C7JA 2B63J 1M1EB 3OIPA 3PO2J 1TWAJ 4B09A 3BR0A 4O5VA 4ZDPA 2ELHA 3ABLH 1YFHA 4GYIA 2PG4A 4I7HA 4WCGA 4RB1A 2BBYA 1FJLA 4F7ZA 5IT9K 3NAUA 1X1CA 5K5QA 1IUYA 4ENNA 1X19A 2VKDA 4E7KA 3EQLF 1IDYA 1ON2A 3V8JA 4A3JJ 4JQFA 4XKVA 4IF4A 3BJAA 2VONA 5FJ8J 2UWMA 1X3ZB 4ON0A 5A2QZ 1LDDA 3CO6C 4W97A 2Y48A 1IW7F 1G3TA 3G73A 2W00A 5KHDA 4A3EJ 2IAIA 4MHGA 4B1RA 3CD6I 1P4XA 5FLVA 2LY1A 4BEHB 3M7GA 2HXOA 1SMTA 1I39A 3BR3A 4CCMA 4IHWA 4UUTA 2E5NA 3O3KA 1OPCA 3KPHA 3SHFA 2DODA 2R7ZJ 5FFXA 3LNQA 4II2A 1YQAA 4C30A 1IXSB 4BNCA 4RM3A 2VL8A 4M73A 2OPTA 3CC4I 3VWBA 3BG6A 1WQ2A 2VE8A 2KP6A 3JRAA 4I0BA 1LDJA 4M9SA 2W1OA 2EFPA 3OYKA 2PEXA 1J9IA 3A4CA 4M3GA 4BE1A 4A93J 4U0VA 3L2QA 2CS3A 2M1BA 4M72A 2M3AA 3I9V2 4KITB 1L3LA 1GXQA 4DYQA 2G0EA 3J7ZI 2ESHA 3BZCA 1OISA 4M6YA 3KYCB 5IP7J 2FQ4A 1MH3A 2PMZN 1WPKA 1ETVA 2UV1A 3S17J 3TO7A 2AO9A 3RTRA 3KP4A 4HRIA 2XPVA 1G3WA 4RMNA 1GV2A 3LSJA 4NC8A 3MCZA 4C2UA 2LKPA 2HQAA 2FU4A 4ENKA 1VQOI 4HYEA 1REPC 4XLCA 2R0QC 1X58A 2JVHA 2KQRA 4NUBA 5FFZA 3GTGJ 5J47A 2ZJ2A 3O8GA 1E0EA 5M5XJ 2CG4A 2EZKA 2I8DA 1E2XA 3CJTB 3CQZJ 3N4MA 2DK5A 1MD0A 3PL8A 1DP7P 3MD2A 2EIMH 2L0KA 2A61A 3DLLF 2WAQN 3G6EI 1T8IA 3GTLJ 2MLGA 4EM2A 2ZMEC 3K10A 2IJLA 2GA2A 3ZCOA 4B3AA 2B9SA 2DQRA 3PUBA 3QRFF 4XBFA 1HKSA 5EJCA 1LKXA 4BXFA 2XAUA 3HXLA 3H9JA 1HXDA 3K1MA 3CCRI 2DLLA 4I09A 1W1WE 1K83J 3ASNH 1MKMA 4XRSG 2XKPA 2L7FP 4CUGA 5IYCJ 1CF7B 1IUFA 4IXAA 1S9HA 1JTXA 2ESNA 2JWTA 3S3MA 2W82A 5KVRA 3OS2A 4H4KC 4PJJA 2OTJI 1K78B 2VQCA 3IP4B 1B9NA 3T5XA 1PYVA 1JJ6C 4UVBA 1XG1A 2MSYA 1OCRH 4CCLA 1Z3YA 4NHJA 2H8RA 3T0YA 5F0HA 2Z33A 2XF7A 2AHQA 1FP1D 2JJ7A 1ZR2A 4M71A 1BOBA 2OZUA 3RJPA 1MSEC 1V4RA 1XGSA 2QQ8A 1R7JA 3TOAA 1IG7A 1Z7LA 4N9HA 1UB9A 4X6AJ 2LF7A 2EBIA 3KYLA 3GTPJ 2HTJA 1LFBA 1UELB 1ENHA 4OAZA 5AONA 1I1SA 3LFKA 2QM3A 4EM0B 3PNTA 5DM7F 2IS6A 3DXJF 2F5DA 1CGPA 3FKIJ 3HKZN 1R49A 3J80K 4CH7A 1KQ9A 1WKMA 3OYBA 4A6EA 3GVAA 2OV7A 2CMPA 4FCYA 1JHFA 3MKWB 3BOQA 1DU6A 4BHBA 2I5UA 1B9MA 4Y15A 3E5UA 4XLHA 1ZK8A 1U5TC 2OCCH 4UXNA 2Q0OA 4MIMA 2XROA 4G7HF 3MKZA 1SVLA 1JUSA 3ZQGA 1F1ZA 4KN7X 1AU7A 1FTZA 4A3KJ 2HQNA 5TRDA 2HNHA 5FD5A 3FDYA 4KICA 4BJ6C 1Z6TA 1YE9A 4OAYA 4WXCA 2DPDA 2G9WA 1E3HA 1MBKA 1ETKA 3OOPA 1MJ9A 3HGYA 2ME0A 3K9TA 4GCVA 2CO5A 4IJAA 2E7XA 3ZN1A 3ABKH 3WHBA 1KZHA 4Q47A 1ZGJA 2EV5A 2Y0MA 1FY7A 4IVNA 2F5EA 2JVGA 1QZEA 3BTCA 2Q2EB 2QQAA 2QENA 4K2EA 4PJNA 1WCMJ 1IJWC 4HOBA 1R36A 5F1JA 3S1MJ 3OYJA 4B3XA 2OTLI 1W4MA 2DFEA 3RYPA 2D1VA 1Y0UA 1QPIA 4C3IJ 2EK5A 1POGA 3VSKA 2DOEA 1WWXA 2TCTA 3WTUC 4HBLA 3FHNA 4L9VA 2KDZA 4BE0A 3TDUC 1OCZH 3IRRA 1FOXA 2BVMA 2LTPA 1GLNA 2WY8Q 2V1XA 4ASNA 3K70C 3ONQA 4RAFA 5DCMA 4U7DA 4PDKA 3H3ZA 4OIRF 3I55I 1MMGA 5D8LB 2BE5F 1FYKA 5E1ZB 2R7TA 1YYVA 2CJJA 1GVJA 5FKKA 3W2WA 2GA1A 3A0BC 2NVQJ 3K1PA 4KIBA 4HF0A 4HG2A 2KHMA 3VYRB 2K86A 4UUSA 1ZG3A 3KFWX 2A5YB 3PSFA 5ERIA 2DA4A 4LG3A 1XD7A 5GTHC 1BR1A 4UHTA 2EIJH 3GLXA 4MEYF 4A3DJ 2TRTA 3WU0A
chains in the Genus database with same CATH topology
2IA2A 5ICEA 1YW9A 1W5SA 2PBIA 3ULQB 4KMUX 4YIIA 4MTDA 4RGUA 3WTZA 5K1YA 3B73A 4HA8A 1ZRFA 1FX7A 3IHUA 2F5CA 4A5MA 5DUKA 1UHMA 4ETSA 2DPUA 1K7AA 4EGZA 4BAYA 3FMQA 4CICA 2NRAC 2ISZA 4ZZLA 4G7OF 2YU3A 3GEZA 2HYGD 4EMSA 3B02A 4G7ZF 3J81K 5FO5A 4MQVA 5D6EA 2DQLA 1WSUA 1S6LA 2FEZA 3M8FA 3I5UA 1JXSA 1ODDA 1FBQA 2PN6A 4LGWA 3H3UA 1FSHA 2FOKA 3FMRA 3W6JB 2NYXA 3R0AA 3GUDA 1YLFA 3K2ZA 2KIFA 2FMYA 3ZQ7A 4HQMA 3KEQA 1BI2A 1T38A 3M1EA 4AIJA 3S2WA 3J81Z 2M87A 3GFJA 2J5OA 3QAHA 3ZMUA 2C6YA 1G3YA 1F5TA 3ERED 2PFBA 4I98B 3LQQA 4LG0A 5CLSA 2Z5UA 4WX9A 1IRGA 3GFLA 2JSCA 1NHAA 3GWZA 1FC3A 4B8XA 4KMFA 2UXNA 1J0RA 5LEJA 2A6HF 5L3GA 1SD6A 3KP3A 3AAFA 1H9TA 1Z6RA 4AVPA 3PFIA 3GF2A 4HF2A 4ZYDA 3DP7A 2CSOA 1LDKB 2HKXA 2TDXA 4HDVA 2OU2A 2VBXA 2LNBA 5HVQC 2PMUA 1XN7A 1RUOA 1HQCA 4HDUA 2IP2A 5D4RA 4P5OA 2O61A 2XVCA 4KIFA 1MDMA 2W25A 4KT5C 1ULYA 4OOIA 4EJOA 2UZKA 2ETHA 3HOTA 1D5VA 5E17F 3RKWA 2ZMEA 2DW4A 1TTYA 4HQEA 4KDPA 2HFHA 2R7DA 1LEAA 4KYWA 1TLHB 2A6EF 2P6SA 1R00A 3I58A 1A04A 2VC0A 2P5VA 5TJJA 3VB2A 1TNTA 3R4KA 2W85A 2LF8A 2YX7A 2W24A 2FRHA 3F8BA 4R79A 1R22A 2L3DA 2H6BA 2P8TA 2EFNA 2RQPA 1KU9A 3R60A 4G94A 4S05A 2QBYB 2VOOA 4WXHA 2H6CA 1P4WA 2Z99A 3V8LA 2COMA 1S29A 5D5WB 3IRQA 2YX4A 2HGCA 1K6OA 1BN5A 2DAOA 1OMIA 2PI0A 1DDNA 1U5TA 1AWCA 3ZN0A 3FF5A 2NS0A 2QYOA 1QNTA 2WV0A 3ECOA 3RPQA 1ZN2A 3WTTC 4ENJA 4ZZDA 3HOSA 2HS5A 3JW4A 5JFRA 1HBXG 1ZLKA 2BEOA 3V7CA 1IXCA 1F9NA 2NNNA 3I4PA 5D5XB 1DPUA 1Z05A 4ESBA 4KIGA 4OIOF 5CVRA 2OQRA 1SFXA 4DQ2A 1J2XA 1Z91A 2Q8KA 2HYFA 5HOOA 1KYWA 4HX4A 4G9YA 2JT1A 3MAJA 2E7WA 2RVCA 4YFKF 4EGYA 5L3FA 3EDPA 3NEUA 4P55A 5BPIA 4XLNF 5LRSA 2ADUA 1LVAA 5AIQA 2FBHA 2FNAA 1OKRA 5HS7A 4OMYA 2P5LC 2GQQA 2JZYA 5HLIA 1EV7A 3CUQC 1K78A 1MGTA 2VBWA 1SFUA 2GAUA 5LRRA 1R23A 4CGZA 3EUHA 2OD5A 4I02A 5HDNA 2KRFA 2P6TA 5L3BA 4ZH4F 5LHHA 4HV6A 3VODA 4CDGA 2EFQA 3BROA 2XGXA 4FHTA 4BYYA 2ZNZA 1YW8A 1Q1HA 1FSEA 2J5PA 1ZLJA 3BJ6A 4LLGF 1LNWA 3EYYA 3MZHA 5H6RA 3QP6A 4N9IA 3P9IA 5CVUA 2VT2A 2HTSA 4Q5SF 1I1GA 1U6GA 1FOKA 4BQAA 3FZVA 2YPRA 2PQ8A 4KNYA 3K1NA 4RAYA 3HRSA 4CZZA 3RI4A 2VC1A 3ABTA 1V3FA 1KQ0A 3KZZA 4ESJA 2HOEA 5JI6A 4A2UA 1B6AA 1J7KA 2JRTA 1KYZA 2VOPA 5K5OA 1BBYA 3GXOA 1J59A 1T6SA 1GXPA 5HDKA 3I0TA 2Q2EA 3E3VA 3JSPA 2XAFA 3P7NA 4Z2YA 1ZHFA 3NQOA 4UV8A 5DUIA 2EV0A 3CDHA 1XGOA 5CVJA 4YFNF 3WTXC 1YTYA 2CWEA 5F6FA 1T2KA 5H20A 3WE3A 2RC4A 1S8NA 2FE3A 1O7LA 1T0FA 4NQWA 3I53A 2MH2A 1IAWA 3IWFA 3O6BB 3U9GA 3ZMTA 1XCVA 3O2PE 1BOAA 4WK8F 1FYMA 5ICGA 1B1BA 3FXRA 4P9FA 3Q5FA 1XB4A 2DI3A 1YIOA 4UVCA 2GXBA 2XASA 3HTSB 3I59A 4RS8A 3WGHA 3ROUA 1PUEE 4U0YA 3DEUA 1UHWA 1RZ4A 4EJUA 2X0LA 3DPLC 3HSEA 3MZYA 1IXRC 3F3XA 2ISYA 4HX7A 2L02A 1I5ZA 2P5KA 3C18A 3HSRA 4OINF 4HLXA 5ICCA 2FQ3A 4L5IA 4A0YA 3E5XA 4LMYA 3BWGA 2O03A 3F8NA 3PQJA 3MQ0A 5ICFA 4UVAA 1P6RA 2QZ8A 5BQTA 4WF2A 3KEOA 4ENMA 2STWA 1QBJA 1G4DA 5E1XA 2KJBA 3IKVA 1EH7A 3HYIA 1HW2A 1MJBA 1T98A 3VEPA 4M9XA 2NAZA 4JK1X 1QZZA 1ZYRF 1HSJA 3OV8A 2VE9A 1B59A 1C0WA 2FA5A 4DNCA 1IF1A 3H92A 3C3WA 3E6CC 3T8RA 3TOBA 1H9GA 1O57A 4RGSA 2CYYA 4EVIA 2IT0A 4PGGA 5D5VB 4RB3C 5IT3A 5D5UB 2W57A 3IL2A 1BJAA 4HF1A 1IZ1A 1FPQA 1FBUA 2H94A 1IN7A 4BHCA 4L18B 4IHSA 4WWCA 2FSWA 5DCMB 3VFZA 2HZTA 2MBFA 1MZBA 2RN7A 2ZCWA 4OIQF 1P4AA 5LGNA 3HUGA 4O6JA 3GZ6A 2QLZA 3J7AO 2E1NA 3WGIA 4AWXB 3CLOA 1ONVA 4FT8A 2DBBA 1IN5A 1BI1A 2PLYA 4RGRA 3LWFA 2JPCA 3MWMA 4TV7A 1TW2A 2O3FA 1SFEA 1H0MA 4HLYA 5FB2A 3LAPA 1RI7A 3R0JA 3E5QA 4A12A 1X3UA 3ECHA 2ZO4A 2DFIA 5LBQA 1KU3A 1MJAA 4MQ9F 1USSA 5BMZA 5LHIA 5ILVA 2HQRA 4IRGA 1BI3A 1ZRDA 3MEXA 4OMZA 1IN8A 1SD5A 2X4HA 1Z9CA 4YFXF 5ILUA 4QLCU 5E18F 3CUQA 2XKOA 3IKTA 5E8IA 4H0EA 2EWNA 2LSOA 3ZMZA 1TW3A 3E6BA 2L54A 1R1TA 1W7PA 2VODA 4MNUA 2A69F 1O3SA 1STZA 4EM1A 1JHHA 1SD7A 4RGXA 3I71A 4PGHA 4R1HA 1D3YA 2VN2A 3F8MA 1ZARA 4QWQA 1R1UA 2KJCA 3WTVC 1LEBA 1LB2A 2PMHA 2V1UA 2F2EA 3LA2A 5D6FA 5HDGA 4HAMA 2V9VA 4R8HA 2A68F 3HSFA 3RPUA 4NB5A 3KZYA 4LK1F 5BPDA 1XSVA 4IRHA 3T8TA 1IRFA 2ZKZA 3FHZA 4LG0B 5F1RA 2XRNA 4XLPF 2O0YA 2EFWA 4ESFA 2L4MA 2VBZA 3CTAA 4UNOA 3QP5A 3GYHX 2LDUA 3V7SA 1HW5A 3FMSA 3DQVC 1D8KA 3T1BA 1P2FA 2QVOA 3TQNA 1FBSA 4EQQA 3REOA 4P9UA 4L0YB 1J75A 1YG2A 1PDNC 5F64A 3FWEA 4LK0F 3FXUA 2DT5A 3F6OA 2IA1A 1T39A 3L7WA 4HW0A 4G6QA 3JTGA 1OYYA 2MLKA 5H6QA 1MDMB 4M6XA 5LEKA 3F8FA 1KU7A 4BHPA 1PP8F 1KU2A 3KP5A 3RDIA 1YO5C 1LJ9A 2ZMEB 4MGRA 4LB6B 4XSZF 5EEGA 2RGVA 1I27A 3WTYC 5HS8A 3BDDA 4GGGA 4EJVA 5D4SA 3RKXA 1OR7A 1YW7A 5FGMA 4RAZA 1RNLA 1F4KA 4ZYGA 1J5YA 1XCBA 1UCRA 1HW1A 3CUOA 3K69A 2K02A 4O3MA 3HRTA 1FT9A 3SXYA 4MEXF 2XAQA 3HHHA 3JAMK 4FX4A 4ZYEA 4GYGA 4I2OA 2RV8A 1U3EM 2IA0A 1P92A 3GFIA 2M5WA 1U5TB 1CF7A 3WTWC 3NRVA 3DPTA 2OAZA 3BY6A 2DU9A 3FM3A 3GW2A 3E97A 4CYDA 5FLXK 5IT9Z 3KETA 4L0ZB 4RB2C 2FBKA 2EB7A 3JAMZ 1R58A 4IHTA 2ACJA 3GFMA 4FX0A 2EA2A 1OYIA 3L09A 2HWVA 2ZXJA 1D8JA 3L2CA 1WRJA 3G3ZA 4EV0A 5LLQA 4UV9A 5E8GA 5JVTA 3LSTA 3W6KB 1O7FA 2GWRA 3FXQA 4U88A 1TQIA 1FYLA 3P9CA 3F21A 3ABUA 3KLOA 4CXFA 5FLXZ 2P4WA 1QZYA 2R3SA 4UUVA 2GXGA 4LFUA 2KIMA 2V79A 4A0ZA 2GZWA 2VBYA 1SMYF 4OU0A 3ML6A 2IVMA 1TQMA 3WTSC 3KLNA 1U78A 1HKTA 4ZYHA 3F8CA 2Z9OA 3Q9VA 2CQKA 4GXOA 2XHKA 1BC8C 2QQBA 2STTA 2P7CB 4U0WA 4CO8A 5FD6A 5LHGA 5JR3A 1W5TA 1EH6A 4P96A 4YIFA 2XAGA 3IC7A 5LGTA 2L4AA 1KGSA 1L0OC 3QPHA 2HEOA 2FMLA 2JPBA 3KP6A 4MTEA 5BOXA 3M8EA 3ZP5A 5E1WA 2O8XA 3GO5A 2IW5A 5E20A 2R7FA 2HDCA 3FX3A 4PCQA 1GHCA 2UXXA 3SZTA 1RUNA 5L3DA 3F23A 3JSOA 2Z3YA 3Q9SA 4HV5A 3QU3A 1HSTA 5CYVA 4U7BA 5EEHA 1SAXA 2VT3A 2QQ9A 1R1VA 2ZNYA 3I64A 2QWWA 2YR2A 5BS6A 5K5RA 2FBIA 3JTHA 5D8KB 3LA7A 2KKOA 1ZG1A 5KK1A 2G7UA 2K4JA 5DD4A 2BYVE 3CO7C 1QQIA 1G3SA 4GO1A 3TO9A 3SQNA 1ZGAA 4D0PA 4EJWA 2W84A 3J80Z 5DDGA 4IPAA 2D2WA 3EETA 1PP7U 3WGGA 2WC2A 1ZRCA 1WI9A 2CW0F 3ZMDA 2IPQX 1DUXC 4CHUA 2B0LA 3D0SA 5J8FA 3BP8A 2XV4S 4S04A 1R5HA 1K79A 3MFKA 1XMAA 4HX8A 5JHUA 3KP7A 2BV6A 1QO0D 5CVIA 1HKQA 1U8RA 4KFCA 2RDPA 3ZMSA 5HLGA 2XAHA 4KA4A 3DV8A 1KQ8A 3COAC 2KIUA 1JE8A 3U2RA 1AOYA 2XAJA 5DD8A 1FLIA 2CFXA 2OBPA 4Y17A 2VXZA 3V7RA 2G7HA 3DFGA 3N97A 3HTUA 2V1DA 3RIRA 3I59B 3M9AA 2MA3A 4A5NA 2E1CA 3GZ5A 1XDUA 4XRFA 4HZFA 1S3JA 1YS7A 3L9FA 1QGPA 3E6MA 4AD9A 4A6DA 2PJPA 4RB0A 5CVVA 3TO6A 3HHGA 3HIFA 5HS9A 4G8XA 4KN4X 4EJTA 2F5FA 1LQ1A 2FNPA 3SZPA 4OIPF 4Q4ZF 3V8KA 1XGMA 2WWYA 3R6SA 1TBXA 1U2WA 6PAXA 3HRMA 5DYMA 1TNSA 2OQGA 2YSRA 1O3TA 1EH8A 3QOPA 4BH9A 1O3QA 1XGNA 2XIGA 3LA3A 3BPVA 3VOEA 2O6GE 3F22A 2CGPA 4A0XA 3QU6A 3SFZA 2AXLA 4E70A 2RNJA 3QPTA 2HR3A 4LLLA 3K0LA 2GIVA 3LAJA 2MH9A 3TDZC 3PQKA 1ZH5A 1FWZA 5J6XA 3WE2A 1RIOH 3KE2A 1R5GA 5LGUA 4WXDA 2H27A 4LD5A 1VTNC 1G6NA 3CJNA 4L9NA 4L9TA 3ZPLA 4L5JA 1O3RA 1Z1DA 2M45A 3HRUA 4XSXF 1BIBA 1FP2A 1USTA 2K7LA 3EYIA 1XDSA 3R61A 1Z7UA 2ZFWA 5AIPA 4M9ZA 3U1DA 2QBYA 1KA8A 3RYRA 1E17A 2JTVA 4Y13A 5DEQA 3BZ6A 3IWZA 2ZBKA 2FXAA 1TQPA 4I0AA 2D45A 3WG9A 2MD5A 2D1HA 4AIKA 4L9JA 3FM5A 2H09A 3WU1B 3ISPA 2P7VB 1BIAA 2MC3A 3D5LA 3KP2A 4Q48A 3DKWA 2XUBA 4M74A 2EJRA 1BC7C 3P9KA 5L3EA 5DCFA 1S7AA 2BGCA 3V4GA 2QUFA 2IRFG 4AIHA 1BM9A 1W7PD 3WODF 3ZMVA 1XMKA 3CUQB 1FNNA 4N0BA 4BXUA 1S7OA 3E6DA 1W7PB 3TGNA 3DF8A 5DV5A 2EV6A 3F72A 1DPRA 1SD4A 1IN4A 1BI0A 2K4BA 4I01A 1B4AA 1ZREA 1ZAOA 3C1DA 2M30A 3I54A 1UFMA 2HKOA 3BJOA 4G6DA 2A3SA 3TKYA 1ZG5A 4YG2F 2DTRA 1FZPB 4LLNA 4IRIA 3L00A 3F6VA 2OZ6A 4KUMA 4JBAA 3BPXA 1IN6A 2A07F 3GX4X 2M8EA 3KCCA 4PZJA 1XSXA 2DK8A 5HLHA 3ELKA 1ON1A 5ED4A 1XSDA 2NNYA 2Y75A 2WTEA 3RKYA 4LB5A 1OYWA 3LQRA 5L3CA 2EFOA 2DO7A 4LJZF 2L01A 2K27A 1QPMA 2FF4A 1I6XA 5ILSA 5A2QK 1YS6A 2EA4A 2RKHA 2OA4A 1JGSA 5CJ9A 2V6CA 5J8CA 2AS5F 3C7JA 4B09A 4O5VA 2ELHA 1YFHA 4GYIA 2PG4A 4I7HA 4WCGA 4RB1A 2BBYA 5IT9K 4F7ZA 5K5QA 1IUYA 4ENNA 3EQLF 3V8JA 1ON2A 4JQFA 4IF4A 3BJAA 2VONA 2UWMA 4ON0A 5A2QZ 1LDDA 3CO6C 2Y48A 1IW7F 1G3TA 3G73A 4MHGA 1P4XA 3M7GA 1SMTA 3O3KA 1OPCA 3SHFA 5FFXA 1YQAA 1IXSB 4BNCA 4M73A 1WQ2A 2VE8A 4I0BA 1LDJA 4M9SA 2EFPA 2PEXA 1J9IA 4U0VA 2M1BA 4M72A 1L3LA 1GXQA 2ESHA 4M6YA 3TO7A 3RTRA 3KP4A 1G3WA 3MCZA 2LKPA 2FU4A 4ENKA 4HYEA 1REPC 5FFZA 2ZJ2A 2CG4A 1E2XA 3N4MA 2DK5A 1MD0A 1DP7P 2A61A 2MLGA 4EM2A 2IJLA 2GA2A 2DQRA 3QRFF 4XBFA 1HKSA 1HXDA 3K1MA 2DLLA 4I09A 1MKMA 1CF7B 2XKPA 4IXAA 2ESNA 5KVRA 1K78B 1B9NA 3T5XA 4UVBA 4NHJA 3T0YA 2Z33A 1FP1D 4M71A 2OZUA 3RJPA 1V4RA 1XGSA 1R7JA 3TOAA 4N9HA 1UB9A 2LF7A 2HTJA 5AONA 1I1SA 3LFKA 2QM3A 4EM0B 3DXJF 2F5DA 1CGPA 3J80K 1KQ9A 1WKMA 4A6EA 3GVAA 1JHFA 3BOQA 4BHBA 1B9MA 4Y15A 3E5UA 1U5TC 4UXNA 2Q0OA 2XROA 4G7HF 1F1ZA 4KN7X 2HQNA 5TRDA 5FD5A 4KICA 1Z6TA 4WXCA 2DPDA 2G9WA 3OOPA 1MJ9A 3K9TA 4GCVA 2CO5A 4IJAA 2E7XA 3ZN1A 4Q47A 1ZGJA 2EV5A 2Y0MA 1FY7A 4IVNA 2F5EA 2QQAA 2QENA 4K2EA 4HOBA 1R36A 1W4MA 3RYPA 2D1VA 1Y0UA 2EK5A 1WWXA 3WTUC 4HBLA 4L9VA 3TDUC 3IRRA 4ASNA 2V1XA 5DCMA 4U7DA 4PDKA 3H3ZA 4OIRF 5D8LB 2BE5F 1FYKA 5E1ZB 1YYVA 1GVJA 2GA1A 3K1PA 4KIBA 4HF0A 2K86A 1ZG3A 3KFWX 2A5YB 5ERIA 1XD7A 4UHTA 3GLXA 4MEYF 3WU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IA2 A;  5ICE A;  1YW9 A;  1W5S A;  2PBI A;  3ULQ B;  4KMU X;  4YII A;  4MTD A;  4RGU A;  3WTZ A;  5K1Y A;  3B73 A;  4HA8 A;  1ZRF A;  1FX7 A;  3IHU A;  2F5C A;  4A5M A;  5DUK A;  1UHM A;  4ETS A;  2DPU A;  1K7A A;  4EGZ A;  4BAY A;  3FMQ A;  4CIC A;  2NRA C;  2ISZ A;  4ZZL A;  4G7O F;  2YU3 A;  3GEZ A;  2HYG D;  4EMS A;  3B02 A;  4G7Z F;  3J81 K;  5FO5 A;  4MQV A;  5D6E A;  2DQL A;  1WSU A;  1S6L A;  2FEZ A;  3M8F A;  3I5U A;  1JXS A;  1ODD A;  1FBQ A;  2PN6 A;  4LGW A;  3H3U A;  1FSH A;  2FOK A;  3FMR A;  3W6J B;  2NYX A;  3R0A A;  3GUD A;  1YLF A;  3K2Z A;  2KIF A;  2FMY A;  3ZQ7 A;  4HQM A;  3KEQ A;  1BI2 A;  1T38 A;  3M1E A;  4AIJ A;  3S2W A;  3J81 Z;  2M87 A;  3GFJ A;  2J5O A;  3QAH A;  3ZMU A;  2C6Y A;  1G3Y A;  1F5T A;  3ERE D;  2PFB A;  4I98 B;  3LQQ A;  4LG0 A;  5CLS A;  2Z5U A;  4WX9 A;  1IRG A;  3GFL A;  2JSC A;  1NHA A;  3GWZ A;  1FC3 A;  4B8X A;  4KMF A;  2UXN A;  1J0R A;  5LEJ A;  2A6H F;  5L3G A;  1SD6 A;  3KP3 A;  3AAF A;  1H9T A;  1Z6R A;  4AVP A;  3PFI A;  3GF2 A;  4HF2 A;  4ZYD A;  3DP7 A;  2CSO A;  1LDK B;  2HKX A;  2TDX A;  4HDV A;  2OU2 A;  2VBX A;  2LNB A;  5HVQ C;  2PMU A;  1XN7 A;  1RUO A;  1HQC A;  4HDU A;  2IP2 A;  5D4R A;  4P5O A;  2O61 A;  2XVC A;  4KIF A;  1MDM A;  2W25 A;  4KT5 C;  1ULY A;  4OOI A;  4EJO A;  2UZK A;  2ETH A;  3HOT A;  1D5V A;  5E17 F;  3RKW A;  2ZME A;  2DW4 A;  1TTY A;  4HQE A;  4KDP A;  2HFH A;  2R7D A;  1LEA A;  4KYW A;  1TLH B;  2A6E F;  2P6S A;  1R00 A;  3I58 A;  1A04 A;  2VC0 A;  2P5V A;  5TJJ A;  3VB2 A;  1TNT A;  3R4K A;  2W85 A;  2LF8 A;  2YX7 A;  2W24 A;  2FRH A;  3F8B A;  4R79 A;  1R22 A;  2L3D A;  2H6B A;  2P8T A;  2EFN A;  2RQP A;  1KU9 A;  3R60 A;  4G94 A;  4S05 A;  2QBY B;  2VOO A;  4WXH A;  2H6C A;  1P4W A;  2Z99 A;  3V8L A;  2COM A;  1S29 A;  5D5W B;  3IRQ A;  2YX4 A;  2HGC A;  1K6O A;  1BN5 A;  2DAO A;  1OMI A;  2PI0 A;  1DDN A;  1U5T A;  1AWC A;  3ZN0 A;  3FF5 A;  2NS0 A;  2QYO A;  1QNT A;  2WV0 A;  3ECO A;  3RPQ A;  1ZN2 A;  3WTT C;  4ENJ A;  4ZZD A;  3HOS A;  2HS5 A;  3JW4 A;  5JFR A;  1HBX G;  1ZLK A;  2BEO A;  3V7C A;  1IXC A;  1F9N A;  2NNN A;  3I4P A;  5D5X B;  1DPU A;  1Z05 A;  4ESB A;  4KIG A;  4OIO F;  5CVR A;  2OQR A;  1SFX A;  4DQ2 A;  1J2X A;  1Z91 A;  2Q8K A;  2HYF A;  5HOO A;  1KYW A;  4HX4 A;  4G9Y A;  2JT1 A;  3MAJ A;  2E7W A;  2RVC A;  4YFK F;  4EGY A;  5L3F A;  3EDP A;  3NEU A;  4P55 A;  5BPI A;  4XLN F;  5LRS A;  2ADU A;  1LVA A;  5AIQ A;  2FBH A;  2FNA A;  1OKR A;  5HS7 A;  4OMY A;  2P5L C;  2GQQ A;  2JZY A;  5HLI A;  1EV7 A;  3CUQ C;  1K78 A;  1MGT A;  2VBW A;  1SFU A;  2GAU A;  5LRR A;  1R23 A;  4CGZ A;  3EUH A;  2OD5 A;  4I02 A;  5HDN A;  2KRF A;  2P6T A;  5L3B A;  4ZH4 F;  5LHH A;  4HV6 A;  3VOD A;  4CDG A;  2EFQ A;  3BRO A;  2XGX A;  4FHT A;  4BYY A;  2ZNZ A;  1YW8 A;  1Q1H A;  1FSE A;  2J5P A;  1ZLJ A;  3BJ6 A;  4LLG F;  1LNW A;  3EYY A;  3MZH A;  5H6R A;  3QP6 A;  4N9I A;  3P9I A;  5CVU A;  2VT2 A;  2HTS A;  4Q5S F;  1I1G A;  1U6G A;  1FOK A;  4BQA A;  3FZV A;  2YPR A;  2PQ8 A;  4KNY A;  3K1N A;  4RAY A;  3HRS A;  4CZZ A;  3RI4 A;  2VC1 A;  3ABT A;  1V3F A;  1KQ0 A;  3KZZ A;  4ESJ A;  2HOE A;  5JI6 A;  4A2U A;  1B6A A;  1J7K A;  2JRT A;  1KYZ A;  2VOP A;  5K5O A;  1BBY A;  3GXO A;  1J59 A;  1T6S A;  1GXP A;  5HDK A;  3I0T A;  2Q2E A;  3E3V A;  3JSP A;  2XAF A;  3P7N A;  4Z2Y A;  1ZHF A;  3NQO A;  4UV8 A;  5DUI A;  2EV0 A;  3CDH A;  1XGO A;  5CVJ A;  4YFN F;  3WTX C;  1YTY A;  2CWE A;  5F6F A;  1T2K A;  5H20 A;  3WE3 A;  2RC4 A;  1S8N A;  2FE3 A;  1O7L A;  1T0F A;  4NQW A;  3I53 A;  2MH2 A;  1IAW A;  3IWF A;  3O6B B;  3U9G A;  3ZMT A;  1XCV A;  3O2P E;  1BOA A;  4WK8 F;  1FYM A;  5ICG A;  1B1B A;  3FXR A;  4P9F A;  3Q5F A;  1XB4 A;  2DI3 A;  1YIO A;  4UVC A;  2GXB A;  2XAS A;  3HTS B;  3I59 A;  4RS8 A;  3WGH A;  3ROU A;  1PUE E;  4U0Y A;  3DEU A;  1UHW A;  1RZ4 A;  4EJU A;  2X0L A;  3DPL C;  3HSE A;  3MZY A;  1IXR C;  3F3X A;  2ISY A;  4HX7 A;  2L02 A;  1I5Z A;  2P5K A;  3C18 A;  3HSR A;  4OIN F;  4HLX A;  5ICC A;  2FQ3 A;  4L5I A;  4A0Y A;  3E5X A;  4LMY A;  3BWG A;  2O03 A;  3F8N A;  3PQJ A;  3MQ0 A;  5ICF A;  4UVA A;  1P6R A;  2QZ8 A;  5BQT A;  4WF2 A;  3KEO A;  4ENM A;  2STW A;  1QBJ A;  1G4D A;  5E1X A;  2KJB A;  3IKV A;  1EH7 A;  3HYI A;  1HW2 A;  1MJB A;  1T98 A;  3VEP A;  4M9X A;  2NAZ A;  4JK1 X;  1QZZ A;  1ZYR F;  1HSJ A;  3OV8 A;  2VE9 A;  1B59 A;  1C0W A;  2FA5 A;  4DNC A;  1IF1 A;  3H92 A;  3C3W A;  3E6C C;  3T8R A;  3TOB A;  1H9G A;  1O57 A;  4RGS A;  2CYY A;  4EVI A;  2IT0 A;  4PGG A;  5D5V B;  4RB3 C;  5IT3 A;  5D5U B;  2W57 A;  3IL2 A;  1BJA A;  4HF1 A;  1IZ1 A;  1FPQ A;  1FBU A;  2H94 A;  1IN7 A;  4BHC A;  4L18 B;  4IHS A;  4WWC A;  2FSW A;  5DCM B;  3VFZ A;  2HZT A;  2MBF A;  1MZB A;  2RN7 A;  2ZCW A;  4OIQ F;  1P4A A;  5LGN A;  3HUG A;  4O6J A;  3GZ6 A;  2QLZ A;  3J7A O;  2E1N A;  3WGI A;  4AWX B;  3CLO A;  1ONV A;  4FT8 A;  2DBB A;  1IN5 A;  1BI1 A;  2PLY A;  4RGR A;  3LWF A;  2JPC A;  3MWM A;  4TV7 A;  1TW2 A;  2O3F A;  1SFE A;  1H0M A;  4HLY A;  5FB2 A;  3LAP A;  1RI7 A;  3R0J A;  3E5Q A;  4A12 A;  1X3U A;  3ECH A;  2ZO4 A;  2DFI A;  5LBQ A;  1KU3 A;  1MJA A;  4MQ9 F;  1USS A;  5BMZ A;  5LHI A;  5ILV A;  2HQR A;  4IRG A;  1BI3 A;  1ZRD A;  3MEX A;  4OMZ A;  1IN8 A;  1SD5 A;  2X4H A;  1Z9C A;  4YFX F;  5ILU A;  4QLC U;  5E18 F;  3CUQ A;  2XKO A;  3IKT A;  5E8I A;  4H0E A;  2EWN A;  2LSO A;  3ZMZ A;  1TW3 A;  3E6B A;  2L54 A;  1R1T A;  1W7P A;  2VOD A;  4MNU A;  2A69 F;  1O3S A;  1STZ A;  4EM1 A;  1JHH A;  1SD7 A;  4RGX A;  3I71 A;  4PGH A;  4R1H A;  1D3Y A;  2VN2 A;  3F8M A;  1ZAR A;  4QWQ A;  1R1U A;  2KJC A;  3WTV C;  1LEB A;  1LB2 A;  2PMH A;  2V1U A;  2F2E A;  3LA2 A;  5D6F A;  5HDG A;  4HAM A;  2V9V A;  4R8H A;  2A68 F;  3HSF A;  3RPU A;  4NB5 A;  3KZY A;  4LK1 F;  5BPD A;  1XSV A;  4IRH A;  3T8T A;  1IRF A;  2ZKZ A;  3FHZ A;  4LG0 B;  5F1R A;  2XRN A;  4XLP F;  2O0Y A;  2EFW A;  4ESF A;  2L4M A;  2VBZ A;  3CTA A;  4UNO A;  3QP5 A;  3GYH X;  2LDU A;  3V7S A;  1HW5 A;  3FMS A;  3DQV C;  1D8K A;  3T1B A;  1P2F A;  2QVO A;  3TQN A;  1FBS A;  4EQQ A;  3REO A;  4P9U A;  4L0Y B;  1J75 A;  1YG2 A;  1PDN C;  5F64 A;  3FWE A;  4LK0 F;  3FXU A;  2DT5 A;  3F6O A;  2IA1 A;  1T39 A;  3L7W A;  4HW0 A;  4G6Q A;  3JTG A;  1OYY A;  2MLK A;  5H6Q A;  1MDM B;  4M6X A;  5LEK A;  3F8F A;  1KU7 A;  4BHP A;  1PP8 F;  1KU2 A;  3KP5 A;  3RDI A;  1YO5 C;  1LJ9 A;  2ZME B;  4MGR A;  4LB6 B;  4XSZ F;  5EEG A;  2RGV A;  1I27 A;  3WTY C;  5HS8 A;  3BDD A;  4GGG A;  4EJV A;  5D4S A;  3RKX A;  1OR7 A;  1YW7 A;  5FGM A;  4RAZ A;  1RNL A;  1F4K A;  4ZYG A;  1J5Y A;  1XCB A;  1UCR A;  1HW1 A;  3CUO A;  3K69 A;  2K02 A;  4O3M A;  3HRT A;  1FT9 A;  3SXY A;  4MEX F;  2XAQ A;  3HHH A;  3JAM K;  4FX4 A;  4ZYE A;  4GYG A;  4I2O A;  2RV8 A;  1U3E M;  2IA0 A;  1P92 A;  3GFI A;  2M5W A;  1U5T B;  1CF7 A;  3WTW C;  3NRV A;  3DPT A;  2OAZ A;  3BY6 A;  2DU9 A;  3FM3 A;  3GW2 A;  3E97 A;  4CYD A;  5FLX K;  5IT9 Z;  3KET A;  4L0Z B;  4RB2 C;  2FBK A;  2EB7 A;  3JAM Z;  1R58 A;  4IHT A;  2ACJ A;  3GFM A;  4FX0 A;  2EA2 A;  1OYI A;  3L09 A;  2HWV A;  2ZXJ A;  1D8J A;  3L2C A;  1WRJ A;  3G3Z A;  4EV0 A;  5LLQ A;  4UV9 A;  5E8G A;  5JVT A;  3LST A;  3W6K B;  1O7F A;  2GWR A;  3FXQ A;  4U88 A;  1TQI A;  1FYL A;  3P9C A;  3F21 A;  3ABU A;  3KLO A;  4CXF A;  5FLX Z;  2P4W A;  1QZY A;  2R3S A;  4UUV A;  2GXG A;  4LFU A;  2KIM A;  2V79 A;  4A0Z A;  2GZW A;  2VBY A;  1SMY F;  4OU0 A;  3ML6 A;  2IVM A;  1TQM A;  3WTS C;  3KLN A;  1U78 A;  1HKT A;  4ZYH A;  3F8C A;  2Z9O A;  3Q9V A;  2CQK A;  4GXO A;  2XHK A;  1BC8 C;  2QQB A;  2STT A;  2P7C B;  4U0W A;  4CO8 A;  5FD6 A;  5LHG A;  5JR3 A;  1W5T A;  1EH6 A;  4P96 A;  4YIF A;  2XAG A;  3IC7 A;  5LGT A;  2L4A A;  1KGS A;  1L0O C;  3QPH A;  2HEO A;  2FML A;  2JPB A;  3KP6 A;  4MTE A;  5BOX A;  3M8E A;  3ZP5 A;  5E1W A;  2O8X A;  3GO5 A;  2IW5 A;  5E20 A;  2R7F A;  2HDC A;  3FX3 A;  4PCQ A;  1GHC A;  2UXX A;  3SZT A;  1RUN A;  5L3D A;  3F23 A;  3JSO A;  2Z3Y A;  3Q9S A;  4HV5 A;  3QU3 A;  1HST A;  5CYV A;  4U7B A;  5EEH A;  1SAX A;  2VT3 A;  2QQ9 A;  1R1V A;  2ZNY A;  3I64 A;  2QWW A;  2YR2 A;  5BS6 A;  5K5R A;  2FBI A;  3JTH A;  5D8K B;  3LA7 A;  2KKO A;  1ZG1 A;  5KK1 A;  2G7U A;  2K4J A;  5DD4 A;  2BYV E;  3CO7 C;  1QQI A;  1G3S A;  4GO1 A;  3TO9 A;  3SQN A;  1ZGA A;  4D0P A;  4EJW A;  2W84 A;  3J80 Z;  5DDG A;  4IPA A;  2D2W A;  3EET A;  1PP7 U;  3WGG A;  2WC2 A;  1ZRC A;  1WI9 A;  2CW0 F;  3ZMD A;  2IPQ X;  1DUX C;  4CHU A;  2B0L A;  3D0S A;  5J8F A;  3BP8 A;  2XV4 S;  4S04 A;  1R5H A;  1K79 A;  3MFK A;  1XMA A;  4HX8 A;  5JHU A;  3KP7 A;  2BV6 A;  1QO0 D;  5CVI A;  1HKQ A;  1U8R A;  4KFC A;  2RDP A;  3ZMS A;  5HLG A;  2XAH A;  4KA4 A;  3DV8 A;  1KQ8 A;  3COA C;  2KIU A;  1JE8 A;  3U2R A;  1AOY A;  2XAJ A;  5DD8 A;  1FLI A;  2CFX A;  2OBP A;  4Y17 A;  2VXZ A;  3V7R A;  2G7H A;  3DFG A;  3N97 A;  3HTU A;  2V1D A;  3RIR A;  3I59 B;  3M9A A;  2MA3 A;  4A5N A;  2E1C A;  3GZ5 A;  1XDU A;  4XRF A;  4HZF A;  1S3J A;  1YS7 A;  3L9F A;  1QGP A;  3E6M A;  4AD9 A;  4A6D A;  2PJP A;  4RB0 A;  5CVV A;  3TO6 A;  3HHG A;  3HIF A;  5HS9 A;  4G8X A;  4KN4 X;  4EJT A;  2F5F A;  1LQ1 A;  2FNP A;  3SZP A;  4OIP F;  4Q4Z F;  3V8K A;  1XGM A;  2WWY A;  3R6S A;  1TBX A;  1U2W A;  6PAX A;  3HRM A;  5DYM A;  1TNS A;  2OQG A;  2YSR A;  1O3T A;  1EH8 A;  3QOP A;  4BH9 A;  1O3Q A;  1XGN A;  2XIG A;  3LA3 A;  3BPV A;  3VOE A;  2O6G E;  3F22 A;  2CGP A;  4A0X A;  3QU6 A;  3SFZ A;  2AXL A;  4E70 A;  2RNJ A;  3QPT A;  2HR3 A;  4LLL A;  3K0L A;  2GIV A;  3LAJ A;  2MH9 A;  3TDZ C;  3PQK A;  1ZH5 A;  1FWZ A;  5J6X A;  3WE2 A;  1RIO H;  3KE2 A;  1R5G A;  5LGU A;  4WXD A;  2H27 A;  4LD5 A;  1VTN C;  1G6N A;  3CJN A;  4L9N A;  4L9T A;  3ZPL A;  4L5J A;  1O3R A;  1Z1D A;  2M45 A;  3HRU A;  4XSX F;  1BIB A;  1FP2 A;  1UST A;  2K7L A;  3EYI A;  1XDS A;  3R61 A;  1Z7U A;  2ZFW A;  5AIP A;  4M9Z A;  3U1D A;  2QBY A;  1KA8 A;  3RYR A;  1E17 A;  2JTV A;  4Y13 A;  5DEQ A;  3BZ6 A;  3IWZ A;  2ZBK A;  2FXA A;  1TQP A;  4I0A A;  2D45 A;  3WG9 A;  2MD5 A;  2D1H A;  4AIK A;  4L9J A;  3FM5 A;  2H09 A;  3WU1 B;  3ISP A;  2P7V B;  1BIA A;  2MC3 A;  3D5L A;  3KP2 A;  4Q48 A;  3DKW A;  2XUB A;  4M74 A;  2EJR A;  1BC7 C;  3P9K A;  5L3E A;  5DCF A;  1S7A A;  2BGC A;  3V4G A;  2QUF A;  2IRF G;  4AIH A;  1BM9 A;  1W7P D;  3WOD F;  3ZMV A;  1XMK A;  3CUQ B;  1FNN A;  4N0B A;  4BXU A;  1S7O A;  3E6D A;  1W7P B;  3TGN A;  3DF8 A;  5DV5 A;  2EV6 A;  3F72 A;  1DPR A;  1SD4 A;  1IN4 A;  1BI0 A;  2K4B A;  4I01 A;  1B4A A;  1ZRE A;  1ZAO A;  3C1D A;  2M30 A;  3I54 A;  1UFM A;  2HKO A;  3BJO A;  4G6D A;  2A3S A;  3TKY A;  1ZG5 A;  4YG2 F;  2DTR A;  1FZP B;  4LLN A;  4IRI A;  3L00 A;  3F6V A;  2OZ6 A;  4KUM A;  4JBA A;  3BPX A;  1IN6 A;  2A07 F;  3GX4 X;  2M8E A;  3KCC A;  4PZJ A;  1XSX A;  2DK8 A;  5HLH A;  3ELK A;  1ON1 A;  5ED4 A;  1XSD A;  2NNY A;  2Y75 A;  2WTE A;  3RKY A;  4LB5 A;  1OYW A;  3LQR A;  5L3C A;  2EFO A;  2DO7 A;  4LJZ F;  2L01 A;  2K27 A;  1QPM A;  2FF4 A;  1I6X A;  5ILS A;  5A2Q K;  1YS6 A;  2EA4 A;  2RKH A;  2OA4 A;  1JGS A;  5CJ9 A;  2V6C A;  5J8C A;  2AS5 F;  3C7J A;  4B09 A;  4O5V A;  2ELH A;  1YFH A;  4GYI A;  2PG4 A;  4I7H A;  4WCG A;  4RB1 A;  2BBY A;  5IT9 K;  4F7Z A;  5K5Q A;  1IUY A;  4ENN A;  3EQL F;  3V8J A;  1ON2 A;  4JQF A;  4IF4 A;  3BJA A;  2VON A;  2UWM A;  4ON0 A;  5A2Q Z;  1LDD A;  3CO6 C;  2Y48 A;  1IW7 F;  1G3T A;  3G73 A;  4MHG A;  1P4X A;  3M7G A;  1SMT A;  3O3K A;  1OPC A;  3SHF A;  5FFX A;  1YQA A;  1IXS B;  4BNC A;  4M73 A;  1WQ2 A;  2VE8 A;  4I0B A;  1LDJ A;  4M9S A;  2EFP A;  2PEX A;  1J9I A;  4U0V A;  2M1B A;  4M72 A;  1L3L A;  1GXQ A;  2ESH A;  4M6Y A;  3TO7 A;  3RTR A;  3KP4 A;  1G3W A;  3MCZ A;  2LKP A;  2FU4 A;  4ENK A;  4HYE A;  1REP C;  5FFZ A;  2ZJ2 A;  2CG4 A;  1E2X A;  3N4M A;  2DK5 A;  1MD0 A;  1DP7 P;  2A61 A;  2MLG A;  4EM2 A;  2IJL A;  2GA2 A;  2DQR A;  3QRF F;  4XBF A;  1HKS A;  1HXD A;  3K1M A;  2DLL A;  4I09 A;  1MKM A;  1CF7 B;  2XKP A;  4IXA A;  2ESN A;  5KVR A;  1K78 B;  1B9N A;  3T5X A;  4UVB A;  4NHJ A;  3T0Y A;  2Z33 A;  1FP1 D;  4M71 A;  2OZU A;  3RJP A;  1V4R A;  1XGS A;  1R7J A;  3TOA A;  4N9H A;  1UB9 A;  2LF7 A;  2HTJ A;  5AON A;  1I1S A;  3LFK A;  2QM3 A;  4EM0 B;  3DXJ F;  2F5D A;  1CGP A;  3J80 K;  1KQ9 A;  1WKM A;  4A6E A;  3GVA A;  1JHF A;  3BOQ A;  4BHB A;  1B9M A;  4Y15 A;  3E5U A;  1U5T C;  4UXN A;  2Q0O A;  2XRO A;  4G7H F;  1F1Z A;  4KN7 X;  2HQN A;  5TRD A;  5FD5 A;  4KIC A;  1Z6T A;  4WXC A;  2DPD A;  2G9W A;  3OOP A;  1MJ9 A;  3K9T A;  4GCV A;  2CO5 A;  4IJA A;  2E7X A;  3ZN1 A;  4Q47 A;  1ZGJ A;  2EV5 A;  2Y0M A;  1FY7 A;  4IVN A;  2F5E A;  2QQA A;  2QEN A;  4K2E A;  4HOB A;  1R36 A;  1W4M A;  3RYP A;  2D1V A;  1Y0U A;  2EK5 A;  1WWX A;  3WTU C;  4HBL A;  4L9V A;  3TDU C;  3IRR A;  4ASN A;  2V1X A;  5DCM A;  4U7D A;  4PDK A;  3H3Z A;  4OIR F;  5D8L B;  2BE5 F;  1FYK A;  5E1Z B;  1YYV A;  1GVJ A;  2GA1 A;  3K1P A;  4KIB A;  4HF0 A;  2K86 A;  1ZG3 A;  3KFW X;  2A5Y B;  5ERI A;  1XD7 A;  4UHT A;  3GLX A;  4MEY F;  3WU0 A; 
#chains in the Genus database with same CATH topology
 4KJZ A;  5FKN A;  1N75 A;  2Y9Z A;  2R4G A;  2IA2 A;  5ICE A;  2CFO A;  1YW9 A;  1W5S A;  2PBI A;  3ULQ B;  2BHY A;  2KIQ A;  1R4M B;  3OR1 C;  4KMU X;  4YII A;  4MTD A;  4RGU A;  1T33 A;  3WTZ A;  5K1Y A;  3B6A A;  3EUH C;  2AQF A;  3B73 A;  3OIO A;  4ZYA A;  4HA8 A;  3DLA A;  1ZRF A;  1FX7 A;  3IHU A;  2F5C A;  4DZP A;  5EDN A;  4A5M A;  2O7O A;  3JRI A;  1YJN I;  5DUK A;  1UHM A;  4ETS A;  2QKL B;  3H36 A;  1RRJ A;  3KYD B;  3CDL A;  3OYL A;  2DPU A;  1K7A A;  4EGZ A;  4BAY A;  5EZG A;  3FMQ A;  1Z67 A;  2VQG A;  4CIC A;  4I6Z A;  2ID6 A;  2NRA C;  2ISZ A;  4ZZL A;  4G7O F;  2YU3 A;  3GEZ A;  2WA0 A;  2HYG D;  2IEK A;  4EMS A;  1HCR A;  2Y0S N;  3B02 A;  2OUM A;  4G7Z F;  1YX5 A;  3J81 K;  5FO5 A;  4MQV A;  5D6E A;  1JTY A;  4B4C A;  5GP9 A;  2DQL A;  4NC7 A;  2ZC2 A;  1Z0X A;  3UR3 C;  1WSU A;  1S6L A;  3GZN B;  2FEZ A;  3M8F A;  3I5U A;  1R9T J;  1JXS A;  1MIJ A;  1ODD A;  2KT0 A;  1FBQ A;  3S3N A;  2I10 A;  4N4N B;  2EZL A;  5IPA A;  1IC8 A;  3CMM A;  1SFK A;  2PN6 A;  3RSN A;  2F4M B;  4IQ4 A;  4BU2 A;  2XRL A;  5J3L A;  1QVU A;  4LGW A;  2YU9 J;  4DYR A;  1MBG A;  3H3U A;  1FSH A;  2FOK A;  3FMR A;  5EG0 B;  2K3P A;  2NYX A;  3W6J B;  3R0A A;  3GUD A;  2DOA A;  2CW7 A;  1YLF A;  3K2Z A;  2KIF A;  2FMY A;  3BR5 A;  4C2T A;  3G4S I;  4XM3 A;  3ZQ7 A;  2QSH X;  3C2H A;  4HQM A;  4BKX A;  2LVS A;  3KEQ A;  2GBY A;  3CCL I;  2UUZ A;  1BI2 A;  3BG9 A;  1T38 A;  2DA3 A;  3M1E A;  3OYF A;  4OWR B;  4AIJ A;  2EIN H;  3S2W A;  3J81 Z;  4E7H A;  2B7E A;  2M87 A;  3GFJ A;  1I3Q J;  3M8J A;  3JRB A;  2J5O A;  3QAH A;  2FUG 2;  3BR2 A;  2R7W A;  3GCM A;  3ZMU A;  2C6Y A;  1G3Y A;  2VQL A;  5FRO A;  3TW7 A;  2XGE A;  1NH3 A;  3HOU J;  1F5T A;  3CCQ I;  1MBJ A;  4CA0 A;  3ERE D;  1MSF C;  2PMZ A;  3KZI C;  4F92 B;  2PFB A;  4ZJZ A;  4I98 B;  3LQQ A;  4LG0 A;  5CLS A;  1OCO H;  2Z5U A;  3V42 A;  4WX9 A;  3AG2 H;  3CDI A;  2HVQ A;  4D9J A;  1IRG A;  2V7F A;  3GFL A;  2JSC A;  2HPI A;  1DP3 A;  2QSG X;  1LE8 B;  2JA6 J;  1NHA A;  3TP3 A;  3GWZ A;  1FC3 A;  1DGR M;  3D5R C;  2LBF A;  4B8X A;  2H1L A;  4KMF A;  2KFD A;  2UXN A;  3LSH A;  3HUG B;  1J0R A;  3C2G A;  5LEJ A;  1V54 H;  4Z6Y A;  2DJI A;  2A6H F;  2ZJR F;  1T0F C;  2K3F A;  5L3G A;  3FIS A;  1SD6 A;  1AHD P;  2V26 A;  3KP3 A;  1QA6 A;  3AAF A;  1J09 A;  2EIL H;  3HBL A;  2WAQ A;  1H9T A;  4RM2 A;  1TT5 B;  3K6G A;  3H5A A;  1Z6R A;  4AVP A;  3PFI A;  1GVD A;  2M9H A;  3GF2 A;  4BGD A;  4HF2 A;  4ZYD A;  4M6V A;  1H88 C;  4AC0 A;  3VYS B;  3DP7 A;  4A3L J;  1Y6I A;  2BW3 A;  1VND A;  3JRF A;  2CSO A;  1LDK B;  2HKX A;  2EZI A;  2TDX A;  4BY7 J;  4HDV A;  2OU2 A;  2VBX A;  3BQY A;  2LNB A;  4BJ5 C;  2JA8 J;  2D5V A;  5HVQ C;  2PMU A;  1XN7 A;  1RUO A;  1HQC A;  2E19 A;  4HDU A;  2IP2 A;  4XQF A;  4D7N A;  4P5O A;  5D4R A;  1YRN A;  2O61 A;  3HOY J;  4HST A;  2GLO A;  2XVC A;  4KIF A;  1MDM A;  2W25 A;  4KT5 C;  1ULY A;  4OOI A;  1IO2 A;  2ZSH B;  4RLQ A;  4EJO A;  5IP9 J;  2UZK A;  1S72 I;  2JA7 J;  2ETH A;  1NK3 P;  3HOT A;  1D5V A;  2K9L A;  2KRC A;  3FIW A;  3OWT A;  5E17 F;  2IBD A;  2NS7 A;  3RKW A;  3PIP F;  3FK6 A;  5E3M A;  2ZME A;  1OFC X;  2DW4 A;  5GTI C;  1Z21 A;  1TTY A;  2BXY A;  4HQE A;  1HF0 A;  4KDP A;  2BY0 A;  2HFH A;  3RKQ A;  3BZK A;  2R7D A;  1LEA A;  3VDX A;  4KYW A;  1TLH B;  2A6E F;  3GBG A;  2P6S A;  5B3S H;  3HKZ A;  4KIS A;  1RC9 A;  4HSR A;  2MFZ A;  1R00 A;  3I58 A;  1A04 A;  3M4O J;  2VC0 A;  2P5V A;  2ICW G;  5TJJ A;  3VB2 A;  1TNT A;  3R4K A;  4II3 A;  2W85 A;  2E5Z A;  2LF8 A;  2YX7 A;  2W24 A;  3HPH A;  3HL2 A;  2FRH A;  3F8B A;  3TL4 X;  4R79 A;  1ETO A;  4XL9 A;  1R22 A;  2L3D A;  2K9Q A;  2H6B A;  1A31 A;  4GFB A;  2P8T A;  2EFN A;  2RQP A;  1Y56 A;  2HQ5 A;  1KU9 A;  3R60 A;  4E7Z A;  4G94 A;  1R71 A;  4S05 A;  4CCK A;  2QBY B;  2VOO A;  4WXH A;  3S1N J;  2HOS A;  4FET A;  3G2B A;  4E7S A;  2H6C A;  2LKX A;  2X1E A;  2IGM A;  1P4W A;  3M1C A;  3QYF A;  2Z99 A;  3V8L A;  2DFH A;  2COM A;  1S29 A;  1D0Y A;  3K2A A;  2HDW A;  3W3C A;  5D5W B;  3IRQ A;  2YX4 A;  2HGC A;  4M3D A;  1BN5 A;  4RDU A;  1K6O A;  2DAO A;  1OMI A;  2BZT A;  2PI0 A;  2JUG A;  1DDN A;  1T56 A;  1U5T A;  1AWC A;  3DCF A;  3ZN0 A;  1JI8 A;  3FF5 A;  2NS0 A;  5H2F C;  2QYO A;  1LVK A;  1QNT A;  2QEX I;  4J01 A;  1X1B A;  2WV0 A;  4Y7N J;  3ECO A;  3RPQ A;  3F9K A;  1ZN2 A;  1LFU P;  3WTT C;  1FIP A;  3FXM A;  2FOW A;  1K61 A;  4IHV A;  4BY1 J;  4ENJ A;  4ZZD A;  4XNF A;  3HOS A;  3A01 B;  2HS5 A;  4BE2 A;  2GIZ A;  3JW4 A;  5JFR A;  1TWC J;  1HBX G;  2E2H J;  3CP8 A;  1ZLK A;  2BEO A;  1ETY A;  3V7C A;  1IXC A;  2BY3 A;  4JP0 A;  3CCY A;  3CZ6 A;  4XN0 A;  5E3O A;  3S3O A;  3AG4 H;  1VQK I;  3IUO A;  2E1O A;  1F9N A;  2CQX A;  2F5V A;  1JUM A;  1JKP C;  3JRD A;  2MG4 A;  2NNN A;  3I4P A;  5J1U A;  5GAH J;  2ME6 A;  5D5X B;  1DPU A;  1Z05 A;  4ESB A;  2VPL A;  4KIG A;  1JT6 A;  2VKE A;  1Y39 A;  4OIO F;  3WG7 H;  5CVR A;  2OQR A;  4M3F A;  3FXO A;  1SFX A;  4A3F J;  4DQ2 A;  3U21 A;  3HOW J;  1J2X A;  1Z91 A;  2Q8K A;  2HYF A;  1N78 A;  5HOO A;  1KYW A;  3S8P A;  1O4X A;  2F4I A;  4HX4 A;  3LOC A;  4G9Y A;  2JT1 A;  3MAJ A;  1SAU A;  2E7W A;  2RVC A;  4YFK F;  1XC5 A;  4EGY A;  2PJR A;  1RKT A;  5L3F A;  4XIC A;  5LFA A;  3EDP A;  4B43 A;  2BOL A;  3NEU A;  4P55 A;  3CME I;  3RZD J;  2XC7 A;  2JSP A;  5BPI A;  3RZO J;  2WAD A;  4XLN F;  1HDD C;  4Y52 J;  2V1N A;  4XOP A;  5C44 J;  5LRS A;  2ADU A;  2HVS A;  4U87 A;  1LVA A;  3KEY A;  4A3I J;  3GTK J;  5AIQ A;  1A5J A;  2FD5 A;  2FBH A;  1AKH B;  1EF4 A;  3FKJ A;  2FNA A;  1OKR A;  5HS7 A;  4OMY A;  4CYC B;  2P5L C;  2CH0 A;  1FIA A;  3DTI A;  2GQQ A;  2E1M B;  2DMT A;  2JZY A;  3PNY A;  5IY5 H;  4PFO A;  2LG4 A;  2Y0S A;  5HLI A;  3CCS I;  1EV7 A;  1QHH D;  2LYC A;  3CUQ C;  3JRG A;  2EZH A;  2OC6 A;  3H35 A;  4HNU A;  2LH9 A;  2Z2S B;  1ORK A;  1K78 A;  3DEE A;  1FMW A;  3HDD A;  1MGT A;  3CF2 A;  2NXN B;  3H3V K;  2WBM A;  1F43 A;  2VBW A;  2BVL A;  1SFU A;  2GAU A;  5LRR A;  1R23 A;  1SVM A;  3EUH A;  4CGZ A;  2OD5 A;  4I02 A;  5HDN A;  2KRF A;  3KX2 A;  2O9L A;  2P6T A;  4JX4 A;  3DU6 A;  4XKB A;  1ITY A;  5L3B A;  4ZH4 F;  3HGG A;  1IRX A;  2N8G A;  4HV6 A;  5LHH A;  3VOD A;  4CDG A;  2OCE A;  3WHC A;  2EFQ A;  2GXA A;  3BRO A;  2XGX A;  4FHT A;  2V9K A;  4MFD A;  4BYY A;  1LUJ B;  2QGU A;  2ZNZ A;  5EYR A;  1H8A C;  1YW8 A;  2ZXI A;  4DIQ A;  1Q1H A;  3DBL B;  1FSE A;  2W4S A;  2R92 J;  4E7L A;  2J5P A;  5B66 C;  4JOM A;  1ZLJ A;  2LY2 A;  3IH4 A;  2CV2 A;  3BJ6 A;  4LLG F;  1B72 B;  1LNW A;  3M07 A;  3EYY A;  1IV6 A;  5EGO A;  1UG0 A;  1X4O A;  2DOF A;  3MZH A;  5H6R A;  3QP6 A;  4N9I A;  3P9I A;  5CVU A;  5F0F A;  2VT2 A;  2HTS A;  2XGC A;  1V5E A;  2LP0 A;  4PJL A;  2IS1 A;  1OCC H;  4Q5S F;  1I1G A;  3X2Q H;  1U6G A;  1FOK A;  1TL8 A;  2E34 A;  3MMY B;  2VJI A;  3HZJ A;  4FTH A;  1I3A A;  3FZV A;  3OYH A;  2YPR A;  3DEW A;  4BQA A;  4XKC A;  2PQ8 A;  3OSG A;  4KNY A;  2JA5 J;  1X2M A;  3K1N A;  4V2F A;  4RAY A;  3OYC A;  5GAE J;  3HRS A;  4CZZ A;  3RI4 A;  2VC1 A;  3ABT A;  1HA8 A;  1V3F A;  1KQ0 A;  5IYD J;  2RQQ A;  4YRV A;  1YIT I;  1ETQ A;  3KZZ A;  2E2I J;  4ESJ A;  2HOE A;  5JI6 A;  3DBH B;  4A2U A;  1B6A A;  4KT6 A;  1J7K A;  1A6I A;  1K4T A;  2JRT A;  1QU3 A;  1KYZ A;  2VOP A;  3Q0W A;  5K5O A;  1BBY A;  3HEF A;  2VPR A;  2KPM A;  5J4V A;  3GXO A;  2XB0 X;  1J59 A;  1T6S A;  4C3J J;  1GXP A;  5HDK A;  3I0T A;  2Q2E A;  3E3V A;  3JSP A;  2XAF A;  4BL0 B;  3P7N A;  4Z2Y A;  1ZHF A;  1LPQ A;  3NQO A;  3H9G A;  4UV8 A;  5DUI A;  2EV0 A;  3CDH A;  5CQG A;  1XGO A;  2NOJ B;  5CVJ A;  3BTI A;  1K6Y A;  2QSF X;  3UKG A;  4YFN F;  3WTX C;  1YTY A;  2CWE A;  5F6F A;  2WB1 N;  2ZB9 A;  1T2K A;  5H20 A;  3HB9 A;  1HDP A;  2VJJ A;  3WE3 A;  2RC4 A;  5FKL A;  5J1R A;  2E60 A;  1S8N A;  2FE3 A;  4RLF A;  1O7L A;  1T0F A;  4NQW A;  3I53 A;  2MH2 A;  1IAW A;  3IWF A;  3O6B B;  3I4N J;  3U9G A;  3ZMT A;  1XCV A;  3O2P E;  1BOA A;  4WK8 F;  4N4O B;  5ICG A;  4BUP A;  2X48 A;  4ZTF A;  1FYM A;  1B1B A;  4AM3 A;  3FXR A;  4B48 A;  3IH3 A;  3AKZ A;  5IOY A;  4P9F A;  3Q5F A;  4NNJ A;  1Y8R B;  1GDT A;  4QIW N;  3AG3 H;  1JKO C;  3L2U A;  3SFI A;  1XB4 A;  2DI3 A;  1YIO A;  3EPZ A;  4UVC A;  3Q0U A;  4A3G J;  2GXB A;  1FTT A;  2XAS A;  3MVP A;  2VB6 A;  3HJE A;  3HTS B;  3I59 A;  1MND A;  1P9Q C;  1EA3 A;  3OYM A;  4RS8 A;  3WGH A;  1OR7 C;  3ROU A;  1PUE E;  4U0Y A;  3KIO A;  3BCA A;  3DEU A;  1UHW A;  1RZ4 A;  1WJA A;  4EJU A;  2X0L A;  3OYN A;  3DPL C;  3GTM J;  3HSE A;  3MZY A;  1IXR C;  3F3X A;  2ISY A;  2F4O B;  4HX7 A;  5EEA A;  3SJM A;  2L02 A;  1I5Z A;  2P5K A;  3C18 A;  3HSR A;  2X1C A;  4OIN F;  4HLX A;  5ICC A;  5CKT A;  2FQ3 A;  4L5I A;  4A0Y A;  3E5X A;  4LMY A;  3BWG A;  3GTQ J;  2O03 A;  1V5G A;  3ZQI A;  3F8N A;  3FXJ A;  3LSM A;  2MW8 A;  3PQJ A;  1NG7 A;  3MQ0 A;  5ICF A;  1UHS A;  4UVA A;  1P6R A;  2QZ8 A;  1OJL A;  4CCO A;  5BQT A;  2A05 A;  2K85 A;  3HM5 A;  4WF2 A;  2L9V A;  2O8K A;  3KEO A;  4ENM A;  2STW A;  1QBJ A;  2Y30 A;  1G4D A;  3A02 A;  1SAN A;  2YS9 A;  2ZSI B;  5E1X A;  2KJB A;  2IGO A;  1Z77 A;  1D1B A;  3TBI A;  2XSD C;  3AL0 B;  4IL6 C;  3IKV A;  3L2V A;  4FQG A;  1EH7 A;  1E3O C;  3HYI A;  4BJT A;  1HW2 A;  3S2D J;  1MJB A;  2ZXH A;  1T98 A;  3VEP A;  4M9X A;  5HOD A;  2LOO A;  1VQ8 I;  2NAZ A;  2QF7 A;  4JK1 X;  1UZC A;  4PJ0 C;  3OYA A;  1QZZ A;  1ZYR F;  2JMW A;  3IAS 2;  4Y3O A;  2QA4 I;  1JT0 A;  1HSJ A;  3OV8 A;  2VE9 A;  1B59 A;  3A2K A;  9ANT A;  3Q3S A;  3WU2 C;  1C0W A;  2Q1Z B;  5M5W J;  2FA5 A;  3L1P A;  1MMN A;  4DNC A;  5E3L A;  1Y8Q B;  3TMO A;  1IF1 A;  1ACI A;  3H92 A;  3C3W A;  3E6C C;  3T8R A;  3TOB A;  4AVZ A;  2DT6 A;  2EPF A;  3K4L A;  1H9G A;  1O57 A;  3BT9 A;  5JHF A;  4RGS A;  2VIX A;  2CYY A;  2Z1D A;  4EVI A;  1ETX A;  4UB8 C;  2IT0 A;  4PGG A;  2KZG A;  5D5V B;  2DCE A;  4RB3 C;  3ERM A;  4ANJ A;  3CJQ B;  5IT3 A;  1MNE A;  5D5U B;  2W57 A;  3IL2 A;  2X6X A;  1MMS A;  1BJA A;  4B44 A;  4HF1 A;  2M4G A;  1RES A;  3A03 A;  2A6T A;  2X6O A;  3PSI A;  1IZ1 A;  1FPQ A;  3HOX J;  1FBU A;  2H94 A;  5F08 A;  2VKV A;  2VUM J;  2NVY J;  1IN7 A;  4BHC A;  1WJD A;  4L18 B;  1AA7 A;  4WWC A;  4IHS A;  2HVR A;  2FSW A;  4HPQ A;  5DCM B;  3VFZ A;  2HZT A;  2MBF A;  1MZB A;  2RN7 A;  2ZCW A;  2DMN A;  3LSI A;  4OIQ F;  2M2E A;  1P4A A;  1WH7 A;  3OOU A;  3HUG A;  4O6J A;  5LGN A;  3GZ6 A;  2QLZ A;  3J7A O;  2E1N A;  1F36 A;  1OQY A;  2Y2Z A;  3WGI A;  4AWX B;  4UUS B;  3CLO A;  3E7L A;  1W5C C;  3H9Q A;  5FKO A;  1ONV A;  5J40 A;  4FT8 A;  3H5R A;  2DBB A;  1YHQ I;  4AU7 A;  1IN5 A;  3CMA I;  2XF6 A;  1BW5 A;  1BI1 A;  1S7E A;  2PLY A;  1ZGW A;  4RGR A;  1PVE A;  2Y9Y A;  3LWF A;  2JRM A;  3BG3 A;  2R5Y B;  2H8W A;  2JPC A;  3MWM A;  3U1K A;  4TV7 A;  4PJM A;  4XLA A;  5IYB J;  4IKF A;  3FXK A;  3UNG C;  2NOG A;  4MFE A;  1TW2 A;  2O3F A;  1SFE A;  3K4M A;  2CUF A;  1H0M A;  3OS1 A;  2ELJ A;  4HLY A;  2VI6 A;  1DGW Y;  3NAR A;  2DMP A;  5FB2 A;  5DS9 A;  2X6Y A;  3LAP A;  1RI7 A;  3R0J A;  2L9N A;  3E5Q A;  4A12 A;  1X3U A;  4HEA 2;  3ECH A;  3SYT A;  1UAA A;  2ZO4 A;  2DFI A;  3K4K A;  5LBQ A;  1KU3 A;  1MJA A;  4MQ9 F;  2HDD A;  2VJ4 A;  1USS A;  1VQ7 I;  5BMZ A;  5LHI A;  1CQT A;  3EUK L;  5ILV A;  2LRE A;  2HQR A;  4IRG A;  3DPU A;  1BI3 A;  1ZRD A;  3H0D A;  4E4H A;  3MEX A;  4OMZ A;  1IN8 A;  2NVX J;  1U9N A;  1SD5 A;  4DOZ A;  2X4H A;  1Z9C A;  2CQ7 A;  4YFX F;  5ILU A;  4QLC U;  2DMQ A;  5E18 F;  3CUQ A;  2XKO A;  3IKT A;  4UB6 C;  4JX5 A;  5E8I A;  4H0E A;  3PFY A;  2EWN A;  2LSO A;  3ZMZ A;  1TW3 A;  3E6B A;  2L54 A;  1R1T A;  4XOR A;  3CJR B;  1W7P A;  4XR6 A;  2R7Q A;  1WH5 A;  2VOD A;  3B6C A;  3D1N I;  4MNU A;  2A69 F;  1O3S A;  1STZ A;  2VAS A;  3C2B A;  4EM1 A;  3ABM H;  1JHH A;  1SD7 A;  2NVU B;  4HNV A;  4RGX A;  3I71 A;  4PGH A;  4RA2 A;  4R1H A;  1D3Y A;  4DYC A;  3F0C A;  2VN2 A;  3F8M A;  1ZAR A;  4QWQ A;  3E1S A;  5BNG A;  1R1U A;  1EJ9 A;  2KJC A;  3WTV C;  4DJA A;  1LEB A;  4GRI A;  1LB2 A;  3FXL A;  3TED A;  2PMH A;  2K9M A;  2O5R A;  2V1U A;  1WFX A;  2F2E A;  3CCJ I;  2BY2 A;  2M7A A;  3A1Y A;  2CUE A;  3LA2 A;  2LLK A;  2K5C A;  4FE7 A;  5D6F A;  3K4J A;  5HDG A;  5JVG F;  1NTC A;  4HAM A;  2M0M A;  2V9V A;  2CU7 A;  3OL3 A;  1RKW A;  4R8H A;  1XS9 A;  2A68 F;  3HSF A;  3RPU A;  1XX5 A;  4NB5 A;  3KZY A;  4LK1 F;  3ZQF A;  3S32 A;  5BPD A;  4HNT A;  3CES A;  1XSV A;  4IRH A;  1U8B A;  3T8T A;  1IRF A;  2ZKZ A;  2OJE D;  3FHZ A;  4LG0 B;  3LSR A;  5F1R A;  2XRN A;  4XLP F;  2O0Y A;  1VQ5 I;  2EFW A;  1NK2 P;  4ESF A;  2DYS H;  1DQU A;  2L4M A;  1H89 C;  1B8I A;  2R7S A;  2L7K A;  1X3W B;  2VBZ A;  2LBF B;  3CTA A;  4UNO A;  2CUJ A;  2KL4 A;  3QP5 A;  3GYH X;  2LDU A;  3V7S A;  3JRE A;  1WJF A;  1HW5 A;  3FMS A;  1TWF J;  2LK2 A;  3DQV C;  3LFU A;  1D8K A;  3H0G J;  3T1B A;  4FE4 A;  3CMY A;  1JKR C;  1VQP I;  1P2F A;  2DDA A;  1PUF B;  2QVO A;  2WAF A;  3TQN A;  4A3M J;  1FBS A;  4EQQ A;  1X2N A;  1ZTR A;  1VQ6 I;  3REO A;  4P9U A;  3FBI B;  4L0Y B;  2VKH A;  4IO9 F;  1Z3X A;  5KNL A;  3JRC A;  1J75 A;  1YG2 A;  1PDN C;  5F64 A;  2IGN A;  3FWE A;  2BW3 B;  2QCO A;  4LK0 F;  3FXU A;  2DT5 A;  2LC2 A;  3F6O A;  3LL7 A;  1RR8 C;  2IA1 A;  3PJR A;  3CCU I;  1T39 A;  3S2H J;  2XDV A;  1VQ4 I;  2HZD A;  2F48 A;  1VFC A;  3L7W A;  2FJ1 A;  3L2W A;  2W7N A;  2LD5 A;  2MAB A;  4HW0 A;  5KAI C;  2CQQ A;  4G6Q A;  3JTG A;  1OCP A;  1OYY A;  2NVT J;  1TC3 C;  1VQL I;  2K40 A;  3JR9 A;  1YRN B;  3ZQQ A;  3QQA A;  2MLK A;  4GDF A;  1UMQ A;  4PFP A;  5H6Q A;  1MDM B;  1I6H J;  4BEH A;  4M6X A;  5LEK A;  3F8F A;  1KU7 A;  1Y0N A;  4BHP A;  4IQJ A;  1PP8 F;  1KU2 A;  3KP5 A;  3RDI A;  4L5E A;  1YO5 C;  1LJ9 A;  2ZME B;  1FOY A;  3H1C A;  4BQQ A;  2GM4 A;  4MGR A;  3BR1 A;  2R5Z B;  4AUX A;  2ELK A;  4EAT A;  3RCO A;  1NG6 A;  5E79 C;  3HPG A;  2CQN A;  2NS8 A;  1ZKG A;  2WAE A;  4LB6 B;  4G6T B;  4XSZ F;  5EEG A;  1X1A A;  3BLY A;  2M34 A;  2RGV A;  4UY8 I;  4P1W A;  1YJ9 I;  3CCM I;  1HLV A;  1I27 A;  3WTY C;  3AFH A;  3K4C A;  5HS8 A;  3BDD A;  1W0U A;  3L2R A;  5M3F J;  4GGG A;  4PSW A;  4D7M A;  2K9N A;  4EJV A;  5D4S A;  3RKX A;  1OR7 A;  1YW7 A;  2DA1 A;  3BG5 A;  4IEJ A;  1N25 A;  4QSH A;  4MO7 A;  2ECC A;  1D1A A;  5FGM A;  4RAZ A;  5JLX A;  3CCV I;  1RNL A;  1F4K A;  3BTL A;  3SEZ A;  1J5Y A;  4ZYG A;  1PJR A;  1MBE A;  1XCB A;  5IP6 A;  1UCR A;  5LD2 C;  5B5E C;  5J4Y A;  3GTO J;  1HW1 A;  2E36 A;  2KRH A;  3CUO A;  3QOE A;  3K69 A;  2K02 A;  4O3M A;  1GUU A;  2MC4 A;  2MGQ A;  3HRT A;  2ZJQ F;  4NC6 A;  4D1Q A;  1FT9 A;  2V9P A;  3SXY A;  1D5Y A;  4MEX F;  2XAQ A;  3HHH A;  4F55 A;  4AYB N;  4LIV A;  3LSK A;  3JAM K;  1XPX A;  4FX4 A;  4ZYE A;  4GYG A;  2E2J J;  1B72 A;  4I2O A;  2RV8 A;  1XTA A;  3HOZ J;  2R7O A;  4BBR J;  1XMX A;  4FAS D;  1U3E M;  2K9S A;  5HNF A;  2IA0 A;  3OL4 A;  1P92 A;  3GFI A;  2M5W A;  4CZC A;  1G2H A;  1U5T B;  3H5N A;  1CF7 A;  1QHG A;  2BHZ A;  5B1A H;  3WTW C;  3NRV A;  1OLT A;  3DPT A;  2OAZ A;  1JKQ C;  4EEF G;  2DTZ A;  3BY6 A;  2DU9 A;  1D1C A;  1R4N B;  2GOX B;  3FM3 A;  3I56 I;  1ZQ3 P;  3W2A A;  3GW2 A;  2IS2 A;  1WJE A;  3E97 A;  3G71 I;  4CYD A;  1W36 C;  3OYI A;  5FLX K;  3J7Y J;  3CCE I;  1YX3 A;  5IT9 Z;  3OY9 A;  3KET A;  3MKL A;  4L0Z B;  1U9O A;  4RB2 C;  1WJB A;  1IGN A;  2FBK A;  2EB7 A;  4CCN A;  3JAM Z;  1R58 A;  4I99 C;  2P0W A;  2WY7 Q;  4IHT A;  2R7V A;  2ACJ A;  3GFM A;  4FX0 A;  3MKY B;  2EA2 A;  1X1D A;  1OYI A;  2HOT A;  3L09 A;  2DT7 B;  2HWV A;  4BBS J;  2ZXJ A;  1D8J A;  2V4J C;  3L2C A;  4B47 A;  2VQH A;  1WRJ A;  3QPL A;  4Y4R A;  2IXS A;  3G3Z A;  4EV0 A;  5LLQ A;  1U0J A;  4UV9 A;  5E8G A;  5JVT A;  3IAM 2;  3ZXS A;  3TW6 A;  1R5I D;  3LST A;  3K70 D;  3CC2 I;  1O7F A;  3W6K B;  1N77 A;  1E3P A;  1UJ8 A;  2GWR A;  2LFB A;  3FXQ A;  4V2G A;  4C3H J;  3ZGK A;  4U88 A;  1P7I A;  3J7A Y;  1TQI A;  3IV5 A;  2LKS A;  3CF5 F;  1FYL A;  3P9C A;  3F21 A;  2DDB A;  3JCU C;  3ABU A;  3KLO A;  2Y31 A;  5HNH A;  2PJR B;  4J00 A;  4CXF A;  2R7U A;  4M3B A;  2DXI A;  2DA6 A;  5FLX Z;  2P4W A;  3CP2 A;  1QZY A;  5FKM A;  3K4B A;  2DN0 A;  3SDB A;  2R3S A;  4QTR A;  4UUV A;  1K4S A;  2GXG A;  2A5W A;  4LFU A;  2KIM A;  2V79 A;  4A0Z A;  2XB5 A;  1V55 H;  2GZW A;  2GOM A;  2OF7 A;  2VBY A;  1SMY F;  2L2O A;  2VLA A;  4OU0 A;  3ML6 A;  2IVM A;  1TQM A;  3WTS C;  3MZ8 A;  4DBR A;  3VPR A;  3KLN A;  1U78 A;  1HKT A;  4ZYH A;  4X0G A;  1ETW A;  3PIO F;  3F8C A;  3VYT B;  2Z9O A;  3PM1 A;  1G8X A;  3Q9V A;  3GLL A;  2CQK A;  3PO3 J;  4FIS A;  2M7B A;  4GXO A;  3S1Q J;  2LY9 A;  4DW6 A;  2XHK A;  1HOM A;  1BC8 C;  2QQB A;  2IGK A;  2STT A;  3P5J A;  2R93 J;  2P7C B;  4A3C J;  4U0W A;  4LIT A;  4PK4 A;  1Q1V A;  2XF5 A;  1S5L C;  4CO8 A;  5FD6 A;  3A0H C;  4F93 B;  5LHG A;  5JR3 A;  2JQ7 A;  3G1O A;  1W5T A;  1EH6 A;  2M8G X;  1WVR A;  3PUF A;  4P96 A;  5B1B H;  3S93 A;  3SZG A;  4YIF A;  2X1D A;  2JA2 A;  2XAG A;  3IC7 A;  3VYU B;  5M3M J;  4BQN A;  4BDZ A;  2EH3 A;  5LGT A;  2L4A A;  1KGS A;  1L0O C;  3QPH A;  2HEO A;  2FML A;  5EZH A;  3ZQL A;  3S1R J;  2JPB A;  3KP6 A;  4MTE A;  1QVT A;  5BOX A;  2MD0 A;  3DWL E;  3LSG A;  3M8E A;  3TP0 A;  1MBH A;  1KON A;  3ZP5 A;  5E1W A;  2O8X A;  3GO5 A;  3VSL A;  2IW5 A;  5F27 A;  5E20 A;  2JK3 A;  2R7F A;  2HDC A;  3FX3 A;  3BR6 A;  3BQZ A;  1V5F A;  4RBO A;  4PCQ A;  1GHC A;  2UXX A;  3SZT A;  1RUN A;  5EGO B;  3OYE A;  5L3D A;  3F23 A;  2E1M C;  3JSO A;  4XRS A;  2Z3Y A;  3Q9S A;  4HV5 A;  3GME A;  3QU3 A;  1HST A;  1HC8 A;  1ERD A;  5CYV A;  4U7B A;  5EEH A;  1SAX A;  1BR4 A;  4DBQ A;  4QPQ A;  2VT3 A;  3RQ4 A;  2QQ9 A;  4ZDL A;  1R1V A;  4PSX A;  4YEL A;  2ZNY A;  3I64 A;  2V6E A;  4A3B J;  2QWW A;  2YR2 A;  3OMY A;  5BS6 A;  5K5R A;  1X1P A;  2FBI A;  3ESW B;  3JTH A;  3MN2 A;  5D8K B;  3S15 J;  3LA7 A;  2KKO A;  4F3Q A;  2DMU A;  4YIR X;  1OCT C;  1D0Z A;  1ZG1 A;  5KK1 A;  2G7U A;  4XKW A;  1BL0 A;  4XN3 A;  2K4J A;  2X6W A;  5DD4 A;  2BYV E;  1RR7 A;  4BQO A;  2E35 A;  1FOW A;  1MMA A;  2LMD A;  3CO7 C;  1QQI A;  1SC7 A;  1G3S A;  5C4X J;  3DKY A;  3ZOB A;  3QYE A;  4GO1 A;  3TO9 A;  3SQN A;  1DU0 A;  1ZGA A;  4D0P A;  1WZ2 A;  2AQE A;  1Y1W J;  5FLM J;  3E0J B;  4EJW A;  2L7M P;  2W84 A;  3J80 Z;  5DDG A;  4IPA A;  4D5C A;  2D2W A;  3ZQC A;  2DYR H;  1FMV A;  3S16 J;  2CV1 A;  1TWG J;  3EET A;  2W48 A;  1PP7 U;  2KDO A;  1A35 A;  3WGG A;  2WC2 A;  1ZRC A;  3FBN B;  1A6Q A;  5C4J J;  1A36 A;  1WI9 A;  2CW0 F;  4ZC3 A;  3ZMD A;  4F52 A;  2IPQ X;  1DUX C;  4CHU A;  2B0L A;  3D0S A;  1Y1V J;  2AXT C;  4CSW A;  3BP8 A;  2XV4 S;  5J8F A;  4S04 A;  5FRM A;  2FX0 A;  1R5H A;  3EUA A;  1K79 A;  2DA7 A;  2R7R A;  2VJ5 A;  3HG9 A;  3MFK A;  1XMA A;  4ZTJ A;  4ABZ A;  4HX8 A;  5JHU A;  1BJZ A;  3KP7 A;  4G12 A;  2BV6 A;  3HOV J;  1RPW A;  1QO0 D;  5CVI A;  3OS0 A;  1HKQ A;  1U8R A;  4KFC A;  2RDP A;  3ASO H;  3ZMS A;  5HLG A;  2XAH A;  5EG0 A;  4KA4 A;  4NQW B;  3DV8 A;  2HPM A;  1KQ8 A;  3LSP A;  2HYJ A;  3COA C;  2WV1 A;  2KIU A;  1JE8 A;  3U2R A;  5GPC A;  1AOY A;  2XAJ A;  1GT0 C;  1RET A;  1G59 A;  4C9Y A;  4ZDO A;  3DTE A;  5DD8 A;  2R5Y A;  1FLI A;  2CFX A;  2OBP A;  4Y17 A;  1IV8 A;  2XGD A;  3DKX A;  2VXZ A;  3V7R A;  3O8H A;  2G7H A;  5FRN A;  5TIS C;  3BG7 A;  3DFG A;  4IZZ A;  3N97 A;  4LOC A;  4DZJ A;  3HTU A;  1BR2 A;  2LRD A;  1SFO J;  2BXZ A;  5K7H A;  2V1D A;  3RIR A;  2CW8 A;  3I59 B;  1VF9 A;  3K7A J;  5K7Z A;  3M9A A;  1SVO A;  2MA3 A;  4E6K G;  2HXI A;  4J19 A;  2P81 A;  4JX6 A;  1BA5 A;  2RRE A;  1JGG A;  3BTJ A;  4A5N A;  4PUS A;  2E1C A;  4IHY A;  3GZ5 A;  1XDU A;  4XRF A;  5K7F A;  4HZF A;  2Z16 A;  1YIJ I;  4IOC F;  1VQ9 I;  1S3J A;  1YS7 A;  3L9F A;  1QGP A;  4XRM A;  3E6M A;  4AD9 A;  1LE8 A;  4BS9 A;  4A6D A;  1YOV B;  2PJP A;  2DJN A;  5TGT A;  2CUZ A;  4RB0 A;  4Y33 A;  5CVV A;  3TO6 A;  3HHG A;  3HIF A;  5HS9 A;  4IHX A;  4G8X A;  1QRY A;  5F04 A;  2QKM B;  4M3E A;  4AYB A;  3GTJ J;  4KN4 X;  4EJT A;  2F5F A;  1LQ1 A;  2FNP A;  3SZP A;  4OIP F;  4Q4Z F;  3V8K A;  2Y69 H;  1MMD A;  1XGM A;  4CCJ A;  1I50 J;  2WWY A;  1VQM I;  3M3Y J;  3R6S A;  1TBX A;  3CLQ A;  1U2W A;  3HC7 A;  3CC7 I;  6PAX A;  3W6V A;  3FK7 A;  3HRM A;  5IOZ A;  5DYM A;  5E3N A;  1TNS A;  2OQG A;  2YSR A;  1O3T A;  4IOA F;  1EH8 A;  3QOP A;  5KCM A;  4BH9 A;  1APL C;  2E71 A;  1O3Q A;  1XGN A;  2XIG A;  3QYB A;  2LR8 A;  4BXX J;  3LA3 A;  3BPV A;  2DFF A;  3VOE A;  3ZRG A;  2O6G E;  1T95 A;  3F22 A;  3DBR B;  2CGP A;  4A0X A;  3QU6 A;  4E7I A;  3SFZ A;  2AXL A;  4E70 A;  2RNJ A;  2YUS A;  1P7J A;  3G1M A;  3OR2 C;  2ZJP F;  3QPT A;  5JLW A;  2HR3 A;  4LLL A;  3SDG A;  3K0L A;  2RNG A;  4NBQ A;  2GIV A;  3LAJ A;  1IDZ A;  2MH9 A;  3NWT A;  5KAF C;  4BAC A;  1GV5 A;  2EQR A;  3OYG A;  3JRH A;  3TDZ C;  4IX7 A;  4XMY A;  5C3E J;  3PQK A;  3QOD A;  1FWZ A;  4W1U A;  3OYD A;  1ZH5 A;  5J6X A;  2MYS A;  1TP4 A;  4E7J A;  1WGX A;  4XID A;  2KIS A;  3WE2 A;  2X9D A;  3KE2 A;  4QPO A;  1RIO H;  1R5G A;  1MW7 A;  5LGU A;  1W0T A;  4WXD A;  3AL0 C;  2CV0 A;  2H27 A;  4LD5 A;  2XPW A;  1VTN C;  1G6N A;  2BY1 A;  3CJN A;  4L9N A;  1IRZ A;  3DTK A;  4L9T A;  4YEJ A;  3ZPL A;  1ZEL A;  1ZR4 A;  2COB A;  1TT0 A;  4L5J A;  1PUF A;  1Z1D A;  1O3R A;  3AG1 H;  2M45 A;  4A69 C;  1WI3 A;  5GAD J;  3HRU A;  1FEX A;  4XSX F;  4AID A;  1WJ5 A;  1BIB A;  2HI3 A;  1FP2 A;  1UST A;  2K7L A;  3EYI A;  1XDS A;  2X51 A;  3R61 A;  1Z7U A;  2ZFW A;  5AIP A;  4M9Z A;  3D5S C;  3U1D A;  4LIU A;  2QBY A;  1KA8 A;  3RYR A;  1VQN I;  1E17 A;  3K4N A;  2JTV A;  4DGW B;  1JUP A;  4Y13 A;  5DEQ A;  1D0X A;  1R6R A;  3BZ6 A;  3IWZ A;  4RAG A;  3ZQH A;  2DA5 A;  2ZBK A;  4XON A;  2L7Z A;  1BW6 A;  3NWS A;  2EIK H;  4XOT A;  2FXA A;  2ZXW H;  2VXD A;  1TQP A;  4I0A A;  2D45 A;  3I3L A;  1LFP A;  3WG9 A;  1UG2 A;  2MD5 A;  2D1H A;  4AIK A;  4MLO A;  5GPA A;  1JJ8 C;  4L9J A;  3FM5 A;  2H09 A;  3WU1 B;  3OSF A;  3IH2 A;  3ISP A;  1TZL A;  2P7V B;  1BIA A;  2MC3 A;  3D5L A;  2KLO A;  3KP2 A;  4Q48 A;  5DM6 F;  3DKW A;  2XUB A;  2R5Z A;  4M74 A;  4JYK A;  2EJR A;  2M0C A;  3A01 A;  1BC7 C;  2HOA A;  3P9K A;  5L3E A;  4I76 A;  5DCF A;  3ZR8 X;  1WHU A;  1S7A A;  2WB1 A;  2BGC A;  2RAE A;  3V4G A;  2QUF A;  2IRF G;  3N05 A;  4AIH A;  3QPS A;  1BM9 A;  1W7P D;  3WOD F;  3ZMV A;  1XMK A;  1W36 D;  3CUQ B;  4XK4 A;  1FNN A;  3SEQ A;  1VI0 A;  4N0B A;  4BDY A;  2ECB A;  2XPU A;  5EF6 A;  5GAG J;  5DTD A;  1VZ0 A;  4BXU A;  1S7O A;  3E6D A;  3Q0V A;  1W7P B;  4X1E A;  3TGN A;  3DF8 A;  5DV5 A;  2EV6 A;  3F72 A;  2JN6 A;  1DPR A;  2L5Q A;  1SD4 A;  1IN4 A;  2H1K A;  1MBF A;  1WJC A;  1BI0 A;  2K4B A;  4I01 A;  4NDL A;  1B4A A;  1ZRE A;  1ZAO A;  3BC8 A;  3C1D A;  2IS4 A;  2M30 A;  3I54 A;  1UFM A;  2HKO A;  5HLT A;  3RQI A;  3BJO A;  4G6D A;  4S0H B;  2A3S A;  3TKY A;  1ZG5 A;  5CPR B;  4YG2 F;  5J1Y A;  2DTR A;  2F6C A;  2KZV A;  1FZP B;  4LLN A;  4IRI A;  3L00 A;  3F6V A;  2OZ6 A;  4KUM A;  4JBA A;  3RPU D;  1X4P A;  3BPX A;  1IN6 A;  2A07 F;  4D5F A;  2ZFU A;  3GX4 X;  2M8E A;  3KCC A;  1YI2 I;  2KMU A;  4F91 B;  4PZJ A;  1XSX A;  2DK8 A;  3PNV A;  5HLH A;  1SEU A;  3ELK A;  1AKH A;  1ON1 A;  5ED4 A;  1XSD A;  2NNY A;  2R7X A;  4CYC A;  1EKE A;  2L9S A;  2Y75 A;  2WTE A;  3G1L A;  3RKY A;  2PX9 A;  3OIQ A;  4XLF A;  4LB5 A;  1OYW A;  3LQR A;  5L3C A;  5F0C A;  4XLE A;  2EFO A;  2DO7 A;  4LJZ F;  2L01 A;  2ID3 A;  2JUC A;  4ITV A;  2K27 A;  1QPM A;  2FF4 A;  1MNM C;  1TWH J;  1I6X A;  3DU5 A;  5CQE A;  2HU9 A;  5ILS A;  2M4K A;  3S14 J;  3QWL A;  1B8I B;  5A2Q K;  1YJW I;  4V19 K;  3LMM A;  1MH4 A;  1YS6 A;  2EA4 A;  2CRG A;  2RKH A;  3BCB A;  2OA4 A;  3W2V A;  1T08 B;  1JGS A;  5CJ9 A;  2L9R A;  2DA2 A;  2V6C A;  2XSJ C;  5M5Y J;  5J8C A;  2AS5 F;  2X85 A;  3I4M J;  4C2M J;  3C7J A;  2B63 J;  1M1E B;  3OIP A;  3PO2 J;  1TWA J;  4B09 A;  3BR0 A;  4O5V A;  4ZDP A;  2ELH A;  3ABL H;  1YFH A;  4GYI A;  2PG4 A;  4I7H A;  4WCG A;  4RB1 A;  2BBY A;  1FJL A;  4F7Z A;  5IT9 K;  3NAU A;  1X1C A;  5K5Q A;  1IUY A;  4ENN A;  1X19 A;  2VKD A;  4E7K A;  3EQL F;  1IDY A;  1ON2 A;  3V8J A;  4A3J J;  4JQF A;  4XKV A;  4IF4 A;  3BJA A;  2VON A;  5FJ8 J;  2UWM A;  1X3Z B;  4ON0 A;  5A2Q Z;  1LDD A;  3CO6 C;  4W97 A;  2Y48 A;  1IW7 F;  1G3T A;  3G73 A;  2W00 A;  5KHD A;  4A3E J;  2IAI A;  4MHG A;  4B1R A;  3CD6 I;  1P4X A;  5FLV A;  2LY1 A;  4BEH B;  3M7G A;  2HXO A;  1SMT A;  1I39 A;  3BR3 A;  4CCM A;  4IHW A;  4UUT A;  2E5N A;  3O3K A;  1OPC A;  3KPH A;  3SHF A;  2DOD A;  2R7Z J;  5FFX A;  3LNQ A;  4II2 A;  1YQA A;  4C30 A;  1IXS B;  4BNC A;  4RM3 A;  2VL8 A;  4M73 A;  2OPT A;  3CC4 I;  3VWB A;  3BG6 A;  1WQ2 A;  2VE8 A;  2KP6 A;  3JRA A;  4I0B A;  1LDJ A;  4M9S A;  2W1O A;  2EFP A;  3OYK A;  2PEX A;  1J9I A;  3A4C A;  4M3G A;  4BE1 A;  4A93 J;  4U0V A;  3L2Q A;  2CS3 A;  2M1B A;  4M72 A;  2M3A A;  3I9V 2;  4KIT B;  1L3L A;  1GXQ A;  4DYQ A;  2G0E A;  3J7Z I;  2ESH A;  3BZC A;  1OIS A;  4M6Y A;  3KYC B;  5IP7 J;  2FQ4 A;  1MH3 A;  2PMZ N;  1WPK A;  1ETV A;  2UV1 A;  3S17 J;  3TO7 A;  2AO9 A;  3RTR A;  3KP4 A;  4HRI A;  2XPV A;  1G3W A;  4RMN A;  1GV2 A;  3LSJ A;  4NC8 A;  3MCZ A;  4C2U A;  2LKP A;  2HQA A;  2FU4 A;  4ENK A;  1VQO I;  4HYE A;  1REP C;  4XLC A;  2R0Q C;  1X58 A;  2JVH A;  2KQR A;  4NUB A;  5FFZ A;  3GTG J;  5J47 A;  2ZJ2 A;  3O8G A;  1E0E A;  5M5X J;  2CG4 A;  2EZK A;  2I8D A;  1E2X A;  3CJT B;  3CQZ J;  3N4M A;  2DK5 A;  1MD0 A;  3PL8 A;  1DP7 P;  3MD2 A;  2EIM H;  2L0K A;  2A61 A;  3DLL F;  2WAQ N;  3G6E I;  1T8I A;  3GTL J;  2MLG A;  4EM2 A;  2ZME C;  3K10 A;  2IJL A;  2GA2 A;  3ZCO A;  4B3A A;  2B9S A;  2DQR A;  3PUB A;  3QRF F;  4XBF A;  1HKS A;  5EJC A;  1LKX A;  4BXF A;  2XAU A;  3HXL A;  3H9J A;  1HXD A;  3K1M A;  3CCR I;  2DLL A;  4I09 A;  1W1W E;  1K83 J;  3ASN H;  1MKM A;  4XRS G;  2XKP A;  2L7F P;  4CUG A;  5IYC J;  1CF7 B;  1IUF A;  4IXA A;  1S9H A;  1JTX A;  2ESN A;  2JWT A;  3S3M A;  2W82 A;  5KVR A;  3OS2 A;  4H4K C;  4PJJ A;  2OTJ I;  1K78 B;  2VQC A;  3IP4 B;  1B9N A;  3T5X A;  1PYV A;  1JJ6 C;  4UVB A;  1XG1 A;  2MSY A;  1OCR H;  4CCL A;  1Z3Y A;  4NHJ A;  2H8R A;  3T0Y A;  5F0H A;  2Z33 A;  2XF7 A;  2AHQ A;  1FP1 D;  2JJ7 A;  1ZR2 A;  4M71 A;  1BOB A;  2OZU A;  3RJP A;  1MSE C;  1V4R A;  1XGS A;  2QQ8 A;  1R7J A;  3TOA A;  1IG7 A;  1Z7L A;  4N9H A;  1UB9 A;  4X6A J;  2LF7 A;  2EBI A;  3KYL A;  3GTP J;  2HTJ A;  1LFB A;  1UEL B;  1ENH A;  4OAZ A;  5AON A;  1I1S A;  3LFK A;  2QM3 A;  4EM0 B;  3PNT A;  5DM7 F;  2IS6 A;  3DXJ F;  2F5D A;  1CGP A;  3FKI J;  3HKZ N;  1R49 A;  3J80 K;  4CH7 A;  1KQ9 A;  1WKM A;  3OYB A;  4A6E A;  3GVA A;  2OV7 A;  2CMP A;  4FCY A;  1JHF A;  3MKW B;  3BOQ A;  1DU6 A;  4BHB A;  2I5U A;  1B9M A;  4Y15 A;  3E5U A;  4XLH A;  1ZK8 A;  1U5T C;  2OCC H;  4UXN A;  2Q0O A;  4MIM A;  2XRO A;  4G7H F;  3MKZ A;  1SVL A;  1JUS A;  3ZQG A;  1F1Z A;  4KN7 X;  1AU7 A;  1FTZ A;  4A3K J;  2HQN A;  5TRD A;  2HNH A;  5FD5 A;  3FDY A;  4KIC A;  4BJ6 C;  1Z6T A;  1YE9 A;  4OAY A;  4WXC A;  2DPD A;  2G9W A;  1E3H A;  1MBK A;  1ETK A;  3OOP A;  1MJ9 A;  3HGY A;  2ME0 A;  3K9T A;  4GCV A;  2CO5 A;  4IJA A;  2E7X A;  3ZN1 A;  3ABK H;  3WHB A;  1KZH A;  4Q47 A;  1ZGJ A;  2EV5 A;  2Y0M A;  1FY7 A;  4IVN A;  2F5E A;  2JVG A;  1QZE A;  3BTC A;  2Q2E B;  2QQA A;  2QEN A;  4K2E A;  4PJN A;  1WCM J;  1IJW C;  4HOB A;  1R36 A;  5F1J A;  3S1M J;  3OYJ A;  4B3X A;  2OTL I;  1W4M A;  2DFE A;  3RYP A;  2D1V A;  1Y0U A;  1QPI A;  4C3I J;  2EK5 A;  1POG A;  3VSK A;  2DOE A;  1WWX A;  2TCT A;  3WTU C;  4HBL A;  3FHN A;  4L9V A;  2KDZ A;  4BE0 A;  3TDU C;  1OCZ H;  3IRR A;  1FOX A;  2BVM A;  2LTP A;  1GLN A;  2WY8 Q;  2V1X A;  4ASN A;  3K70 C;  3ONQ A;  4RAF A;  5DCM A;  4U7D A;  4PDK A;  3H3Z A;  4OIR F;  3I55 I;  1MMG A;  5D8L B;  2BE5 F;  1FYK A;  5E1Z B;  2R7T A;  1YYV A;  2CJJ A;  1GVJ A;  5FKK A;  3W2W A;  2GA1 A;  3A0B C;  2NVQ J;  3K1P A;  4KIB A;  4HF0 A;  4HG2 A;  2KHM A;  3VYR B;  2K86 A;  4UUS A;  1ZG3 A;  3KFW X;  2A5Y B;  3PSF A;  5ERI A;  2DA4 A;  4LG3 A;  1XD7 A;  5GTH C;  1BR1 A;  4UHT A;  2EIJ H;  3GLX A;  4MEY F;  4A3D J;  2TRT A;  3WU0 A; 
#chains in the Genus database with same CATH homology
 2IA2 A;  5ICE A;  1YW9 A;  1W5S A;  2PBI A;  3ULQ B;  4KMU X;  4YII A;  4MTD A;  4RGU A;  3WTZ A;  5K1Y A;  3B73 A;  4HA8 A;  1ZRF A;  1FX7 A;  3IHU A;  2F5C A;  4A5M A;  5DUK A;  1UHM A;  4ETS A;  2DPU A;  1K7A A;  4EGZ A;  4BAY A;  3FMQ A;  4CIC A;  2NRA C;  2ISZ A;  4ZZL A;  4G7O F;  2YU3 A;  3GEZ A;  2HYG D;  4EMS A;  3B02 A;  4G7Z F;  3J81 K;  5FO5 A;  4MQV A;  5D6E A;  2DQL A;  1WSU A;  1S6L A;  2FEZ A;  3M8F A;  3I5U A;  1JXS A;  1ODD A;  1FBQ A;  2PN6 A;  4LGW A;  3H3U A;  1FSH A;  2FOK A;  3FMR A;  3W6J B;  2NYX A;  3R0A A;  3GUD A;  1YLF A;  3K2Z A;  2KIF A;  2FMY A;  3ZQ7 A;  4HQM A;  3KEQ A;  1BI2 A;  1T38 A;  3M1E A;  4AIJ A;  3S2W A;  3J81 Z;  2M87 A;  3GFJ A;  2J5O A;  3QAH A;  3ZMU A;  2C6Y A;  1G3Y A;  1F5T A;  3ERE D;  2PFB A;  4I98 B;  3LQQ A;  4LG0 A;  5CLS A;  2Z5U A;  4WX9 A;  1IRG A;  3GFL A;  2JSC A;  1NHA A;  3GWZ A;  1FC3 A;  4B8X A;  4KMF A;  2UXN A;  1J0R A;  5LEJ A;  2A6H F;  5L3G A;  1SD6 A;  3KP3 A;  3AAF A;  1H9T A;  1Z6R A;  4AVP A;  3PFI A;  3GF2 A;  4HF2 A;  4ZYD A;  3DP7 A;  2CSO A;  1LDK B;  2HKX A;  2TDX A;  4HDV A;  2OU2 A;  2VBX A;  2LNB A;  5HVQ C;  2PMU A;  1XN7 A;  1RUO A;  1HQC A;  4HDU A;  2IP2 A;  5D4R A;  4P5O A;  2O61 A;  2XVC A;  4KIF A;  1MDM A;  2W25 A;  4KT5 C;  1ULY A;  4OOI A;  4EJO A;  2UZK A;  2ETH A;  3HOT A;  1D5V A;  5E17 F;  3RKW A;  2ZME A;  2DW4 A;  1TTY A;  4HQE A;  4KDP A;  2HFH A;  2R7D A;  1LEA A;  4KYW A;  1TLH B;  2A6E F;  2P6S A;  1R00 A;  3I58 A;  1A04 A;  2VC0 A;  2P5V A;  5TJJ A;  3VB2 A;  1TNT A;  3R4K A;  2W85 A;  2LF8 A;  2YX7 A;  2W24 A;  2FRH A;  3F8B A;  4R79 A;  1R22 A;  2L3D A;  2H6B A;  2P8T A;  2EFN A;  2RQP A;  1KU9 A;  3R60 A;  4G94 A;  4S05 A;  2QBY B;  2VOO A;  4WXH A;  2H6C A;  1P4W A;  2Z99 A;  3V8L A;  2COM A;  1S29 A;  5D5W B;  3IRQ A;  2YX4 A;  2HGC A;  1K6O A;  1BN5 A;  2DAO A;  1OMI A;  2PI0 A;  1DDN A;  1U5T A;  1AWC A;  3ZN0 A;  3FF5 A;  2NS0 A;  2QYO A;  1QNT A;  2WV0 A;  3ECO A;  3RPQ A;  1ZN2 A;  3WTT C;  4ENJ A;  4ZZD A;  3HOS A;  2HS5 A;  3JW4 A;  5JFR A;  1HBX G;  1ZLK A;  2BEO A;  3V7C A;  1IXC A;  1F9N A;  2NNN A;  3I4P A;  5D5X B;  1DPU A;  1Z05 A;  4ESB A;  4KIG A;  4OIO F;  5CVR A;  2OQR A;  1SFX A;  4DQ2 A;  1J2X A;  1Z91 A;  2Q8K A;  2HYF A;  5HOO A;  1KYW A;  4HX4 A;  4G9Y A;  2JT1 A;  3MAJ A;  2E7W A;  2RVC A;  4YFK F;  4EGY A;  5L3F A;  3EDP A;  3NEU A;  4P55 A;  5BPI A;  4XLN F;  5LRS A;  2ADU A;  1LVA A;  5AIQ A;  2FBH A;  2FNA A;  1OKR A;  5HS7 A;  4OMY A;  2P5L C;  2GQQ A;  2JZY A;  5HLI A;  1EV7 A;  3CUQ C;  1K78 A;  1MGT A;  2VBW A;  1SFU A;  2GAU A;  5LRR A;  1R23 A;  4CGZ A;  3EUH A;  2OD5 A;  4I02 A;  5HDN A;  2KRF A;  2P6T A;  5L3B A;  4ZH4 F;  5LHH A;  4HV6 A;  3VOD A;  4CDG A;  2EFQ A;  3BRO A;  2XGX A;  4FHT A;  4BYY A;  2ZNZ A;  1YW8 A;  1Q1H A;  1FSE A;  2J5P A;  1ZLJ A;  3BJ6 A;  4LLG F;  1LNW A;  3EYY A;  3MZH A;  5H6R A;  3QP6 A;  4N9I A;  3P9I A;  5CVU A;  2VT2 A;  2HTS A;  4Q5S F;  1I1G A;  1U6G A;  1FOK A;  4BQA A;  3FZV A;  2YPR A;  2PQ8 A;  4KNY A;  3K1N A;  4RAY A;  3HRS A;  4CZZ A;  3RI4 A;  2VC1 A;  3ABT A;  1V3F A;  1KQ0 A;  3KZZ A;  4ESJ A;  2HOE A;  5JI6 A;  4A2U A;  1B6A A;  1J7K A;  2JRT A;  1KYZ A;  2VOP A;  5K5O A;  1BBY A;  3GXO A;  1J59 A;  1T6S A;  1GXP A;  5HDK A;  3I0T A;  2Q2E A;  3E3V A;  3JSP A;  2XAF A;  3P7N A;  4Z2Y A;  1ZHF A;  3NQO A;  4UV8 A;  5DUI A;  2EV0 A;  3CDH A;  1XGO A;  5CVJ A;  4YFN F;  3WTX C;  1YTY A;  2CWE A;  5F6F A;  1T2K A;  5H20 A;  3WE3 A;  2RC4 A;  1S8N A;  2FE3 A;  1O7L A;  1T0F A;  4NQW A;  3I53 A;  2MH2 A;  1IAW A;  3IWF A;  3O6B B;  3U9G A;  3ZMT A;  1XCV A;  3O2P E;  1BOA A;  4WK8 F;  1FYM A;  5ICG A;  1B1B A;  3FXR A;  4P9F A;  3Q5F A;  1XB4 A;  2DI3 A;  1YIO A;  4UVC A;  2GXB A;  2XAS A;  3HTS B;  3I59 A;  4RS8 A;  3WGH A;  3ROU A;  1PUE E;  4U0Y A;  3DEU A;  1UHW A;  1RZ4 A;  4EJU A;  2X0L A;  3DPL C;  3HSE A;  3MZY A;  1IXR C;  3F3X A;  2ISY A;  4HX7 A;  2L02 A;  1I5Z A;  2P5K A;  3C18 A;  3HSR A;  4OIN F;  4HLX A;  5ICC A;  2FQ3 A;  4L5I A;  4A0Y A;  3E5X A;  4LMY A;  3BWG A;  2O03 A;  3F8N A;  3PQJ A;  3MQ0 A;  5ICF A;  4UVA A;  1P6R A;  2QZ8 A;  5BQT A;  4WF2 A;  3KEO A;  4ENM A;  2STW A;  1QBJ A;  1G4D A;  5E1X A;  2KJB A;  3IKV A;  1EH7 A;  3HYI A;  1HW2 A;  1MJB A;  1T98 A;  3VEP A;  4M9X A;  2NAZ A;  4JK1 X;  1QZZ A;  1ZYR F;  1HSJ A;  3OV8 A;  2VE9 A;  1B59 A;  1C0W A;  2FA5 A;  4DNC A;  1IF1 A;  3H92 A;  3C3W A;  3E6C C;  3T8R A;  3TOB A;  1H9G A;  1O57 A;  4RGS A;  2CYY A;  4EVI A;  2IT0 A;  4PGG A;  5D5V B;  4RB3 C;  5IT3 A;  5D5U B;  2W57 A;  3IL2 A;  1BJA A;  4HF1 A;  1IZ1 A;  1FPQ A;  1FBU A;  2H94 A;  1IN7 A;  4BHC A;  4L18 B;  4IHS A;  4WWC A;  2FSW A;  5DCM B;  3VFZ A;  2HZT A;  2MBF A;  1MZB A;  2RN7 A;  2ZCW A;  4OIQ F;  1P4A A;  5LGN A;  3HUG A;  4O6J A;  3GZ6 A;  2QLZ A;  3J7A O;  2E1N A;  3WGI A;  4AWX B;  3CLO A;  1ONV A;  4FT8 A;  2DBB A;  1IN5 A;  1BI1 A;  2PLY A;  4RGR A;  3LWF A;  2JPC A;  3MWM A;  4TV7 A;  1TW2 A;  2O3F A;  1SFE A;  1H0M A;  4HLY A;  5FB2 A;  3LAP A;  1RI7 A;  3R0J A;  3E5Q A;  4A12 A;  1X3U A;  3ECH A;  2ZO4 A;  2DFI A;  5LBQ A;  1KU3 A;  1MJA A;  4MQ9 F;  1USS A;  5BMZ A;  5LHI A;  5ILV A;  2HQR A;  4IRG A;  1BI3 A;  1ZRD A;  3MEX A;  4OMZ A;  1IN8 A;  1SD5 A;  2X4H A;  1Z9C A;  4YFX F;  5ILU A;  4QLC U;  5E18 F;  3CUQ A;  2XKO A;  3IKT A;  5E8I A;  4H0E A;  2EWN A;  2LSO A;  3ZMZ A;  1TW3 A;  3E6B A;  2L54 A;  1R1T A;  1W7P A;  2VOD A;  4MNU A;  2A69 F;  1O3S A;  1STZ A;  4EM1 A;  1JHH A;  1SD7 A;  4RGX A;  3I71 A;  4PGH A;  4R1H A;  1D3Y A;  2VN2 A;  3F8M A;  1ZAR A;  4QWQ A;  1R1U A;  2KJC A;  3WTV C;  1LEB A;  1LB2 A;  2PMH A;  2V1U A;  2F2E A;  3LA2 A;  5D6F A;  5HDG A;  4HAM A;  2V9V A;  4R8H A;  2A68 F;  3HSF A;  3RPU A;  4NB5 A;  3KZY A;  4LK1 F;  5BPD A;  1XSV A;  4IRH A;  3T8T A;  1IRF A;  2ZKZ A;  3FHZ A;  4LG0 B;  5F1R A;  2XRN A;  4XLP F;  2O0Y A;  2EFW A;  4ESF A;  2L4M A;  2VBZ A;  3CTA A;  4UNO A;  3QP5 A;  3GYH X;  2LDU A;  3V7S A;  1HW5 A;  3FMS A;  3DQV C;  1D8K A;  3T1B A;  1P2F A;  2QVO A;  3TQN A;  1FBS A;  4EQQ A;  3REO A;  4P9U A;  4L0Y B;  1J75 A;  1YG2 A;  1PDN C;  5F64 A;  3FWE A;  4LK0 F;  3FXU A;  2DT5 A;  3F6O A;  2IA1 A;  1T39 A;  3L7W A;  4HW0 A;  4G6Q A;  3JTG A;  1OYY A;  2MLK A;  5H6Q A;  1MDM B;  4M6X A;  5LEK A;  3F8F A;  1KU7 A;  4BHP A;  1PP8 F;  1KU2 A;  3KP5 A;  3RDI A;  1YO5 C;  1LJ9 A;  2ZME B;  4MGR A;  4LB6 B;  4XSZ F;  5EEG A;  2RGV A;  1I27 A;  3WTY C;  5HS8 A;  3BDD A;  4GGG A;  4EJV A;  5D4S A;  3RKX A;  1OR7 A;  1YW7 A;  5FGM A;  4RAZ A;  1RNL A;  1F4K A;  4ZYG A;  1J5Y A;  1XCB A;  1UCR A;  1HW1 A;  3CUO A;  3K69 A;  2K02 A;  4O3M A;  3HRT A;  1FT9 A;  3SXY A;  4MEX F;  2XAQ A;  3HHH A;  3JAM K;  4FX4 A;  4ZYE A;  4GYG A;  4I2O A;  2RV8 A;  1U3E M;  2IA0 A;  1P92 A;  3GFI A;  2M5W A;  1U5T B;  1CF7 A;  3WTW C;  3NRV A;  3DPT A;  2OAZ A;  3BY6 A;  2DU9 A;  3FM3 A;  3GW2 A;  3E97 A;  4CYD A;  5FLX K;  5IT9 Z;  3KET A;  4L0Z B;  4RB2 C;  2FBK A;  2EB7 A;  3JAM Z;  1R58 A;  4IHT A;  2ACJ A;  3GFM A;  4FX0 A;  2EA2 A;  1OYI A;  3L09 A;  2HWV A;  2ZXJ A;  1D8J A;  3L2C A;  1WRJ A;  3G3Z A;  4EV0 A;  5LLQ A;  4UV9 A;  5E8G A;  5JVT A;  3LST A;  3W6K B;  1O7F A;  2GWR A;  3FXQ A;  4U88 A;  1TQI A;  1FYL A;  3P9C A;  3F21 A;  3ABU A;  3KLO A;  4CXF A;  5FLX Z;  2P4W A;  1QZY A;  2R3S A;  4UUV A;  2GXG A;  4LFU A;  2KIM A;  2V79 A;  4A0Z A;  2GZW A;  2VBY A;  1SMY F;  4OU0 A;  3ML6 A;  2IVM A;  1TQM A;  3WTS C;  3KLN A;  1U78 A;  1HKT A;  4ZYH A;  3F8C A;  2Z9O A;  3Q9V A;  2CQK A;  4GXO A;  2XHK A;  1BC8 C;  2QQB A;  2STT A;  2P7C B;  4U0W A;  4CO8 A;  5FD6 A;  5LHG A;  5JR3 A;  1W5T A;  1EH6 A;  4P96 A;  4YIF A;  2XAG A;  3IC7 A;  5LGT A;  2L4A A;  1KGS A;  1L0O C;  3QPH A;  2HEO A;  2FML A;  2JPB A;  3KP6 A;  4MTE A;  5BOX A;  3M8E A;  3ZP5 A;  5E1W A;  2O8X A;  3GO5 A;  2IW5 A;  5E20 A;  2R7F A;  2HDC A;  3FX3 A;  4PCQ A;  1GHC A;  2UXX A;  3SZT A;  1RUN A;  5L3D A;  3F23 A;  3JSO A;  2Z3Y A;  3Q9S A;  4HV5 A;  3QU3 A;  1HST A;  5CYV A;  4U7B A;  5EEH A;  1SAX A;  2VT3 A;  2QQ9 A;  1R1V A;  2ZNY A;  3I64 A;  2QWW A;  2YR2 A;  5BS6 A;  5K5R A;  2FBI A;  3JTH A;  5D8K B;  3LA7 A;  2KKO A;  1ZG1 A;  5KK1 A;  2G7U A;  2K4J A;  5DD4 A;  2BYV E;  3CO7 C;  1QQI A;  1G3S A;  4GO1 A;  3TO9 A;  3SQN A;  1ZGA A;  4D0P A;  4EJW A;  2W84 A;  3J80 Z;  5DDG A;  4IPA A;  2D2W A;  3EET A;  1PP7 U;  3WGG A;  2WC2 A;  1ZRC A;  1WI9 A;  2CW0 F;  3ZMD A;  2IPQ X;  1DUX C;  4CHU A;  2B0L A;  3D0S A;  5J8F A;  3BP8 A;  2XV4 S;  4S04 A;  1R5H A;  1K79 A;  3MFK A;  1XMA A;  4HX8 A;  5JHU A;  3KP7 A;  2BV6 A;  1QO0 D;  5CVI A;  1HKQ A;  1U8R A;  4KFC A;  2RDP A;  3ZMS A;  5HLG A;  2XAH A;  4KA4 A;  3DV8 A;  1KQ8 A;  3COA C;  2KIU A;  1JE8 A;  3U2R A;  1AOY A;  2XAJ A;  5DD8 A;  1FLI A;  2CFX A;  2OBP A;  4Y17 A;  2VXZ A;  3V7R A;  2G7H A;  3DFG A;  3N97 A;  3HTU A;  2V1D A;  3RIR A;  3I59 B;  3M9A A;  2MA3 A;  4A5N A;  2E1C A;  3GZ5 A;  1XDU A;  4XRF A;  4HZF A;  1S3J A;  1YS7 A;  3L9F A;  1QGP A;  3E6M A;  4AD9 A;  4A6D A;  2PJP A;  4RB0 A;  5CVV A;  3TO6 A;  3HHG A;  3HIF A;  5HS9 A;  4G8X A;  4KN4 X;  4EJT A;  2F5F A;  1LQ1 A;  2FNP A;  3SZP A;  4OIP F;  4Q4Z F;  3V8K A;  1XGM A;  2WWY A;  3R6S A;  1TBX A;  1U2W A;  6PAX A;  3HRM A;  5DYM A;  1TNS A;  2OQG A;  2YSR A;  1O3T A;  1EH8 A;  3QOP A;  4BH9 A;  1O3Q A;  1XGN A;  2XIG A;  3LA3 A;  3BPV A;  3VOE A;  2O6G E;  3F22 A;  2CGP A;  4A0X A;  3QU6 A;  3SFZ A;  2AXL A;  4E70 A;  2RNJ A;  3QPT A;  2HR3 A;  4LLL A;  3K0L A;  2GIV A;  3LAJ A;  2MH9 A;  3TDZ C;  3PQK A;  1ZH5 A;  1FWZ A;  5J6X A;  3WE2 A;  1RIO H;  3KE2 A;  1R5G A;  5LGU A;  4WXD A;  2H27 A;  4LD5 A;  1VTN C;  1G6N A;  3CJN A;  4L9N A;  4L9T A;  3ZPL A;  4L5J A;  1O3R A;  1Z1D A;  2M45 A;  3HRU A;  4XSX F;  1BIB A;  1FP2 A;  1UST A;  2K7L A;  3EYI A;  1XDS A;  3R61 A;  1Z7U A;  2ZFW A;  5AIP A;  4M9Z A;  3U1D A;  2QBY A;  1KA8 A;  3RYR A;  1E17 A;  2JTV A;  4Y13 A;  5DEQ A;  3BZ6 A;  3IWZ A;  2ZBK A;  2FXA A;  1TQP A;  4I0A A;  2D45 A;  3WG9 A;  2MD5 A;  2D1H A;  4AIK A;  4L9J A;  3FM5 A;  2H09 A;  3WU1 B;  3ISP A;  2P7V B;  1BIA A;  2MC3 A;  3D5L A;  3KP2 A;  4Q48 A;  3DKW A;  2XUB A;  4M74 A;  2EJR A;  1BC7 C;  3P9K A;  5L3E A;  5DCF A;  1S7A A;  2BGC A;  3V4G A;  2QUF A;  2IRF G;  4AIH A;  1BM9 A;  1W7P D;  3WOD F;  3ZMV A;  1XMK A;  3CUQ B;  1FNN A;  4N0B A;  4BXU A;  1S7O A;  3E6D A;  1W7P B;  3TGN A;  3DF8 A;  5DV5 A;  2EV6 A;  3F72 A;  1DPR A;  1SD4 A;  1IN4 A;  1BI0 A;  2K4B A;  4I01 A;  1B4A A;  1ZRE A;  1ZAO A;  3C1D A;  2M30 A;  3I54 A;  1UFM A;  2HKO A;  3BJO A;  4G6D A;  2A3S A;  3TKY A;  1ZG5 A;  4YG2 F;  2DTR A;  1FZP B;  4LLN A;  4IRI A;  3L00 A;  3F6V A;  2OZ6 A;  4KUM A;  4JBA A;  3BPX A;  1IN6 A;  2A07 F;  3GX4 X;  2M8E A;  3KCC A;  4PZJ A;  1XSX A;  2DK8 A;  5HLH A;  3ELK A;  1ON1 A;  5ED4 A;  1XSD A;  2NNY A;  2Y75 A;  2WTE A;  3RKY A;  4LB5 A;  1OYW A;  3LQR A;  5L3C A;  2EFO A;  2DO7 A;  4LJZ F;  2L01 A;  2K27 A;  1QPM A;  2FF4 A;  1I6X A;  5ILS A;  5A2Q K;  1YS6 A;  2EA4 A;  2RKH A;  2OA4 A;  1JGS A;  5CJ9 A;  2V6C A;  5J8C A;  2AS5 F;  3C7J A;  4B09 A;  4O5V A;  2ELH A;  1YFH A;  4GYI A;  2PG4 A;  4I7H A;  4WCG A;  4RB1 A;  2BBY A;  5IT9 K;  4F7Z A;  5K5Q A;  1IUY A;  4ENN A;  3EQL F;  3V8J A;  1ON2 A;  4JQF A;  4IF4 A;  3BJA A;  2VON A;  2UWM A;  4ON0 A;  5A2Q Z;  1LDD A;  3CO6 C;  2Y48 A;  1IW7 F;  1G3T A;  3G73 A;  4MHG A;  1P4X A;  3M7G A;  1SMT A;  3O3K A;  1OPC A;  3SHF A;  5FFX A;  1YQA A;  1IXS B;  4BNC A;  4M73 A;  1WQ2 A;  2VE8 A;  4I0B A;  1LDJ A;  4M9S A;  2EFP A;  2PEX A;  1J9I A;  4U0V A;  2M1B A;  4M72 A;  1L3L A;  1GXQ A;  2ESH A;  4M6Y A;  3TO7 A;  3RTR A;  3KP4 A;  1G3W A;  3MCZ A;  2LKP A;  2FU4 A;  4ENK A;  4HYE A;  1REP C;  5FFZ A;  2ZJ2 A;  2CG4 A;  1E2X A;  3N4M A;  2DK5 A;  1MD0 A;  1DP7 P;  2A61 A;  2MLG A;  4EM2 A;  2IJL A;  2GA2 A;  2DQR A;  3QRF F;  4XBF A;  1HKS A;  1HXD A;  3K1M A;  2DLL A;  4I09 A;  1MKM A;  1CF7 B;  2XKP A;  4IXA A;  2ESN A;  5KVR A;  1K78 B;  1B9N A;  3T5X A;  4UVB A;  4NHJ A;  3T0Y A;  2Z33 A;  1FP1 D;  4M71 A;  2OZU A;  3RJP A;  1V4R A;  1XGS A;  1R7J A;  3TOA A;  4N9H A;  1UB9 A;  2LF7 A;  2HTJ A;  5AON A;  1I1S A;  3LFK A;  2QM3 A;  4EM0 B;  3DXJ F;  2F5D A;  1CGP A;  3J80 K;  1KQ9 A;  1WKM A;  4A6E A;  3GVA A;  1JHF A;  3BOQ A;  4BHB A;  1B9M A;  4Y15 A;  3E5U A;  1U5T C;  4UXN A;  2Q0O A;  2XRO A;  4G7H F;  1F1Z A;  4KN7 X;  2HQN A;  5TRD A;  5FD5 A;  4KIC A;  1Z6T A;  4WXC A;  2DPD A;  2G9W A;  3OOP A;  1MJ9 A;  3K9T A;  4GCV A;  2CO5 A;  4IJA A;  2E7X A;  3ZN1 A;  4Q47 A;  1ZGJ A;  2EV5 A;  2Y0M A;  1FY7 A;  4IVN A;  2F5E A;  2QQA A;  2QEN A;  4K2E A;  4HOB A;  1R36 A;  1W4M A;  3RYP A;  2D1V A;  1Y0U A;  2EK5 A;  1WWX A;  3WTU C;  4HBL A;  4L9V A;  3TDU C;  3IRR A;  4ASN A;  2V1X A;  5DCM A;  4U7D A;  4PDK A;  3H3Z A;  4OIR F;  5D8L B;  2BE5 F;  1FYK A;  5E1Z B;  1YYV A;  1GVJ A;  2GA1 A;  3K1P A;  4KIB A;  4HF0 A;  2K86 A;  1ZG3 A;  3KFW X;  2A5Y B;  5ERI A;  1XD7 A;  4UHT A;  3GLX A;  4MEY F;  3WU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...