1YYXA

The solution structure of a redesigned apocytochrome b562 (rd-apocyt b562) at 2.8m urea
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTIRAYNQKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redesigned apo-cytochrome b562
publication title Detection and structure determination of an equilibrium unfolding intermediates of Rd-apocytochrome b562: native fold with non-native hydrophobic interactions
pubmed doi rcsb
molecule tags De novo protein
total genus 35
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yyxA00
3ZTMA 2YLDA 3HNIA 1M6TA 3L1MA 4ULVA 4WGYA 2J8WA 4U9EA 4D4NA 1CGNA 2XLDA 2XLEA 1QQ3A 1JAFA 1YZCA 2XM4A 3M79A 1E84A 3IQ5A 3DE8A 4N6HA 2BC5A 1CPQA 1E86A 1LM3B 1QPUA 1APCA 4IARA 2XLWA 2XL6A 1YYXA 5JRAA 3HNKA 3FOPA 2J9BA 5AGFA 5JSLA 1NBBA 3NMKA 3ZQVA 3FOOA 1CPRA 2XLHA 1E83A 4L6RA 3M15A 3ZTZA 2CCYA 4D4XA 3VRCA 3C62A 5JLIA 3NMJA 3TOLA 4CJOA 4JE9A 2YL0A 5JVEA 4IAQA 2QLAA 3C63A 3QW1A 2YKZA 3U8PA 3M4BA 3QVYA 4CJGA 4JEBA 2XL8A 3QW0A 2YL7A 2YLGA 1BBHA 1CGOA 1YYJA 3QVZA 5JP7A 5B3IA 4NC3A 4JKVA 3HNJA 1E85A 3TOMA 4CDVA 1RCPA 4N4WA 2XLOA 1YZAA 3ZWIA 4IB4A 4CX9A 4EIYA 3HNLA 4WGZA 2YL1A 256BA 5JUAA 4CDAA 1GQAA 1S05A 3DE9A 4JEAA 5JS5A 2YLIA 5JT4A 1EKYA 2XLVA 2XLMA 3M4CA 3ZQYA 4CDYA 3NMIA 4U9DA 1A7VA 2XM0A 4ER9A 4CIPA 1MQVA 3IQ6A 2YL3A
chains in the Genus database with same CATH superfamily
1HY5A 1JMWA 3KMIA 2VC9A 3C8GB 5K0IA 1G4US 2OKUA 1PD1A 2KGOA 4IWBA 1YVIA 4XLNF 1RKEA 4DBQA 1GGQA 1JOGA 2EPNA 3UMIA 1VTMP 4H4KC 4XQ1A 1LE2A 4XEFA 2HMQA 2PX3A 3TJ5A 3RVZA 5KYXA 2A69F 2WZFA 4DVYP 5DS4A 1M57C 2Y3HA 1QVXA 4BEJA 1QQ3A 5DQTA 1JAFA 1WASA 2JD3A 2XM4A 4W8PA 3ZVRA 1V74B 3S84A 1Z3IX 2C04A 3MYFA 4E0HA 2R7VA 1XZQA 1OKKD 3GWNA 3K1HA 1G8XA 2BC5A 1NZEA 1OW8A 4IJJA 3EHNA 1E86A 3LUTB 1R5ID 4OIQF 1E2XA 1YA7O 1LM3B 4JRZA 4RBNA 1WWPA 4Q7CA 3WAQA 3Q7GA 4DRIB 4IARA 2GDCA 2FFHA 3EZIA 1VLSA 3GWLA 2HS5A 4CS9A 3HNKA 2MWQA 1ZU5A 3NYMA 5AGFA 5JSLA 2IXMA 4RDAA 2KSFA 4UDVA 4N6CA 4KNWA 2IXPA 3DXJF 3SXMA 3HLZA 1KTMA 5L0JA 5DS6A 4AE4A 3U9JA 3G4ZA 3GANA 3FAJA 3MX3A 3KYIA 1D1BA 1Q0KA 4H54A 4BJ5C 5KYUA 3X2QC 2QNLA 1H6GA 1HW1A 3C18A 3L8JA 3I5QA 2DB4A 3VRCA 4YL0A 4MS2A 1ZZPA 2RSEB 3E9VA 3DAFA 1K04A 1KNYA 1MMGA 1TWCA 3FXHA 3GORA 4MVOA 2J7PD 4O6YA 3EJNA 4XPYA 3TOLA 4CIHA 4BJ6C 2EIJC 4MW8A 2Q9BA 3ATPA 3RFYA 1TFKB 2GAQA 2E87A 4IAQA 3JTLO 2P61A 1FAPB 2CNWA 3EQLF 2VB6A 1WN0A 3K6BA 4LERA 4CJGA 4DBRA 1PD0A 5BUOA 4JEBA 3GEEA 5HV9A 1C02A 3ITFA 2NUTB 4RD9A 4OIOF 2R7XA 2J9VA 1Q0MA 2HJMA 4MVRA 1M56C 1U6HA 1WOLA 3GM2A 1A41A 4PFOA 3A11A 1BR2A 2WL8A 1Z7Qc 4E17A 3W8HA 3FHDA 5F5FA 5JP7A 1UG7A 3MLGA 4GQHA 2OJED 3S9OA 5B3IA 3R2PA 2H8AA 4KC9A 2UUHA 3TK0A 4BJTA 3EG9A 1BR4A 1MNEA 4MVSA 3SXZA 4Q4ZF 1AEPA 2KYHA 3SZRA 3MBGA 4U5GA 3S28A 4AL1A 1E85A 3TJ6A 1O5HA 2XSEA 2R05A 1FMWA 2J9UA 3LEOA 3AG2C 4I3MA 4MQ9F 3T6GB 4XEKA 1Z23A 1T5OA 1JPJA 2CDQA 3AG3C 3M1CB 4YT8A 2M4EA 3JSZA 3FMSA 3H65A 4O6MA 4E7ZA 2FAPB 4JCZA 4Z9IA 3RYLA 1Z5ZA 3Q7LA 4WGZA 5COGA 1ORYA 1OCOC 1T6QA 2GWWA 3FDQA 1RJ9B 4DOZA 1W2WA 2BL2A 2XS8A 2YL1A 4PJNA 3UGOA 3LJBA 1XWJA 4QI2A 3JYHA 3ZG1A 3SP1A 1M2VB 1TFOB 4OD5A 3ZSUA 3ECSA 4JEAA 3N0TA 4LLEA 4MVUA 4U5BE 1T01A 5JT4A 2XRHA 4U9DA 1A7VA 1TKNA 2Y3GA 2AVKA 3W8IA 2NUPA 5E3CA 2R7RA 3MFNA 5T3TA 1S7ZA 3KKBA 4MVZA 4PJJA 5DLJA 1C03A 2ICWG 1QLEC 1RKCA 2W9YA 3DJNB 2R7UA 1HW2A 1J8MF 1VK5A 4PK4A 3O55A 2WZLA 3AQBA 4HFKB 4I1OB 4JVSA 4ULVA 2ZXPA 3DMDA 2OEXA 3JRMO 4G0HA 3RVYA 4D4NA 3V5YA 1L3PA 3QZCA 4LDQA 4U5DE 2XLDA 3EZHA 2CNWD 2XLEA 2AWYA 2PBEA 1Q0GA 4O7GA 4DRJB 1YZCA 2V26A 2IOQA 5KYYB 3U5SA 4DJ9A 3T6JA 3W4YA 4OIRF 3ABLC 4NTAA 5BQHA 3N2ZB 4JZAA 3PCVA 1NSGB 1D0ZA 1NU7D 2YEVA 3DZAA 3I4UA 3RH3A 1ZHZA 2B0JA 5EK0A 3O39A 1LI7A 2H7BA 2XL6A 2Z15A 4KI2A 1YYXA 1RXQA 2HSBA 2WVOA 1EQ1A 1IZMA 3EGXA 3FOPA 1FFHA 5BQIA 1LS1A 1I4ZA 1FFTC 1NBBA 1SMYF 1YARO 5CIVA 3TD7A 1D1CA 4P6IC 5D91A 4BJ1A 3Q6MA 3FOOA 4FAPB 3HKKA 3RIPA 2CGEA 3E70C 3VYWA 1CPRA 2R7OA 3F46A 2XLHA 2P7VA 1T9KA 1VOMA 2DYSC 5GPGB 3T6BA 2EPKX 4L6RA 2P0NA 2WVQA 4CS7A 3CZ6A 3M15A 5A6AA 2CCYA 1Y4CA 4I44A 3K1IC 3NDBB 4K7BA 5KYWA 4YJWA 1D0YA 1TWAA 4KBLA 5KYUB 3NYJA 2WZGA 4PACA 4G7ZF 2HUJA 2A6HF 1ST6A 5E3AA 5B1BC 3ZDLA 2R25A 4Z9HA 2QE9A 1LPEA 4JE9A 4J7YA 2YL0A 5BQGA 5JVEA 1IW7F 1BZ4A 3LNMB 4B6IA 3AOUA 3U8VA 1ORJA 2QLAA 2YKZA 1JR8A 5L3QA 2D5RB 2PF4E 5F28E 2P6VA 1O87A 2IBFA 2UUIA 4EBKA 3U8PA 1HE9A 2J0XA 2A0BA 3MYIA 4C7OA 2A1DD 3LS1A 4WABA 2YL7A 1SR2A 2M64A 4XPWA 1MNDA 2EPMX 4A2NB 2A68F 2RD9A 3LEVA 1NFOA 3SNHA 3U2MA 2ZPAA 3GM3A 4DRHB 1OR3A 2R03A 1MMDA 2OQMA 3EFOB 1H9GA 4FX5A 5DS5A 3DI5A 3LAYA 1Q0FA 3C8GA 3U9MA 2KW3C 2NSGA 3S0XA 3EGDB 4CDVA 1QSPA 2J46A 2A6EF 4LDKA 1FMVA 5D92A 3SYNA 5A6BA 1YZAA 2I8BA 3HJCA 3LESA 3QTHA 4IB4A 4XLPF 4EIYA 1TWHA 1PCXA 1BDJB 3W2VA 3HNLA 4JTDB 4CSAC 3G4XA 3SXKA 3UGPA 2HKVA 2LQGA 4NTFA 3KPHA 3VF0A 1YJGA 4EBJA 2PP4A 3KYJA 1S05A 5L0IA 4KNVA 3B0UX 3CEXA 5JS5A 3S90A 3ZIBA 1B68A 1YLMA 3FVYA 3OWTA 2G3VA 3BRJA 3LNRA 2XLMA 4XPXA 3DJUB 3M4CA 1HMDA 2YRFA 4ULWA 2XXAB 1MMAA 1R4TA 3IQCA 4I1MA 2R02A 5COFA 4CIPA 2L9JA 5KYNA 2XL4A 2X0CA 3K7DA 1KU2A 1JRAA 1MQVA 2IYLD 2XS1A 3W2WA 4YT5A 1SZIA 4A4AA 1CGME 1OR2A 1QKRA 3TULA 1WTYA 4WJ0A 2GFHA 1M6TA 3PDMP 3L1MA 2R7WA 4EKWA 3N24A 5T1DB 4JIOA 3C8ZA 4MTGA 5CI9A 3B71A 1SYQA 4YN0B 5T3WA 2EPLX 2HSQA 2Q00A 3UNGC 1EA8A 3A9CA 2IXNA 1LE4A 4EUKB 5L0HA 1A0BA 3I5PA 3M79A 3R7CA 3RQFA 4M63A 2ZXOA 3IQ5A 3RQGA 3UMKA 4CS9C 2J9WA 3DE8A 2Y3DA 3IHUA 1ZYRF 4GEHA 4QI0A 3DM9B 4U5FE 2O9XA 1CPQA 3O10A 4MVMA 1BR1A 1G5ZA 2LK4A 2Q9CA 2HZ8A 1APCA 2BE5F 3PHF2 1OCCC 4BPMA 5CI8A 1T6IA 1T6UA 3NKEA 4NY3A 3RQEA 3C7JA 2ZXWC 2KK1A 3GM1A 4NQFA 4PJMA 4BEMJ 3VAYA 1V55C 2J9BA 1G4WR 3BEHA 4K0DA 3SXYA 5L3VA 3ABMC 3OEOA 2R7SA 1A7EA 4J30B 1ZHYA 3ZQVA 3EPVA 4JTAB 1ZHTA 2VASA 1NU9C 1RKEB 4C3DA 3NYLA 4Q5SF 4G7HF 2VCCA 4HE8D 5L0CA 1OW6A 1O3UA 3V5XA 5KYXB 5TJ5E 2VH3A 3H2VA 3Q6NA 3QMKA 5EGYA 1YAUO 1Z6AA 2G3KA 3AG1C 1OXKA 3DWWA 3NMJA 3EH1A 4HFFB 4XWJA 4E7SA 5KYWB 2ZXRA 4CJOA 4J32B 5AC5A 4BJ5A 3K33A 2DYRC 3KL4A 1ZHXA 2WB7A 4MVQA 1ZW3A 3AGTA 1AVOB 4YL3A 3L8IA 3TQOA 2YWAA 2Y3BA 3K66A 3JSEO 3VM6A 4CS8C 2R7TA 1RJ9A 3S29A 3CSKA 4E0IA 3QVYA 2HMZA 2OOCA 4AX2A 4R32A 4XEVA 4BJ6A 2XL8A 3H2UA 3L34A 1WATA 4JJFA 4OIPF 4W8KA 2CW0F 2J7PA 1DOVA 2OJQA 1VB5A 3GEHA 1BBHA 1CGOA 5A6JA 4E18A 4U5HA 2HFIA 2L6FA 1FNTc 2P1AA 4ZLCA 2ASRA 4AE4B 1WGWA 1M2OA 2EINC 2Y69C 4FESA 4DXWA 4U5CE 3GEIA 5A69A 3AQCA 2AP3A 3HNJA 4XTKA 1AUEA 2X51A 1ZVZA 3CQZA 3KH2A 4K1OA 4YK5A 3AJMA 2D4UA 4YL1A 1U0BB 2MYSA 3LLKA 3POVA 2EIMC 2XLOA 3IQTA 3SEOA 4EWCA 3ZWIA 1NFNA 2IXOA 2HV7A 2MHRA 4ZLDA 1H9TA 5DQZA 3L0IA 1TQGA 1FR0A 5E33A 2KNHA 5FZTA 5KYYA 2GA0A 2QY9A 3U3FA 1VLTA 1GQAA 3JT1A 2QUPA 5B1AC 3U2LA 4P9FA 2R7QA 2LD6A 4FWVA 5F5HA 4YWQA 1I5NA 2KQ9A 2LSEA 1V4AA 4IAOA 2PFDA 2ZD9A 4AL0A 5A6KA 2DGJA 2NPUA 2XLVA 3NRHA 4IGGA 3ZQYA 3JZ0A 1ZHWA 3NMIA 2V3CC 3B29A 4JC7A 4ER9A 4EBBA 2PNOA 2OU6A 4MTFA 1I4YA 2LFDA 3EG9B 1OXBA 2OCCC 2Q9AA 4JJGA 2YLDA 4P9TA 3ZTMA 5L0GA 5L0FA 3GODA 1Q0DA 2ETSA 1PV3A 3HNIA 4JTCB 1UFBA 2FGYA 1V54C 1XZPA 2OEVA 2YQYA 1A7DA 4WGYA 5L0DA 2J8WA 4U9EA 4X0RA 4J7TA 5EHHA 2I15A 1CGNA 2L6HA 2LCHA 3UMHA 2HJ3A 3JRTA 2EIKC 2W4MA 3LLIA 1U89A 1H7IA 1LS4A 2AWCA 3EH2A 4C3BA 3DKAA 2Y39A 1E84A 1K40A 3DM5A 4N6HA 1LIHA 2AU5A 1ZW2A 4MW3A 1OCZC 1VYIA 3UR3C 3U3BA 4JCHA 2EPOA 1QPUA 1SF8A 1J8YF 2Q4FA 1Y6DA 4O6NA 4EHPA 2XLWA 5HSWA 4YT2A 1ORSC 2JX0A 3LS0A 1Z63A 4F4BA 5JRAA 3T4RA 1N1CA 2NUPB 3ZC4A 2R9RB 1YDIA 4N06A 2CYDA 4NCQA 1YA9A 4PR9A 4LACB 1VYKA 3NMKA 2W45A 4CBEA 2J0WA 3WODF 2L81A 4MNDA 1HE1A 1VMAA 3S27A 2NG1A 1TWGA 3B0PA 1E83A 3DAGA 3US6A 4C3EA 1TR2A 2YHSA 4CS8A 3EFOA 4PFPA 5B3SC 3ZTZA 3V7OA 1DOWA 4D4XA 3U0CA 2C03A 3C62A 1F1MA 5JLIA 3ASOC 3EGDA 5IY5C 1HMOA 5COMA 3IPMO 2QTVA 1GM5A 4ANJA 3B0VC 4ONSA 4DVZA 3HTKC 2Q3TA 1OW7A 4LLCA 1C17M 3RKOF 4G78A 3K1IA 3C63A 3QW1A 3NKDA 3PMRA 2HV6A 2NUTA 2LFFA 3F47A 1NG1A 2B0HA 2LIGA 3C8GD 3M4BA 5E2QA 3J06A 2A0UA 3EGXB 3T9OA 1OKKA 3JCUQ 3QW0A 3G50A 3FAPB 2F22A 4QDLA 3NG1A 3EHMA 2L6GA 2YLGA 2YVKA 1JPNA 2LP4A 2DI3A 1YYJA 5A6BD 3QVZA 1LKXA 3RW0A 2XXAA 4BG0A 5DVWA 1FTSA 4G7OF 4JURI 3IEEA 4PJLA 2VCAA 4NC3A 4AK9A 2PX0A 4HEAJ 4JKVA 2KC3A 1GS9A 2KJGA 3OA1A 3RF3A 3TOMA 4O79A 1RCPA 3ASNC 4LDRA 1LI5A 2Q7RA 2TMVP 1OQCA 1QZXA 2NSFA 3X1OA 4N4WA 1MMNA 3DD7A 5FCLA 1K05A 4YT4A 2OG2A 4CX9A 1L7CA 1OCRC 2IM8A 2J45A 2L7AA 3B9QA 1M2VA 4IRUA 3AG4C 4GYTA 4U5EE 5JUAA 256BA 4OINF 4CDAA 5AC4A 1D1AA 1NLXA 1ZU4A 4Z9JA 4C7OB 3DE9A 1RMVA 4JW1A 3WG7C 2YLIA 3O6XA 2JPUA 2EILC 2VCBA 3ABKC 3JYYA 2WVNA 2G62A 2W4BA 3WHNA 1EKYA 1D0XA 2H7OA 4CDYA 4CSAA 3V5ZA 3AGUA 2XM0A 4NTBA 1EI7A 1LVKA 2H7VC 2YZSA 3CAXA 4OD4A 3IQ6A 2YL3A 4MTOA
chains in the Genus database with same CATH topology
3ZTMA 2YLDA 3HNIA 1M6TA 3L1MA 4ULVA 4WGYA 2J8WA 4U9EA 4D4NA 1CGNA 2XLDA 2XLEA 1QQ3A 1JAFA 1YZCA 2XM4A 3M79A 1E84A 3IQ5A 3DE8A 4N6HA 2BC5A 1CPQA 1E86A 1LM3B 1QPUA 1APCA 4IARA 2XLWA 2XL6A 1YYXA 5JRAA 3HNKA 3FOPA 2J9BA 5AGFA 5JSLA 1NBBA 3NMKA 3ZQVA 3FOOA 1CPRA 2XLHA 1E83A 4L6RA 3M15A 3ZTZA 2CCYA 4D4XA 3VRCA 3C62A 5JLIA 3NMJA 3TOLA 4CJOA 4JE9A 2YL0A 5JVEA 4IAQA 2QLAA 3C63A 3QW1A 2YKZA 3U8PA 3M4BA 3QVYA 4CJGA 4JEBA 2XL8A 3QW0A 2YL7A 2YLGA 1BBHA 1CGOA 1YYJA 3QVZA 5JP7A 5B3IA 4NC3A 4JKVA 3HNJA 1E85A 3TOMA 4CDVA 1RCPA 4N4WA 2XLOA 1YZAA 3ZWIA 4IB4A 4CX9A 4EIYA 3HNLA 4WGZA 2YL1A 256BA 5JUAA 4CDAA 1GQAA 1S05A 3DE9A 4JEAA 5JS5A 2YLIA 5JT4A 1EKYA 2XLVA 2XLMA 3M4CA 3ZQYA 4CDYA 3NMIA 4U9DA 1A7VA 2XM0A 4ER9A 4CIPA 1MQVA 3IQ6A 2YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTM A;  2YLD A;  3HNI A;  1M6T A;  3L1M A;  4ULV A;  4WGY A;  2J8W A;  4U9E A;  4D4N A;  1CGN A;  2XLD A;  2XLE A;  1QQ3 A;  1JAF A;  1YZC A;  2XM4 A;  3M79 A;  1E84 A;  3IQ5 A;  3DE8 A;  4N6H A;  2BC5 A;  1CPQ A;  1E86 A;  1LM3 B;  1QPU A;  1APC A;  4IAR A;  2XLW A;  2XL6 A;  1YYX A;  5JRA A;  3HNK A;  3FOP A;  2J9B A;  5AGF A;  5JSL A;  1NBB A;  3NMK A;  3ZQV A;  3FOO A;  1CPR A;  2XLH A;  1E83 A;  4L6R A;  3M15 A;  3ZTZ A;  2CCY A;  4D4X A;  3VRC A;  3C62 A;  5JLI A;  3NMJ A;  3TOL A;  4CJO A;  4JE9 A;  2YL0 A;  5JVE A;  4IAQ A;  2QLA A;  3C63 A;  3QW1 A;  2YKZ A;  3U8P A;  3M4B A;  3QVY A;  4CJG A;  4JEB A;  2XL8 A;  3QW0 A;  2YL7 A;  2YLG A;  1BBH A;  1CGO A;  1YYJ A;  3QVZ A;  5JP7 A;  5B3I A;  4NC3 A;  4JKV A;  3HNJ A;  1E85 A;  3TOM A;  4CDV A;  1RCP A;  4N4W A;  2XLO A;  1YZA A;  3ZWI A;  4IB4 A;  4CX9 A;  4EIY A;  3HNL A;  4WGZ A;  2YL1 A;  256B A;  5JUA A;  4CDA A;  1GQA A;  1S05 A;  3DE9 A;  4JEA A;  5JS5 A;  2YLI A;  5JT4 A;  1EKY A;  2XLV A;  2XLM A;  3M4C A;  3ZQY A;  4CDY A;  3NMI A;  4U9D A;  1A7V A;  2XM0 A;  4ER9 A;  4CIP A;  1MQV A;  3IQ6 A;  2YL3 A; 
#chains in the Genus database with same CATH topology
 1HY5 A;  1JMW A;  3KMI A;  2VC9 A;  3C8G B;  5K0I A;  1G4U S;  2OKU A;  1PD1 A;  2KGO A;  4IWB A;  1YVI A;  4XLN F;  1RKE A;  4DBQ A;  1GGQ A;  1JOG A;  2EPN A;  3UMI A;  1VTM P;  4H4K C;  4XQ1 A;  1LE2 A;  4XEF A;  2HMQ A;  2PX3 A;  3TJ5 A;  3RVZ A;  5KYX A;  2A69 F;  2WZF A;  4DVY P;  5DS4 A;  1M57 C;  2Y3H A;  1QVX A;  4BEJ A;  1QQ3 A;  5DQT A;  1JAF A;  1WAS A;  2JD3 A;  2XM4 A;  4W8P A;  3ZVR A;  1V74 B;  3S84 A;  1Z3I X;  2C04 A;  3MYF A;  4E0H A;  2R7V A;  1XZQ A;  1OKK D;  3GWN A;  3K1H A;  1G8X A;  2BC5 A;  1NZE A;  1OW8 A;  4IJJ A;  3EHN A;  1E86 A;  3LUT B;  1R5I D;  4OIQ F;  1E2X A;  1YA7 O;  1LM3 B;  4JRZ A;  4RBN A;  1WWP A;  4Q7C A;  3WAQ A;  3Q7G A;  4DRI B;  4IAR A;  2GDC A;  2FFH A;  3EZI A;  1VLS A;  3GWL A;  2HS5 A;  4CS9 A;  3HNK A;  2MWQ A;  1ZU5 A;  3NYM A;  5AGF A;  5JSL A;  2IXM A;  4RDA A;  2KSF A;  4UDV A;  4N6C A;  4KNW A;  2IXP A;  3DXJ F;  3SXM A;  3HLZ A;  1KTM A;  5L0J A;  5DS6 A;  4AE4 A;  3U9J A;  3G4Z A;  3GAN A;  3FAJ A;  3MX3 A;  3KYI A;  1D1B A;  1Q0K A;  4H54 A;  4BJ5 C;  5KYU A;  3X2Q C;  2QNL A;  1H6G A;  1HW1 A;  3C18 A;  3L8J A;  3I5Q A;  2DB4 A;  3VRC A;  4YL0 A;  4MS2 A;  1ZZP A;  2RSE B;  3E9V A;  3DAF A;  1K04 A;  1KNY A;  1MMG A;  1TWC A;  3FXH A;  3GOR A;  4MVO A;  2J7P D;  4O6Y A;  3EJN A;  4XPY A;  3TOL A;  4CIH A;  4BJ6 C;  2EIJ C;  4MW8 A;  2Q9B A;  3ATP A;  3RFY A;  1TFK B;  2GAQ A;  2E87 A;  4IAQ A;  3JTL O;  2P61 A;  1FAP B;  2CNW A;  3EQL F;  2VB6 A;  1WN0 A;  3K6B A;  4LER A;  4CJG A;  4DBR A;  1PD0 A;  5BUO A;  4JEB A;  3GEE A;  5HV9 A;  1C02 A;  3ITF A;  2NUT B;  4RD9 A;  4OIO F;  2R7X A;  2J9V A;  1Q0M A;  2HJM A;  4MVR A;  1M56 C;  1U6H A;  1WOL A;  3GM2 A;  1A41 A;  4PFO A;  3A11 A;  1BR2 A;  2WL8 A;  1Z7Q c;  4E17 A;  3W8H A;  3FHD A;  5F5F A;  5JP7 A;  1UG7 A;  3MLG A;  4GQH A;  2OJE D;  3S9O A;  5B3I A;  3R2P A;  2H8A A;  4KC9 A;  2UUH A;  3TK0 A;  4BJT A;  3EG9 A;  1BR4 A;  1MNE A;  4MVS A;  3SXZ A;  4Q4Z F;  1AEP A;  2KYH A;  3SZR A;  3MBG A;  4U5G A;  3S28 A;  4AL1 A;  1E85 A;  3TJ6 A;  1O5H A;  2XSE A;  2R05 A;  1FMW A;  2J9U A;  3LEO A;  3AG2 C;  4I3M A;  4MQ9 F;  3T6G B;  4XEK A;  1Z23 A;  1T5O A;  1JPJ A;  2CDQ A;  3AG3 C;  3M1C B;  4YT8 A;  2M4E A;  3JSZ A;  3FMS A;  3H65 A;  4O6M A;  4E7Z A;  2FAP B;  4JCZ A;  4Z9I A;  3RYL A;  1Z5Z A;  3Q7L A;  4WGZ A;  5COG A;  1ORY A;  1OCO C;  1T6Q A;  2GWW A;  3FDQ A;  1RJ9 B;  4DOZ A;  1W2W A;  2BL2 A;  2XS8 A;  2YL1 A;  4PJN A;  3UGO A;  3LJB A;  1XWJ A;  4QI2 A;  3JYH A;  3ZG1 A;  3SP1 A;  1M2V B;  1TFO B;  4OD5 A;  3ZSU A;  3ECS A;  4JEA A;  3N0T A;  4LLE A;  4MVU A;  4U5B E;  1T01 A;  5JT4 A;  2XRH A;  4U9D A;  1A7V A;  1TKN A;  2Y3G A;  2AVK A;  3W8I A;  2NUP A;  5E3C A;  2R7R A;  3MFN A;  5T3T A;  1S7Z A;  3KKB A;  4MVZ A;  4PJJ A;  5DLJ A;  1C03 A;  2ICW G;  1QLE C;  1RKC A;  2W9Y A;  3DJN B;  2R7U A;  1HW2 A;  1J8M F;  1VK5 A;  4PK4 A;  3O55 A;  2WZL A;  3AQB A;  4HFK B;  4I1O B;  4JVS A;  4ULV A;  2ZXP A;  3DMD A;  2OEX A;  3JRM O;  4G0H A;  3RVY A;  4D4N A;  3V5Y A;  1L3P A;  3QZC A;  4LDQ A;  4U5D E;  2XLD A;  3EZH A;  2CNW D;  2XLE A;  2AWY A;  2PBE A;  1Q0G A;  4O7G A;  4DRJ B;  1YZC A;  2V26 A;  2IOQ A;  5KYY B;  3U5S A;  4DJ9 A;  3T6J A;  3W4Y A;  4OIR F;  3ABL C;  4NTA A;  5BQH A;  3N2Z B;  4JZA A;  3PCV A;  1NSG B;  1D0Z A;  1NU7 D;  2YEV A;  3DZA A;  3I4U A;  3RH3 A;  1ZHZ A;  2B0J A;  5EK0 A;  3O39 A;  1LI7 A;  2H7B A;  2XL6 A;  2Z15 A;  4KI2 A;  1YYX A;  1RXQ A;  2HSB A;  2WVO A;  1EQ1 A;  1IZM A;  3EGX A;  3FOP A;  1FFH A;  5BQI A;  1LS1 A;  1I4Z A;  1FFT C;  1NBB A;  1SMY F;  1YAR O;  5CIV A;  3TD7 A;  1D1C A;  4P6I C;  5D91 A;  4BJ1 A;  3Q6M A;  3FOO A;  4FAP B;  3HKK A;  3RIP A;  2CGE A;  3E70 C;  3VYW A;  1CPR A;  2R7O A;  3F46 A;  2XLH A;  2P7V A;  1T9K A;  1VOM A;  2DYS C;  5GPG B;  3T6B A;  2EPK X;  4L6R A;  2P0N A;  2WVQ A;  4CS7 A;  3CZ6 A;  3M15 A;  5A6A A;  2CCY A;  1Y4C A;  4I44 A;  3K1I C;  3NDB B;  4K7B A;  5KYW A;  4YJW A;  1D0Y A;  1TWA A;  4KBL A;  5KYU B;  3NYJ A;  2WZG A;  4PAC A;  4G7Z F;  2HUJ A;  2A6H F;  1ST6 A;  5E3A A;  5B1B C;  3ZDL A;  2R25 A;  4Z9H A;  2QE9 A;  1LPE A;  4JE9 A;  4J7Y A;  2YL0 A;  5BQG A;  5JVE A;  1IW7 F;  1BZ4 A;  3LNM B;  4B6I A;  3AOU A;  3U8V A;  1ORJ A;  2QLA A;  2YKZ A;  1JR8 A;  5L3Q A;  2D5R B;  2PF4 E;  5F28 E;  2P6V A;  1O87 A;  2IBF A;  2UUI A;  4EBK A;  3U8P A;  1HE9 A;  2J0X A;  2A0B A;  3MYI A;  4C7O A;  2A1D D;  3LS1 A;  4WAB A;  2YL7 A;  1SR2 A;  2M64 A;  4XPW A;  1MND A;  2EPM X;  4A2N B;  2A68 F;  2RD9 A;  3LEV A;  1NFO A;  3SNH A;  3U2M A;  2ZPA A;  3GM3 A;  4DRH B;  1OR3 A;  2R03 A;  1MMD A;  2OQM A;  3EFO B;  1H9G A;  4FX5 A;  5DS5 A;  3DI5 A;  3LAY A;  1Q0F A;  3C8G A;  3U9M A;  2KW3 C;  2NSG A;  3S0X A;  3EGD B;  4CDV A;  1QSP A;  2J46 A;  2A6E F;  4LDK A;  1FMV A;  5D92 A;  3SYN A;  5A6B A;  1YZA A;  2I8B A;  3HJC A;  3LES A;  3QTH A;  4IB4 A;  4XLP F;  4EIY A;  1TWH A;  1PCX A;  1BDJ B;  3W2V A;  3HNL A;  4JTD B;  4CSA C;  3G4X A;  3SXK A;  3UGP A;  2HKV A;  2LQG A;  4NTF A;  3KPH A;  3VF0 A;  1YJG A;  4EBJ A;  2PP4 A;  3KYJ A;  1S05 A;  5L0I A;  4KNV A;  3B0U X;  3CEX A;  5JS5 A;  3S90 A;  3ZIB A;  1B68 A;  1YLM A;  3FVY A;  3OWT A;  2G3V A;  3BRJ A;  3LNR A;  2XLM A;  4XPX A;  3DJU B;  3M4C A;  1HMD A;  2YRF A;  4ULW A;  2XXA B;  1MMA A;  1R4T A;  3IQC A;  4I1M A;  2R02 A;  5COF A;  4CIP A;  2L9J A;  5KYN A;  2XL4 A;  2X0C A;  3K7D A;  1KU2 A;  1JRA A;  1MQV A;  2IYL D;  2XS1 A;  3W2W A;  4YT5 A;  1SZI A;  4A4A A;  1CGM E;  1OR2 A;  1QKR A;  3TUL A;  1WTY A;  4WJ0 A;  2GFH A;  1M6T A;  3PDM P;  3L1M A;  2R7W A;  4EKW A;  3N24 A;  5T1D B;  4JIO A;  3C8Z A;  4MTG A;  5CI9 A;  3B71 A;  1SYQ A;  4YN0 B;  5T3W A;  2EPL X;  2HSQ A;  2Q00 A;  3UNG C;  1EA8 A;  3A9C A;  2IXN A;  1LE4 A;  4EUK B;  5L0H A;  1A0B A;  3I5P A;  3M79 A;  3R7C A;  3RQF A;  4M63 A;  2ZXO A;  3IQ5 A;  3RQG A;  3UMK A;  4CS9 C;  2J9W A;  3DE8 A;  2Y3D A;  3IHU A;  1ZYR F;  4GEH A;  4QI0 A;  3DM9 B;  4U5F E;  2O9X A;  1CPQ A;  3O10 A;  4MVM A;  1BR1 A;  1G5Z A;  2LK4 A;  2Q9C A;  2HZ8 A;  1APC A;  2BE5 F;  3PHF 2;  1OCC C;  4BPM A;  5CI8 A;  1T6I A;  1T6U A;  3NKE A;  4NY3 A;  3RQE A;  3C7J A;  2ZXW C;  2KK1 A;  3GM1 A;  4NQF A;  4PJM A;  4BEM J;  3VAY A;  1V55 C;  2J9B A;  1G4W R;  3BEH A;  4K0D A;  3SXY A;  5L3V A;  3ABM C;  3OEO A;  2R7S A;  1A7E A;  4J30 B;  1ZHY A;  3ZQV A;  3EPV A;  4JTA B;  1ZHT A;  2VAS A;  1NU9 C;  1RKE B;  4C3D A;  3NYL A;  4Q5S F;  4G7H F;  2VCC A;  4HE8 D;  5L0C A;  1OW6 A;  1O3U A;  3V5X A;  5KYX B;  5TJ5 E;  2VH3 A;  3H2V A;  3Q6N A;  3QMK A;  5EGY A;  1YAU O;  1Z6A A;  2G3K A;  3AG1 C;  1OXK A;  3DWW A;  3NMJ A;  3EH1 A;  4HFF B;  4XWJ A;  4E7S A;  5KYW B;  2ZXR A;  4CJO A;  4J32 B;  5AC5 A;  4BJ5 A;  3K33 A;  2DYR C;  3KL4 A;  1ZHX A;  2WB7 A;  4MVQ A;  1ZW3 A;  3AGT A;  1AVO B;  4YL3 A;  3L8I A;  3TQO A;  2YWA A;  2Y3B A;  3K66 A;  3JSE O;  3VM6 A;  4CS8 C;  2R7T A;  1RJ9 A;  3S29 A;  3CSK A;  4E0I A;  3QVY A;  2HMZ A;  2OOC A;  4AX2 A;  4R32 A;  4XEV A;  4BJ6 A;  2XL8 A;  3H2U A;  3L34 A;  1WAT A;  4JJF A;  4OIP F;  4W8K A;  2CW0 F;  2J7P A;  1DOV A;  2OJQ A;  1VB5 A;  3GEH A;  1BBH A;  1CGO A;  5A6J A;  4E18 A;  4U5H A;  2HFI A;  2L6F A;  1FNT c;  2P1A A;  4ZLC A;  2ASR A;  4AE4 B;  1WGW A;  1M2O A;  2EIN C;  2Y69 C;  4FES A;  4DXW A;  4U5C E;  3GEI A;  5A69 A;  3AQC A;  2AP3 A;  3HNJ A;  4XTK A;  1AUE A;  2X51 A;  1ZVZ A;  3CQZ A;  3KH2 A;  4K1O A;  4YK5 A;  3AJM A;  2D4U A;  4YL1 A;  1U0B B;  2MYS A;  3LLK A;  3POV A;  2EIM C;  2XLO A;  3IQT A;  3SEO A;  4EWC A;  3ZWI A;  1NFN A;  2IXO A;  2HV7 A;  2MHR A;  4ZLD A;  1H9T A;  5DQZ A;  3L0I A;  1TQG A;  1FR0 A;  5E33 A;  2KNH A;  5FZT A;  5KYY A;  2GA0 A;  2QY9 A;  3U3F A;  1VLT A;  1GQA A;  3JT1 A;  2QUP A;  5B1A C;  3U2L A;  4P9F A;  2R7Q A;  2LD6 A;  4FWV A;  5F5H A;  4YWQ A;  1I5N A;  2KQ9 A;  2LSE A;  1V4A A;  4IAO A;  2PFD A;  2ZD9 A;  4AL0 A;  5A6K A;  2DGJ A;  2NPU A;  2XLV A;  3NRH A;  4IGG A;  3ZQY A;  3JZ0 A;  1ZHW A;  3NMI A;  2V3C C;  3B29 A;  4JC7 A;  4ER9 A;  4EBB A;  2PNO A;  2OU6 A;  4MTF A;  1I4Y A;  2LFD A;  3EG9 B;  1OXB A;  2OCC C;  2Q9A A;  4JJG A;  2YLD A;  4P9T A;  3ZTM A;  5L0G A;  5L0F A;  3GOD A;  1Q0D A;  2ETS A;  1PV3 A;  3HNI A;  4JTC B;  1UFB A;  2FGY A;  1V54 C;  1XZP A;  2OEV A;  2YQY A;  1A7D A;  4WGY A;  5L0D A;  2J8W A;  4U9E A;  4X0R A;  4J7T A;  5EHH A;  2I15 A;  1CGN A;  2L6H A;  2LCH A;  3UMH A;  2HJ3 A;  3JRT A;  2EIK C;  2W4M A;  3LLI A;  1U89 A;  1H7I A;  1LS4 A;  2AWC A;  3EH2 A;  4C3B A;  3DKA A;  2Y39 A;  1E84 A;  1K40 A;  3DM5 A;  4N6H A;  1LIH A;  2AU5 A;  1ZW2 A;  4MW3 A;  1OCZ C;  1VYI A;  3UR3 C;  3U3B A;  4JCH A;  2EPO A;  1QPU A;  1SF8 A;  1J8Y F;  2Q4F A;  1Y6D A;  4O6N A;  4EHP A;  2XLW A;  5HSW A;  4YT2 A;  1ORS C;  2JX0 A;  3LS0 A;  1Z63 A;  4F4B A;  5JRA A;  3T4R A;  1N1C A;  2NUP B;  3ZC4 A;  2R9R B;  1YDI A;  4N06 A;  2CYD A;  4NCQ A;  1YA9 A;  4PR9 A;  4LAC B;  1VYK A;  3NMK A;  2W45 A;  4CBE A;  2J0W A;  3WOD F;  2L81 A;  4MND A;  1HE1 A;  1VMA A;  3S27 A;  2NG1 A;  1TWG A;  3B0P A;  1E83 A;  3DAG A;  3US6 A;  4C3E A;  1TR2 A;  2YHS A;  4CS8 A;  3EFO A;  4PFP A;  5B3S C;  3ZTZ A;  3V7O A;  1DOW A;  4D4X A;  3U0C A;  2C03 A;  3C62 A;  1F1M A;  5JLI A;  3ASO C;  3EGD A;  5IY5 C;  1HMO A;  5COM A;  3IPM O;  2QTV A;  1GM5 A;  4ANJ A;  3B0V C;  4ONS A;  4DVZ A;  3HTK C;  2Q3T A;  1OW7 A;  4LLC A;  1C17 M;  3RKO F;  4G78 A;  3K1I A;  3C63 A;  3QW1 A;  3NKD A;  3PMR A;  2HV6 A;  2NUT A;  2LFF A;  3F47 A;  1NG1 A;  2B0H A;  2LIG A;  3C8G D;  3M4B A;  5E2Q A;  3J06 A;  2A0U A;  3EGX B;  3T9O A;  1OKK A;  3JCU Q;  3QW0 A;  3G50 A;  3FAP B;  2F22 A;  4QDL A;  3NG1 A;  3EHM A;  2L6G A;  2YLG A;  2YVK A;  1JPN A;  2LP4 A;  2DI3 A;  1YYJ A;  5A6B D;  3QVZ A;  1LKX A;  3RW0 A;  2XXA A;  4BG0 A;  5DVW A;  1FTS A;  4G7O F;  4JUR I;  3IEE A;  4PJL A;  2VCA A;  4NC3 A;  4AK9 A;  2PX0 A;  4HEA J;  4JKV A;  2KC3 A;  1GS9 A;  2KJG A;  3OA1 A;  3RF3 A;  3TOM A;  4O79 A;  1RCP A;  3ASN C;  4LDR A;  1LI5 A;  2Q7R A;  2TMV P;  1OQC A;  1QZX A;  2NSF A;  3X1O A;  4N4W A;  1MMN A;  3DD7 A;  5FCL A;  1K05 A;  4YT4 A;  2OG2 A;  4CX9 A;  1L7C A;  1OCR C;  2IM8 A;  2J45 A;  2L7A A;  3B9Q A;  1M2V A;  4IRU A;  3AG4 C;  4GYT A;  4U5E E;  5JUA A;  256B A;  4OIN F;  4CDA A;  5AC4 A;  1D1A A;  1NLX A;  1ZU4 A;  4Z9J A;  4C7O B;  3DE9 A;  1RMV A;  4JW1 A;  3WG7 C;  2YLI A;  3O6X A;  2JPU A;  2EIL C;  2VCB A;  3ABK C;  3JYY A;  2WVN A;  2G62 A;  2W4B A;  3WHN A;  1EKY A;  1D0X A;  2H7O A;  4CDY A;  4CSA A;  3V5Z A;  3AGU A;  2XM0 A;  4NTB A;  1EI7 A;  1LVK A;  2H7V C;  2YZS A;  3CAX A;  4OD4 A;  3IQ6 A;  2YL3 A;  4MTO A; 
#chains in the Genus database with same CATH homology
 3ZTM A;  2YLD A;  3HNI A;  1M6T A;  3L1M A;  4ULV A;  4WGY A;  2J8W A;  4U9E A;  4D4N A;  1CGN A;  2XLD A;  2XLE A;  1QQ3 A;  1JAF A;  1YZC A;  2XM4 A;  3M79 A;  1E84 A;  3IQ5 A;  3DE8 A;  4N6H A;  2BC5 A;  1CPQ A;  1E86 A;  1LM3 B;  1QPU A;  1APC A;  4IAR A;  2XLW A;  2XL6 A;  1YYX A;  5JRA A;  3HNK A;  3FOP A;  2J9B A;  5AGF A;  5JSL A;  1NBB A;  3NMK A;  3ZQV A;  3FOO A;  1CPR A;  2XLH A;  1E83 A;  4L6R A;  3M15 A;  3ZTZ A;  2CCY A;  4D4X A;  3VRC A;  3C62 A;  5JLI A;  3NMJ A;  3TOL A;  4CJO A;  4JE9 A;  2YL0 A;  5JVE A;  4IAQ A;  2QLA A;  3C63 A;  3QW1 A;  2YKZ A;  3U8P A;  3M4B A;  3QVY A;  4CJG A;  4JEB A;  2XL8 A;  3QW0 A;  2YL7 A;  2YLG A;  1BBH A;  1CGO A;  1YYJ A;  3QVZ A;  5JP7 A;  5B3I A;  4NC3 A;  4JKV A;  3HNJ A;  1E85 A;  3TOM A;  4CDV A;  1RCP A;  4N4W A;  2XLO A;  1YZA A;  3ZWI A;  4IB4 A;  4CX9 A;  4EIY A;  3HNL A;  4WGZ A;  2YL1 A;  256B A;  5JUA A;  4CDA A;  1GQA A;  1S05 A;  3DE9 A;  4JEA A;  5JS5 A;  2YLI A;  5JT4 A;  1EKY A;  2XLV A;  2XLM A;  3M4C A;  3ZQY A;  4CDY A;  3NMI A;  4U9D A;  1A7V A;  2XM0 A;  4ER9 A;  4CIP A;  1MQV A;  3IQ6 A;  2YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...