1YZGA

Structure of human adp-ribosylation factor-like 8
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
168
structure length
168
Chain Sequence
AKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDHPWHIQSCCALTGEGLCQGLEWMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human ADP-ribosylation factor-like 8
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords ADP-ribosylation factor-like 8
total genus 57
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yzgA00
1MR3F 2C2HA 1VCMA 3KQLA 3BFVA 4JZKA 5B2ZA 4M1MA 3NWJA 2V1XA 3RSOA 4JVSB 3U4QB 2BMJA 5SZHB 4B44A 4E03A 1JEEA 1E2DA 1RJ9B 2AL7A 3EASA 5FTLA 4TYYA 1HY3A 1ZM2A 4HAVA 2XNDA 2PEZA 1RC8A 4B33A 2IT1A 2PL3A 5HR5A 1YKSA 1G5TA 4Z8XA 2P6RA 3ZGXA 1J70A 3IHLA 4PC1A 1OFHA 4I1VA 1AKYA 4M8NE 1LS6A 1G5RA 2ERXA 3QKSB 4V0ME 4US1R 2IF2A 2OLJA 2KJQA 4Q02A 3ZLJA 4BRWA 2ANBA 2VF8A 4TTRA 1Q21A 4PHGA 3HWSA 1ZUHA 1OXTA 1XXHE 2ZJ8A 2HV8A 4Q7JB 4LJ7A 2AWNA 5H68A 3IILA 3GJ5A 1E0AA 4CF7A 3I61A 3LRPA 3Q5EA 1G17A 2H8KA 1E79D 2BV3A 3BERA 5ANRB 2FU5C 5EZ6B 3B8HA 5GJBA 2Q9BA 3B1ZA 2ANCA 3P27A 1XD9A 2ZSAA 1J8YF 1ZM4A 4EJSC 5HPYB 3EZ7A 3NH9A 4L4UA 1XMVA 5EE3A 2KWIA 4GOJA 4XWOA 2Q9AA 2Z83A 5TV2A 1OJLA 5KDDA 2J5XA 2NO6A 1E98A 3C41J 3QF7A 2JAQA 1CXZA 3W90A 4A92A 2FPKA 2XNSA 3D8BA 1CBUA 4PSKA 4XD7A 3KTAA 5FTMA 1GDDA 2IWHA 1IY1A 1W0JD 4XH9B 2HEIA 1EWQA 2XX3A 5CITA 2ODWA 2YZ2A 3RS4A 3I3SR 2WJYA 2WAYA 1DAEA 1K8RA 3DOEA 2O8DA 1W0KD 2X1VA 1U81A 1NI3A 4D25A 1RPZA 2WWWA 1DPFA 1G4AE 3BXZA 1JR3E 1GWNA 4LHVA 4PAQA 5L3VA 3GJ4A 1Z22A 4OQNA 1Z8FA 4P32A 2O52A 2EFCB 4WZAE 4QGGA 3EWAA 4V0KA 5CDFA 3K0AB 4ERNA 2GVZC 3QPVA 4F4CA 1IY2A 3QJYA 1YR6A 1W47A 4YONB 3AF2A 4DSNA 3AKEA 1CJMA 5LD2C 4HLQB 2ZXUA 3ZS8A 4HB3A 1E2EA 4WVFA 5KO2A 2VTKA 5TY0A 3U61B 4M1YA 3A6PC 1FZQA 1CTQA 1VKJA 4W5WA 1IN8A 1NF3A 5FR1A 4BFWA 1SKYE 2QRNA 3SOPA 2AKYA 2RH5A 5JMTA 4TLDA 4TWZA 4XVQA 2QMEA 2JLYA 4BLSA 3ND9A 1Q1ZA 5G41A 3FB4A 2RKOA 4ZCIA 1Z08A 2FG5A 1KJYA 1WCV1 5EUQB 221PA 1ZC3A 2WJJA 1BS1A 1ODFA 2BMDA 4UNNA 4RD0A 5JWOA 3RWOA 1CIPA 2J0VA 2IC5A 1JQJC 2ZQ5A 1N3BA 5B57C 1VCNA 2HT6A 1H8ED 4EUNA 1Q0UA 3SN6A 2IS4A 4JKYA 1M1YE 1N6HA 2CBZA 2Q9CA 2WWIA 3SDZA 1W4RA 1FX0B 4QNMA 3BAFA 3PXGA 1KZ7B 1W44A 3ZDQA 5C2JB 3AF3A 4BGDA 1PLLA 2Y8EA 1JR6A 1KK0A 1QHHB 3A1SA 2PT5A 1FP7A 4D4LA 3LA6A 3QEJA 4KVGA 1HUQA 4IJMA 4XWAA 1S0UA 1YZNA 4QRHA 3CZPA 1AJEA 1E2FA 4GRAA 4JBXA 2VP2A 3X1DA 4D81A 3BFXA 1GTVA 4I99A 2QRZA 1FFHA 4ZV4A 5AUPB 1D9ZA 4JL8A 1WP9A 1Z0DA 1LFDB 5CB6A 3QG1A 4YMSA 1BKDR 1QVAA 3I8XA 4LV8B 1G3IA 3T1QA 5HE9A 2NZJA 1MT0A 3I32A 5FI1B 1KOFA 3GJXC 4DCNA 1BYUA 1K6MA 1KSGA 1IN5A 1Z06A 3B1WA 3T1TA 4AKGA 4AC9A 3NDPA 2C9YA 1TAGA 4D80A 1G19A 1VYTA 1Y63A 4LJYA 3BC1A 2P6UA 2HCJB 1CP2A 1Q20A 2RB4A 2QM8A 1J99A 1F3OA 3G5UA 4EQ6A 1EFUA 4QOSA 4WIAA 1G20E 3SU8A 3OE7D 2QTHA 1KMQA 4Q19A 2OFWA 1E4VA 1U2RA 2V8OA 2ZTSA 1SHZA 4EPVA 4QGFA 3SZRA 2MSEB 2MSDB 1Z0JA 2JJ1D 2PLFA 2VEDA 4M1TA 1CR0A 5DE3A 1US8A 1W4BA 1KI7A 3EZ6A 2PCLA 2ZVQX 2QL6A 1E9CA 5CLLA 2AFIE 2FDCA 1QHGA 3C16C 2VHCA 3KL4A 1KDOA 2HXYA 2J3EA 1OV4A 3K0EA 4ASUD 4AK9A 2GZHA 4JMPA 2JIZD 4Q4JB 4GT1A 3TJZA 5ELXA 4NTZA 4YDSA 2A30A 4C0BA 4X8HA 3PVSA 2OCAA 4LC1A 5JI2E 2LKCA 2AD5A 2WJGA 1SXJD 1GNQA 4Q7KA 3LX8A 4MYTA 5EE5B 2IYVA 2ZRPA 5LD2B 3VU9B 1JAHA 1CJUC 3G0HA 3MJHA 1D8TA 3I4LA 2BCGY 3LQRA 2O0JA 4DLXA 1XF9A 3GLFE 3OEHA 5BQ5A 2QG6A 2EFDB 1H8HA 4DEXA 4YMVA 4DWJA 1U94A 2DR3A 1NJFA 5H1YA 1SVLA 2ZSFA 1NMXA 4LHXA 1GRNA 3KKNA 1FX0A 2OCPA 2WOOA 2X2EA 3U7FB 1XMIA 1Q3HA 2FE4A 2FOLA 5HKKA 4P0TA 2W00A 3AUYA 2VPPA 4V0OA 3UKDA 1XXHB 1GL9B 2JLWA 1XCMA 1ELOA 4Q01A 3THWB 2OE2A 1KO5A 2D3WA 2GXUA 5BN3A 3NBFA 1DAFA 3THYB 1Q44A 2V7QA 2FA9A 3AH8A 3K70D 2ZRHA 2G1KA 2OBLA 3ASZA 4JT2A 4LYJA 2FMXA 3W8RA 1CLUA 2YV5A 4GFDA 4TYNA 1LY1A 1X8JA 4II7A 1RZ3A 2IEYA 2F7SA 1II8A 2O8BA 1TU4A 4B3XA 2MMGA 1Z0AA 1S9DA 2AFHE 1N6LA 3AEZA 5B64A 1E9RA 1BO6A 3CZQA 5J4KA 2ZRLA 3MUFA 3V9PA 3CX8A 4PPQA 3SJBA 1M34E 1NBMD 3RYTC 4BFZA 1Z6YA 1A4RA 2CJWA 1TADA 3BH6A 2HLDA 1ZIOA 3TK1A 4GOKA 2V3CC 2N1BA 3X1WA 1JECA 1OXVA 5FBWB 4LJAA 1JXMA 2VHUA 1EX6A 2CK3D 1AGPA 2R44A 1UKZA 3NEJA 5JWHA 4HB2A 3U3KA 4C0AC 1G5PA 1E0SA 4KITB 3T06B 3Q8XB 2V6IA 2GRJA 3QKRA 4HZUB 4Q03A 3GPLA 4XSGA 2MSCB 2GCOA 1UAAA 3VHXA 5BWMA 3SR0A 4KU4A 1XTKA 4AURA 2WJVA 5AUQA 2HF8A 3GLHE 5IT5A 1U8YA 3NHAA 3CNNA 4NBSA 4B48A 2QBYA 4TQ9A 2YHSA 3LLUA 1RJ9A 4Y0VA 1SVKA 1N6IA 1KKMA 3TKLA 1N5KA 2IYZA 5L8VA 5EE1A 1RE0A 1WBBA 2A9KA 1Z3IX 4PSVA 1E2IA 3BK7A 2PCJA 2CJWB 3UANA 1M6NA 5K8LA 3EPJA 4JKIA 1JEDA 2QMHA 2REXB 2ZEJA 4NYMQ 4DDTA 3AVXA 1NVVQ 2RGNC 1TTTA 2J46A 5TMPA 3REGA 4M4SA 1KZGB 1ZU5A 1QDEA 2ATXA 1R10A 5LB2A 4TSFD 3AP2A 4K8OA 1MV5A 1G6OA 2V54A 3K0CA 1KIMA 1T3LA 4DDWA 1F2UB 3H4MA 4D0LB 1X8LA 5BXQC 2IF0A 2NQ2C 2Z6VA 5FBQB 1FP6A 1RYHA 2WPDA 1RFLA 3NC1C 2IA5A 4UJ3A 2GXQA 2DY1A 1EESA 2XGJA 3M4YA 3T1OA 4XVUA 1FMLA 3UWKA 4A8JA 4XD7D 4B47A 3KKPA 1UM8A 4M9XA 2EWWA 1NLFA 2VF7A 3OFNA 1F60A 3BFKA 2ZRBA 4BZQA 121PA 2OO7A 4QGHA 4RZ2A 2EQBA 3SHWA 2AKAB 3EA5A 4KFTA 4Z1MD 4C0SA 1AS3A 1UJ2A 3QUSA 5E95A 2BBWA 5BN4A 2P6NA 1GL7A 4CRWB 1HE8B 5CM8B 2R65A 4B73A 3DKPA 3OESA 4UJ5A 2RMKA 5EJEA 2WIAA 4FN5A 3UPUA 3B1VA 2GDJA 3ZS9A 4US2R 3HPRA 1DADA 1CRQA 3NC0C 1E94E 2PX3A 5P21A 1FOEB 4HAUA 5E7MA 5FOTA 3HPQA 4E22A 4XSHA 3K0SA 1OXSC 1B0UA 4IFEA 2P65A 3CPJB 1ONBA 1KO4A 4RY2A 3LW7A 2V1UA 1T3HA 1L7VC 4TL8A 2GNOA 1GL6A 1XWIA 5JHGB 3K70B 3HP1A 2BBOA 4L5BA 2NIPA 4HZUA 1KJWA 3OIUA 2JLUA 1AS0A 1DTSA 2O5VA 1VG9B 2Z4SA 4U5XA 4DLWA 1E2LA 2FWRA 5DI9A 2G9NA 2XNDD 1U9IA 2Z5FA 3VHLB 1J7KA 3R9IA 3OF5A 3H84A 1NJGA 2IK8A 3OIYA 4ASUA 1GVNB 1NVUQ 4ZDIA 3GLFB 4CEIB 3LVRE 2D2FA 3K9LA 4LK2A 3C15C 2GJ8A 2JLSA 2ZRFA 3BE4A 3QF4B 4FCWA 4RD4A 4Q21A 2FEOA 3GLGB 1FL9A 3RRZA 3MG9A 5AUNB 3IQXA 2CE2X 4Q48A 5G3YA 4LPKA 3ND8A 4PZLA 3CPHA 1M8PA 1QG4A 2J87A 4M9QA 3KKOA 3CNLA 1M74A 3PUXA 3CX6A 4EPXA 5JLJA 1J90A 2XSZD 3ZVLA 4DDVA 2O8FA 2ZJBA 3EAQA 3BH0A 3SQXA 1JXOA 2QZ4A 4DLVA 4BQSA 2ZJYA 4JLOA 1QF9A 3THXB 4NYMR 4LV5B 5FUXA 3O8CA 1JI0A 1UF9A 2OAP1 3CH4B 3DEFA 5CDFE 1N6NA 1OFUX 3VR6A 3TGPA 2DWOA 4B74A 3AKCA 3Q3JB 3ETLA 1KAOA 1T5LA 1U0JA 1XPUA 1W5TA 3EWSA 4PC2A 4POAA 4R71A 1GRQA 4UNPA 2ZRKA 5C46F 1E1RD 1SXJC 1XCGB 2QN6A 2KBFA 2ZR0A 5CJPA 4EPRA 4UKDA 2YYZA 2AK3A 1F2TB 3EZ9A 4PPNA 1GKUB 4A6XA 3CKLA 2FH5B 3AKDA 3H86A 4NYIR 4C0QC 4V02A 4OI1A 1KI8A 3HDTA 4MKHA 3IO5A 3SE0A 3UATA 1G18A 2CDNA 3KXLA 4CZ2A 4DB2A 2EFHB 2O8CA 2ONKA 1ZMXA 1A2KC 1P60A 1XJ0A 2FPLA 2OILA 3QVUA 4N0EA 3TH5A 4QJ3A 4CW7A 2IYTA 3R7WA 3BH7A 3IQWA 2I1QA 4IOJA 1OYWA 2NG1A 1U8ZA 3GCGA 1SVSA 3FPAA 4AKEA 1W2GA 4Z1MA 4M9SA 4HUQA 1XZQA 1CR4A 1ZM9A 1ANKA 3K9GA 1JPJA 4MKFA 4OBEA 1Z0KA 5AUOB 4B2IA 3QPWA 4FMCB 5JEDA 1QHIA 2BOVA 4R9UC 4A2WA 4Z51A 3EPKA 1C4OA 3P4XA 4Q9HA 4C9BA 4B3GA 1ZC4A 4PQRA 2W2TA 3KQNA 1QZXA 4EIWA 4Q5IA 3N2EA 1NN5A 4LCBA 4PC3A 1E2HA 2AK2A 1EXMA 1KAGA 3CR8A 3W34A 1P73A 1P61B 2ZSDA 1CF4A 1MRNA 4Q9JA 4CGZA 3JZMA 4BFSA 4R98A 1V43A 1S9HA 4M9ZA 3RRNA 3THOA 1T5IA 4XIGS 1P7CA 4LY6A 4U00A 1D2MA 1OH5A 3UG6A 2EU8A 1VPLA 2FV8A 3WHKA 2AD1A 3QY0A 2C9CA 3FKSA 3T34A 2CXXA 2KE5A 1KI4A 1SVMA 5TXGA 5EE9A 4TTQA 1Z47A 4KHZA 1U8AA 2ZJOA 3L8YA 4M2LA 3KQKA 3WHLA 1OKKA 4HAWA 3A1TA 1ZRHA 1ZW6A 2GCNA 1XMJA 2J7PD 2WWXA 1DG1G 3HR7A 1VG1A 2QP3A 1WF3A 3FKSD 1G4UR 3GJ6A 4Q66C 5FI0B 3VNUA 4LYHA 5KNDA 3EX7C 2JLVA 1KSFX 2WHXA 4TYPA 2OCBA 4N3NA 1JJVA 2J7KA 1BYIA 4X8OA 3K8YA 1NKTA 4GBMA 1NG1A 3P4YA 2K5UA 4URXR 5JSZA 5JI3E 2HJVA 3EW9A 3RS2A 2CCGA 5TB5A 3BB1A 3C5HA 1W0JA 1IN7A 4HEJA 4TMKA 2J45A 2P3SA 4QM6A 4FCVA 1R0WA 1XJQA 3DVLA 4BZXA 4B3DA 2O8EB 3I8SA 3AVVA 3QXXA 3FGNA 1W5SA 3UK6A 3QKUA 4BEJA 4MH0R 4I1OA 1TU3A 3IUYA 1HURA 2ZI6A 4AI6A 2Z0MA 2E87A 2CK3A 2GZAA 1IN4A 1HV8A 2JATA 1YR8A 1YZUA 1F2TA 4Q7MB 5C4GB 2YWFA 2CMKA 3Q7QA 4JT4A 4R7ZA 2GTPA 1PUIA 2XTMA 1OE0A 4D6PA 3ECCA 2IYQA 2CHGA 2RGAA 5K8TA 2ZE5A 2QAGC 3ZVMA 4TN1A 4F38A 5J4VA 2BMEA 2JA1A 1R5BA 4GP6A 1HE1C 1J2JA 1KHTA 4P31A 4LJ4A 5JSZB 4L9WA 3K70C 4IDQA 3NEYA 2F1JA 5J47A 2FFBA 2F1HA 1WB9A 4BPBA 2XITA 3WYAA 4CT4B 3EARA 5FOXA 2BM1A 1XP8A 4Q4JA 3X1YA 4ZI2A 4X8LA 2D62A 4ZCLA 1WXQA 2QT1A 1JNYA 4DHEA 2DBYA 3SJCA 4JJKA 4UXJA 5B58C 2N46A 4LI0A 1GP2A 4IKEA 3RAPR 2V4ZA 4NDZA 4QC2A 5CB8A 4BASA 5J4YA 1S4QA 4A2QA 1KK2A 1NLYA 1VCIA 1F48A 4JYCA 3MWJA 3R7WB 2AXNA 1SQ5A 4OI0A 3KJIA 2ZS8A 4HUTA 1AIPA 5HCIA 5FL3A 3A37A 1T8UA 4PHTA 2LKDA 2A5FA 1Q1BA 3E2IA 2KBEA 1XEXA 2OHFA 5HKKD 3C14C 1Q12A 4HAXA 1AKEA 2NPFA 1LV7A 1ZD1A 3K09C 4AG6A 3RVBA 2C95A 3RANA 4B2PA 1CRPA 4MITA 4CEHA 4O2RA 3PUYA 3T15A 2WM9B 4JLAA 3RDPA 4CEJB 2W58A 5KTYA 5KOYA 2X19A 5FPHA 2IYUA 4US0R 5BW8A 1DAGA 3TAHA 2YC2C 2C5LA 3OAAA 3FWYA 3TSOA 1C1YA 1G8YA 2JDID 4I4LA 5KNBA 1BMFA 1GIAA 2ZANA 4DLRA 4H1UA 1MO4A 4FIDA 4C0JA 5GVRA 3TMKA 5AJYA 4DJTA 2ZUDA 2ORIA 2OSBA 2L0XA 2CNWA 2XJ4A 2ZS9A 5FPTA 3U44A 1G41A 3W5JA 3CB4A 1OYYA 2JIZA 3P26A 1IBRA 2ZJ2A 1CR1A 2QPOA 1MABA 2CNWD 2IEZA 1OXXK 2OBMA 3AP3A 2RGBA 3L8ZA 3ZZ0A 5H8WA 1ZNXA 2FPMA 3U60B 1YHNA 1WA5A 1NIPA 1XBTA 1AQUA 2XB4A 3FHCB 2BC9A 4C3ZA 3FHOA 4NCHA 4FMBB 3OZXA 4TMTA 4KODA 1M7HA 3ZD7A 1KY3A 2ZS7A 2VSXA 2PEYA 3OEED 2YWGA 5KU1A 4Q4HA 5AWFC 4C30A 2PBRA 3T5DA 2X2FA 4AKHA 1P2TA 1E9FA 1QHYA 5DHAA 3K1JA 2D74A 2B8TA 1G8HA 3BB3A 3K0CC 4B34A 2IHBA 2GJ9A 3IIMA 3EZ2A 4JLPA 1NVVR 3HYTA 3TVTA 3SYLA 4TL9A 3VR5A 4JIMA 1O87A 4JVMA 3TNFA 4DLZA 5C18A 1SVWA 3KKMA 2BM0A 1NRJB 2AN9A 3IO3A 1DE0A 5L3QB 2G77B 1G21E 1QBKC 3MGCA 4RVCA 4C0LA 1E0KA 2DPXA 1B23P 2VLIA 5JJLA 4PANA 3GLIB 5DYGA 4B76A 3KQHA 3GQBA 3RS0A 3ASYA 1KMHB 3FFAA 1VYUA 1JR3D 1UBGA 1XEFA 4B35A 1ZD9A 2RCNA 3RABA 3SI7A 4QJ5A 2EVWX 4O3MA 4NCIA 1R0XA 2YJTD 3DDCA 4V0LA 3AF0A 3N5CA 3TW8B 2ZRIA 3MSXA 3UMRA 1AZTA 2EYUA 2BJVA 4V0NA 1IN6A 2GA8A 3QIAA 5DLQC 4TLAA 4EFMA 4BLRA 4M1KA 4Q4LA 1XTQA 2I3BA 1S2MA 4C4PA 5J4HA 1D5CA 1HA3A 5AR1A 1KSJA 4JL6A 2GCPA 2AWOA 3GEEA 3ADDA 2H1LA 3L0OA 3WMGA 2QY9A 1FPMA 4ZIRA 5G53C 2IYSA 4LBVA 3ZH9B 2ZRCA 3MMPA 2VHQA 4M1OA 1G16A 2D7CA 4QBHA 5CM9C 3ZVNA 4EFLA 3H0KA 4WXRA 5KHOC 3EZFA 1YZKA 1KDPA 4JLDA 2OXCA 2FZLA 2OEPA 1E2QA 3DMDA 2ZM5A 5KYKA 5F3WB 5CK5A 1VHTA 1XTJA 4TLBA 3W9YA 3P32A 2FSFA 2H18A 2J9RA 4RSGA 1P5ZB 3MRSA 2D2EA 1CS4C 1X6VA 3DL0A 4OK3A 2FFHA 2YC4C 5FUVA 2W6IA 4PO9A 2Q3MA 2IS2A 1QHHA 2WBLC 3CRMA 4Z8YA 1N25A 3L0SA 3QG5A 4EFNA 2Z4RA 3PG5A 4P4TA 2O0HA 2BKEA 2J0UB 3K0FA 3SYKA 1VMAA 4PPGA 2ZSBA 4QJ4A 2AX4A 3OIWA 3MJRA 2C8VA 3EC1A 3LXRA 4O25A 5FTKA 1S3GA 3DOFA 2J7PA 4KV9A 2W83A 4ZDWA 2VA8A 1FQJA 2IUTA 4LHZA 1ZYUA 4JLBA 1L2TA 5DNYB 2W2XA 5GJVC 1KK3A 2ZJZA 4JS0A 1HH4A 2A5JA 1HT1E 4NPHA 4G5GA 4TMVA 3TVDA 4KJZA 2GZDA 2LCFA 1HTWA 3PUWA 5E3HA 3RHFA 2C77A 2ZVPX 2FEMA 3WYFA 4YXWD 1F5NA 5G3ZA 4Q1AA 2ZITA 4OI2A 1FUUA 3NBYC 1SULA 2OCYC 3KXKA 2F3TA 5E7IA 2VQSA 4OHXA 521PA 2IXEA 1XJCA 4HATA 1QVRA 4KFSA 3GLIE 2QMUA 1T0JB 3NTUA 1E9BA 4DUGA 2CEAA 4D0GA 1WMSA 2ATVA 2A2ZA 2F3RA 4PC7A 3V4RA 1ZCAA 4FW9A 3F5FA 4LPSA 5TDHA 3A8TA 4MGKR 4A8JC 2R2AA 2IWRA 4EQ6B 2VP4A 1NN1A 1II8B 4LV6A 5FOSA 3G82C 4NCJA 2W0SA 1XD2B 2BJWA 4DVGA 3DMNA 1E99A 1XTSA 5KPDA 3EPLA 3GLHA 1GM5A 1M7GA 3CX7A 1TX4B 2QMOA 1E1QA 3WNBA 3OEEA 1N5JA 2WMOB 1GFIA 1SGWA 3S1AA 1UBEA 2WTUA 3Q5DA 5FOVA 4JL5A 3AVTA 1SXJE 2JJ8A 4TMWA 3RLFA 3PEWA 4KFRA 2H92A 1JAIA 1MO5A 3HYRA 4FCTA 2C96A 2R6DA 1AGRA 1T0HB 3GP8A 1NG9A 1ZP6A 2PH1A 4DSTA 3FHTA 2JJ2A 4PZYA 4DT1A 2FFQA 3E1SA 3PUVA 1KI9A 2GKSA 4MDEA 2I4IA 2ZSEA 1EFTA 1FTNA 4QHYA 1KJZA 2QTFA 4JJZA 4C0HA 2JEOA 3W6PA 1G8GA 2HF9A 3NXSA 4HYYA 5JRZA 1Z2AA 2BCJQ 2ODNA 4JSTA 1IHUA 5LPNA 2VHJA 4QHSA 1QHNA 1RW4A 2WZQA 1UDXA 3MD0A 4PO1A 4Q47A 2JDIA 3GJ8A 1P3JA 3NHBA 4Q1EA 3LBHA 3OAAD 1ZIPA 5HZKA 3CONA 3KFVA 4TT3D 3X2SA 5IK2D 1XX6A 2DFNA 1YZQA 3CBQA 3PENA 2D06A 3V00A 4CIDA 4JBYA 1X3SA 4HLDA 2OAQ1 1DAMA 1NLZA 3BORA 4XWKA 2X77A 4PO8A 4XOIA 2BBSA 2C03A 1R0ZA 5D3QA 3SFVA 1OLOA 4D4JA 3KDSE 3FTQA 1PZNA 1OFTA 2EW1A 3M1IA 4BLTA 4OL0A 3KKQA 3VR1A 3W3ZB 4BWYA 1W7AA 2D7DA 1E0JA 1ZUNB 1HQYE 3HU2A 2EYQA 1ZNWA 2GWHA 1U90A 4Q9KA 4DSOA 2FN4A 4B43A 4WZ6A 1KI6B 5DI3A 1PVOA 1CEEA 3CF6R 4W7SA 3MWYW 4OHZA 3LBNA 5AK0A 3I92A 3KB2A 4MGZR 3U7HB 2Q3HA 3T35A 4KAXA 4ABYA 3KQUA 3B85A 421PA 2XOKD 2WOJA 1XPRA 2KB0A 5IF9A 3O8RA 3U44B 4AYTA 5JZVA 4E07A 2G83A 2OG2A 4NKRA 4Q1FA 1EFHA 3CR7A 4ACBA 2XB2A 1MABB 2O8BB 4IOLA 1BIFA 2QBYB 2IL1A 5FR2A 3ZQJA 3SC3A 4QKQA 3EC2A 4NZYA 2YINC 1N0WA 5BN5A 1D6JA 1Q1EA 1SHKA 3T1VA 3DM5A 4RD1A 5KPJA 2ZYTX 3IGFA 1A82A 3AVQA 4LHWA 4B2LA 5FUWA 2NOAA 3JVUA 3O47A 4U7DA 5GVSA 1I2MA 1W46A 2WWHA 2GXSA 4BEBA 4LYFA 1NBME 2XZPA 1LW7A 4G5QA 3IHWA 2GCOB 4HB0A 2B21A 4ITRC 5HCNA 1I4DD 2F43B 4FWIB 2FZ4A 4MYHA 2GF9A 3THXA 3L0PA 3BGWA 4QFMA 4BZPA 4RZ3A 2XZLA 4MRRA 3ZZTA 4PZZA 1XD2A 2IS6A 3LW8A 3TIFA 2B8WA 3EPHA 2ZROA 1LB1B 2HUPA 3EIQA 4OHYA 1T8TA 2GAAA 2CE7A 2OFXA 1TL7C 3TLXA 2H7VA 2GJAA 2GILA 2ZI7A 3KUDA 5H70A 4HUQB 5TVKA 1N5IA 6Q21A 721PA 1PLJA 1X8KA 4Q4AB 2JLQA 2QGZA 3W5IA 3WXMA 4IRUB 1M7BA 1KI6A 5DI3B 4LJ5A 1R7RA 4NE2A 2WSSD 2UVQA 3B5JA 2BHRA 3CPEA 4HAYA 4DEYA 1UADA 3QXCA 4JLNA 1OPXA 2ZRJA 1OF1A 1T91A 3FYHA 1I4TD 4MGYR 4AWXA 1LTQA 3U6KA 2A78A 4WBSA 2VRWA 4BE7B 2GETA 2V9PA 3AM1A 4URZR 2N42A 1GNRA 5DN6D 3SFZA 4B3CA 1G8PA 4IVQA 1G7TA 4OHVA 1N6RA 5CYPA 3U4QA 2HYDA 4C2TA 4HDOB 1KKLA 1VECA 1XRJA 4LX0A 1OB5A 3VX4A 4PHHA 3TW4A 2IW3A 1KO8A 1KTVA 4W5JA 1N0UA 2ZPTX 3KUCA 4HLUC 2CL0X 5JECA 1GOTA 2DB3A 2QQ0A 4N1AA 1IJFA 3P20A 2W0MA 4DKXA 1KY2A 1XFAA 4KBGA 4JSYA 4A8JB 3GFOA 2DFLA 2R6AA 3TR0A 1G3RA 4GZMA 2G88A 4UXHA 3J81k 5C4MA 2YOFA 1Z29A 5CIWA 4GL2A 2GAOA 3C8UA 4G5RA 1YR7A 3LBIA 5CK4A 1EG7A 1VIYA 4DCVA 1SXJB 1TMKA 4A0GA 3VR2A 2REBA 1G3QA 3L2OB 3SYNA 1YJ5A 3DPUA 4YLGA 2H5EA 2VHTA 4IOMA 1SVOA 4U02A 4PQYA 4PFSA 2NMVA 3EG5A 2ORWA 2Q21A 5L3QA 4AG5A 2CHVA 2GHIA 1OFIA 3RC3A 5FFMA 1AA9A 2QAGA 2P5TB 4C7OA 5GADl 1EFRA 4ARZB 1E9EA 4MA4A 3RC8A 2IYWA 1LF0A 1E4YA 1P2VA 5SZKB 2G1JA 3LFUA 4GPTA 4RKEA 3IEVA 5KSZA 2NZ8A 1G1MA 3QXSA 2XXAB 3D7MA 3QEOA 2V7QD 3FMIA 5JFGA 1WDTA 1Q3TA 3F0TA 1Z6GA 2YNMA 2F9LA 3UMSA 3X1XA 4LUCA 2AXPA 3PCRB 1X86B 1Q22A 1OHHD 4KLNA 1DS6A 1TQ6A 1D9XA 2UZIR 4JLJA 4TMZA 3RWMB 2PMDA 4B3FX 2VBCA 1R0YA 3MFYA 4IDNA 1CR2A 3FMPB 3BS4A 2QUZA 3SEAA 4A2PA 3LV8A 1TEVA 1I4LD 1R2QA 4B6EA 2RHMA 5SZIA 5K8IA 4L8GA 4LOAA 5L3SA 2ECKA 1XDBA 1NMZA 3E70C 4QHTA 2IHYA 2IYLD 2XSZA 4I1UA 1D2EA 5L3RA 2RGCA 3AVOA 1E2MA 2QAGB 5KNCA 1OH8A 4EKDA 4C7OB 1YVDA 4D4MA 2E9SA 3KX2A 1YU9A 3OIVA 1NKSA 4TZ0A 2NO7A 3LO5A 4OK6A 2NO1A 3CUEF 1E9DA 3R8CA 4NL4H 3I62A 5JBQA 1T6NA 4NCKA 5AJXA 1XTRA 1SXJA 3VX3A 2CLSA 2XEXA 4IEEA 5FBLB 2PJZA 2PZGA 1O3YA 5D3MB 5EQTA 4BUJA 2C99A 2GF0A 4A4DA 5EE0A 1W2HA 3CNOA 4OHWA 5DYIA 1ZBDA 1HEIA 1P62B 2H17A 3AKYA 3CIOA 4Q1DA 2G3YA 1WBDA 3HJNA 3ZIAA 1BMFD 5K8UA 2EFEB 2IUSA 3QXJA 3WRYC 4OYHA 3K0AA 5AJVB 2ORVA 4RCYA 5A0FA 2QP9X 3TR5A 2JJ1A 3C5CA 4D4KA 4AYXA 1UPTA 1NSFA 4URWR 3U6BA 3CRVA 3GLGE 4IHQA 1UKEA 1E1QD 3IIKA 1UEIA 3TSWA 3AVUA 5DIFA 2Q6TA 1D2NA 2ZE6A 4TTPA 2D4HA 3WNDA 4DT1B 5IHPA 1PUJA 3MLEA 4NYJR 2BKUA 5EP1A 4DB4A 2HJGA 4FMDF 4TMXA 2H57A 1NIJA 1TF7A 2YWHA 4TYWA 1J8MF 2J41A 1T9HA 1I2DA 4KO8A 3WP1B 1SKQA 4DLSA 3PIRA 3CWQA 4TLCA 2ZAMA 1Z63A 5DHFA 4MYUA 1E2GA 5DISB 1ZD8A 4RFSA 4DUGD 4ZDKA 1AK2A 4LBYA 2NGRA 2ZU6A 3AQ4A 3FE2A 1MKYA 1CU1A 2BMFA 2QTVB 1X1RA 1V5WA 3K0FB 1TQ2A 5KSOA 1G7RA 3IIJA 3SBDA 3WYGA 2CL7X 4K81B 3QOFA 4CEJA 3EA0A 4JLKA 4Q9LA 3M0EA 1IM2A 2IX3A 1EFRD 1YRBA 3B9PA 2JLXA 1R8QA 2PZFA 2RGXA 4PHFA 3W3AA 4DCUA 1GNPA 5FPSA 2ZRNA 4EJSB 1NY6A 2IXFA 2VH5R 1ZU4A 2B7CA 3QBVA 3W8NA 1RVDA 4ARZA 5BYJA 1OIWA 4MUAA 1E2KA 3UG7A 3A36A 4ZCMA 4M53A 4URUR 1U0HC 3ZVRA 4NMMA 4ESHA 1VG8A 3GLIA 2UKDA 4ZPXA 4B6FA 1UBFA 4XTCS 1UBCA 2XAUA 2QPTA 3AF4A 4TYQA 1IQPA 4CDGA 2F9MA 3AUXA 2BIFA 2MMCA 4Z54A 4KXFB 4G5OA 4L15A 2P67A 1AM4D 3B82A 2J0SA 2QEQA 4QNRA 4RZUA 2UZ3A 5EP4A 3X1ZA 2G0TA 1P6XA 1DAHA 2JCSA 4IDPA 1Z5ZA 4HB4A 4LBZA 2IYYA 1MRSA 1P4SA 4IEIA 3SBEA 1KO7A 4PTLA 1XD8A 1N5LA 2ZRDA 3VQTA 3U7EB 1ESNA 3GMTA 4DC9A 3U3RA 5JCPA 2OESA 5FL7D 2VP0A 3A4LA 3B1XA 1Q1QA 3PUZA 2BBTA 3UMFA 1CULC 4ESVA 3IBGA 3NIBA 4A82A 1Z2CA 2GJKA 1GZSA 1G6HA 2OFOA 2QAJA 4H9GA 4MKGA 4A0RA 1YZTA 4WAUA 1HT2E 3S1AB 2W6JD 4GMXA 2C78A 1JJ7A 2WSSA 4WXPA 2HLDD 4UNQA 2NTYC 1P9RA 4XVRA 4PPFA 1NBMA 1OT3A 1W4AA 3A58B 2QSZA 4UXIA 3NVAA 5J40A 1DBSA 4TL7A 3B13B 3CRQA 4MKIA 5KSYA 4DBLC 5LDDC 3AF1A 3PR1A 3QBTA 3TUZC 4QBFA 2YWEA 5F9FA 1OXUA 1G3UA 2IYXA 4X8MA 4A15A 4AYWA 4RFSB 2VO1A 3TE6A 1S3SA 5E4FA 1EFCA 3D6TB 3PFIA 1JALA 3NBXX 4AY2A 2I1VB 4MUBA 1TPZA 5JJKA 5EP2A 2R8RA 4S2EA 2CHQA 4DDUA 2A5YB 5EUMA 2IBMA 1PV4A 2ZYVX 1DELA 3R8FA 5CYOA 1VTKA 1S1MA 2ZI9A 2ZUCA 2R62A 3QXHA 3DZDA 4BFUA 4S35A 2WWYA 1JB1A 2FSHA 5TARA 4IOKA 2O8FB 3MWKA 1KNXA 2OUKA 3CH5A 1WQ1R 3KZ1E 4FMDB 4IXMA 2J0UA 5F9HA 1ESMA 2X8AA 4QM7A 4LBWA 5SZJA 1DG3A 4ON9A 3NBZC 1E2JA 1Z83A 2PMKA 2DFKB 2ZR7A 4JBWA 1H8HD 5EXPA 2ZI4A 3B9QA 4ZO4A 1F6BA 2QA5A 1AQYA 4F7WA 4GZLA 1FNNA 4KVAA 1E9SA 2B6HA 3GFPA 2P5SA 3PV0A 4QXAA 1OH7A 4RFVA 4KFUA 2ZJ5A 2QQEA 3GEHA 5FH9A 3T12A 4NONA 1XEWY 2ZE7A 3AGQA 2DCUA 4Q9IA 1R4AA 3SS8A 3ZIAD 2WVJA 2FFAA 1ZNZA 4ZKDA 2F1IA 1UFQA 3LQQA 3ZQ6A 2SHKA 4UNRA 1UDWA 4TQUS 1KI2A 1NSTA 4M1SA 4A0HA 4HLCA 3U3OA 2WWFA 1LVGA 1COWD 3U5ZB 2IYRA 5FOUA 4XJXA 4IDHA 4R2IA 1IXZA 1XMSA 4OQLA 2CLCX 5FBRB 5JRJA 3I73A 4HZIA 1VHLA 1HQCA 2B7BA 3T5GA 4IW3B 2VSFA 3PEUA 3B6EA 1BH2A 4W5HA 3BJIC 4LJ6A 3ADBA 3SJZA 1TQDA 5M04A 1Z6XA 3DKVA 4I81A 1E69A 2A7QA 4TQAA 5FBVB 3AVYA 2FSGA 3E5HA 3ZYCA 3TQFA 2FX3A 4YC7A 4E09A 2FGJA 2JLRA 1WE2A 3DM9B 3OE7A 4QL3A 4Q4HB 3REFA 1OW3B 1ZCBA 1KMHA 4ZKEA 1GILA 1XPOA 1NN0A 2G0NA 3LH5A 2ZAOA 3KTAB 4Q1CA 2XZOA 5JS7A 3VR3A 4OJKA 1TF5A 4NH0A 4FWTA 1E2PA 4YMUA 1IONA 3EIHA 4QBGB 1COWA 1VYVA 5EXSA 3OHMA 4ACAA 3L0IB 3VR4A 1JPNA 3R9WA 1KNQA 3CF2A 1SVIA 2VP9A 2OXRA 3FFBA 3QKSA 1W49A 3RS3A 1R8SA 2ZIAA 4HLUA 4PAMA 1KGDA 1ZJ6A 4BLOA 3F3YA 3NKVA 2HT1A 2ERYA 2RAPA 2FJUA 2FNAA 2VIIA 3LXXA 4L9SA 2VP5A 2YVUA 4PAOA 5JHHB 4MRNA 2ZI5A 2OV2A 1IXSB 3T61A 3KJHA 3ICEA 2AHOA 4DXAA 1E96A 2OBNA 2QE7D 1W36B 1TEXA 1VG0B 3QSYA 5EXTA 4QBIA 2WSMA 2VL7A 1E2NA 1UKVY 4F4IA 1E32A 3GLFA 4CEIA 1E6CA 4Y0AA 1U9IC 3QPUA 3I5YA 2RGNA 1BOFA 1G8FA 3I72A 3BBPA 1ZNYA 3EXAA 1L4YA 4G3XA 4NYIQ 4Q7LA 4ZIRB 3R9XA 3U3MA 4B32A 4OQMA 2AR7A 1M2OB 4CYMA 1YRAA 1H8EA 1N0VC 4I1SA 3IDQA 3GJ7A 3BOSA 2XXAA 3WMEA 1Z28A 4IDOA 1R6BX 1P9NA 3NDBB 2ZYUX 3LLMA 2YKGA 3WRXC 5JJIA 2GK6A 2Q3FA 2ZU0C 2ODBA 5FTNA 4WOPA 4FINA 4F93B 1S96A 1T3SA 4EPWA 5DN6A 4P4UA 2C04A 3RNLA 1E9AA 2OZEA 4DCTA 1OH6A 3THYA 2XJ9A 4TSFA 1EX7A 3IEUA 5FPYA 1GUAA 4A36A 1RRPA 4F91B 1A7JA 3N2IA 1OKKD 2F43A 2W6JA 4LHYA 2DFTA 4MYCA 4TL6A 1KDRA 2QNRA 3CF0A 4E5UA 4EDHA 2GEUA 2CCJA 4CVNA 3FVQA 1TQ4A 1AS2A 2NPIA 3QKRB 2ZE8A 1XTIA 4LSGA 3WY9A 2QM7A 4PQFA 4ZI3A 4IVRA 5FL7A 1GKYA 2CLDX 4N0DA 2RGGA 2O8DB 4TZ6A 1KO1A 3LDAA 1P75A 3CO5A 5EXXA 2W6ID 3KJEA 1L4UA 2VYFA 4FD2A 2GESA 3A1WA 5AJZA 4MDFA 4NU0A 2QSYA 2XTZA 1GAJA 2WAXA 5EZ5A 1OIXA 4P4SB 3A1VA 3RRYA 2ZUBA 2BEKA 4BFYA 3GEIA 2WICA 1W1WA 1TUIA 5DO9A 4IVPA 4KSBA 1K5GA 2QP4A 4TLEA 1RRGA 1KSHA 2DWQA 4LZZA 4OJQA 1MH1A 1KK1A 2V6JA 3GFTA 2HXSA 4OK5A 5CJ2A 1NY5A 2GBLA 4HI0E 2O8CB 3D31A 2OM2A 1GSIA 2GJSA 4LWZA 4URVR 3LWNA 4JVNA 2BVNA 2F6RA 2QPAA 3CWZA 4EAQA 1NVWQ 1XXHA 2IXGA 2PJRA 2VP6A 2R9VA 3CLVA 3LX5A 5DGXA 1LS1A 3ZZUA 2C98A 1P2UA 3W6OA 3THWA 2QE7A 2XOKA 4P33A 1AZSC 1XNJA 4CEHB 4P3YA 4ZDJA 3L82B 3CM0A 3M6AA 2CVFA 4BRUA 1MO3A 3H2YA 1OB2A 1II9A 1T4GA 1Z0FA 2RHDA 3B7GA 4XTRA 1MOZA 1G64A 2ZYWX 3U3JA 621PA 3KB1A 3JZAA 1F2UA 1NL3A 3HR8A 1R5OA 1DAKA 4M1WA 4DIDA 1G7CA 4BECA 3EIEA 4HAZA 5LB4A 3TQCA 4EPTA 2JLZA 1W4CA 1YE8A 4R2HA 3MWLA 3P1JA 4BFVA 3AVPA 3DO6A 2HDNB 4GI7A 2REOA 2ZJAA 3RS5A 3CW2A 3TUIC 1U98A 3HU1A 4LDJA 4FI3C 2Z43A 4KYIB 5LBIA 2QROA 4QG7A 4B75A 1KDTA 1RIFA 2DWPA 4RKFA 1OIVA 3A4NA 1ETUA 1TNDA 1U0LA 3WBJA 3ZD6A 3FDIA 3Q7PA 4RZXA 4Q00A 1IJEA 1W36C 4TT3A 1US8B 1ZM7A 1DAIA 2GXAA 2HCBA 3A1UA 2B92A 3VAAA 5JEEA 2E1RA 4DLYA 1RRCA 4O0MA 4M21A 4UNSA 3TUJC 4AIIA 4PC6A 4C0KA 3PEYA 1TUEA 3N70A 5IDVA 3D3QA 4GOXA 1N6PA 3Q85A 4NHOA 3VKGA 1LF5A 3HU3A 1Q57A 2QGNA 5KUTA 1RKBA 3LVQE 4GNKA 3FMFA 4GMDA 1XU4A 3QENA 2JJ2D 4LJ8A 4V0MA 2ZETA 4YDHB 2QENA 1PJRA 4G01B 2O8EA 1Y3AA 1E3MA 1VIAA 4OQXA 2YOGA 1FW6A 3QF4A 2P0EA 5DH9A 4DLUA 5B30A 2GBLC 2YOHA 4CT5A 1FQKA 2QI9C 3SJAA 3RS7A 1CJVC 5E7JA 3U2QA 3O8BA 4AKIA 3QVVA 1XCPA 1QHSA 3BB4A 1ZVQA 3PITA 1RRFA 3JVVA 1CKEA 2ZRGA 5C1BA 3PEVA 1H65A 4UQOA 4B3BA 4LYAA 3B78A 5J4LA 2CVHA 4ILEA 2PLRA 4LRWA 1P2SA 4H1VA 4OI4A 2ODEA 5J5CA 3TSZA 2G6BA 4KYUA 2WV9A 3ONWA 4D2IA 1XEXB 1OHHA 1W36D 3LAWA 2GEDA 3C4JA 4JYBA 4FMCF 1FUKA 3OFND 3AV0B 4DCSA 2WKRA 3ADCA 1YZLA 1NP6A 4G1UC 2RGDA 2QORA 3ICQB 1PLKA 3NG1A 4OQFA 4RD6A 5CLQA 1N2CE 2FSIA 3WP0A 2R6CA 4K46A 4GSYA 3UIEA 4LGMA 1X1SA 3LD9A 2WMNB 5A5GA 3R20A 2J0QA 4BFTA 2WPDD 4YXWA 1NVXQ 2A3RA 1HYQA 1TF2A 1XZPA 5DSZA 3K53A 1OSNA 3ZJYA 1GG2A 1L8QA 3RRMA 1IAQA 5JWRA 4MRPA 1AN0A 1II0A 4IXNA 4A1FA 2NO9A 5HE8A 4MGIR 3IKJA 1C9KA 2F1RA 1IXRC 1DO0A 1DO2A 1Z6TA 3ADKA 3K9NA 1G9XA 5G40A 2ZRMA 4RD2A 4PXAA 3RSLA 1GRRA 4JLMA 2PZEA 4PR0A 4A6PA 1KI3A 3VKHA 2ZREA 4YMWA 4O2LA 2JGNA 1JQLB 1XEWX 5A4JA 1QHXA 4DLTA 1K5DA 2PT7A 1GKIA 5FPKA 4URYR 5AJWA 3V4FA 1JBKA 1S8FA 2WJHA 1YZGA 2BDTA 5GJWC 4BLPA 4DZZA 1IOZA 3GD7A 4A0FA 3WBKA 3KXIA 4NCNA 3GJ0A 4RD3A 2BWJA 3QKTA 821PA 3L43A 1N6KA 2QT0A 3FKQA 1FMJA 4WW0A 3MAAC 4BLQA 1P9WA 1XB2A 3UXMA 1R5NA 2CL6X 5KDLA 3WNCA 4GDFA 2QU8A 3VFDA 1EWRA 2H16A 3BWDD 2J1LA 3CRW1 2J59A 3MCAA 4HDCA 4KI0A 5KSPA 2F55A 2A5DA 5FUYA 2OT3B 3QI2A 4V03A 3Q72A 2ASEA 4W9MC 2R6FA 4PX9A 4YQFA 1SKYB 3TRFA 4MQBA 2NO0A 1ZAKA 1NNEA 1A5TA 1YR9A 1NMYA 4F4JA 4FXPA 3B2EA 3FMOB 2WIBA 2WWGA 2TMKA 2OLKA 1KI1A 3I1FA 1UKYA 2KI5A 4MRSA 3AVWA 4RCZA 2ONJA 1ZUIA 3IPXA 5GJCA 1W0KA 3GLHB 4JVLA 1RYFA 3VMFA 3Q9LA 1IY0A 2DYKA 4KLZA 3SNHA 4DIEA 5L3SB 3VNVA 2W2VA 3U7GA 1VCOA 1NN3A 4RJLA 1UEJA 4D0NA 1JR3A 5F98A 1DARA 4JLVA 4DSUA 4G5SA 4Q1BA 2IS1A 3K09A 3QNUA 3DZ8A 3UWOA 4IFBA 2R6GA 3H1TA 3A4MA 4P4SA 4PSAA 5IRCD 2CCKA 4M0LA 5KDOA 5F2EA 2EWVA 5EP3A 8OHMA 3IPYA 2P2LA 4F92B 1FNMA 1QRAA 2XTNA 5CIQA 4HDQB 1QG2A 5FOWA 2PX0A 4OKSA 4QGAA 1G3MA 4KSCA 2JASA 2GVDC 3AGPA 1A1VA 1E79A 1FTSA 3BD9A 1MO6A 4MRVA 3FOZA 3O8DA 1EK0A 1P72A 5D3MA 5HZHA 1CJTC 3B60A 3SQWA 4AD8A 4C2UA 2Q0HA 4KBFA 2ZI3A 3AP1A 4Q4AA 5UKDA 1CJKC 4WZBE 3OEHD 3KJGA 1GITA 3GLGA 2HYIC 4NP6A 3B1YA 2C9OA 2RGEA 4GP7A 4BFXA 1YQTA 1N6OA 4D82A 2FF7A 2GK7A 3QQ5A 4J0QA 4A9AA 3BRWD 2WKPA 5JCZA 4G0NA 2BEJA 1LNZA 2O0KA 1E1RA 3C7KA 1W48A 4HSEA 1KYIA 1ZINA 3KFXA 2ZR9A 2V55B 1WRBA 3QE0A 2GEVA 4B71A 3AB3A 3PQCA 4M22A 3W6NA 3GJ3A 1S1CA 4D26A 1DVRA 3NH6A 5BYKA 1A2BA 1G7SA 3BIFA 5HTKA 1SZPA 1Z6AA 1G291 3VTKA 1DEKA 1Z07A 2ZRAA 3WMFA 4EJSA 4LC0A 3DHWC 3LY5A 3VU9A 2LWIA 1EGAA 2A5GA 2VSOA 4NYJQ 3F8TA 2FGKA 1DOAA 3PJRA 4EPYA 3K9HA 4KCGA 5IK2A 4DRZA 3TBKA 5JS8A 2IUUA 1Z0IA 5FTJA 1U99A 2EFGA 2DHRA 2KSQA 2WJIA 3CRRA 3LNCA 4LJ9A 1VDZA 4YMTA 3I5XA 4Q18A 2WKQA 4L16A 4WA7A 3VKWA 3SHFA 3TAUA 1ZM3A 3IBYA
chains in the Genus database with same CATH superfamily
5AJHA 3QU5A 5SYAA 5M3BA 4JZKA 2CNKA 2IU6A 2MINA 3TOXA 3U4HA 2BH9A 1UBNA 1WAMA 2FQWA 2V1XA 2WUVA 2ZTLA 3NWJA 4JVSB 4N01A 4UCQA 5D7NA 1JEEA 1RJ9B 3DAYA 5SZHB 4B44A 4EY7A 1UMBA 2FEWB 3KR0A 4KMSA 4UBLA 4JR1A 1TW2A 3DUFB 4V38A 1Y89A 2ZZNA 1F17A 2IRWA 2IT1A 5KNDH 5KYXA 2A0FA 1YKSA 3ELDA 1EZZA 4TRRA 5ECGC 2EZUA 5A1TA 3FI0A 2WSIA 3BMCA 3OKFA 3LKZA 4M8NE 1G5RA 1DRKA 1E89A 1N8TA 4MVJF 4R54A 2P4HX 1I2ZA 3TB4A 4OJNA 3T1YB 1JQEA 3IDOA 4J16C 4OXRA 5JDCC 5E0OA 4D6XA 2XCQA 3AEYA 4Q02A 4WCFA 4KLRA 4EY6A 3ZLJA 5AHWA 1DIBA 4ZVMA 4BO7A 1XA4A 4MIOA 4PHGA 4JI7B 1OXTA 1XXHE 2AMYA 1AB5A 3JQAD 2AWNA 4CTMA 3I39X 1CUSA 3Q7IA 4H0FA 4B40A 3QELB 4YRIA 5K4HA 3I61A 3LHKA 5CVUA 1Z5UA 1QIKA 3KWJA 3PD0A 1XV5A 5ANRB 3KHSA 3MT7A 3F6YA 2Q9BA 1NMEA 2PV0A 3CEPB 1XD9A 3P27A 4J4TA 2NU8B 1ZMBA 2XWBF 2HX1A 3DOIA 3EZ7A 2LCQA 1NYTA 2F4VB 2J8ZA 1D6NA 2QN3A 3CCBA 3E2PA 2PL1A 4WBNF 5A7FA 3T52A 4GOJA 5B3JC 3TF5A 3PXUA 5EJ8A 1M2OA 4NI5A 1NW7A 1U2DA 5TV2A 5KDDA 2NO6A 3ND7A 1E98A 2QZJA 2VK1A 3QF7A 3W90A 4A92A 4YUWA 2Q5OA 3PYMA 3D8BA 2FPPA 1XVVA 1XTPA 4XD7A 3AYXB 4RK4A 2F17A 3EQ7A 2IWHA 2WWVD 2X7XA 1IY1A 2CB0A 5C8XA 3SVZA 3QFTA 4RVDA 1WCYA 1X2BA 3EZNA 2YZ2A 1DAEA 2EATA 3NLLA 3IAAA 3LQ2A 4URFA 1K8RA 3WZLA 3FR7A 1U7PA 4NULA 3RJMA 5JMPA 2H4YA 3WX0A 4D5GA 3DHEA 1IHXA 2WWWA 2COKA 1G4AE 1CZOA 2X0RA 3BXZA 3MMSA 3SS9X 4EG8A 3FGOA 3ZTWA 1X9IA 1PX0A 3GJ4A 5JXHA 3PI6A 1Z8FA 2JIQA 2OENG 2QM3A 4XCXA 4ERNA 1QE5A 1L5ZA 2JZOA 2GVZC 4ZVTA 5DNCA 1XQ6A 1K4MA 5CEJA 1YR6A 3OQHA 4WXHA 5C5CA 1RZVA 3LF1A 1K97A 2HW8A 3DEKA 2WJAA 1D7AA 1OLSA 1TVMA 1XT6A 2PZJA 3ENVA 4QDOA 3WGLA 3IQHX 2QG4A 4ETMA 3MJFA 1YVPA 4MTCA 2IIPA 2YXNA 4WNCA 4WOCA 4X0EA 4TMFA 4C4ZA 3U61B 2M6KA 1FTQA 4W5WA 1EUCA 4N6OA 3I9LA 3ORFA 5DSTA 1F7UA 3E9CA 4RGYA 4JV5B 2AKYA 1DIRA 4GBGA 2F48A 1HQKA 4TLDA 4TWZA 4XVQA 2IE0A 5CAEB 4DA0A 5BPHA 3H8SA 1Q1ZA 3FYCA 2IIQA 3TEJA 5AOCA 1Z08A 1A2OA 5B7NA 1KJYA 1SC9A 2BEUB 5EUQB 3GA5A 2WJJA 3Q10A 1QVVA 3FCOA 4RK5A 3S4YA 5K0JA 2WYVA 3OFJA 3TL2A 1P2BA 3AFOA 3O2QB 3T1NA 3TD2A 4X5OA 3WADA 3G8CA 4BQFA 3M5DA 5EMNA 4NE7A 3AESA 2Q4EA 4PG7A 5G02A 1M1YE 1N6HA 1W94A 3VH3A 5BR8B 3J81A 2JCYA 4OAOA 1FX0B 1U5AA 3BAFA 3PXGA 1K1EA 4LZPA 1NKVA 1TM7E 1N57A 4BNHA 3ETCA 1V3UA 3H6GA 4BGDA 1N5RA 3O94A 4CM5A 1WEKA 2Y8EA 1NM5A 2PH5A 1QZTA 1XP5A 2QY6A 4Y6GB 1JR6A 2BTOA 1DDIA 2DOKA 3HC7A 2I6TA 5HBRA 3TTWA 2HSGA 2F3SA 3QEJA 1F4LA 4ZQEA 1CEQA 5JXJA 3IH5A 2KYRA 2K7FA 1YDMA 2FMIA 4BX8A 4HFRA 1AJEA 3PKZA 1J97A 2VP2A 1FDUA 1NBEA 1QV7A 1GTVA 2Y27A 2QRZA 2XMQA 3H99A 3UB4A 1FFHA 4UAGA 5A5DA 1U8EA 1D9ZA 2AV6A 1KEVA 2JGDA 5AUPB 1S8AA 1Z0DA 1Z2DA 2OFFA 4EUSA 3QG1A 1QVAA 1Y4AE 1J7JA 1R3UA 1TK3A 2NZJA 3JX9A 4N3GA 4PSCA 4PYKA 5FI1B 4TM7A 4G8BA 4NAUA 1BYUA 3GMDA 1YASA 2XGGA 4YB8A 5LYJA 4UPEA 1OT5A 3NDPA 5E8RA 2WG0A 4P1ZA 3K1ZA 4CV1A 2ECQA 3GFFA 3WIVA 4GYWA 1RDFA 3TTVA 5JXGA 4J1TA 3VNBA 4KN5A 2VNSA 1H2HA 3DS8A 3I05A 2PMFA 1XNRB 2RB4A 3TLJA 2MIIA 4EQ6A 4N12A 5AM3A 2HQBA 3AHHA 4WIAA 5CVDA 3SU8A 1JTFA 4Z2AA 1H94A 4FQ5A 3RD5A 3GAZA 3IAUA 2CJPA 4EPVA 1CYDA 1FNCA 2IHZA 1CW2B 3GCXA 4Y0NA 3P9QA 4YHBA 4EHAA 4DR6B 1H0SA 2OHXA 1Y3CE 3ENZA 2CXPA 1NV9A 3LCRA 1DJMA 1IK4A 3BEOA 1JE1A 2PKRA 3DPSA 4RTLA 1XDUA 1W34A 3HNPA 5DHPA 3MRVA 4UU0A 3ZWBA 4L6CA 3WQSB 3F5QA 2QL6A 1E9CA 2YW9A 3DAHA 1AUOA 1JEJA 1S2GA 2PANA 1DLJA 4TS9A 5JAIA 1OMOA 2WTMA 5AHXA 2HXYA 4G67A 1E5QA 1Z38A 1QF6A 4ZZ1A 3UJHA 4TN5A 1GZHB 2FZEA 5IKEA 3SYMA 2P79A 3TJZA 1G0NA 3W9BA 4Y2HA 4YDSA 1TAQA 1XYYA 2FW8A 5KOJB 1D4OA 1EA7A 3N9IA 2QD2A 2OCAA 4LC1A 2LKCA 2V3VA 2AD5A 5ALEA 2GEJA 3GJSA 1SXJD 1GNQA 1DKNA 5YASA 2ZSHA 4GLOA 1T2UA 4Q7KA 3PCTA 5EE5B 2IYVA 3LDUA 2DUWA 2XE8A 3C2QA 5GONF 1TK2A 3VYRB 2NTEA 4L95C 2BFWA 2PUGA 1OZAA 2BCGY 4MROA 3IR6A 2V97A 1ESZA 5BQ5A 4XX0A 4DEXA 2A1TS 2A67A 1N2OA 4HAOA 4DWJA 2DR3A 1NJFA 5H1YA 1WV0A 4CEHA 2XZDA 2ZSFA 1NMXA 3KKNA 4YUXA 3IESA 3I0NA 1TO1E 4A5SA 2G4VA 2XLBA 3I5AA 1XHEA 4JHXA 1XMIA 4YPVA 4JSRA 1Q6ZA 2ID9A 3CVOA 3EB9A 4JLWA 2P75A 2IPLA 2Q1WA 3LC1O 3PGMA 4L4RA 4RWZA 5C37A 5CB4A 5HKKA 2E4ZA 2Y71A 3LUCA 3OCYA 1I6KA 3AUYA 3GD5A 3KZNA 4GR5A 4V0OA 5A9TA 1PHRA 4NK4A 3SSMA 1TIPA 3WLRA 2VJPA 1YQWA 4BRZA 4HNSA 2UZ1B 1GZ5A 1S7CA 1EFLA 3GGPA 4WH0A 1O97C 2ZUSA 3D5QA 3GFGA 1KVQA 3LBFA 1FLAA 4LECA 4OUDB 3RGWS 4DY6A 4KQ9A 4ZU3A 5J4HA 3WBFA 5LUBA 3L6OO 4N0PA 2ZK7A 3K8QA 4Y1GA 4U7WA 3ZXSA 4GX1A 2W6QA 2ZRHA 4WXMA 1ZNQO 2IKSA 3EGVA 3FOAA 2Z08A 3MTAA 3P4UA 3OOSA 2FMXA 2D8MA 1LPBB 2R7LA 2EIXA 5JE8A 1VHJA 5E1MA 4OATA 3R76A 4GX2A 5KC8A 1Z4IA 4GFDA 1TXGA 3VU0A 2WYWA 5KNLA 5DTMA 2QNIA 4HV4A 3F6EX 1Z0UA 5BSTA 5HK9A 1R8XA 1X77A 1XZMA 4UTXA 3FIUA 2EQAA 2WFAA 3GV0A 5EWMA 1JZQA 5B64A 3PNMA 5J4KA 1L7QA 3CZQA 3N39C 4LWPA 1ULHA 5LQMA 3N2NA 3FAZA 5FWDA 1VLMA 3JZFA 4UC0A 1TADA 3QW4B 8LDHA 3SQLA 3K3PA 3KQMA 3TK1A 3PRKE 2V3CC 1KAQA 2N1BA 4O4HB 3CUTA 4I50F 2ET6A 3X1WA 4FJ0A 4NS4A 1KWKA 1L5LA 4LQLA 4X00A 5FBWB 3JWGA 3ZI0A 4CU2A 3IEIA 3HJUA 3OI7A 3PNQA 3ER8A 1EX6A 3AG5A 4IGAA 4U7FA 2CK3D 3HG7A 1NM5C 1UKZA 5JWHA 4AZ3A 4AJJA 2DSNA 5B4UA 1FVXA 2BUAA 4DBZA 3PNSA 2RIRA 2X8LA 5DCLA 3OQMA 3O8OB 2PIDA 4LOLA 1ZHFA 5H4GA 1QTNA 4XSGA 2O54A 2EHJA 4HMOA 2QRVB 2JAWA 4KU4A 1XTKA 3SMVA 4AURA 2WJVA 4DR2B 5AUQA 1O77A 1J0DA 2Y76A 1JFFB 4REQA 4UVGA 3VHRA 1U8YA 1N92A 3CNNA 3TZCA 3HBFA 2A58A 4ZARA 4BX2A 2QBYA 2P9YA 1BW9B 4BAGA 3CLUC 4NECA 1N6IA 2Z5LA 2OZKA 3QVJA 4XGRA 3R7BA 1N5KA 4F3RA 3PC8A 2V9CA 4NESA 3PEFA 5CTAA 4MQ5A 1WBBA 1JHYA 1CHNA 5HOEA 2JGAA 1V8DA 3V2HA 4BGEA 3UANA 2Y1WA 5BP7A 2HHAA 4OX9Y 4AJIA 1VLZA 2O2YA 4NZOA 4U6QA 3N3AC 2ZEJA 2REXB 1KOJA 4MPJA 1XLUA 4JXXA 4O5OA 4ML3A 4AJ2A 1BMTA 1H2EA 4FR2A 2Q4TA 1TTTA 1M54A 2J46A 1HDIA 4C22A 4YROA 3E7WA 1KZ4A 1BEUB 1FMCA 1EVIA 1MU0A 3F3KA 4D41A 1KZGB 4BCBA 4EMTA 2ATXA 1V11B 1VBMA 4PXSA 5BUQA 1L7XA 2FUCA 4DDHA 3T3HA 1VA5A 2V54A 4R68A 3K0CA 3UJ9A 3WISA 1KIMA 1P2DA 3NVMB 5AW1A 5DHQA 1MVLA 2ZAIA 4DDWA 4YRAA 3GI1A 2CF5A 4D0LB 1JFFA 2Q99A 5BXQC 3CZAA 2IF0A 2NQ2C 2X3YA 1CZUA 1G2PA 1RYHA 1FDIA 1RXSA 1RFLA 1SKBA 2WPDA 2I3ZA 3AHGA 3NC1C 4LOKA 1DTWB 2B2CA 4UJ3A 3V4SA 4DLBA 3JQAB 1VXOA 4GVXA 1Y6GA 5EFZA 3FFWA 1ZOPA 1RD4A 3M4YA 3EJWA 2FLKA 2VQDA 1C50A 4NZ9A 3T1OA 3S2YA 3EZYA 5F7ZA 3KHTA 4EELA 4D43A 2P6OA 3UWKA 4A8JA 5JDIC 4NCAA 4AMZA 4GLJA 1OA0A 3HABA 2G4CA 4GBJA 4S1OA 1NLFA 3OFNA 2BEVB 1M34A 1O8BA 1F60A 1KYWA 1PWZA 2V7EA 3SZGA 121PA 2GEKA 1BS2A 1KFEB 2QJWA 3EBPA 2ZZMA 1NQXA 1ZD5A 2EQBA 3DFKA 4NOLA 4H6VA 3EA5A 4RPCA 4EL0A 4KFTA 1SCUA 3M49A 4Z1MD 4C7XA 1AS3A 3OZFA 5EHZA 3RIHA 4LE1A 3LKDA 2QZ9A 3FGPA 4KW7A 3VHQA 3TJMA 5HUHA 3GCZA 2X9VA 4UJ5A 3ELBA 4DNOA 1P3DA 1ZXXA 4MCAA 1R3DA 4X1YB 5I7OA 3ZWQA 4JYPA 1CRQA 3IIIA 1EFVA 1MP0A 2OGTA 2PX3A 3O83A 1NR5A 2APJA 3T95A 4W9NC 2X15A 2O4UX 3QEMB 2AJLI 5EUCA 5AM2A 1ONBA 4GECA 4C78A 1AKNA 2J5KA 2WYIA 1MVNA 5G1NA 4PSUA 3THSA 1J09A 2IX9A 3E7XA 5BXYA 1WZEA 1X92A 4HPWA 1P45A 2RGUA 1I9GA 2R4UA 4UMVA 3RVLA 1GL6A 1OWNA 1XWIA 4IFTA 6NULA 5JHGB 3K70B 3HP1A 2BBOA 4FSXA 2NIPA 1WU8A 4ITVA 1KJWA 4GGOA 5AQ1A 5JD6A 2JLUA 3DMTC 4UUQA 1XNGA 3B6KA 3ZTTA 2VBGA 1ZIYA 4EA8A 5P8WA 3V8RA 5LP1A 3FPJA 1SAYA 4OXYA 3FVWA 5A71A 5F5XA 3ROEA 2PIAA 3OF5A 3R9IA 3V8BA 4BTVA 5I8WA 2AC4A 1NJGA 1P8JA 4BB0A 1U0SY 1FCJA 3T8YA 3GLFB 3LVRE 4RL4A 1QDUA 3K9LA 4Z4HA 4FR0A 4JT9A 1J20A 4KR7A 3RU7A 2FEOA 2GN6A 3GLGB 1FL9A 3IKLA 5AUNB 2GM4A 5C34B 1YOVA 4J4HA 4Q48A 4MW4A 4LPKA 3CLRD 4JFRA 2OAEA 3GW8A 1P4HA 1MEEA 1SUCA 3SZOA 1KRWA 2Y3IA 3M4JA 2J87A 4LZAA 1Q11A 2OC9A 4LISA 3CX6A 1J90A 3JTMA 3HEMA 3O74A 3FPSA 4ARCA 2O8FA 1J5EB 1BN7A 3EAQA 2ZYRA 1MX1A 4HQ6A 3HFRA 4HMPA 1FSZA 1YFKA 3BX1A 1QQ7A 1K3FA 4D3SA 1A0OA 3THXB 2EBUA 3KUKA 1B0PA 3EK2A 1SU4A 1CV2A 5E9QA 5KWJA 3GDWA 4NNPA 1J5PA 2HFKA 3B1FA 4RZQA 4K2AA 5EVCA 2OAP1 4KWTA 4F60A 1LPNA 3S68A 1OFUX 3CS3A 1ULSA 2CJXA 2PLNA 3ELYA 3CSUA 3OQJA 4PIPA 3Q3JB 2PRIA 2QD4A 1E3QA 1E3IA 1V2GA 1KAOA 4GKBA 4K3VA 4PYQA 3VNQA 3VV3A 1YB1A 1O9GA 1W5TA 2ZZKA 2IZOA 1IHOA 2H9AA 1KPIA 4JX8A 3U1BA 3AXSA 4JODA 3A6KA 3N7AA 3SS7X 4BLVA 4FM9A 2KBFA 1IPEA 1E7WA 1W29A 2GMWA 1C7EA 3JPWA 4UAVA 3UUWA 1PQ4A 1N5MA 4UKDA 4EPRA 4JEMA 5ITSA 1F2TB 1S7GA 2DQSA 8ATCA 4WMLA 3GR6A 3I6YA 3NHPA 2YMLA 3DLHA 3D6AA 4DN6A 3EVNA 3JATA 3VPDA 2ZR8A 4INJA 1H6AA 2FH5B 4UDOA 3B3AA 2G67A 4KQFA 1ZN8A 2C9DA 1BA3A 1P1RA 1KI8A 1X7YB 3P0EA 1PIWA 5K6AC 2WUEA 4R1MA 1Z73A 3BE5A 3KXLA 5K3EA 4MGEA 4ZI5A 5ALUA 1ZMXA 4Q15A 1P60A 2X86A 1FVFA 1VE3A 1XJ0A 2OILA 2Z2KA 2XMBA 2XODA 3AU9A 4J0KA 2XD9A 5GWXA 3NYIA 3T7JA 3VTZA 3BIWA 2HQOA 2NQ8A 4CLXA 2IYTA 2AG8A 5AKGA 5AKYA 3R7WA 3IJEB 3L6EA 2I1QA 4IOJA 4LDRA 1VYHA 2B5VA 4EM6A 4IMIB 2G1PA 3GCGA 1Z34A 4LFAB 3ERCA 4N41A 3I45A 5T7BA 1YOVB 1EM8B 2BY4A 5DTIA 2UYCA 4HUQA 3VJLA 1C3OB 3JWEA 2IKQA 2V8BA 1ANKA 4N5MA 1FDSA 2GNPA 2NVUA 3DC2A 3GNLA 3K9GA 3R7NA 4ARSA 3MWFA 3RK1A 4BQEA 3BTSA 2LIPA 3F6PA 4BBPA 1M1UA 4KI7A 5AUOB 3WL3A 3PRYA 4R8VA 2UUBB 3HYLA 2B9EA 2BOVA 3FMVA 1ZN9A 4G84A 4GMGA 1CUUA 3P4XA 3TGLA 5THQA 2PY6A 1P2FA 2FW1A 2HSJA 3KRTA 4YJ2A 2XDAA 4AF6A 4PQRA 3KQNA 1G2QA 2XVAA 3LUBA 3N2EA 5JAQA 3EEOA 5BW5A 3M89A 2C5BA 3EFBA 3L8EA 2AK2A 4OXQA 3GGOA 4WNIA 4DWOA 2ZSDA 4ZYVA 3WAGA 1MRNA 2PUTA 5GGXA 1CF4A 2BFNA 4BFSA 1V43A 4D8UA 4JASB 1DHTA 4LQ4A 4XIGS 1P7CA 1JG4A 4LY6A 1I7DA 2IYPA 3KU4A 2I8LA 3AUSA 2EU8A 1VPLA 2EERA 2AD1A 4IIVA 4OREX 2C9CA 5KX5B 1KI4A 1SVMA 1QK4A 2HJ9A 2YQ4A 3HO8A 3K1AA 2CF6A 3I9MA 4GEKA 5EE9A 3TBHA 3KEFA 4NAHA 3ZWKA 4QQKA 1VE9A 5K3BA 1I3CA 4BVJA 4HAWA 4WEOA 3DYIA 1U11A 1ZW6A 5G2OA 5TGTA 1XMJA 1C3EA 1R88A 1HEUA 2I4TA 2AUTA 2QZSA 2AFVA 3D1LA 1WF3A 4Q66C 3GJ6A 2H2HA 4CN8A 3VNUA 3FNBA 4JJIA 3OC0A 4CUJA 1ORVA 4NBTA 5D85A 1JJVA 1NRXA 3G0CA 5KVCA 1FZTA 3JZDA 1CY1A 1FDVA 1KWGA 1PZGA 4IQ8A 2C4TA 5JSZA 1QTRA 1XLWA 3VGJA 4QJBA 4DMHA 5L51A 5CD1A 1JDPA 3RWBA 4YYZA 2CCGA 5TB5A 3BB1A 2P9TA 5KTSA 4HEJA 1DLIA 4FKZA 4PX5A 2DR0A 2J45A 5I7HA 2V65A 2XUZA 3H8VA 3L4BA 4K9OA 2PAAA 3IVXA 4FCVA 5FDFA 1R0WA 1T4MA 1USUA 1XJQA 5KQGA 3AEXA 3OCUA 2P2NA 2PPVA 2BTQA 4BEJA 3QKUA 4J07A 3ZY3A 1D1SA 1OOEA 4P7GA 1XQ1A 3ISVA 3IUYA 2E49A 4JDPA 1W8IA 5JBIA 3FTPA 4S04A 4AI6A 4CEJB 1IN4A 3QRWA 1YR8A 3BCRA 4WCFC 16PKA 1D4AA 1DC8A 1EDBA 2CZCA 3KTFA 3LKVA 1NLUA 4I4NA 4M36A 4MVJD 4R7ZA 3C24A 3MCZA 4CM8A 4F3NA 4D6PA 4D1YA 3KAPA 3QVGA 1XA3A 2IYQA 3AESB 1AQNA 2GSDA 1TZJA 3CLTD 2F00A 4E31A 3JQ7B 3I53A 3U1TA 1IYZA 5J4VA 3LUFA 4LRYA 4X20B 4OYLA 1VA4A 1U5BA 4GP6A 4WE3A 1HE1C 5IKXA 3FAKA 1J2JA 4HWOA 1R12A 4P31A 2TMDA 5DP1A 3UTCA 4C6HA 5AVUA 3K70C 4IDQA 2OHIA 2PX2A 3OCXA 2ZJFA 2F1HA 3ZE1B 4Q3NA 2XITA 4CM3A 1YQUA 1OILA 1ZGAA 2O3QA 2PPLA 5FOXA 1IUKA 4GXNA 2CV2A 4NENA 4UMDA 4KOAA 3PGKA 2D62A 1U2DC 3C3KA 1WDLA 2B99A 1WXQA 1E5DA 5A3JA 2FSVA 3VYTB 2RC5A 4FFBB 4UCWA 5B7PA 4UXJA 1UJMA 4MMYB 4CG1A 3CZ5A 1N78A 2QTTA 1UK7A 2QLLA 3E9ZA 1SG6A 5LBTA 2EJWA 3AM5A 2X6QA 2H6EA 1S4QA 2O20A 3AF5A 3WGZA 1VCIA 2XUQA 4JROA 4YWHA 3UEOA 3QFFA 1KJ9A 3MWJA 4X71A 3VZBA 4LXIA 3TJRA 4UAJA 1AIPA 4XPIB 2Y05A 1TRKA 3NYWA 5TPWB 2DRIA 4UM7A 3E8MA 1O6GA 1Q91A 3LC0A 2AYXA 1BFKA 5FI3A 2HBRA 3BDAA 1FE8A 1PDOA 1UL1X 2A5FA 3E2IA 1XEXA 2OHFA 3WIEA 3C14C 2E4AA 1Q12A 3GGSA 4I5FA 5JTTA 5JCXA 4TGLA 4NIMA 1QYDA 2ZIUB 4JQSA 5C1DA 1ZD1A 3BN3A 3DV0A 5H82A 1CRPA 3RVBA 3WL8A 1L7EA 4O2RA 3HDHA 3PUYA 2DPMA 5T3UA 1W1IA 3RDPA 1NI5A 3T15A 5KTYA 3UBTA 5FPHA 4F3KA 1PGOA 4US0R 5TT1A 4O4IB 1TYAE 3TAHA 3TG8A 2YC2C 2H8GA 3GVIA 1WY5A 4HO1X 5JCJD 1G8YA 2JDID 2V4MA 2ZJ4A 3ML1A 4HGPA 4KP7A 5J23A 4K9MA 2BJHA 2HI0A 3UUEA 3FDZA 4J6EA 1QQTA 3SQDA 5GVRA 4UM5A 3TMKA 4AJHA 1BMDA 5AJYA 1B0ZA 1IIBA 1MXFA 2H1CA 3IS3A 4KXUA 3KJNA 1KEWA 1QAQA 1OYYA 1R6TA 2CXHA 4B7ZA 4I6GA 3P26A 4YUVA 2B36A 3HMKA 3NM5A 4B84A 1IBRA 4KMRA 4ONEA 4DCOA 4TVSA 2DUMA 1MABA 1PS9A 2JG3A 5JPDA 3OKPA 4WOJA 3EH2A 3DG9A 5H8WA 4HEHA 1RMYA 5C32A 3HB4X 1KPHA 1OBFO 3KLBA 4MMZB 2C5EA 5E9AA 5FHRA 1NIPA 2NU6A 3UCEA 3HO1A 1TA0A 1V8FA 3U44A 4NX2A 1JT2A 4TROA 1N1GA 4UBOA 3GEMA 3EMKA 4QQFA 2I6FA 2L42A 4BNYA 2O2SA 2YWGA 3D2CA 3ZBUA 4BLUA 1X14A 2R60A 5KYNA 2PBRA 4AQDA 2X2FA 3C8DA 1OQAA 3FJOA 3HBMA 3O31A 4EAAA 5EWLA 2EZ9A 3BXPA 5JUWA 3BB3A 2Z3ZA 3L7IA 3W5VA 4A2CA 1ZVMA 3HUTA 1FX1A 1FXSA 3C4VA 3D6VA 1NQVA 3IIMA 4JLPA 3DF9A 2YIVX 2JF0A 4UFNA 3SYLA 3TS1A 5CVVA 4YP6A 3TNFA 4DLZA 4XZ3A 4BO0A 5C18A 4DR5B 2BM0A 5CH5A 4J29A 2D54A 1DE0A 4EB6B 4JA2A 4EVIA 1G21E 2FZKA 1Y4SA 2PO7A 1M2VA 3EVGA 3MGCA 4J1SA 2VLIA 4QO7A 1B23P 3GLIB 1Q1GA 4MVCA 4UOZA 1LI7A 5DYGA 2JI9A 4TQGA 4B76A 4HQKA 5IKPA 3KQHA 4F72A 3OM1A 4LNHA 5E4YA 4D8VA 4TVOA 1P31A 3GFRA 3ASYA 1KMHB 1F9AA 4GE3A 4A6DA 1S2DA 1RP1A 3GO4A 3SYRA 1ZD9A 3ZWVA 3QBJA 4AICA 5I9IA 1FDWA 4WBNA 4ARVA 1INLA 4J4BA 1MBZA 2RBGA 2ZCJA 2X5OA 4K9KA 2ZRIA 2UDPA 1AZTA 2ENUA 4E7OA 4X64B 2LV8A 1IN6A 1IN1A 5DLQC 3ZDEA 4BLRA 4Q4LA 1AHNA 3N58A 4NBLA 1FYWA 1XTQA 2I3BA 4J0GA 4U2GA 5IVKA 3FYTA 1ZN7A 1IAVA 3DEZA 2Y68A 4RNDB 2GCPA 2VEOA 4G5YA 1B7GO 1YQDA 3ADDA 2H1LA 3L0OA 4BNZA 3WMGA 1Z39A 3UWSA 1D7OA 3D0KA 1NHGA 3MT8A 5L9AA 5DTEA 2EKPA 4YJFB 4ZO7A 3ACDA 1NUPA 4DM4A 5CM9C 4CKBB 2QJRA 3H0KA 3KQQA 4FHGA 4R5HA 4O8ZA 1GA4A 1E2QA 1V7QA 2ZQYA 3QMMA 3HKCB 2ZM5A 3OT5A 5BN1A 3NJRA 1Z8NA 3I09A 3I6BA 3TXYA 3W9YA 2ACVA 3NV7A 3MMZA 1AKMA 2DJIA 2H18A 1GGVA 1P5ZB 2J9RA 3MRSA 2H59A 2PX5A 1K8YB 1HOTA 2JIPA 3PYXA 3PQ2A 4YCBA 2ZXFA 3RVJA 2YC4C 1XAJA 4ER7A 2W6IA 2OCLA 4I4CA 1UK9A 4M9UA 2Q3MA 2Z6UA 4PLGA 2Z98A 1QHHA 3DP9A 3CRMA 5A3SA 3BDIA 1UXGA 1N25A 2C0PA 1Z25A 3AB7A 1Z17A 4CKWA 2BKEA 4JC8A 1FRZA 3HKDA 2P9CA 3IA2A 5DOVA 2QW0X 1A9YA 3FUUA 3LTNC 3U3XA 2BZGA 3IT3A 4IYJA 2AX4A 1HNNA 2HXGA 2UYOA 3LXRA 2QL5A 4J7UA 5KHAA 3T4UA 3DOFA 4KV9A 4BKQA 3CW9A 4HGQA 5A62A 3L77A 4IWXA 4OGGA 1XVAA 5K0TA 2VAXA 4XW2A 1B73A 4AXBA 4RM2A 2PDAA 3H83A 1SBYA 3A4TA 4NQRA 3IEPA 4XEHA 3BSSA 1KK3A 4FGWA 4MI1A 5FEMA 1OLUB 4GXQA 1RIIA 1MW9X 3C0KA 3Q3GE 4KJZA 4RS3A 5H81A 2OA0A 3I01M 3OZ7A 3PUWA 4K9SA 4ALIA 2ODAA 3HB7A 3AERB 4EJ6A 3WLMA 4YNBA 3ODPA 2ONYA 4G9GA 1GZVA 2XUJA 3I12A 4EITA 2P0AA 4KR2A 3MS2A 4I0WB 4B0PA 1QFYA 4L74A 2BN4A 2FWBA 1L4HA 3NBYC 5B1HA 2QVXX 1SULA 2UUCB 1X70A 2P9GA 1ZICA 3WTCA 2VQSA 2VPIA 4OHXA 4WADA 4E4TA 1CQIB 1RWQA 4KYVA 2JFGA 1T6ZA 2Q8QA 4Z7NB 2OCXA 3O9ZA 3GLIE 4IHKA 1SCNE 2W2OA 4DUGA 3EDYA 3GPDG 2AI1A 2CEAA 2BMVA 3A9CA 5LM3A 2J9XB 3QLUC 3L8MA 5GAJA 1JFTA 3UQZA 3NBMA 1XYGA 4CT0A 3OFKA 4RPHA 3JQBA 2QZPA 4N6GA 3TX2A 4LPSA 1QE3A 3JALB 4LV6A 2I22A 3G82C 3I9KA 3HU5A 3DL4A 2W0SA 1CQJA 3V1NA 3SQNA 2W8BA 3DO8A 4HFJA 4DVGA 2OY0A 3DDSA 1O5IA 2XQIA 4KO3S 4P93A 1V5FA 4YUZA 1M7GA 3QVLA 3KG2A 2R7MA 4MZXA 5C5IA 4KUHA 3U3ZA 5A4FS 3BMQA 3FB1A 3WNBA 1IM8A 2P9BA 2IV7A 1N5JA 5HM6A 2WMOB 1GFIA 1SGWA 5CHYA 3W1VA 1YD7A 3Q5DA 1DRWA 4YR9A 1I01A 3AVTA 3K1YA 1Q19A 2JJ8A 1C30B 3IR5A 4IBOA 3RLFA 3UVEA 4CM6A 4DOMA 1K4KA 2JBHA 2H92A 1JAIA 2I4OA 4UHDA 4JUFA 3SVLA 1MO5A 4WHMA 3WLPA 3HYRA 4WY2A 1M2WA 2C96A 3W2EA 1ZP6A 2PH1A 2YV3A 5B2FA 4TKZA 4J3FA 4UARA 5EIOA 2FFQA 1DAPA 3E1SA 3OM8A 3PUVA 4DT1A 4EGQA 4KR0A 2I4IA 2O2XA 4NSNA 2KS6A 1FTNA 3DPIA 2B69A 4G1BA 5EZYB 3GT4A 5E2IA 3FZNA 3EMBA 5TEVA 4JB3A 5A9SB 2VQEB 1G8GA 1G20B 2EHDA 5HG0A 2HF9A 1AGNA 1U3GA 4HYYA 1Z2AA 3A7DA 4HDKB 4JSTA 5EJMA 1QHNA 1UDXA 2FX2A 4NJOA 1R9NA 1I9CA 4YJHA 1JIQA 3OAAD 3GZ4A 1Y5MA 1ZIPA 3CONA 1ONNA 2AG1A 4YI3A 3FLEA 5AKHA 3X2SA 2DG2A 1XX6A 2DFNA 3CBQA 3DE3X 3D2AA 4JGGA 3EXG2 4OHCA 5AKJA 3T7IA 4BJHB 2IXDA 1X3SA 2HOQA 4JEHA 1NJ2A 4XA8A 4IMPA 4A26A 1DAMA 1SD5A 4QZVA 5TIIA 4XWKA 2PMEA 2FPXA 2TMYA 4ZI7F 3FTCA 4I50B 3F9IA 5B12A 2I9PA 2PYDA 1TAHA 4WCDA 2A9JA 2XA1A 3I9NA 5CU7A 5KYYA 2EW1A 2VDQB 4OL0A 2EP8A 3KKQA 4Z0HO 4DXDA 4II3A 1WHTB 2D7DA 4NBKA 3ZJUA 2QQ5A 1HQYE 4TXNA 4MW0A 4Q9KA 1ZNWA 1C81A 4DSOA 1TMGE 2XUDA 1XCJA 1Y48E 3ZEAA 4B43A 4E08A 4ETNA 5EWMB 1U7XA 5HMLA 1PVOA 1CEEA 2YJZA 1F8GA 5HA5A 3BJEA 3QPDA 1NQAO 2GZMA 3AHDA 3HXTA 3PUJA 4W7SA 3MWYW 5F5LA 1UMKA 3NUZA 4OHZA 3LBNA 4PWYA 4R3WA 2M1XA 1GHTA 5AK0A 4CF3A 2BR4A 4F4UA 1YIOA 1P7VA 5DASA 3EFEA 4U0KA 2CMDA 2Q7XA 4PYNA 2YVQA 3QVSA 2WY2D 2CSUA 3BULA 3E03A 4NU8X 4N65A 3HFGA 4E07A 1DKRA 1UMDB 3KJZA 5JZVA 3OZGA 4Q1FA 4QU9A 2Q2WA 3CR7A 3JSAA 1MABB 2O8BB 1QR6A 3P19A 3SBEA 2QRKA 3KS9A 1EINA 4QKQA 3M6VA 1YJ8A 3PQEA 4IIUA 4NVRA 4NZYA 1MH9A 3TM4A 4IP0A 1Q1EA 3U7QA 3T1VA 4RD1A 1SUPA 2F67A 4E5MA 2ZYTX 1KTIA 1BFUA 4TXJA 4MR8B 2NOAA 4BQNA 3IQEA 3O47A 4CMJA 1I2MA 8ADHA 1JR2A 1Z45A 2JFBA 3UCFA 4AW9A 3IXLA 1NBME 2XZPA 4G97A 4W1RA 4G5QA 4WNYA 1FEZA 4GKVA 2VJKA 2O1SA 4HB0A 4HNAB 5HCNA 1I4DD 2BFDA 4M88A 4JJ8A 4X3PA 3N1UA 4AUEA 4ITUA 5COQA 2YJNA 2XZLA 2XA2A 4J8PA 2IS6A 4IZOA 3QBEA 4ETWA 3U31A 3ZHTA 1EP9A 5AVJA 9ATCA 5I8PA 5LU9A 4B3RB 3NZEA 4EVRA 1DQZA 1TL7C 3C3XA 2H7VA 4LCJA 1WV1A 3CJQA 2QR3A 2GILA 3AR8A 1K27A 3K9WA 1XKQA 2PK3A 3B2NA 3QHPA 4NZNA 3M3DA 3UJCA 4F3YA 3ZJVA 4H7IA 2XWQA 1A96A 1X8KA 4NCXA 2QMYA 4CMIB 2EKBA 3TW0A 3ZV3A 4RDXA 2QGZA 4C88A 5DDIP 3H4IA 3OLCX 1E58A 2AT1A 4H6PA 2Y2VA 3HKBB 4NE2A 1JWAB 2UVQA 4HAYA 2BGJA 3OZSA 4WXYB 4YP9A 3HBJA 1UADA 4IUCS 1BRMA 2HIAA 2QN7A 1OPXA 3K72B 4V1CB 1P5FA 1GGHA 3Q40A 1T91A 3AFGA 5JO9A 5T6MA 1ULZA 3I2YX 3N2GA 3NTQA 4MGYR 4YI5A 4WBSA 4I6JA 4ZZ3A 4G56A 4I50A 4YMIA 3BRCA 4ME6A 1UBMS 3O95A 1WUJS 1GNRA 5KYUB 4QG3A 1JDNA 3HCRA 4R8SA 3SFZA 4BPRA 1G8PA 4UOEA 2ZG6A 3HA7A 1RJGA 2FEPA 5JSHA 4NU6A 1NATA 4X63A 1I1QB 3QMPA 3IUMA 4ENPA 4RJKA 5EJ5A 3U4QA 1VECA 3NB0A 1JH9A 1EVQA 1ZW1A 4DQXA 1VGQA 3JAWA 4PHHA 5K0SA 3WGVA 1OX5A 2IW3A 1AT1A 3EGOA 3D5EA 3KUCA 3NAZA 4P2GA 1YJCA 3FSJX 4UU1A 4OB7A 3STYA 4N1AA 4AY3A 4HPJB 5K01A 3P20A 2RK3A 3QEBZ 4A8JB 4JSYA 4WK0B 3FPLA 1S3IA 1IC6A 4OQQA 1VHQA 1WDKA 1CZKA 1NUQA 1MB2A 2G88A 1L1RA 2XGSA 3EXEB 3KHKA 2DBQA 1W0CA 1YK1A 1YWGO 4KZPA 3MJCA 1L5KA 3TFWA 1EP3B 5C4MA 1L5YA 1PKXA 1H93A 2I34A 2J4CA 3PL5A 5CIWA 3SOZA 5LLDA 1TKBA 2GAOA 4D3ZA 4G5RA 5CK4A 3Q12A 1M9NA 1EG7A 2UU9B 3ZLUA 1KBZA 2KLBA 1GAQA 1SQ6A 5H9WA 2IHUA 4A0GA 3VR2A 2REBA 2O2HA 2VYVA 3RQIA 3L2OB 1PNVA 2GB4A 4YLGA 1OD6A 3H7IA 4QO8A 4DA9A 4U02A 5CTJA 2EBHX 2H4WA 4HBGA 2W98A 2ZW9A 3PYLA 3Q6IA 4NDAA 1AKRA 1TB4A 2CHVA 4GR4A 2GHIA 3BGIA 3RSZA 3ZXIA