1YZ9A

Crystal structure of rnase iii mutant e110q from aquifex aeolicus complexed with double stranded rna at 2.1-angstrom resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
220
Chain Sequence
MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETIIGDVFQALWAAVYIDSGRDANFTRELFYKLFKEDILSAIKEGRVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKIKEYRTLGEGKSKKEAEQRAAEELIKLLEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*GP*AP*AP*CP*UP*UP*CP*GP*CP*G)-3'
publication title Intermediate states of ribonuclease III in complex with double-stranded RNA
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Hydrolase/rna
total genus 78
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.1.26.3: Ribonuclease III.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00035 dsrm Double-stranded RNA binding motif
A PF00636 Ribonuclease_3 Ribonuclease III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1520.10 Mainly Alpha Orthogonal Bundle Ribonuclease iii, N-terminal Endonuclease Domain; Chain A Ribonuclease III domain 1yz9A01
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 1yz9A02
2B7TA 4DV4E 2B7VA 4JI7E 5LMNE 2E5LE 4NXME 2L33A 4OUNA 1J26A 2L2KB 3OTOE 4DV6E 3P1XA 2NUGA 4DKKA 4LF5E 4JV5E 1DI2A 4B3SE 1IBME 4LF9E 4B3ME 3ADGA 1WHNA 1HNZE 4JI5E 2L3CA 1T4LB 2RSMA 5LMUE 1YYOA 4JYAE 3VYYA 2L2NA 1FKAE 2UXDE 2B3TB 4DV0E 2UXCE 2UUCE 3ADJA 4LF4E 2RTXA 2UUAE 1X47A 2EZ6A 2F4VE 5CFFE 2EB1A 1WHQA 1T4OA 4JI1E 3ADLA 2GSLA 1IBKE 1GQEA 2JVAA 4X66E 2A11A 4LFBE 2NA2A 4DUYE 2DB2A 1YYWA 5BR8E 4X62E 4X65E 3RV1A 2NUFA 2L2MA 5IWAE 2UXBE 1JFZA 2DIXA 2N3GA 4LF8E 2MDRA 4DR5E 4GKKE 2RS6A 2VQEE 1T4NA 4M30A 4DR3E 2KHXA 2NUEA 1UILA 2L3JA 1RC5A 1N32E 1EKZA 4JI3E 4B3TE 4DV3E 1N36E 1X49A 1IBLE 3C4TA 3O2RB 1QU6A 1STUA 4LFCE 2RS7A 2LTSA 4X64E 1N33E 2CPNA 4JI0E 4DR2E 1XNRE 3VYXA 1J5EE 4AQYE 1FJGE 2UU9E 2JY9A 3J7Yp 4LFAE 1YZ9A 1ZBTA 4YHHE 2YT4A 1U61A 2HHHE 4DR4E 3C4BA 4WYQB 1YYKA 4DR6E 3O2RA 4WFTA 2IHR1 1HNWE 2UUBE 2LTRA 4DUZE 1RC7A 2ZM6E 3T1HE 4JI4E 3HTXA 2LBSB 4DR1E 2N3HA 3T1YE 4DV5E 1HNXE 4NXNE 2FFLA 1I4SA 3N3WA 3RV0A 4OX9E 4DV1E 4K0KE 4JI2E 2QVWA 4DV2E 3LLHA 1PKPA 4JI8E 4KHPE 4GKJE 1I94E 2LUQA 1XMOE 4LF7E 1XNQE 2LJHA 1O0WA 2LRSA 4M2ZA 2DMYA 1UHZA 2VQFE 1XMQE 4JI6E 1N34E 1RQ0A 1HR0E 4X8WA 3ADIA 4LF6E 2LUPB 4OOGC 1X48A 4DV7E 4YY3E 4DR7E 4B3RE
chains in the Genus database with same CATH superfamily
4MLQA 2G7HA 4ZYGA 4JI7E 1A1JA 4BHBA 2LO3A 2YTQA 3OTOE 1DI2A 2HJJA 2EPCA 2H36X 2DLKA 1PDAA 4BBYA 4JI5E 2B9DA 2EMCA 1T4LB 2RSMA 3QG5C 2YZTA 5IXMB 2JXPA 5AE1A 2YTEA 1EH6A 4KZSA 2EPNA 2WBUA 5DNYA 4GZNC 1X3CA 1X47A 2F4VE 4KWYA 1T4OA 2GSLA 2E72A 2YTNA 3M99B 2EOIA 3FIGA 3THOB 2JOBA 1NCSA 2NA2A 2JR1A 5ADZA 2EPOA 4WXDA 4X62E 2MC5A 4F6NA 2L2MA 2UXBE 1ZU1A 3LMLA 1UN6B 4DR5E 2EMXA 1GTKA 2EMGA 1MGTA 2NUEA 4R2PA 1RC5A 2GLIA 3TQMA 4NZVA 3EQ1A 2YSPA 3O2RB 2EWLA 3KZZA 1SR9A 2N8XA 5AE3A 5KL5A 2RS7A 2MKNA 2F8BA 4JI0E 1XNRE 2EN3A 4AQYE 1BB8A 1YFHA 3J81C 3EPKA 4R2DA 3HPSA 4LFAE 4DMIA 1DQ3A 2YTPA 1L4SA 2EP3A 4MLVA 4YHHE 2EMZA 1U61A 2YU5A 2YTJA 4DR4E 2EM9A 3O2RA 3RMPA 2Q8UA 2EMBA 2L8TA 2JYAA 2V83A 4F9BB 1HNWE 3IWCA 2EOFA 4RH8A 4TUIA 2DSYA 2ENHA 4X9JA 4F6MA 1X5WA 1HNXE 3F6GA 5A6JA 4DV5E 3RV0A 1A1KA 4NXNE 2EOHA 4JI2E 2QVWA 2EORA 1NEIA 2J7JA 1Z1BA 2BB8A 1I94E 2LUQA 4P78A 4RHBB 1N3GA 3OMLA 2HC5A 4L5NC 1F2IG 4GEQB 4M2ZA 1JK1A 3JTZA 1UHZA 2EMHA 2GHFA 4X8WA 2LUPB 3MHHC 2EPLX 2EL5A 4B3RE 3KWRA 3BBGA 3HPZA 2B7VA 2ELZA 1YUJA 4NXME 2L33A 4OUNA 2EN4A 3DF6A 4FK5C 4DV6E 2YTGA 2V8QB 2JOXA 4LF5E 2EOZA 2LE2A 5A69A 2YU8A 2JPAA 1HNZE 2L92A 1YYOA 1ZBQA 2V88A 4F54A 2EPKX 2EM5A 4BMJA 1YPNA 1FKAE 2B3TB 2LMZA 2VF1A 5F3WA 2KONA 4DV0E 3ADJA 4M0VA 4R2AA 2EMWA 3MHSC 2RQLA 2V87A 2JVAA 4NHRA 3K6QA 2LV2A 3RV1A 2I9IA 2EM2A 1JFZA 2DIXA 2MC6A 3AUZA 3C6MA 4GKKE 2RS6A 3L00A 2YRKA 3IWBA 1EKZA 4JI3E 1TN9A 4B3TE 4DV3E 2WBTA 3ECRA 4O4KA 1N36E 1X49A 1IBLE 5KL7A 4O24A 4WSPA 4BCAA 2V85A 2EN8A 2ADRA 2LTSA 4X64E 4O5GA 3THNA 3HXLA 3C6KA 1J5EE 5IT9C 2EOXA 2EPPA 1PJSA 1FJGE 2ODRD 2EMFA 1YZ9A 1ZBTA 2YT4A 2HHHE 3C4BA 2VE7C 4WYQB 4LU9A 2IHR1 2A25A 2ODRC 2LTRA 4DUZE 3HTXA 2EQ1A 4J8ZA 4M9VC 3T1YE 2FFLA 1I4SA 4OX9E 4K0KE 4R2SA 4DV2E 3LLHA 2EN2A 2I13A 1PJTA 3ZOQB 2YRHA 4F9AB 3J80C 1ZTDA 4LF7E 4BHCA 1P47A 1O0WA 3IWDA 2R1FA 2EM7A 2DMYA 2M1SA 3BIDA 1XMQE 4JI6E 1IMUA 5AE2A 1MEYC 2CT1A 4DV7E 2B7TA 1GZ6A 2EOQA 1BBOA 2E5LE 2ENAA 3JU0A 2JWOA 3EPJA 4HEIA 1A1LA 3P1XA 2NUGA 4DKKA 1IQSA 4JV5E 2EOYA 3KZYA 4B3ME 3ADGA 3MSWA 2L3CA 1T38A 4JYAE 3VYYA 1JK2A 2FV4B 2WZOA 2EL6A 4I8OA 2RTXA 2EE8A 2EZ6A 3AV0A 5CFFE 3UK3C 2M9AA 1LLMC 2EB1A 1WRJA 5KL4A 3JAMC 3ADLA 1IBKE 1GQEA 3F6HA 1X6HA 3H09A 4X66E 2NABA 4DUYE 2EM4A 1EH7A 2DB2A 4X65E 1WJPA 2NUFA 4O43A 5IWAE 3EPLA 1TF6A 2N3GA 2WBSA 1ZR9A 4LF8E 2MDRA 2YSOA 1T4NA 4M30A 4WSGA 2KHXA 5A6KA 1UILA 2L3JA 1N32E 4BC9A 4WXCA 2EJ4A 2GPIA 1X6FA 1KJKA 5IV8B 1QU6A 5T6JA 2D9HA 2MKDA 4R2CA 2V86A 4LFCE 2MDGA 2ENCA 4BS9A 4DR2E 1T39A 2EMIA 5AC5A 3DJWA 2UU9E 2JY9A 3J7Yp 2YRMA 4WPYA 2ELYA 5LL6R 5A6BA 1YYKA 2EN1A 5KL2A 2UUBE 2LJUA 2R76A 1A1IA 1RC7A 3T1HE 4JI4E 4N4RB 4R2RA 2EQ3A 2EPXA 3N3WA 4R2QA 2EPRA 4L8NA 4GKJE 4R8OA 4HTGA 4ZYHA 1XMOE 1TF3A 2EM0A 2YTDA 2K4VA 2LJHA 2LRSA 2FGGA 2V89A 2PRTA 1AH5A 2EMYA 1N34E 1RQ0A 4ZYEA 1HR0E 2WCC3 4WX9A 2YTFA 4LF6E 4F2JC 1AAYA 5AC4A 2DMIA 3BF2A 2YWQA 4DR7E 2YTOA 2EMLA 4DV4E 5KL6A 5LMNE 2RPCA 2EPUA 1J26A 3HQ1A 2EPZA 2L2KB 2EOSA 5FLXC 2JP9A 4B3SE 1IBME 2L6MA 1A1FA 4LF9E 1WHNA 1A1GA 2DLQA 1G2DC 2EM6A 2YTIA 5LMUE 2EOJA 2L2NA 2EL4A 4P7DA 3VK6A 2EOMA 2UXDE 1G2FC 5A6BD 2YPNA 5AASA 2UXCE 2UUCE 4LF4E 5KL3A 1YUIA 2UUAE 2K7IA 2LVHA 2M4IA 1WHQA 4JI1E 4Q28A 5A6AA 2A11A 4LFBE 5TSEA 5BR8E 1YYWA 2FTXB 1WXRA 2EMKA 4R2EA 3EPHA 1QNTA 2E1MA 2VQEE 4DR3E 2HGHA 2EN7A 2BBGA 2EOEA 3C4TA 2VRDA 5LLQA 1DGCA 1STUA 4ZYDA 1N33E 2EM3A 2CPNA 2EMAA 3VYXA 1A1HA 1BBGA 2RSIA 2CSHA 2LCEA 2EPMX 4DR6E 1RMDA 3BGHA 4WFTA 3J7AG 4Q35B 1YSAC 2ZM6E 2DRPA 2LBSB 4DR1E 1B69A 2EN6A 2N3HA 1X6EA 4DV1E 2KOUA 1IQOA 1PKPA 2M7QA 1EH8A 1UBDC 4JI8E 2EOOA 2EQ0A 4KHPE 1ZAAC 1KYQA 2EM8A 4LTYA 1SFEA 1XNQE 2LT7A 2EPAA 5A2QC 4F9CB 4R03A 4BC7A 4TUGA 4IJDA 2VQFE 4IS1C 2DGCA 2CTDA 3ADIA 4OOGC 3VHTB 1X48A 1PJQA 4YY3E
chains in the Genus database with same CATH topology
3KWRA 2B7TA 1GZ6A 4DV4E 3HPZA 2G7HA 2B7VA 4JI7E 5LMNE 2E5LE 3JU0A 4NXME 2JWOA 2L33A 4OUNA 1J26A 3DF6A 3HQ1A 2L2KB 3OTOE 4DV6E 3P1XA 2NUGA 4DKKA 2V8QB 2JOXA 4LF5E 5FLXC 4JV5E 1DI2A 4B3SE 1IBME 2LE2A 2L6MA 2H36X 4LF9E 4B3ME 3ADGA 1WHNA 3MSWA 4BBYA 2B9DA 2L3CA 1HNZE 4JI5E 1T4LB 2RSMA 2L92A 1YYOA 1ZBQA 2V88A 2YZTA 2L2NA 4F54A 4BMJA 5LMUE 3VYYA 4JYAE 4P7DA 3VK6A 1FKAE 2UXDE 2FV4B 2B3TB 2LMZA 5AE1A 2VF1A 2WZOA 5AASA 2KONA 4DV0E 4KZSA 5F3WA 2UXCE 2UUCE 3ADJA 4M0VA 4I8OA 5DNYA 2RTXA 4LF4E 2UUAE 1X47A 2EZ6A 2F4VE 3AV0A 5CFFE 2M4IA 2EB1A 1WHQA 1T4OA 4Q28A 4JI1E 3JAMC 2GSLA 3ADLA 2V87A 1IBKE 1GQEA 2JVAA 3F6HA 3H09A 3FIGA 4X66E 2A11A 2JOBA 3K6QA 4LFBE 2NA2A 4DUYE 2JR1A 5ADZA 2DB2A 1YYWA 5BR8E 4X62E 2MC5A 4X65E 3RV1A 2NUFA 2FTXB 2L2MA 5IWAE 1WXRA 2UXBE 1JFZA 2DIXA 2MC6A 2N3GA 3AUZA 3LMLA 4LF8E 2MDRA 4DR5E 4GKKE 2RS6A 2E1MA 1T4NA 2VQEE 4M30A 4DR3E 2KHXA 3IWBA 2NUEA 1UILA 2L3JA 1RC5A 1N32E 1EKZA 4BC9A 4JI3E 4B3TE 4DV3E 1N36E 1X49A 1IBLE 3C4TA 3O2RB 2EWLA 4WSPA 1QU6A 2V85A 5T6JA 1STUA 4BCAA 1SR9A 2V86A 5AE3A 4LFCE 2RS7A 2LTSA 4X64E 1N33E 2F8BA 2CPNA 3HXLA 4BS9A 4DR2E 4JI0E 1XNRE 3VYXA 1J5EE 5IT9C 4AQYE 3J81C 1FJGE 3DJWA 2UU9E 2JY9A 2ODRD 3HPSA 4WPYA 4DMIA 1YZ9A 1DQ3A 1ZBTA 5LL6R 4YHHE 2YT4A 3J7Yp 4LFAE 1U61A 2HHHE 4DR4E 3C4BA 2VE7C 1YYKA 4WYQB 4DR6E 3O2RA 3RMPA 4LU9A 4WFTA 2IHR1 2L8TA 3J7AG 2ODRC 2V83A 4F9BB 2UUBE 2LTRA 4DUZE 3IWCA 1HNWE 1RC7A 4TUIA 2DSYA 2ZM6E 3T1HE 4JI4E 3HTXA 2LBSB 4DR1E 4J8ZA 2N3HA 3T1YE 3F6GA 4DV5E 1HNXE 2FFLA 1I4SA 3N3WA 3RV0A 4NXNE 4OX9E 4DV1E 4K0KE 4JI2E 2QVWA 2KOUA 4DV2E 3LLHA 1PKPA 4L8NA 2M7QA 4JI8E 3ZOQB 4R8OA 4F9AB 1I94E 2LUQA 4KHPE 4GKJE 4P78A 3J80C 4LTYA 1XMOE 4LF7E 1XNQE 3OMLA 4L5NC 5A2QC 4F9CB 2K4VA 4R03A 2LJHA 4BC7A 1O0WA 2LRSA 3IWDA 4GEQB 4M2ZA 4TUGA 2FGGA 2DMYA 1UHZA 2M1SA 2V89A 3JTZA 2VQFE 1XMQE 1RQ0A 1N34E 1HR0E 4JI6E 4X8WA 3ADIA 5AE2A 4LF6E 2LUPB 4OOGC 1X48A 4DV7E 4YY3E 4DR7E 4B3RE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7T A;  4DV4 E;  2B7V A;  4JI7 E;  5LMN E;  2E5L E;  4NXM E;  2L33 A;  4OUN A;  1J26 A;  2L2K B;  3OTO E;  4DV6 E;  3P1X A;  2NUG A;  4DKK A;  4LF5 E;  4JV5 E;  1DI2 A;  4B3S E;  1IBM E;  4LF9 E;  4B3M E;  3ADG A;  1WHN A;  1HNZ E;  4JI5 E;  2L3C A;  1T4L B;  2RSM A;  5LMU E;  1YYO A;  4JYA E;  3VYY A;  2L2N A;  1FKA E;  2UXD E;  2B3T B;  4DV0 E;  2UXC E;  2UUC E;  3ADJ A;  4LF4 E;  2RTX A;  2UUA E;  1X47 A;  2EZ6 A;  2F4V E;  5CFF E;  2EB1 A;  1WHQ A;  1T4O A;  4JI1 E;  3ADL A;  2GSL A;  1IBK E;  1GQE A;  2JVA A;  4X66 E;  2A11 A;  4LFB E;  2NA2 A;  4DUY E;  2DB2 A;  1YYW A;  5BR8 E;  4X62 E;  4X65 E;  3RV1 A;  2NUF A;  2L2M A;  5IWA E;  2UXB E;  1JFZ A;  2DIX A;  2N3G A;  4LF8 E;  2MDR A;  4DR5 E;  4GKK E;  2RS6 A;  2VQE E;  1T4N A;  4M30 A;  4DR3 E;  2KHX A;  2NUE A;  1UIL A;  2L3J A;  1RC5 A;  1N32 E;  1EKZ A;  4JI3 E;  4B3T E;  4DV3 E;  1N36 E;  1X49 A;  1IBL E;  3C4T A;  3O2R B;  1QU6 A;  1STU A;  4LFC E;  2RS7 A;  2LTS A;  4X64 E;  1N33 E;  2CPN A;  4JI0 E;  4DR2 E;  1XNR E;  3VYX A;  1J5E E;  4AQY E;  1FJG E;  2UU9 E;  2JY9 A;  3J7Y p;  4LFA E;  1YZ9 A;  1ZBT A;  4YHH E;  2YT4 A;  1U61 A;  2HHH E;  4DR4 E;  3C4B A;  4WYQ B;  1YYK A;  4DR6 E;  3O2R A;  4WFT A;  2IHR 1;  1HNW E;  2UUB E;  2LTR A;  4DUZ E;  1RC7 A;  2ZM6 E;  3T1H E;  4JI4 E;  3HTX A;  2LBS B;  4DR1 E;  2N3H A;  3T1Y E;  4DV5 E;  1HNX E;  4NXN E;  2FFL A;  1I4S A;  3N3W A;  3RV0 A;  4OX9 E;  4DV1 E;  4K0K E;  4JI2 E;  2QVW A;  4DV2 E;  3LLH A;  1PKP A;  4JI8 E;  4KHP E;  4GKJ E;  1I94 E;  2LUQ A;  1XMO E;  4LF7 E;  1XNQ E;  2LJH A;  1O0W A;  2LRS A;  4M2Z A;  2DMY A;  1UHZ A;  2VQF E;  1XMQ E;  4JI6 E;  1N34 E;  1RQ0 A;  1HR0 E;  4X8W A;  3ADI A;  4LF6 E;  2LUP B;  4OOG C;  1X48 A;  4DV7 E;  4YY3 E;  4DR7 E;  4B3R E; 
#chains in the Genus database with same CATH topology
 4MLQ A;  2G7H A;  4ZYG A;  4JI7 E;  1A1J A;  4BHB A;  2LO3 A;  2YTQ A;  3OTO E;  1DI2 A;  2HJJ A;  2EPC A;  2H36 X;  2DLK A;  1PDA A;  4BBY A;  4JI5 E;  2B9D A;  2EMC A;  1T4L B;  2RSM A;  3QG5 C;  2YZT A;  5IXM B;  2JXP A;  5AE1 A;  2YTE A;  1EH6 A;  4KZS A;  2EPN A;  2WBU A;  5DNY A;  4GZN C;  1X3C A;  1X47 A;  2F4V E;  4KWY A;  1T4O A;  2GSL A;  2E72 A;  2YTN A;  3M99 B;  2EOI A;  3FIG A;  3THO B;  2JOB A;  1NCS A;  2NA2 A;  2JR1 A;  5ADZ A;  2EPO A;  4WXD A;  4X62 E;  2MC5 A;  4F6N A;  2L2M A;  2UXB E;  1ZU1 A;  3LML A;  1UN6 B;  4DR5 E;  2EMX A;  1GTK A;  2EMG A;  1MGT A;  2NUE A;  4R2P A;  1RC5 A;  2GLI A;  3TQM A;  4NZV A;  3EQ1 A;  2YSP A;  3O2R B;  2EWL A;  3KZZ A;  1SR9 A;  2N8X A;  5AE3 A;  5KL5 A;  2RS7 A;  2MKN A;  2F8B A;  4JI0 E;  1XNR E;  2EN3 A;  4AQY E;  1BB8 A;  1YFH A;  3J81 C;  3EPK A;  4R2D A;  3HPS A;  4LFA E;  4DMI A;  1DQ3 A;  2YTP A;  1L4S A;  2EP3 A;  4MLV A;  4YHH E;  2EMZ A;  1U61 A;  2YU5 A;  2YTJ A;  4DR4 E;  2EM9 A;  3O2R A;  3RMP A;  2Q8U A;  2EMB A;  2L8T A;  2JYA A;  2V83 A;  4F9B B;  1HNW E;  3IWC A;  2EOF A;  4RH8 A;  4TUI A;  2DSY A;  2ENH A;  4X9J A;  4F6M A;  1X5W A;  1HNX E;  3F6G A;  5A6J A;  4DV5 E;  3RV0 A;  1A1K A;  4NXN E;  2EOH A;  4JI2 E;  2QVW A;  2EOR A;  1NEI A;  2J7J A;  1Z1B A;  2BB8 A;  1I94 E;  2LUQ A;  4P78 A;  4RHB B;  1N3G A;  3OML A;  2HC5 A;  4L5N C;  1F2I G;  4GEQ B;  4M2Z A;  1JK1 A;  3JTZ A;  1UHZ A;  2EMH A;  2GHF A;  4X8W A;  2LUP B;  3MHH C;  2EPL X;  2EL5 A;  4B3R E;  3KWR A;  3BBG A;  3HPZ A;  2B7V A;  2ELZ A;  1YUJ A;  4NXM E;  2L33 A;  4OUN A;  2EN4 A;  3DF6 A;  4FK5 C;  4DV6 E;  2YTG A;  2V8Q B;  2JOX A;  4LF5 E;  2EOZ A;  2LE2 A;  5A69 A;  2YU8 A;  2JPA A;  1HNZ E;  2L92 A;  1YYO A;  1ZBQ A;  2V88 A;  4F54 A;  2EPK X;  2EM5 A;  4BMJ A;  1YPN A;  1FKA E;  2B3T B;  2LMZ A;  2VF1 A;  5F3W A;  2KON A;  4DV0 E;  3ADJ A;  4M0V A;  4R2A A;  2EMW A;  3MHS C;  2RQL A;  2V87 A;  2JVA A;  4NHR A;  3K6Q A;  2LV2 A;  3RV1 A;  2I9I A;  2EM2 A;  1JFZ A;  2DIX A;  2MC6 A;  3AUZ A;  3C6M A;  4GKK E;  2RS6 A;  3L00 A;  2YRK A;  3IWB A;  1EKZ A;  4JI3 E;  1TN9 A;  4B3T E;  4DV3 E;  2WBT A;  3ECR A;  4O4K A;  1N36 E;  1X49 A;  1IBL E;  5KL7 A;  4O24 A;  4WSP A;  4BCA A;  2V85 A;  2EN8 A;  2ADR A;  2LTS A;  4X64 E;  4O5G A;  3THN A;  3HXL A;  3C6K A;  1J5E E;  5IT9 C;  2EOX A;  2EPP A;  1PJS A;  1FJG E;  2ODR D;  2EMF A;  1YZ9 A;  1ZBT A;  2YT4 A;  2HHH E;  3C4B A;  2VE7 C;  4WYQ B;  4LU9 A;  2IHR 1;  2A25 A;  2ODR C;  2LTR A;  4DUZ E;  3HTX A;  2EQ1 A;  4J8Z A;  4M9V C;  3T1Y E;  2FFL A;  1I4S A;  4OX9 E;  4K0K E;  4R2S A;  4DV2 E;  3LLH A;  2EN2 A;  2I13 A;  1PJT A;  3ZOQ B;  2YRH A;  4F9A B;  3J80 C;  1ZTD A;  4LF7 E;  4BHC A;  1P47 A;  1O0W A;  3IWD A;  2R1F A;  2EM7 A;  2DMY A;  2M1S A;  3BID A;  1XMQ E;  4JI6 E;  1IMU A;  5AE2 A;  1MEY C;  2CT1 A;  4DV7 E;  2B7T A;  1GZ6 A;  2EOQ A;  1BBO A;  2E5L E;  2ENA A;  3JU0 A;  2JWO A;  3EPJ A;  4HEI A;  1A1L A;  3P1X A;  2NUG A;  4DKK A;  1IQS A;  4JV5 E;  2EOY A;  3KZY A;  4B3M E;  3ADG A;  3MSW A;  2L3C A;  1T38 A;  4JYA E;  3VYY A;  1JK2 A;  2FV4 B;  2WZO A;  2EL6 A;  4I8O A;  2RTX A;  2EE8 A;  2EZ6 A;  3AV0 A;  5CFF E;  3UK3 C;  2M9A A;  1LLM C;  2EB1 A;  1WRJ A;  5KL4 A;  3JAM C;  3ADL A;  1IBK E;  1GQE A;  3F6H A;  1X6H A;  3H09 A;  4X66 E;  2NAB A;  4DUY E;  2EM4 A;  1EH7 A;  2DB2 A;  4X65 E;  1WJP A;  2NUF A;  4O43 A;  5IWA E;  3EPL A;  1TF6 A;  2N3G A;  2WBS A;  1ZR9 A;  4LF8 E;  2MDR A;  2YSO A;  1T4N A;  4M30 A;  4WSG A;  2KHX A;  5A6K A;  1UIL A;  2L3J A;  1N32 E;  4BC9 A;  4WXC A;  2EJ4 A;  2GPI A;  1X6F A;  1KJK A;  5IV8 B;  1QU6 A;  5T6J A;  2D9H A;  2MKD A;  4R2C A;  2V86 A;  4LFC E;  2MDG A;  2ENC A;  4BS9 A;  4DR2 E;  1T39 A;  2EMI A;  5AC5 A;  3DJW A;  2UU9 E;  2JY9 A;  3J7Y p;  2YRM A;  4WPY A;  2ELY A;  5LL6 R;  5A6B A;  1YYK A;  2EN1 A;  5KL2 A;  2UUB E;  2LJU A;  2R76 A;  1A1I A;  1RC7 A;  3T1H E;  4JI4 E;  4N4R B;  4R2R A;  2EQ3 A;  2EPX A;  3N3W A;  4R2Q A;  2EPR A;  4L8N A;  4GKJ E;  4R8O A;  4HTG A;  4ZYH A;  1XMO E;  1TF3 A;  2EM0 A;  2YTD A;  2K4V A;  2LJH A;  2LRS A;  2FGG A;  2V89 A;  2PRT A;  1AH5 A;  2EMY A;  1N34 E;  1RQ0 A;  4ZYE A;  1HR0 E;  2WCC 3;  4WX9 A;  2YTF A;  4LF6 E;  4F2J C;  1AAY A;  5AC4 A;  2DMI A;  3BF2 A;  2YWQ A;  4DR7 E;  2YTO A;  2EML A;  4DV4 E;  5KL6 A;  5LMN E;  2RPC A;  2EPU A;  1J26 A;  3HQ1 A;  2EPZ A;  2L2K B;  2EOS A;  5FLX C;  2JP9 A;  4B3S E;  1IBM E;  2L6M A;  1A1F A;  4LF9 E;  1WHN A;  1A1G A;  2DLQ A;  1G2D C;  2EM6 A;  2YTI A;  5LMU E;  2EOJ A;  2L2N A;  2EL4 A;  4P7D A;  3VK6 A;  2EOM A;  2UXD E;  1G2F C;  5A6B D;  2YPN A;  5AAS A;  2UXC E;  2UUC E;  4LF4 E;  5KL3 A;  1YUI A;  2UUA E;  2K7I A;  2LVH A;  2M4I A;  1WHQ A;  4JI1 E;  4Q28 A;  5A6A A;  2A11 A;  4LFB E;  5TSE A;  5BR8 E;  1YYW A;  2FTX B;  1WXR A;  2EMK A;  4R2E A;  3EPH A;  1QNT A;  2E1M A;  2VQE E;  4DR3 E;  2HGH A;  2EN7 A;  2BBG A;  2EOE A;  3C4T A;  2VRD A;  5LLQ A;  1DGC A;  1STU A;  4ZYD A;  1N33 E;  2EM3 A;  2CPN A;  2EMA A;  3VYX A;  1A1H A;  1BBG A;  2RSI A;  2CSH A;  2LCE A;  2EPM X;  4DR6 E;  1RMD A;  3BGH A;  4WFT A;  3J7A G;  4Q35 B;  1YSA C;  2ZM6 E;  2DRP A;  2LBS B;  4DR1 E;  1B69 A;  2EN6 A;  2N3H A;  1X6E A;  4DV1 E;  2KOU A;  1IQO A;  1PKP A;  2M7Q A;  1EH8 A;  1UBD C;  4JI8 E;  2EOO A;  2EQ0 A;  4KHP E;  1ZAA C;  1KYQ A;  2EM8 A;  4LTY A;  1SFE A;  1XNQ E;  2LT7 A;  2EPA A;  5A2Q C;  4F9C B;  4R03 A;  4BC7 A;  4TUG A;  4IJD A;  2VQF E;  4IS1 C;  2DGC A;  2CTD A;  3ADI A;  4OOG C;  3VHT B;  1X48 A;  1PJQ A;  4YY3 E; 
#chains in the Genus database with same CATH homology
 3KWR A;  2B7T A;  1GZ6 A;  4DV4 E;  3HPZ A;  2G7H A;  2B7V A;  4JI7 E;  5LMN E;  2E5L E;  3JU0 A;  4NXM E;  2JWO A;  2L33 A;  4OUN A;  1J26 A;  3DF6 A;  3HQ1 A;  2L2K B;  3OTO E;  4DV6 E;  3P1X A;  2NUG A;  4DKK A;  2V8Q B;  2JOX A;  4LF5 E;  5FLX C;  4JV5 E;  1DI2 A;  4B3S E;  1IBM E;  2LE2 A;  2L6M A;  2H36 X;  4LF9 E;  4B3M E;  3ADG A;  1WHN A;  3MSW A;  4BBY A;  2B9D A;  2L3C A;  1HNZ E;  4JI5 E;  1T4L B;  2RSM A;  2L92 A;  1YYO A;  1ZBQ A;  2V88 A;  2YZT A;  2L2N A;  4F54 A;  4BMJ A;  5LMU E;  3VYY A;  4JYA E;  4P7D A;  3VK6 A;  1FKA E;  2UXD E;  2FV4 B;  2B3T B;  2LMZ A;  5AE1 A;  2VF1 A;  2WZO A;  5AAS A;  2KON A;  4DV0 E;  4KZS A;  5F3W A;  2UXC E;  2UUC E;  3ADJ A;  4M0V A;  4I8O A;  5DNY A;  2RTX A;  4LF4 E;  2UUA E;  1X47 A;  2EZ6 A;  2F4V E;  3AV0 A;  5CFF E;  2M4I A;  2EB1 A;  1WHQ A;  1T4O A;  4Q28 A;  4JI1 E;  3JAM C;  2GSL A;  3ADL A;  2V87 A;  1IBK E;  1GQE A;  2JVA A;  3F6H A;  3H09 A;  3FIG A;  4X66 E;  2A11 A;  2JOB A;  3K6Q A;  4LFB E;  2NA2 A;  4DUY E;  2JR1 A;  5ADZ A;  2DB2 A;  1YYW A;  5BR8 E;  4X62 E;  2MC5 A;  4X65 E;  3RV1 A;  2NUF A;  2FTX B;  2L2M A;  5IWA E;  1WXR A;  2UXB E;  1JFZ A;  2DIX A;  2MC6 A;  2N3G A;  3AUZ A;  3LML A;  4LF8 E;  2MDR A;  4DR5 E;  4GKK E;  2RS6 A;  2E1M A;  1T4N A;  2VQE E;  4M30 A;  4DR3 E;  2KHX A;  3IWB A;  2NUE A;  1UIL A;  2L3J A;  1RC5 A;  1N32 E;  1EKZ A;  4BC9 A;  4JI3 E;  4B3T E;  4DV3 E;  1N36 E;  1X49 A;  1IBL E;  3C4T A;  3O2R B;  2EWL A;  4WSP A;  1QU6 A;  2V85 A;  5T6J A;  1STU A;  4BCA A;  1SR9 A;  2V86 A;  5AE3 A;  4LFC E;  2RS7 A;  2LTS A;  4X64 E;  1N33 E;  2F8B A;  2CPN A;  3HXL A;  4BS9 A;  4DR2 E;  4JI0 E;  1XNR E;  3VYX A;  1J5E E;  5IT9 C;  4AQY E;  3J81 C;  1FJG E;  3DJW A;  2UU9 E;  2JY9 A;  2ODR D;  3HPS A;  4WPY A;  4DMI A;  1YZ9 A;  1DQ3 A;  1ZBT A;  5LL6 R;  4YHH E;  2YT4 A;  3J7Y p;  4LFA E;  1U61 A;  2HHH E;  4DR4 E;  3C4B A;  2VE7 C;  1YYK A;  4WYQ B;  4DR6 E;  3O2R A;  3RMP A;  4LU9 A;  4WFT A;  2IHR 1;  2L8T A;  3J7A G;  2ODR C;  2V83 A;  4F9B B;  2UUB E;  2LTR A;  4DUZ E;  3IWC A;  1HNW E;  1RC7 A;  4TUI A;  2DSY A;  2ZM6 E;  3T1H E;  4JI4 E;  3HTX A;  2LBS B;  4DR1 E;  4J8Z A;  2N3H A;  3T1Y E;  3F6G A;  4DV5 E;  1HNX E;  2FFL A;  1I4S A;  3N3W A;  3RV0 A;  4NXN E;  4OX9 E;  4DV1 E;  4K0K E;  4JI2 E;  2QVW A;  2KOU A;  4DV2 E;  3LLH A;  1PKP A;  4L8N A;  2M7Q A;  4JI8 E;  3ZOQ B;  4R8O A;  4F9A B;  1I94 E;  2LUQ A;  4KHP E;  4GKJ E;  4P78 A;  3J80 C;  4LTY A;  1XMO E;  4LF7 E;  1XNQ E;  3OML A;  4L5N C;  5A2Q C;  4F9C B;  2K4V A;  4R03 A;  2LJH A;  4BC7 A;  1O0W A;  2LRS A;  3IWD A;  4GEQ B;  4M2Z A;  4TUG A;  2FGG A;  2DMY A;  1UHZ A;  2M1S A;  2V89 A;  3JTZ A;  2VQF E;  1XMQ E;  1RQ0 A;  1N34 E;  1HR0 E;  4JI6 E;  4X8W A;  3ADI A;  5AE2 A;  4LF6 E;  2LUP B;  4OOG C;  1X48 A;  4DV7 E;  4YY3 E;  4DR7 E;  4B3R E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...