1YYXA

The solution structure of a redesigned apocytochrome b562 (rd-apocyt b562) at 2.8m urea
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTIRAYNQKYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redesigned apo-cytochrome b562
publication title Detection and structure determination of an equilibrium unfolding intermediates of Rd-apocytochrome b562: native fold with non-native hydrophobic interactions
pubmed doi rcsb
molecule tags De novo protein
total genus 35
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yyxA00
4IB4A 2XLVA 4JEBA 1RCPA 1GQAA 2YLIA 1APCA 3C63A 1M6TA 3ZQVA 3M15A 2XLMA 2QLAA 2XLHA 4U9DA 1CGOA 3QVZA 3C62A 5JUAA 4ULVA 4WGZA 2YLDA 1NBBA 3M4CA 1LM3B 4EIYA 1E86A 3FOPA 2YL3A 4JE9A 3HNLA 4N6HA 5JP7A 2CCYA 3VRCA 2XLOA 3ZTMA 3NMIA 3DE9A 4IAQA 1MQVA 4CDVA 1QQ3A 3M79A 3TOLA 3QW0A 4ER9A 2XLWA 1E84A 1CPQA 2XM4A 3QVYA 5JSLA 1CPRA 1JAFA 2YLGA 3HNIA 1E85A 3IQ5A 3HNJA 3HNKA 3QW1A 1YYJA 2J8WA 1CGNA 4U9EA 1EKYA 5B3IA 1S05A 3TOMA 1QPUA 3NMKA 5JT4A 2XLDA 2XM0A 4JKVA 2XLEA 2YL7A 5JVEA 1YZCA 3DE8A 3FOOA 1BBHA 2XL6A 2YL0A 2YL1A 4WGYA 4N4WA 5AGFA 3ZQYA 2XL8A 1YYXA 4L6RA 4CJGA 5JLIA 256BA 3M4BA 4CX9A 4IARA 4CDYA 3L1MA 3ZTZA 4CIPA 4NC3A 5JS5A 1A7VA 1YZAA 4D4NA 2YKZA 3ZWIA 3U8PA 4JEAA 5JRAA 2BC5A 4CJOA 2J9BA 4CDAA 4D4XA 1E83A 3IQ6A 3NMJA
chains in the Genus database with same CATH superfamily
1ZU5A 1TWAA 4IB4A 4DRHB 1FR0A 4MVSA 3AOUA 1JPNA 2FFHA 4PJNA 1MMGA 3GM1A 4O6YA 3GEIA 4XEVA 1RKEA 1WGWA 1V74B 3G4ZA 1Z7Qc 5KYNA 4BJ5C 3EGXB 3L0IA 1TFOB 4YT5A 3SNHA 4CS9C 3JCUQ 1VTMP 2Y3BA 1LKXA 4PACA 1B68A 2Y39A 2QUPA 4QDLA 3E70C 1ZW3A 1A7EA 3EHMA 3FAJA 2YHSA 3NYJA 1YVIA 4IAOA 4AE4A 5KYYB 4Q5SF 1TKNA 3EQLF 3LEVA 2CGEA 3OWTA 2QLAA 1VK5A 1V55C 2XLHA 4YN0B 4X0RA 1OKKD 2DB4A 1Q0FA 2FAPB 1HE1A 1TQGA 2NUPB 3QVZA 1VYKA 4I1OB 1YA7O 3FVYA 4YT4A 5JUAA 4P6IC 4I44A 2R7TA 2J9WA 3LS0A 5CI9A 4EBKA 1NSGB 3W8IA 2WVOA 3FOPA 4JCHA 5DS4A 4QI2A 4G0HA 2XLOA 1MNDA 2MWQA 3GWNA 4MVOA 4YL0A 2R7WA 2HV7A 2KGOA 2QNLA 3LUTB 1R4TA 1ST6A 2GA0A 2R25A 2PNOA 4BJ6A 4U5HA 4CDVA 1LI5A 2QTVA 4JRZA 3CAXA 2D5RB 1C02A 2DI3A 2R02A 4IGGA 4OD5A 1Z6AA 2DYRC 2RSEB 1EA8A 4MQ9F 3QW0A 3TOLA 1OXKA 3QTHA 4N6CA 3W8HA 4RBNA 3QVYA 1W2WA 4NTAA 3AQCA 4JC7A 3ZIBA 3SYNA 1JOGA 3SEOA 2YLGA 1ZHZA 1YA9A 2X51A 2WB7A 3NKEA 3SXYA 2DGJA 3H2VA 4MVRA 3DKAA 4H4KC 5KYWA 2LP4A 3U5SA 1YARO 3QW1A 3X2QC 5FCLA 2VASA 1GGQA 1LI7A 2JX0A 5A6AA 1CGNA 4J7YA 4I3MA 3ABKC 2AWYA 3KYJA 4ZLCA 1M57C 1H7IA 3NKDA 1QPUA 1QSPA 3G50A 1ZHXA 2JPUA 3DZAA 3JRTA 2XLEA 2DYSC 2C04A 3IHUA 5EK0A 4BJ6C 4CBEA 1MNEA 4Z9HA 4KBLA 3DE8A 1BZ4A 3U9MA 1H9TA 3U3BA 3JSZA 3EFOA 1TWGA 4N4WA 2MHRA 3TJ5A 5K0IA 4G7HF 3MBGA 1PV3A 5COMA 3F47A 2P1AA 3LNRA 1XWJA 1K40A 1OXBA 2WZGA 3GANA 3S29A 4DVYP 5JLIA 5KYXA 4FAPB 2LIGA 4CX9A 4CDYA 2HKVA 1ZW2A 5EHHA 1FMWA 1K05A 4YK5A 3RW0A 3FXHA 1JRAA 3Q7LA 2J7PD 3RQFA 4DOZA 4XQ1A 5E33A 4BG0A 4NC3A 4C7OA 5BQIA 4D4NA 4BEMJ 2Z15A 3O55A 3AGTA 1ZHYA 3AG4C 5L0JA 3C8GA 4RD9A 3EGDA 5L0CA 4EHPA 3S27A 1G8XA 1RXQA 4UDVA 1IZMA 2OG2A 2ZPAA 4C3BA 2XXAB 1QZXA 4HFKB 3B9QA 3EH2A 2ZXWC 4HFFB 2J9BA 3RF3A 3X1OA 1TWCA 4J30B 5A6JA 1E83A 2XSEA 5A69A 2HS5A 2GDCA 2LFFA 2VH3A 2EILC 5L0IA 3HLZA 4U5DE 4JIOA 1YAUO 1I4YA 1PD1A 2H7VC 1HY5A 3RQEA 1Y4CA 2M64A 1KU2A 3V5YA 4PFOA 2BE5F 2ETSA 3M1CB 2A6HF 2P6VA 1LVKA 3WHNA 3ZVRA 3H2UA 3UGOA 1SYQA 2A69F 4MS2A 4YT2A 2NUTB 1VMAA 1ORJA 4OD4A 2I8BA 3KMIA 4AL0A 2D4UA 3BRJA 5L0DA 1NG1A 3EHNA 1OCZC 3FMSA 3LLKA 1F1MA 3GM2A 2LD6A 4EUKB 5L3QA 1O3UA 2L81A 2WVNA 2HUJA 3AQBA 4NQFA 1M6TA 2R7SA 1VLTA 3B0UX 1HW1A 1OKKA 3I4UA 2LCHA 3T6BA 3M15A 5A6KA 2XLMA 4OIRF 4U9DA 3U2LA 2X0CA 1D1CA 3K66A 1WN0A 2OOCA 4ULVA 3IPMO 3IEEA 4WGZA 3TK0A 1LM3B 3WAQA 3N2ZB 3UMHA 1LPEA 2CNWD 4EIYA 4HE8D 4JE9A 3S28A 4FESA 4N6HA 2CCYA 2NSGA 3R7CA 2NG1A 2L9JA 3ZTMA 4U5EE 5BQHA 1RJ9A 4E0IA 1LIHA 3DE9A 4IAQA 1O87A 2J0XA 4E7ZA 3A9CA 5B1AC 2H7BA 1RKCA 2J46A 1C03A 5D92A 4WJ0A 1QQ3A 4O7GA 2YRFA 3U2MA 1Z23A 4GQHA 3H65A 4C3EA 4DXWA 1HW2A 1ORYA 1MMAA 1OR2A 3GODA 4LLCA 4ULWA 3U9JA 4DJ9A 4O6NA 4ER9A 4CIHA 4Z9IA 5T3WA 4DRJB 4EBBA 2VCCA 3B29A 5JSLA 4JTAB 4W8PA 2W4BA 2ICWG 4HEAJ 1CPRA 5D91A 3GWLA 1OCRC 2L6FA 3K1IA 3SXKA 3IQ5A 3HNJA 3LNMB 5F28E 4XEFA 1D1BA 3UGPA 3ZG1A 1T6UA 2GFHA 1A7DA 1U89A 2H7OA 4XEKA 1VYIA 1ZVZA 5L0GA 1K04A 4JZAA 2R7OA 1TFKB 1EKYA 1U6HA 3FDQA 4E0HA 1S05A 2R7RA 3TOMA 2IXMA 4GEHA 1M2VB 3UMIA 4YL1A 4JKVA 1JPJA 3WG7C 1LS4A 2YL7A 5JVEA 2OEVA 1SZIA 1YZCA 3RKOF 4FX5A 3FOOA 3NDBB 5DLJA 5TJ5E 2XL6A 2YL0A 1MMDA 1HE9A 2YL1A 3EH1A 3NMJA 4NY3A 4WGYA 3SXMA 1UG7A 2OQMA 1AEPA 2JD3A 3JTLO 4IWBA 3VF0A 4CS8A 1OCCC 4PR9A 1VLSA 4XLNF 3JYYA 1T9KA 2A1DD 2ZD9A 3DAGA 3JZ0A 2LK4A 5B1BC 1Y6DA 1YYXA 3K7DA 3U0CA 1HMOA 3EZHA 3K1IC 4XPYA 2KC3A 4BPMA 1A0BA 3LLIA 4PJLA 3FAPB 3RQGA 3L1MA 2J7PA 3O10A 1QKRA 2CDQA 1ZHWA 2WZFA 4NCQA 3WODF 3KL4A 3PDMP 5DS6A 3ZTZA 1QVXA 4IRUA 1SR2A 1NU9C 4U5CE 4AL1A 1FNTc 2KQ9A 3S9OA 2YEVA 3EGXA 1E2XA 2KW3C 2CW0F 3W4YA 1Z63A 4XWJA 3ZWIA 3Q6NA 4JJGA 2A68F 4JEAA 1O5HA 2Q00A 2KJGA 2VCAA 3OA1A 3ZSUA 2QY9A 5KYYA 4U5BE 2J0WA 3IQ6A 2HJMA 3MX3A 2YQYA 3LS1A 4CS8C 3PCVA 2NUPA 2WZLA 2OCCC 3KPHA 1OQCA 2E87A 1R5ID 4W8KA 4XPXA 5T1DB 3TQOA 1WOLA 3R2PA 4MVQA 3QMKA 3RH3A 2M4EA 1OW6A 4ANJA 5KYUB 3JSEO 4F4BA 4YL3A 3T6GB 3ABMC 3IQTA 3J06A 1GQAA 3EG9B 2H8AA 1FFTC 1IW7F 3BEHA 4JJFA 1WTYA 1SF8A 4LDKA 3GM3A 2J45A 3C63A 2W4MA 2LQGA 3T6JA 2B0JA 2OU6A 1SMYF 2F22A 1TR2A 1Q0GA 5F5FA 3DD7A 1G4WR 4LLEA 2GWWA 1H9GA 2AVKA 2YVKA 3CSKA 1BR2A 3NRHA 4Z9JA 3ZQVA 5F5HA 2KNHA 3W2WA 4A4AA 1Z5ZA 3AGUA 4EWCA 4G7ZF 2R7UA 2CNWA 2PX3A 2HZ8A 4P9FA 2YLDA 3M4CA 3Q7GA 1VB5A 5A6BD 2ZXPA 1YJGA 1E86A 1GS9A 2J9UA 5JP7A 4DBQA 2VCBA 4DRIB 3ZDLA 3RIPA 1RKEB 3NMIA 1J8MF 2EPKX 2OEXA 4YJWA 3W2VA 4E18A 5CIVA 2HV6A 1WWPA 1L3PA 2Q9BA 2Y3HA 4BJ1A 5L3VA 1MQVA 3IQCA 2V3CC 5HSWA 1Q0DA 2UUIA 3EZIA 4ONSA 2ZXOA 4XLPF 3M79A 2L6HA 2IXPA 5AC5A 2XS1A 3GEHA 4K7BA 4AE4B 4JTDB 4EKWA 3LJBA 2XM4A 3AJMA 3UR3C 1T5OA 1LE2A 2A6EF 2UUHA 3CEXA 1ZYRF 1D0XA 4BJTA 1AVOB 5CI8A 1T01A 2EIMC 2B0HA 1G4US 4Q7CA 5BQGA 4JCZA 1OW8A 2IYLD 2BL2A 3KKBA 4RDAA 3I5QA 1DOVA 2ZXRA 2J9VA 4MW3A 3RYLA 2J8WA 2W45A 4KC9A 4DBRA 2EIKC 2KSFA 4N06A 4U9EA 4KI2A 1DOWA 2IXNA 4Q4ZF 3UNGC 3DAFA 3T9OA 5JT4A 3L8IA 3CZ6A 1HMDA 2G3VA 2LSEA 2XLDA 2XM0A 2XS8A 1U0BB 4ZLDA 1JR8A 4DVZA 2HJ3A 2W9YA 5BUOA 1OW7A 4G78A 3ECSA 2EINC 3ITFA 3JT1A 1NU7D 4E7SA 1BBHA 3VM6A 4JTCB 2TMVP 4O6MA 4G7OF 3I5PA 2XRHA 3N24A 4PK4A 2NPUA 2XXAA 1I4ZA 2CYDA 1EI7A 4QI0A 2P0NA 3AG2C 3KH2A 4U5FE 5KYWB 1BR1A 4B6IA 2XL8A 2VC9A 4R32A 1LE4A 2V26A 2MYSA 1E85A 3C18A 3M4BA 4WABA 2C03A 5GPGB 3S84A 1N1CA 3HTKC 4GYTA 3LEOA 3C7JA 4MTFA 2R7VA 1M56C 2L6GA 1BDJB 5COFA 2Q9CA 2NUTA 2EPLX 5DQZA 4O79A 4E17A 1YZAA 4JVSA 4NTBA 5DVWA 1AUEA 2YKZA 2ASRA 4MW8A 1QLEC 4NTFA 1GM5A 3EPVA 4PFPA 3TJ6A 1XZQA 1NZEA 2R7QA 3GORA 2Q7RA 3V7OA 3EFOB 2Q4FA 3RVZA 3EJNA 2BC5A 3VYWA 1D1AA 4CJOA 4CSAA 4D4XA 4K1OA 4MVUA 4U5GA 4AX2A 3DJUB 3PHF2 1JMWA 1WATA 4YWQA 2P61A 1VOMA 3A11A 2R9RB 1UFBA 3HKKA 3G4XA 2XLVA 3TD7A 4I1MA 1T6QA 3O6XA 3JRMO 4JEBA 3U8VA 1RCPA 2P7VA 1Q0MA 2WVQA 3DWWA 3AG3C 2VB6A 1G5ZA 1BR4A 2NSFA 2YLIA 4C7OB 3DXJF 3POVA 2HSBA 1YLMA 1APCA 1LS1A 4LERA 3C8GB 3O39A 3EGDB 2EPNA 2YWAA 3RVYA 3F46A 2HMQA 3SP1A 3US6A 5L0FA 3U3FA 1FAPB 1I5NA 5A6BA 1CGOA 4MVZA 3C62A 2IOQA 4FWVA 2G62A 4CSAC 1EQ1A 1NBBA 1WASA 1ZZPA 3L8JA 3V5ZA 5EGYA 3NYLA 3N0TA 4C3DA 3K1HA 2HMZA 2YL3A 3VRCA 2IBFA 3HNLA 4P9TA 3S90A 5E3CA 2EPMX 1FMVA 2HSQA 3B0VC 3L34A 1XZPA 1T6IA 3Q6MA 3V5XA 4MVMA 4OIOF 1S7ZA 2A0UA 1M2VA 4XTKA 5T3TA 2A0BA 3UMKA 1FFHA 1PCXA 4JW1A 4KNVA 4PJMA 4LACB 5DQTA 5IY5C 2YZSA 3FHDA 2XLWA 3SZRA 1CPQA 1E84A 3ASOC 3K33A 3CQZA 3ZC4A 2PFDA 2I15A 3B71A 3MYFA 3NG1A 5E2QA 1V54C 4H54A 2KK1A 2OJED 3T4RA 2L7AA 1OCOC 2IXOA 1JAFA 2PF4E 2QE9A 3HNIA 3K6BA 3MYIA 4OINF 5L0HA 1M2OA 3HNKA 4XPWA 2PBEA 2EPOA 1YYJA 2Y3DA 4M63A 4AK9A 1RJ9B 3C8ZA 3OEOA 2PP4A 3DI5A 3DM5A 4BEJA 4LDQA 1V4AA 5B3IA 1Z3IX 2Q3TA 3NMKA 2GAQA 1ZU4A 2Y3GA 4OIPF 4MTOA 2HFIA 3GEEA 3AG1C 1PD0A 2XL4A 3ABLC 3VAYA 1ZHTA 3ASNC 4J32B 2O9XA 1D0ZA 2AU5A 4LDRA 4MTGA 3NYMA 1NLXA 2AP3A 1ORSC 2AWCA 2RD9A 5AGFA 4JURI 2OJQA 1J8YF 3ZQYA 2OKUA 1CGME 3LAYA 4A2NB 2WL8A 4J7TA 4PJJA 4MNDA 2IM8A 3RFYA 4L6RA 4CS7A 5FZTA 3S0XA 4CJGA 256BA 1YDIA 3E9VA 4IARA 2Q9AA 5KYUA 2Y69C 3SXZA 4YT8A 1KTMA 5HV9A 5E3AA 4BJ5A 1NFOA 1H6GA 3ATPA 3DJNB 3LESA 4CS9A 4CIPA 1OR3A 1NFNA 1RMVA 1D0YA 2R03A 3EG9A 2R7XA 5JS5A 1A7VA 3B0PA 3MFNA 2PX0A 3PMRA 2FGYA 3KYIA 3U8PA 1L7CA 2LFDA 3QZCA 5KYXB 1FTSA 2R05A 1A41A 5JRAA 3C8GD 5B3SC 4IJJA 5DS5A 1MMNA 1C17M 3DM9B 3HJCA 4KNWA 4CDAA 2EIJC 4K0DA 2KYHA 3MLGA 2G3KA 3DMDA 1KNYA 5COGA 3TULA 3JYHA 4EBJA 1TWHA 4OIQF 1Q0KA 5AC4A
chains in the Genus database with same CATH topology
4IB4A 2XLVA 4JEBA 1RCPA 1GQAA 2YLIA 1APCA 3C63A 1M6TA 3ZQVA 3M15A 2XLMA 2QLAA 2XLHA 4U9DA 1CGOA 3QVZA 3C62A 5JUAA 4ULVA 4WGZA 2YLDA 1NBBA 3M4CA 1LM3B 4EIYA 1E86A 3FOPA 2YL3A 4JE9A 3HNLA 4N6HA 5JP7A 2CCYA 3VRCA 2XLOA 3ZTMA 3NMIA 3DE9A 4IAQA 1MQVA 4CDVA 1QQ3A 3M79A 3TOLA 3QW0A 4ER9A 2XLWA 1E84A 1CPQA 2XM4A 3QVYA 5JSLA 1CPRA 1JAFA 2YLGA 3HNIA 1E85A 3IQ5A 3HNJA 3HNKA 3QW1A 1YYJA 2J8WA 1CGNA 4U9EA 1EKYA 5B3IA 1S05A 3TOMA 1QPUA 3NMKA 5JT4A 2XLDA 2XM0A 4JKVA 2XLEA 2YL7A 5JVEA 1YZCA 3DE8A 3FOOA 1BBHA 2XL6A 2YL0A 2YL1A 4WGYA 4N4WA 5AGFA 3ZQYA 2XL8A 1YYXA 4L6RA 4CJGA 5JLIA 256BA 3M4BA 4CX9A 4IARA 4CDYA 3L1MA 3ZTZA 4CIPA 4NC3A 5JS5A 1A7VA 1YZAA 4D4NA 2YKZA 3ZWIA 3U8PA 4JEAA 5JRAA 2BC5A 4CJOA 2J9BA 4CDAA 4D4XA 1E83A 3IQ6A 3NMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IB4 A;  2XLV A;  4JEB A;  1RCP A;  1GQA A;  2YLI A;  1APC A;  3C63 A;  1M6T A;  3ZQV A;  3M15 A;  2XLM A;  2QLA A;  2XLH A;  4U9D A;  1CGO A;  3QVZ A;  3C62 A;  5JUA A;  4ULV A;  4WGZ A;  2YLD A;  1NBB A;  3M4C A;  1LM3 B;  4EIY A;  1E86 A;  3FOP A;  2YL3 A;  4JE9 A;  3HNL A;  4N6H A;  5JP7 A;  2CCY A;  3VRC A;  2XLO A;  3ZTM A;  3NMI A;  3DE9 A;  4IAQ A;  1MQV A;  4CDV A;  1QQ3 A;  3M79 A;  3TOL A;  3QW0 A;  4ER9 A;  2XLW A;  1E84 A;  1CPQ A;  2XM4 A;  3QVY A;  5JSL A;  1CPR A;  1JAF A;  2YLG A;  3HNI A;  1E85 A;  3IQ5 A;  3HNJ A;  3HNK A;  3QW1 A;  1YYJ A;  2J8W A;  1CGN A;  4U9E A;  1EKY A;  5B3I A;  1S05 A;  3TOM A;  1QPU A;  3NMK A;  5JT4 A;  2XLD A;  2XM0 A;  4JKV A;  2XLE A;  2YL7 A;  5JVE A;  1YZC A;  3DE8 A;  3FOO A;  1BBH A;  2XL6 A;  2YL0 A;  2YL1 A;  4WGY A;  4N4W A;  5AGF A;  3ZQY A;  2XL8 A;  1YYX A;  4L6R A;  4CJG A;  5JLI A;  256B A;  3M4B A;  4CX9 A;  4IAR A;  4CDY A;  3L1M A;  3ZTZ A;  4CIP A;  4NC3 A;  5JS5 A;  1A7V A;  1YZA A;  4D4N A;  2YKZ A;  3ZWI A;  3U8P A;  4JEA A;  5JRA A;  2BC5 A;  4CJO A;  2J9B A;  4CDA A;  4D4X A;  1E83 A;  3IQ6 A;  3NMJ A; 
#chains in the Genus database with same CATH topology
 1ZU5 A;  1TWA A;  4IB4 A;  4DRH B;  1FR0 A;  4MVS A;  3AOU A;  1JPN A;  2FFH A;  4PJN A;  1MMG A;  3GM1 A;  4O6Y A;  3GEI A;  4XEV A;  1RKE A;  1WGW A;  1V74 B;  3G4Z A;  1Z7Q c;  5KYN A;  4BJ5 C;  3EGX B;  3L0I A;  1TFO B;  4YT5 A;  3SNH A;  4CS9 C;  3JCU Q;  1VTM P;  2Y3B A;  1LKX A;  4PAC A;  1B68 A;  2Y39 A;  2QUP A;  4QDL A;  3E70 C;  1ZW3 A;  1A7E A;  3EHM A;  3FAJ A;  2YHS A;  3NYJ A;  1YVI A;  4IAO A;  4AE4 A;  5KYY B;  4Q5S F;  1TKN A;  3EQL F;  3LEV A;  2CGE A;  3OWT A;  2QLA A;  1VK5 A;  1V55 C;  2XLH A;  4YN0 B;  4X0R A;  1OKK D;  2DB4 A;  1Q0F A;  2FAP B;  1HE1 A;  1TQG A;  2NUP B;  3QVZ A;  1VYK A;  4I1O B;  1YA7 O;  3FVY A;  4YT4 A;  5JUA A;  4P6I C;  4I44 A;  2R7T A;  2J9W A;  3LS0 A;  5CI9 A;  4EBK A;  1NSG B;  3W8I A;  2WVO A;  3FOP A;  4JCH A;  5DS4 A;  4QI2 A;  4G0H A;  2XLO A;  1MND A;  2MWQ A;  3GWN A;  4MVO A;  4YL0 A;  2R7W A;  2HV7 A;  2KGO A;  2QNL A;  3LUT B;  1R4T A;  1ST6 A;  2GA0 A;  2R25 A;  2PNO A;  4BJ6 A;  4U5H A;  4CDV A;  1LI5 A;  2QTV A;  4JRZ A;  3CAX A;  2D5R B;  1C02 A;  2DI3 A;  2R02 A;  4IGG A;  4OD5 A;  1Z6A A;  2DYR C;  2RSE B;  1EA8 A;  4MQ9 F;  3QW0 A;  3TOL A;  1OXK A;  3QTH A;  4N6C A;  3W8H A;  4RBN A;  3QVY A;  1W2W A;  4NTA A;  3AQC A;  4JC7 A;  3ZIB A;  3SYN A;  1JOG A;  3SEO A;  2YLG A;  1ZHZ A;  1YA9 A;  2X51 A;  2WB7 A;  3NKE A;  3SXY A;  2DGJ A;  3H2V A;  4MVR A;  3DKA A;  4H4K C;  5KYW A;  2LP4 A;  3U5S A;  1YAR O;  3QW1 A;  3X2Q C;  5FCL A;  2VAS A;  1GGQ A;  1LI7 A;  2JX0 A;  5A6A A;  1CGN A;  4J7Y A;  4I3M A;  3ABK C;  2AWY A;  3KYJ A;  4ZLC A;  1M57 C;  1H7I A;  3NKD A;  1QPU A;  1QSP A;  3G50 A;  1ZHX A;  2JPU A;  3DZA A;  3JRT A;  2XLE A;  2DYS C;  2C04 A;  3IHU A;  5EK0 A;  4BJ6 C;  4CBE A;  1MNE A;  4Z9H A;  4KBL A;  3DE8 A;  1BZ4 A;  3U9M A;  1H9T A;  3U3B A;  3JSZ A;  3EFO A;  1TWG A;  4N4W A;  2MHR A;  3TJ5 A;  5K0I A;  4G7H F;  3MBG A;  1PV3 A;  5COM A;  3F47 A;  2P1A A;  3LNR A;  1XWJ A;  1K40 A;  1OXB A;  2WZG A;  3GAN A;  3S29 A;  4DVY P;  5JLI A;  5KYX A;  4FAP B;  2LIG A;  4CX9 A;  4CDY A;  2HKV A;  1ZW2 A;  5EHH A;  1FMW A;  1K05 A;  4YK5 A;  3RW0 A;  3FXH A;  1JRA A;  3Q7L A;  2J7P D;  3RQF A;  4DOZ A;  4XQ1 A;  5E33 A;  4BG0 A;  4NC3 A;  4C7O A;  5BQI A;  4D4N A;  4BEM J;  2Z15 A;  3O55 A;  3AGT A;  1ZHY A;  3AG4 C;  5L0J A;  3C8G A;  4RD9 A;  3EGD A;  5L0C A;  4EHP A;  3S27 A;  1G8X A;  1RXQ A;  4UDV A;  1IZM A;  2OG2 A;  2ZPA A;  4C3B A;  2XXA B;  1QZX A;  4HFK B;  3B9Q A;  3EH2 A;  2ZXW C;  4HFF B;  2J9B A;  3RF3 A;  3X1O A;  1TWC A;  4J30 B;  5A6J A;  1E83 A;  2XSE A;  5A69 A;  2HS5 A;  2GDC A;  2LFF A;  2VH3 A;  2EIL C;  5L0I A;  3HLZ A;  4U5D E;  4JIO A;  1YAU O;  1I4Y A;  1PD1 A;  2H7V C;  1HY5 A;  3RQE A;  1Y4C A;  2M64 A;  1KU2 A;  3V5Y A;  4PFO A;  2BE5 F;  2ETS A;  3M1C B;  2A6H F;  2P6V A;  1LVK A;  3WHN A;  3ZVR A;  3H2U A;  3UGO A;  1SYQ A;  2A69 F;  4MS2 A;  4YT2 A;  2NUT B;  1VMA A;  1ORJ A;  4OD4 A;  2I8B A;  3KMI A;  4AL0 A;  2D4U A;  3BRJ A;  5L0D A;  1NG1 A;  3EHN A;  1OCZ C;  3FMS A;  3LLK A;  1F1M A;  3GM2 A;  2LD6 A;  4EUK B;  5L3Q A;  1O3U A;  2L81 A;  2WVN A;  2HUJ A;  3AQB A;  4NQF A;  1M6T A;  2R7S A;  1VLT A;  3B0U X;  1HW1 A;  1OKK A;  3I4U A;  2LCH A;  3T6B A;  3M15 A;  5A6K A;  2XLM A;  4OIR F;  4U9D A;  3U2L A;  2X0C A;  1D1C A;  3K66 A;  1WN0 A;  2OOC A;  4ULV A;  3IPM O;  3IEE A;  4WGZ A;  3TK0 A;  1LM3 B;  3WAQ A;  3N2Z B;  3UMH A;  1LPE A;  2CNW D;  4EIY A;  4HE8 D;  4JE9 A;  3S28 A;  4FES A;  4N6H A;  2CCY A;  2NSG A;  3R7C A;  2NG1 A;  2L9J A;  3ZTM A;  4U5E E;  5BQH A;  1RJ9 A;  4E0I A;  1LIH A;  3DE9 A;  4IAQ A;  1O87 A;  2J0X A;  4E7Z A;  3A9C A;  5B1A C;  2H7B A;  1RKC A;  2J46 A;  1C03 A;  5D92 A;  4WJ0 A;  1QQ3 A;  4O7G A;  2YRF A;  3U2M A;  1Z23 A;  4GQH A;  3H65 A;  4C3E A;  4DXW A;  1HW2 A;  1ORY A;  1MMA A;  1OR2 A;  3GOD A;  4LLC A;  4ULW A;  3U9J A;  4DJ9 A;  4O6N A;  4ER9 A;  4CIH A;  4Z9I A;  5T3W A;  4DRJ B;  4EBB A;  2VCC A;  3B29 A;  5JSL A;  4JTA B;  4W8P A;  2W4B A;  2ICW G;  4HEA J;  1CPR A;  5D91 A;  3GWL A;  1OCR C;  2L6F A;  3K1I A;  3SXK A;  3IQ5 A;  3HNJ A;  3LNM B;  5F28 E;  4XEF A;  1D1B A;  3UGP A;  3ZG1 A;  1T6U A;  2GFH A;  1A7D A;  1U89 A;  2H7O A;  4XEK A;  1VYI A;  1ZVZ A;  5L0G A;  1K04 A;  4JZA A;  2R7O A;  1TFK B;  1EKY A;  1U6H A;  3FDQ A;  4E0H A;  1S05 A;  2R7R A;  3TOM A;  2IXM A;  4GEH A;  1M2V B;  3UMI A;  4YL1 A;  4JKV A;  1JPJ A;  3WG7 C;  1LS4 A;  2YL7 A;  5JVE A;  2OEV A;  1SZI A;  1YZC A;  3RKO F;  4FX5 A;  3FOO A;  3NDB B;  5DLJ A;  5TJ5 E;  2XL6 A;  2YL0 A;  1MMD A;  1HE9 A;  2YL1 A;  3EH1 A;  3NMJ A;  4NY3 A;  4WGY A;  3SXM A;  1UG7 A;  2OQM A;  1AEP A;  2JD3 A;  3JTL O;  4IWB A;  3VF0 A;  4CS8 A;  1OCC C;  4PR9 A;  1VLS A;  4XLN F;  3JYY A;  1T9K A;  2A1D D;  2ZD9 A;  3DAG A;  3JZ0 A;  2LK4 A;  5B1B C;  1Y6D A;  1YYX A;  3K7D A;  3U0C A;  1HMO A;  3EZH A;  3K1I C;  4XPY A;  2KC3 A;  4BPM A;  1A0B A;  3LLI A;  4PJL A;  3FAP B;  3RQG A;  3L1M A;  2J7P A;  3O10 A;  1QKR A;  2CDQ A;  1ZHW A;  2WZF A;  4NCQ A;  3WOD F;  3KL4 A;  3PDM P;  5DS6 A;  3ZTZ A;  1QVX A;  4IRU A;  1SR2 A;  1NU9 C;  4U5C E;  4AL1 A;  1FNT c;  2KQ9 A;  3S9O A;  2YEV A;  3EGX A;  1E2X A;  2KW3 C;  2CW0 F;  3W4Y A;  1Z63 A;  4XWJ A;  3ZWI A;  3Q6N A;  4JJG A;  2A68 F;  4JEA A;  1O5H A;  2Q00 A;  2KJG A;  2VCA A;  3OA1 A;  3ZSU A;  2QY9 A;  5KYY A;  4U5B E;  2J0W A;  3IQ6 A;  2HJM A;  3MX3 A;  2YQY A;  3LS1 A;  4CS8 C;  3PCV A;  2NUP A;  2WZL A;  2OCC C;  3KPH A;  1OQC A;  2E87 A;  1R5I D;  4W8K A;  4XPX A;  5T1D B;  3TQO A;  1WOL A;  3R2P A;  4MVQ A;  3QMK A;  3RH3 A;  2M4E A;  1OW6 A;  4ANJ A;  5KYU B;  3JSE O;  4F4B A;  4YL3 A;  3T6G B;  3ABM C;  3IQT A;  3J06 A;  1GQA A;  3EG9 B;  2H8A A;  1FFT C;  1IW7 F;  3BEH A;  4JJF A;  1WTY A;  1SF8 A;  4LDK A;  3GM3 A;  2J45 A;  3C63 A;  2W4M A;  2LQG A;  3T6J A;  2B0J A;  2OU6 A;  1SMY F;  2F22 A;  1TR2 A;  1Q0G A;  5F5F A;  3DD7 A;  1G4W R;  4LLE A;  2GWW A;  1H9G A;  2AVK A;  2YVK A;  3CSK A;  1BR2 A;  3NRH A;  4Z9J A;  3ZQV A;  5F5H A;  2KNH A;  3W2W A;  4A4A A;  1Z5Z A;  3AGU A;  4EWC A;  4G7Z F;  2R7U A;  2CNW A;  2PX3 A;  2HZ8 A;  4P9F A;  2YLD A;  3M4C A;  3Q7G A;  1VB5 A;  5A6B D;  2ZXP A;  1YJG A;  1E86 A;  1GS9 A;  2J9U A;  5JP7 A;  4DBQ A;  2VCB A;  4DRI B;  3ZDL A;  3RIP A;  1RKE B;  3NMI A;  1J8M F;  2EPK X;  2OEX A;  4YJW A;  3W2V A;  4E18 A;  5CIV A;  2HV6 A;  1WWP A;  1L3P A;  2Q9B A;  2Y3H A;  4BJ1 A;  5L3V A;  1MQV A;  3IQC A;  2V3C C;  5HSW A;  1Q0D A;  2UUI A;  3EZI A;  4ONS A;  2ZXO A;  4XLP F;  3M79 A;  2L6H A;  2IXP A;  5AC5 A;  2XS1 A;  3GEH A;  4K7B A;  4AE4 B;  4JTD B;  4EKW A;  3LJB A;  2XM4 A;  3AJM A;  3UR3 C;  1T5O A;  1LE2 A;  2A6E F;  2UUH A;  3CEX A;  1ZYR F;  1D0X A;  4BJT A;  1AVO B;  5CI8 A;  1T01 A;  2EIM C;  2B0H A;  1G4U S;  4Q7C A;  5BQG A;  4JCZ A;  1OW8 A;  2IYL D;  2BL2 A;  3KKB A;  4RDA A;  3I5Q A;  1DOV A;  2ZXR A;  2J9V A;  4MW3 A;  3RYL A;  2J8W A;  2W45 A;  4KC9 A;  4DBR A;  2EIK C;  2KSF A;  4N06 A;  4U9E A;  4KI2 A;  1DOW A;  2IXN A;  4Q4Z F;  3UNG C;  3DAF A;  3T9O A;  5JT4 A;  3L8I A;  3CZ6 A;  1HMD A;  2G3V A;  2LSE A;  2XLD A;  2XM0 A;  2XS8 A;  1U0B B;  4ZLD A;  1JR8 A;  4DVZ A;  2HJ3 A;  2W9Y A;  5BUO A;  1OW7 A;  4G78 A;  3ECS A;  2EIN C;  3ITF A;  3JT1 A;  1NU7 D;  4E7S A;  1BBH A;  3VM6 A;  4JTC B;  2TMV P;  4O6M A;  4G7O F;  3I5P A;  2XRH A;  3N24 A;  4PK4 A;  2NPU A;  2XXA A;  1I4Z A;  2CYD A;  1EI7 A;  4QI0 A;  2P0N A;  3AG2 C;  3KH2 A;  4U5F E;  5KYW B;  1BR1 A;  4B6I A;  2XL8 A;  2VC9 A;  4R32 A;  1LE4 A;  2V26 A;  2MYS A;  1E85 A;  3C18 A;  3M4B A;  4WAB A;  2C03 A;  5GPG B;  3S84 A;  1N1C A;  3HTK C;  4GYT A;  3LEO A;  3C7J A;  4MTF A;  2R7V A;  1M56 C;  2L6G A;  1BDJ B;  5COF A;  2Q9C A;  2NUT A;  2EPL X;  5DQZ A;  4O79 A;  4E17 A;  1YZA A;  4JVS A;  4NTB A;  5DVW A;  1AUE A;  2YKZ A;  2ASR A;  4MW8 A;  1QLE C;  4NTF A;  1GM5 A;  3EPV A;  4PFP A;  3TJ6 A;  1XZQ A;  1NZE A;  2R7Q A;  3GOR A;  2Q7R A;  3V7O A;  3EFO B;  2Q4F A;  3RVZ A;  3EJN A;  2BC5 A;  3VYW A;  1D1A A;  4CJO A;  4CSA A;  4D4X A;  4K1O A;  4MVU A;  4U5G A;  4AX2 A;  3DJU B;  3PHF 2;  1JMW A;  1WAT A;  4YWQ A;  2P61 A;  1VOM A;  3A11 A;  2R9R B;  1UFB A;  3HKK A;  3G4X A;  2XLV A;  3TD7 A;  4I1M A;  1T6Q A;  3O6X A;  3JRM O;  4JEB A;  3U8V A;  1RCP A;  2P7V A;  1Q0M A;  2WVQ A;  3DWW A;  3AG3 C;  2VB6 A;  1G5Z A;  1BR4 A;  2NSF A;  2YLI A;  4C7O B;  3DXJ F;  3POV A;  2HSB A;  1YLM A;  1APC A;  1LS1 A;  4LER A;  3C8G B;  3O39 A;  3EGD B;  2EPN A;  2YWA A;  3RVY A;  3F46 A;  2HMQ A;  3SP1 A;  3US6 A;  5L0F A;  3U3F A;  1FAP B;  1I5N A;  5A6B A;  1CGO A;  4MVZ A;  3C62 A;  2IOQ A;  4FWV A;  2G62 A;  4CSA C;  1EQ1 A;  1NBB A;  1WAS A;  1ZZP A;  3L8J A;  3V5Z A;  5EGY A;  3NYL A;  3N0T A;  4C3D A;  3K1H A;  2HMZ A;  2YL3 A;  3VRC A;  2IBF A;  3HNL A;  4P9T A;  3S90 A;  5E3C A;  2EPM X;  1FMV A;  2HSQ A;  3B0V C;  3L34 A;  1XZP A;  1T6I A;  3Q6M A;  3V5X A;  4MVM A;  4OIO F;  1S7Z A;  2A0U A;  1M2V A;  4XTK A;  5T3T A;  2A0B A;  3UMK A;  1FFH A;  1PCX A;  4JW1 A;  4KNV A;  4PJM A;  4LAC B;  5DQT A;  5IY5 C;  2YZS A;  3FHD A;  2XLW A;  3SZR A;  1CPQ A;  1E84 A;  3ASO C;  3K33 A;  3CQZ A;  3ZC4 A;  2PFD A;  2I15 A;  3B71 A;  3MYF A;  3NG1 A;  5E2Q A;  1V54 C;  4H54 A;  2KK1 A;  2OJE D;  3T4R A;  2L7A A;  1OCO C;  2IXO A;  1JAF A;  2PF4 E;  2QE9 A;  3HNI A;  3K6B A;  3MYI A;  4OIN F;  5L0H A;  1M2O A;  3HNK A;  4XPW A;  2PBE A;  2EPO A;  1YYJ A;  2Y3D A;  4M63 A;  4AK9 A;  1RJ9 B;  3C8Z A;  3OEO A;  2PP4 A;  3DI5 A;  3DM5 A;  4BEJ A;  4LDQ A;  1V4A A;  5B3I A;  1Z3I X;  2Q3T A;  3NMK A;  2GAQ A;  1ZU4 A;  2Y3G A;  4OIP F;  4MTO A;  2HFI A;  3GEE A;  3AG1 C;  1PD0 A;  2XL4 A;  3ABL C;  3VAY A;  1ZHT A;  3ASN C;  4J32 B;  2O9X A;  1D0Z A;  2AU5 A;  4LDR A;  4MTG A;  3NYM A;  1NLX A;  2AP3 A;  1ORS C;  2AWC A;  2RD9 A;  5AGF A;  4JUR I;  2OJQ A;  1J8Y F;  3ZQY A;  2OKU A;  1CGM E;  3LAY A;  4A2N B;  2WL8 A;  4J7T A;  4PJJ A;  4MND A;  2IM8 A;  3RFY A;  4L6R A;  4CS7 A;  5FZT A;  3S0X A;  4CJG A;  256B A;  1YDI A;  3E9V A;  4IAR A;  2Q9A A;  5KYU A;  2Y69 C;  3SXZ A;  4YT8 A;  1KTM A;  5HV9 A;  5E3A A;  4BJ5 A;  1NFO A;  1H6G A;  3ATP A;  3DJN B;  3LES A;  4CS9 A;  4CIP A;  1OR3 A;  1NFN A;  1RMV A;  1D0Y A;  2R03 A;  3EG9 A;  2R7X A;  5JS5 A;  1A7V A;  3B0P A;  3MFN A;  2PX0 A;  3PMR A;  2FGY A;  3KYI A;  3U8P A;  1L7C A;  2LFD A;  3QZC A;  5KYX B;  1FTS A;  2R05 A;  1A41 A;  5JRA A;  3C8G D;  5B3S C;  4IJJ A;  5DS5 A;  1MMN A;  1C17 M;  3DM9 B;  3HJC A;  4KNW A;  4CDA A;  2EIJ C;  4K0D A;  2KYH A;  3MLG A;  2G3K A;  3DMD A;  1KNY A;  5COG A;  3TUL A;  3JYH A;  4EBJ A;  1TWH A;  4OIQ F;  1Q0K A;  5AC4 A; 
#chains in the Genus database with same CATH homology
 4IB4 A;  2XLV A;  4JEB A;  1RCP A;  1GQA A;  2YLI A;  1APC A;  3C63 A;  1M6T A;  3ZQV A;  3M15 A;  2XLM A;  2QLA A;  2XLH A;  4U9D A;  1CGO A;  3QVZ A;  3C62 A;  5JUA A;  4ULV A;  4WGZ A;  2YLD A;  1NBB A;  3M4C A;  1LM3 B;  4EIY A;  1E86 A;  3FOP A;  2YL3 A;  4JE9 A;  3HNL A;  4N6H A;  5JP7 A;  2CCY A;  3VRC A;  2XLO A;  3ZTM A;  3NMI A;  3DE9 A;  4IAQ A;  1MQV A;  4CDV A;  1QQ3 A;  3M79 A;  3TOL A;  3QW0 A;  4ER9 A;  2XLW A;  1E84 A;  1CPQ A;  2XM4 A;  3QVY A;  5JSL A;  1CPR A;  1JAF A;  2YLG A;  3HNI A;  1E85 A;  3IQ5 A;  3HNJ A;  3HNK A;  3QW1 A;  1YYJ A;  2J8W A;  1CGN A;  4U9E A;  1EKY A;  5B3I A;  1S05 A;  3TOM A;  1QPU A;  3NMK A;  5JT4 A;  2XLD A;  2XM0 A;  4JKV A;  2XLE A;  2YL7 A;  5JVE A;  1YZC A;  3DE8 A;  3FOO A;  1BBH A;  2XL6 A;  2YL0 A;  2YL1 A;  4WGY A;  4N4W A;  5AGF A;  3ZQY A;  2XL8 A;  1YYX A;  4L6R A;  4CJG A;  5JLI A;  256B A;  3M4B A;  4CX9 A;  4IAR A;  4CDY A;  3L1M A;  3ZTZ A;  4CIP A;  4NC3 A;  5JS5 A;  1A7V A;  1YZA A;  4D4N A;  2YKZ A;  3ZWI A;  3U8P A;  4JEA A;  5JRA A;  2BC5 A;  4CJO A;  2J9B A;  4CDA A;  4D4X A;  1E83 A;  3IQ6 A;  3NMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...