1YZHA

Crystal structure of the conserved hypothetical protein, methyltransferase from streptococcus pneumoniae tigr4
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
204
structure length
204
Chain Sequence
b'GATELLEANPQYVVLNPLEAKAKWRDLFGNDNPIHVEVGSGKGAFVSGMAKQNPDINYIGIDIQKSVLSYALDKVLEVGVPNIKLLWVDGSDLTDYFEDGEIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPENGEIHFKTDNRGLFEYSLVSFSQYGMKLNGVWLDLHASDFEGNVMTEYEQKFSNKGQVIYRVEAEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(7)-)-methyltransferase
molecule tags Transferase
source organism Streptococcus pneumoniae
publication title Crystal Structure of the Conserved Methyltransferase from Streptococcus pneumoniae TIGR4
rcsb
total genus 63
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.1.1.33: tRNA (guanine(46)-N(7))-methyltransferase.
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02390 Methyltransf_4 Putative methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1yzhA00
3G89A 4PWYA 5E8RA 5EC8A 2FRXA 4QVKA 5HOQA 5FA5A 2ONZA 3HCBA 5ICCA 2YXEA 1IY9A 4DCMA 4YV1A 4AUKA 5DRYA 3BWCA 5HIIA 2HMYB 4R8RA 2AN5A 2PVCA 3BWMA 3NWEA 3P9CA 1H1DA 1XCLA 5BXYA 5EHGA 4DKJA 3TR6A 3CJTA 3FUWA 4YUXA 4PYLA 2N47A 3SSNA 3IV6A 1G8SA 3FRHA 3DOUA 2PBFA 3P9KA 1U2ZA 1YUBA 5KS2A 3LCUA 1XDUA 1ZGAA 5EPEA 1O9GA 4YUYA 1KP9A 2NXNA 4P7FA 3UWPA 3JWGA 2GPYA 3KQOA 2WA2A 1BC5A 2OO3A 3GNLA 2P3LA 1UFKA 5T64A 3PLAE 2G8NA 4M37A 3FPGA 1I4WA 5F2KA 4FZVA 5GOZA 3DR5A 8MHTA 1WY7A 4GOOD 5DTMA 5DT2A 1BHJA 3BGIA 3EEYA 4R8SA 3SX0A 5FQNA 4BY9E 2PWPA 1FP2A 4QPNA 2DPMA 3HVHA 3EVZA 3KKZA 2NXJA 2BH2A 1XCJA 1JG1A 3HTXA 3CJRA 4IV8A 3ORHA 2HNKA 5ICEA 1V39A 2ESRA 3KQSA 1FPQA 4X60A 2BR5A 4BLUA 4GBED 3KQVA 3M6VA 2PKWA 3UJBA 5IKMA 2JHPA 3DH0A 2Z6QA 1VP3A 3RODA 2ZIEA 3E7PA 4C08A 3GU3A 1WXWA 1R6AA 3BGVA 2B2CA 3ID6C 1G38A 3P9NA 2GB4A 2LD4A 3THRA 4XUEA 3HEMA 5EEHA 3G7UA 1XVAA 1P91A 3G8BA 3DXYA 3MHTA 2ADMA 3AXSA 2XYRA 3A25A 2O05A 2ZIFA 3B89A 4RTNA 4MWZA 5LQJA 1L3IA 5EMLA 2ZZNA 3TLJA 1Z3CA 3PB3A 4KRGA 3KPWA 3K0BA 4MQ4A 5DM0A 1VP9A 5FCDA 3GRUA 2HTEA 2K4MA 4EKIA 3DXXA 3G5TA 2P41A 2DULA 4PYKA 5CD1A 3KR1A 5CCXA 1R74A 3ELUA 4P7GA 5K09A 1JR4A 2F8LA 3FUUA 5K03A 3GJYA 4H0NA 2GLUA 4OX9Y 2OY0A 3FPJA 5EVJA 3OU7A 2ZCJA 1KR5A 3PVCA 4OBXA 3EPPA 3G2PA 5LQNA 3AWIA 3OCJA 3I58A 1TPYA 5E8JA 3RW9A 3NDJA 4POOA 2O07A 2JH8A 2PT9A 3ANXA 3HA7A 5DLYA 5K8VA 5LQCA 2PX5A 4CKEA 1VIDA 4RTQA 4C04A 1M6EX 1RJEA 1BKYA 3CCFA 3M6XA 2VZ9A 3R0QA 2YX1A 3A26A 4QTUB 5JUWA 1X1AA 3ERCA 5DXAA 2P40A 1WXXA 4L7VA 5CVJA 2V74B 2YQZA 1N7IA 3SSOA 10MHA 3OFKA 3H2BA 1NE2A 2JG3A 3NMUF 1X1CA 2AOXA 2VS1A 5K0GA 2GAFA 2B25A 2PXXA 2Q41A 3DLIA 3EGVA 2QRVA 1XTPA 4R05A 5FADA 5G02A 2VDWA 3T7TA 3GXOA 5EMKA 4CWAA 3UJ6A 2ERCA 5CVDA 4E31A 3EVGA 3I53A 4PYJA 4PGHA 4QDJA 5K0LA 5E1BA 2AOTA 1QAQA 5FUBA 3I5UA 1IXKA 1INLA 3CBGA 4RVDA 1P39A 3IHTA 3EVEA 3LGAA 5DTQA 3LKZA 2OBFA 5HIMA 3MAGA 1OR8A 2JHAA 4YMHA 3E23A 2FHPA 5F2NA 3BGDA 2P7IA 4OBWA 4BP3A 2C7QA 4P7KA 4FSXA 4GQBA 4RTRA 4MHTA 3V97A 2AR0A 3P71T 1KHHA 3Q7EA 4V0QA 3LDFA 1JQEA 3MB5A 1R18A 2EFJA 3DMFA 3HP7A 4KDRA 4M7RA 2ZBRA 5GIOE 1YB2A 1D2HA 3EGEA 3PX2A 3G2OA 3FPFA 4QPPA 5ICFA 1XDSA 3DP7A 4M38A 4E30A 2OYRA 3FZGA 4FSDA 4X41A 5ERGB 3KPUA 1VL5A 3KHKA 2VP3A 4P58A 4PYMA 4RVGA 4RX1A 4C03A 1DCTA 2IPXA 3KR2A 4RTKA 5FA8A 5LSAA 4E2WA 1NW7A 4MTLA 2IBTA 1KXZA 1JQ3A 2ZW9A 2HWKA 3M33A 2YUIA 3LBFA 4GC9A 4OQEA 4QDKA 2UYHA 4O29A 3ELWA 4X61A 1YF3A 3L8DA 2P1DA 3KQTA 4RTJA 1EQAA 2E5WA 4EKGA 4GF5A 3O31A 3LX6A 4PINA 4PYNA 4OA5A 4AX8A 3FPEA 1VLMA 4PIPA 3FUTA 5DWQA 3LECA 2PJDA 1ORIA 2AOWA 1NW8A 3QOWA 1RI3A 4CKBA 1JSXA 4E2ZA 3GDHA 3C0KA 3LCVB 3HM2A 3C6MA 1DL5A 1VE3A 2OB1A 4DCGA 3KU1A 4OQDA 2AS0A 3AJDA 3JWHA 4GOMD 3MTIA 5EHIA 4HH4A 4V0RA 3LKDA 3TFWA 2PX2A 3M4XA 5DM2A 1YZ3A 4R6XA 3GRZA 1I1NA 1JQDA 3HNRA 1F38A 2G70A 2AOTB 1WZNA 1O9HA 2FYTA 4JXJA 4K6MA 1RI4A 2P3QA 3PT9A 3ELYA 3HA5A 4FR0A 2KW5A 5DX1A 4ATNA 4EMSA 2O0LA 3FTCA 4U7PB 1SVUA 1KPHA 3EVFA 5P8WA 2IP2A 5HZMA 2FK7A 3VSEA 4XUCA 4GUAA 2FCAA 3B3GA 5C9ZA 5CVUA 1NT2A 3BWBA 2ZWVA 3MCZA 3TKAA 3G8AA 4RTMA 3FTDA 1O54A 3A7EA 1RJGA 5HEKA 5T6BA 3B3FA 3EEOA 5HILA 1P1CA 2PLWA 5DRTA 4CKCA 1SKMA 2YR0A 3E05A 1BOOA 4PCAA 1ZKDA 3I9FA 5EIFA 1NW6A 1PJZA 3IYLW 3HCFA 3DMHA 4RVFA 2O06A 3R6TA 1RJDA 9MHTA 2PWYA 3R9XB 3O4FA 1X19A 1TW2A 3MGGA 3X0DA 3MCTA 2Y1XA 3A4TA 4HSGA 1SG9A 3DXZA 3A7DA 3G5LA 3KPYA 4GOLD 2QE6A 4E32A 2BM8A 3REOA 1KIAA 5EKXA 4A6EA 2ZTHA 2XBMA 5GIPE 3E8SA 3SVZA 2JHCA 2H11A 3PFGA 3LPMA 4Y30A 5E9JA 3AY0A 3GGDA 4FT4A 2VDVE 4EVIA 2NXCA 4FT2A 2UYOA 1M0EA 4HTFB 4DZRA 3EVDA 3LHDA 1KYWA 5F2OA 1Q0TA 3HCCA 4HTFA 5GM1A 5EQJB 1D2CA 1G8AA 1L1EA 2P8JA 2YVLA 2AVNA 4AZWA 5KVAA 2XVAA 2IGTA 4YMGA 1NV9A 2ZULA 2EJUA 5GM2A 5LQAA 3NW9A 1WG8A 2G71A 4XUDA 2ONYA 5CCBA 2IH5A 2AZTA 1QANA 3SSMA 3TMAA 5E9QA 4EK9A 4RTOA 3A27A 1Y8CA 2I7CA 1IM8A 3CKKA 4C4AA 4AZVA 5DPMA 5EZQA 1QAMA 3TQSA 4PNEA 3O7WA 5FQOA 1TW3A 2AN3A 4Y2HA 4U7TB 3GRYA 3FUVA 4RSRA 2PGXA 3GIWA 1R8XA 4LWOA 4PYQA 4ER7A 3BWYA 5E2BA 5HIKA 5E1OA 1YZHA 2UZ4A 3KR9A 5K0FA 2OB2A 4QVGA 5LQRA 1L3BA 3R24A 1I9GA 2CMGA 4KW7A 2GA9A 4F85A 5LQUA 4DA4A 3ER8A 3OZTA 1UWVA 5KQRA 2AVDA 4IKPA 1XXLA 3KR0A 1KPGA 4WXHA 3JWIA 3P2IA 3UJ9A 2AOUA 5K0EA 2QYOA 4DF3A 4ISCA 4ER3A 2PX4A 4YV0A 1VPTA 3BKWA 3D2LA 3NWBA 1ZGJA 3KPVA 4RTLA 5FWDA 2YTZA 5BW5A 4Z2YA 4HGZA 2XYQA 2AOVA 3BT7A 2BR4A 3C3PA 4X63A 3HCEA 2OPBA 3TM4A 3HCAA 3DTNA 4ER6A 5ICGA 5BP7A 2R3SA 3BXOA 3QOXA 4BP1A 1KYZA 3DULA 1FP1D 4IWNA 1L3CA 2P3OA 5T67A 1QYRA 1SUIA 2NP6A 3FRIA 1PRYA 3OZRA 1VQ1A 1AQIA 3LBYA 3GRVA 3QV2A 5B1SA 5K0JA 1R00A 5GP1A 3KPJA 2JJQA 4ER0A 2FPOA 3K6RA 4R6WA 5HIJA 2IBSA 5FULA 4F84A 1JTEA 2IFTA 2IDKA 1Q0SA 3F4KA 2IDJA 5KQSA 1YFJA 3BKXA 3OPNA 4GOND 5GWXA 1B42A 5KYGA 4YUVA 5CIYA 3FTFA 3LSTA 3NTVA 1DUSA 1D2GA 2OKCA 3HCDA 3G88A 3EVCA 2HR1A 5DM4A 3UA4A 2YXDA 1L9KA 2ZZKA 2B78A 2NYUA 2ORED 3P2KA 5EZSA 5E1DA 5C1IA 2B9EA 4GC5A 4E33A 2ZZMA 2ZIGA 2B3TA 1NW3A 2ZVJA 2Z6AA 1KPIA 3CGGA 3PS9A 2BM9A 2UYCA 2PXCA 3MERA 5FHQA 2EX4A 2WA1A 2YXLA 4PIMA 2CWWA 4RWZA 1RI1A 3EGIA 2I6GA 1YFLA 4PYIA 3CC8A 3TM5A 2PV0A 3UJCA 1VBFA 1NBIA 1RI2A 3UJDA 3VC1A 2PT6A 5FHRA 1JG3A 1R8YA 3UJ7A 1X1BA 3C6KA 4UOEA 3UZUA 3FYDA 1HMYA 5EMJA 2HV9A 2ZSUA 3FUXA 4DMGA 4HGYA 1XJ5A 3Q87B 4CTJA 3OZSA 2CL5A 3BZBA 4WVLA 4YUZA 5MHTA 3EVBA 1T43A 4PYOA 1FJXA 2O57A 1N2XA 5CUQA 4E2XA 3NJRA 4DQ0A 5EMMA 2FK8A 1ZHFA 1UIRA 1G60A 2G72A 3M6UA 3LDUA 4C05A 4F86A 1RJFA 2ZBQA 3DMGA 2IH2A 5K0CA 3C3YA 2EJTA 3S68A 1EIZA 2CKDA 4YV2A 1N7JA 7MHTA 2QM3A 3I64A 3WSTA 2C7OA 5CVVA 2P7HA 2A14A 3FTEA 3KQQA 4C06A 4QQNA 3R3HA 4QTTB 3VC2A 4A6DA 3AXTA 1EJ6A 3LCCA 3TOSA 3M6WA 1EJ0A 3IEIA 3UJAA 1M6YA 3ELDA 4EQZA 1SQGA 2V7EA 2P35A 2IIPA 4HG2A 1AF7A 4KIFA 4KVZA 4P7JA 2AN4A 3LL7A 3EMDA 3KQWA 3P8ZA 5DXJA 1QZZA 5K0NA 3NVKI 5JR3A 1AQJA 3EVAA 5U4XA 1WS6A 5BW4A 5E9WA 1HNNA 3B3JA 2BZGA 3DLCA 3P2EA 5GINE 1JSZA 1G6Q1 4FS8A 1FBNA 3NDIA 5EOVA 3NVMB 3CJQA 4E2YA 5EKUA 5K05A 5K0BA 3KQPA 5E1MA 4RTSA 3FYCA 4PONA 3UFBA 2NNWB 2VDUE 3GWZA 4KIGA 2C7PA 2AOUB 2Y1WA 4NECA 4CXMA 5IH3A 3TKYA 2OZVA 3P9IA 4QQKA 2PXAA 4BLWA 2GS9A 1JG4A 3MQ2A 4PGGA 1NV8A 2G1PA 4LECA 2NP7A 3BUSA 4KDCA 4XCXA 4RV9A 3RIEA 1NKVA 5DX8A 1JG2A 5M5BA 2IH4A 5DM1A 2PY6A 4IV0A 2XVMA 5D1NA 5EG5A 1F3LA 3ME5A 2R6ZA 4YUWA 2JH9A 2QY6A 3GO4A 5LR6A 3M70A 4PCLA 5EEGA 3KQYA 4BLVA 2I9KA 5EGSA 2CMHA 1ZG3A 1G55A 4ER5A 2PX8A 1EG2A 3SXJA 3U81A 3V8VA 3CVOA 2QRVB 3DUWA 4GEKA 5K01A 3HVJA 3T7SA 5FWAA 3OFJA 3G2QA 4RTPA 4G56A 4KWCA 3HVIA 3PFHA 1ZQ9A 3OU2A 4HC4A 1MHTA 2ZWAA 5DSXA 1P1BA 3SR4A 1JTFA 3JWJA 4CTKA 5FTWA 1SQFA 1MJFA 1NBHA 4HRAA 3MTEA 3HVKA 5DX0A 3TPZA 1SUSA 3T7RA 3LDGA 5DTRA 4AZTA 1AV6A 4LG1A 5CVEA 3KQMA 1EAMA 3P97A 2BR3A 3GRRA 5H02A 3UJ8A 4MIKA 2H1RA 5HFJA 2C7RA 2WK1A 1RI5A 3GCZA 4DM3A 4B17A 3SGLA 1X1DA 4RVHA 5DSTA 4ZTBA 2EG5A 1ORHA 5C0OE 5EIWA 3SM3A 3OE4A 5LQKA 1NW5A 4M36A 3PX3A 2Z6UA 2NXEA 5CM2Z 4FGZA 3ER9A 4RYLA 4X1OA 4OA8A 4C07A 2ZLBA 2ZFUA 5E2AA 4E70A 2I62A 3OU6A 3B5IA 3T0IA 3B7PA 3HA3A 4AZSA 3TRKA 2ZBPA 2PSSA 3FPHA 2OXTA 5D1HA 3UBTA 3OE5A 2XYVA 3SMQA 1XDZA 3G2MA 4LWPA 3UA3A 3VYWA 2GH1A 4FP9A 1QAOA 2UYQA 3THSA 2H00A 3PTAA 3EMBA
chains in the Genus database with same CATH superfamily
1N0UA 1R5JA 2FQ1A 2A2ZA 3D0RA 2B82A 4FYIA 3HDVA 2EWMA 2JFHA 3WTCA 5AVRA 4D96A 2PNFA 2QENA 3TCNA 4MR9B 4NCIA 4ZMRA 1OV4A 1YZVA 2G63A 3H11B 4F3RA 3FWYA 5AW6A 2X3YA 4JC4A 1H3EA 1Y1PA 4LWQA 2AN5A 1HK7A 4RE6A 4XIJA 2VWGA 3GG2A 5EHGA 1DJOA 2C97A 3NVDA 2YWXA 3CPSA 4FTWA 1YONA 4MITA 4RIGA 5TRTA 5JZSA 4IYRA 2ZIUB 2YHAA 3M2TA 5CA1F 4Y1EA 1FK8A 3HY4A 3LCUA 3M5DA 4B3RB 2WUGA 1K6MA 3G2HA 4JNKA 4YQYA 2XAAA 2E0IA 2ZYUX 2BRUC 4MROA 3HADA 4LJRA 5L53A 1U3WA 1Z6TA 3GCDA 4LRYA 1RR6A 4U7JA 3SDBA 3W1EA 3E6AA 4PXAA 5AVUA 4YUAA 1FYEA 2XYGA 3H18A 4FZVA 1ZX1A 1UJ2A 2I99A 1I7SB 4NMWA 1ESZA 3AUKA 3PEYA 3QUCA 5DT2A 3MIIA 2I3GA 3QHQA 4EVQA 1P7WA 2PU7A 1D8AA 4UUBA 2JAUA 3IOMA 5TQVA 2BFWA 3EYWA 1CUUA 3KZNA 1G20A 2H1HA 3I4CA 4I46A 1WQ3A 4BLUA 4EI8A 1LX6A 4H7EA 4F9EA 2JHPA 1U2RA 3JASB 5JWHA 4CMIA 1DC6A 3ZV4A 1NUTA 4QOGA 4EFDA 3VPCA 2JFVA 4MWEA 3VSBA 4Y2UA 2ZWPA 1DO8A 3I9MA 4L5JA 4X93A 3USES 4HZIA 1K6XA 2W22A 3IB3A 3AVQA 4G8BA 4UVHA 1KBZA 1W29A 1XJQA 2C8VA 4OLHA 4PS0A 4CZ2A 4YMVA 2V5VA 3KAKA 5HDBB 1RT9A 1XMQB 2C5SA 4BTVA 5K99A 1YOBA 1C9DB 2HM7A 1FLDA 2XUKA 5DV9A 3TLJA 1SQ6A 1BX0A 2YHUA 4BPBA 4EMUA 1A9YA 3DGEC 2GJ8A 3ETGA 1T6YA 4FCTA 2H4XA 3JTEA 2AHOA 1YV9A 1DQRA 2CD7A 2QRKA 2XDYA 5AKIA 4ZC8A 4AVYA 3OEHD 1Q20A 3OFSA 4U2FA 1AKNA 1OC4A 3WKAA 3R7WA 1YQWA 2PWZA 4PAOA 4PW0A 2CXNA 1ZOIA 2ZTMA 1KY4A 2ODNA 3DMTC 3I61A 2VRWA 4RCZA 1Y4UA 3FDXA 3R7SA 3PVCA 1G5TA 1K5GA 3MJSA 1JE1A 1X77A 1RPJA 1H94A 1XGKA 4K6FA 1P4RA 4NJMA 1Z6QA 1TQ2A 4HHEA 4YRBA 4MV5A 1IM2A 1FRQA 1FX1A 1UWKA 3IP8A 4OMCA 2D2XA 4TKZA 3ANXA 3SD7A 5BW8A 1OI3A 4XQEA 1MVNA 3M6FA 1Z9BA 5JS8A 3DT8A 1AKEA 1YR9A 3TZEA 5KYWB 3WKCA 3ZR4B 3T5AA 4Y6SA 3L1HA 4D46A 1QTNA 1E6EA 4NQZA 4QFCA 1NC1A 1KFCB 3WBBA 1JPJA 1YL5A 3WB0A 3QX9A 4LSMA 1PS0A 3GRFA 2ZRFA 4N5IX 1V8DA 4LV6A 1PFVA 3IX7A 1L5KA 2XA1A 1U0FA 5FH9A 3BSYA 3DO6A 3NMUF 3D4BA 2PZLA 2FZLA 3WZLA 3QZUA 1MRSA 2A30A 3OFNA 3ZPXA 4NQRA 5G02A 4OTZA 4IMPA 4Q9DA 4INZA 4LXUA 5M04A 1YVDA 3TRJA 5CVDA 1IEQA 4Q3AA 4QDJA 1HEUA 3CEHA 4FCCA 1W5FA 1V7PC 2RKOA 3K1YA 3OWOA 3ZGZA 1BO6A 1E4EA 1V9SA 2VF8A 3DL4A 1UOQA 3JR7A 3OZEA 4HGNA 1XVUA 2PGLA 3E03A 3LWZA 4K40A 1LW7A 4JYPA 4S1WA 5FUBA 5HQJA 3HN6A 4C0JA 1IXYA 2A58A 2E37A 3BHMA 5C5IA 1DHRA 2V03A 3W5CA 1I3CA 4L85A 4F3KA 4CIAA 3U37A 3URKA 4L4YA 2C7QA 4QODA 4G9BA 4DR5B 5ALWA 3QMPA 1H93A 1ZA1A 3QUQA 1FNSA 2F00A 1W25A 1YZGA 2W4MA 4NHEA 2XQGA 1OBHA 3T94A 1KARA 4TQGA 4YHBA 4H35A 3EODA 1FB5A 3OM1A 3PRKE 2HPHA 2ZIXB 5ICFA 3U19A 3SPXA 5DK4A 4UNRA 3WGOA 3WL8A 3SR3A 4C76A 3MUFA 3VJRA 3FZGA 4RH0A 3FGNA 5LC1A 2BFFB 1Z28A 4KQJA 5ERGB 5C4IA 3KB6A 4JJKA 3VTKA 2IPXA 1MNQA 1QBKC 1RLTA 3KR2A 3W8FA 1F9AA 3IO5A 1ADFA 4BJHB 3LPAA 4OK5A 2HWKA 2B9VA 5U1PA 5KYUB 5D85A 1ZICA 1C50A 3AI7A 4KYUA 4OQMA 1XHFA 1N8TA 3I5AA 1FXUA 1GRQA 2B5WA 3FNQA 3ITDA 1W19A 4UCFA 1UMCA 3H9BA 5SY6A 4BKMA 5A3JA 1K8RA 5BV1A 1G8KA 4TKLA 2DKNA 3TZLA 3QVTA 4KGXA 1VLMA 1V16A 1EH5A 1YJCA 2CFRA 1Z5VA 4WESB 4X6YA 3X43A 2UZ1A 3ZKAA 1IHDA 3WGHA 3ZTWA 2K2QB 3R6LA 4X8OA 5I4BA 3OOEA 3ZD9A 5FOUA 5H4HA 4ZJPA 1JF8A 2JA2A 4DCGA 2GWHA 4PAQA 4EIWA 2HQSA 1AD2A 2E5FA 4KI7A 1M72A 2N3ZA 2W6OA 3PPWA 3K71B 2VCHA 1GTMA 3HNRA 1QX3A 3C70A 1CY1A 4DJAA 4ZT4A 2O1XA 2P3QA 4GT1A 3GLFA 2IEYA 3MJCA 3DE1X 1HO3A 3L6OO 1CZOA 3QKTA 4JB8A 4YJ2B 4HEJA 4ZOEA 4G1CA 1J49A 3MMZA 1U7HA 4IXDA 1EP1B 4AG3A 4PXSA 2ZE7A 1Z5PA 3LUFA 2ZWVA 5EE1A 4DLBA 2GN4A 2HLHA 4EENA 4HLCA 2NAPA 3LWNA 1ACMA 3ZZ1A 1J39A 4YJ3A 2BRUA 1A2OA 1DC8A 1CVRA 1DDGA 1P1CA 1E1CB 1N2BA 1T1IA 2HFJA 2I8AA 3KBBA 4KBFA 5EXXA 1JR6A 1TT5B 4L28A 3D5TA 4OD0A 4YJGB 2XMGA 2YCLA 1P4AA 2PWYA 4NBLA 5CA0B 5IDWA 2M32A 4REQA 1HM5A 1X86B 3HZRA 3CIOA 5L3QA 5GADl 5B6IA 3VO2A 4G09A 4PZEA 4PTLA 3BTSA 5I7AA 3ZEAA 4NZMA 4ZK6A 2A94A 4GMKA 5GQSA 5CCDA 4KO1S 3WNBA 2HRCA 4V3BA 3O8RA 1WQ4A 5B2EA 2VATA 3E8SA 4ALKA 4EFKA 3LPMA 3V55A 2J07A 4NPCA 4UVDA 4UTRA 5I3CA 3L92A 4B82A 5JIBA 4RQAA 2NMVA 3TNDA 5YASA 1YQDA 2VNKA 3EVDA 2VP0A 3ER6A 3CINA 4M98A 3UK0A 4WBNB 2ZT7A 3Q0TA 3ESRA 1A8HA 1NIJA 2GAAA 3PD7A 4KV7A 2JVJA 5KVAA 1CPYA 1QC5A 1XZJA 2X1VA 2QEQA 3CZ9A 4UDNA 3VZDA 4UPEA 1IEVA 4YMGA 2AL7A 4O4JA 3L7DA 5IAKA 1EBUA 3HU1A 3ASZA 4XUDA 3ZCTA 3R0IA 2ERXA 1G5QA 3PUKA 4DA0A 4MQEA 2Y68A 4RD4A 3T5TA 6NULA 1QS0B 3A70A 4PZ0A 4JI2B 1O08A 1CJSA 2BH9A 2AC7A 2XA2A 3DT6A 1IOVA 2QLMA 3LH5A 4KTVE 3SNHA 3W5IA 5HIKA 3R7NA 4TS1A 1DC7A 4X64B 5JISA 4B5KA 3TLGA 1RZVA 3RAGA 4M88A 4D82A 5L7WA 5PGMA 3TQRA 1D6NA 2DBQA 1R6BX 4G81A 3UY4A 4JVSB 2DT8A 4GRIA 1MEOA 2BWJA 4QJBA 1DKMA 4LDRA 4TVKA 1PYDA 4YQFA 2XQIA 2CHQA 3BSFA 3KR0A 2H57A 3FR7A 3VPSA 5JAHA 2PN1A 1BW9B 3AFNA 2IV3A 2BMEA 4L8FA 3L4BA 2ZQZA 4IRXA 3RE1A 3H1AA 1VPTA 1Y89A 4CT4B 3TXXA 3ECAA 1RQXA 4LVCA 4JZYA 5J5AA 4P4UA 2XYQA 4OMFG 2O20A 1Q15A 2WJZB 4BMVA 1JIIA 1FMFA 3EXHA 3D43A 3HHEA 5DNCA 2EZ9A 4RDXA 1OLSB 3PXBA 2G8LA 1SBHA 1EVJA 2J85A 2XEXA 3K6JA 4BP1A 2G9NA 4YAKA 2PMKA 5FWNA 1L7VC 1LBIA 3SWWA 5J40A 1FP1D 2HF2A 4MRRA 1UBUS 1IRIA 1XD9A 3AF4A 3E82A 4OL0A 2EBUA 2PTGA 4DNFA 3A4IA 5L6MB 1MLDA 1X7XB 2QD5A 4TLCA 3SFTA 1CB7A 5EKTA 3KPJA 3RSGA 3TIXB 2FPOA 3JD1A 4DJ5X 5CDYA 3ZI7A 3MXOA 2CLSA 3K0EA 3RVBA 3ILSA 1SAYA 1SEVA 5CD9A 1QH9A 3GUUA 4OQZA 3BKXA 3DL0A 2WG1A 4LTMA 5IXSA 1Y8QB 4B3GA 3C4VA 1CY2A 3GI1A 1DHTA 4EYOA 2DUWA 4TX1A 1IN8A 1JILA 1KY3A 4R8LA 4F5EA 3KEFA 4Y18A 5BNFA 5CXUA 3I76A 4WZAA 5AHXA 1USGA 2AG1A 2ON6A 1HYEA 2GLXA 3O4JA 2GHRA 1ZOSA 2G9RA 3DWIA 3TNJA 3R5TA 4O4IF 3R44A 1IK6A 1Z29A 1GL3A 1OGJA 2DUMA 3B9QA 2I4MA 3T5GA 4ND5A 3W6ZA 2JRCA 2E6KA 2VZ8A 4WK4B 4J94A 1Y6RA 2ZIZA 3EGOA 4KMMA 2FR8A 2J0VA 1CP3A 1KO5A 1BZYA 1EXNA 3ZY6A 3FCCA 3SDZA 3EYAA 4CTJA 3HO6A 4DUPA 3ZD7A 2O8DB 5LOVB 4NY1A 5CUQA 3H2HA 4JQSA 2FK8A 4WDRA 4OMDA 5T8KA 3P32A 4RULA 1X7WA 4NU0A 1U31A 4KAXA 1KJIA 2X7XA 3PHBE 4QXMA 5J2TF 1E3EA 2B92A 2G77B 2COEA 1X1TA 1VRWA 4JBYA 2WHEA 1RRFA 2XNCA 4P6VF 2V9ZA 4QQFA 3SHOA 1B0AA 3NHAA 5TY0A 3F5MA 2E4UA 3Q0IA 3ET4A 1DAHA 5F5NA 1T4GA 1WHTA 2AEEA 4MUHA 3PFIA 3JQAD 4NTZA 1A9XB 4D81A 4EQZA 5J2TA 2BE9A 4J3NA 1L7NA 2Z5FA 3EMDA 1HQDA 1DT3A 1I6LA 3OQJA 4R51A 4WCDA 3HI6A 2B7BA 1BU5A 1WDTA 2OOKA 2ZXEA 4IM7A 5FTNA 2W7TA 4WQMA 5F1YA 4NJOA 4MARA 4GZMA 2J3MA 2XRYA 1F2TA 4WD3A 2XMBA 4WGFA 3DJYA 4FS8A 1N4DA 1NNSA 4BJ6A 2NYVA 2Q4EA 1AS3A 4XDHA 4UBIA 1KAQA 1DAIA 2YW9A 4FLEA 1E1KA 2UVPB 1YMQA 2GPSA 1WSBA 3F3YA 3HP1A 1QIMA 3OLYA 5K45A 5IANA 4UTZA 1BA3A 4R1PA 2K5UA 4MQBA 3BMOB 3O6VA 1FTQA 4FWBA 1Q1ZA 4OP2A 4O63O 4MJXA 3H5LA 3W3AA 3HXOA 4IV0A 5H9VA 5AW7A 4QG7A 3R3UA 1OD6A 5EG5A 3RC2A 3RIXA 1ONPA 4QYMA 5H3HA 1SOAA 2FB9A 1N7GA 4NNJA 1FEZA 4XASA 5B12A 1P75A 3QEMA 2XCTB 2PU5A 3L7BA 3V8VA 4BV3A 3TDMA 1Y63A 3S5UA 4JOSA 4ESOA 3KQKA 4L9RA 3S40A 1FZQA 4G56A 4JB2A 2PD4A 4CQNA 4P8RA 1WZUA 2HCBA 4QDTA 4ABTA 1CDDA 4XVCA 2XJ9A 2ZWAA 2BLLA 1FFXA 4S1PA 3JQAA 1HEIA 4HRAA 2D1SA 2LWIA 4PPFA 4YBZA 1HDYA 1XP8A 3GH1A 1WD5A 3ZLBA 4BE4A 4ETIA 3OQMA 3FNRA 2W43A 4C0LA 1THTA 4G36A 1KC1A 2WIJA 1LS6A 4DHWA 4DG8A 3UJ8A 5LB2A 4LBYA 2QZJA 1H0KA 1QK5A 3OJFA 3QTLA 2HQRA 2QW1A 4UHKA 4W5NA 3RVPA 2FDRA 2TMGA 4PR3A 1YZTA 4CEHB 4G67A 2D4HA 3R0ZA 1Z5WA 3M5WA 2FMIA 3ULKA 1IBMB 1NW5A 5JSHA 1SUCA 4ZAWA 2NXEA 3N0VA 3PNVA 2X1LA 4GZ6A 5AI4A 3NT4A 4LUCA 4BU0A 2BTQB 2NZXA 3ZZUA 2XF2A 1G2OA 2PUJA 2H1VA 2DKFA 3DKPA 1NXVA 4RD6A 3T38A 3B5IA 3QVMA 4BDTA 1M2OA 1O8BA 2ZBPA 5K3DA 4MIYA 2D5AA 3PE4A 5IUJC 1LEHA 4EY7A 4Y0AA 2XIQA 1W88B 2WZDA 3V3TA 1EQUA 4B33A 4KYIB 3PIIA 4HDNA 1ZZGA 2GNOA 3HKCB 3UUFA 3VPGA 4NAVA 1RAGA 4EI7A 3IR5A 4GKKB 5ALZA 1G42A 1E89A 3AFGA 1A9QA 1KRXA 2OLJA 5C35A 2ONZA 1EHYA 4JAVC 4WH0A 3ZI4A 4OAOA 2N42A 3AOEC 3TWOA 4UAGA 2X8BA 2FX5A 4IDBA 3C98A 4A8TA 5J4KA 4LWZA 3F0TA 2I6QA 2X7HA 3RHZA 2Q5LA 1VE6A 1XX6A 3EQ8A 2YZ7A 5TLSA 3KKEA 1PS9A 1JTVA 2VHEA 1F2DA 1N33B 1Z6AA 1UPFA 1C3XA 1S02A 3EXEB 3I6ZA 4W99A 4S05A 3ZD6A 3CT4A 4JLOA 2O4CA 5T4FA 2D2VA 2DHDA 1KP9A 2MYNA 4XWYA 3KJXA 1PVOA 2QRMA 1R8SA 3KQOA 1YBFA 1H2HA 1YC2A 4Q4LA 4EW1A 3A6GA 1CJTC 3E9QA 2Q50A 2WSYB 5DH9A 1RFGE 3CKYA 4M37A 3KUUA 1J8MF 1TJNA 4RKEA 4TV8B 4A0RA 3OC6A 2PIAA 5AVJA 2CW5A 2IY8A 2WUDA 2CXOA 4J0IA 2XV1A 4XM0A 4UCXA 3AT1A 4EO4A 1JU9A 1A4UA 1XTKA 1MIOA 2WTMA 1N5DA 4TL9A 4B3CA 5IJ0B 3D6HA 2WKPA 3PJEA 4M1ZA 1G8JA 1AB5A 1OBCA 3G3EA 3GA5A 3HTXA 1N78A 2E87A 1P61B 3CRRA 3EEQA 3T1HB 2JFBA 4GXRA 4FFVA 1JGTA 3L0ZA 4BRZA 2FF5A 2BFEA 4ARUA 2HYDA 3MTAA 3CRVA 1F8GA 3TIFA 4B7AA 1RRPA 4UNNA 1RYMA 4GPIB 3AM3A 4XUEA 4RA9B 1IXSB 1B3RA 2DQKA 2V5UA 3RK1A 2ZRDA 3O3MB 5M3BA 2QN2A 1JKJB 1FVFA 1YVUA 3CWQA 3EUWA 4Q3NA 1R27A 1UPTA 1WMEA 2R4TA 4QOEA 1L3IA 2R25B 3IUYA 3CCBA 3VNRA 2P2GA 4MOWA 1N6HA 5IT9A 3KPWA 3AG5A 1XMJA 2VJCA 2GFIA 2OQRA 3G2KA 5DMHA 4YAOA 3T9AA 2G88A 4L5BA 4CV2A 3VNAA 4JJ6A 5LP1A 5TPWB 3L0DA 4EKIA 2PMCA 2OXCA 3OWXA 3W3AD 2PRJA 1JHYA 1ZSNA 2Q6TA 2IXDA 4P7GA 5K0SA 4IRUB 4F04A 2P78A 1IC6A 2WU3A 4PFJA 4MYCA 5FBQB 4II2A 3PNQA 4MYSA 4Y6OA 3CSDA 1M1NA 2ZCJA 3TLZA 1Z63A 2V5AA 3Q7QA 3KHTA 2IQ5A 4U9HS 5TGZA 1CQPA 4C4OA 4M55A 3AL2A 2O07A 2VPWA 4Y9DA 4N5HX 5DLYA 4NG5A 5IT0A 2Q45A 1M5TA 3CSUA 1HF3A 1R6XA 2X15A 2R5NA 1OHHD 2NO5A 2ZSBA 2JBAA 2XLCA 5CMLA 1HR0B 5CW2A 1VHJA 2P40A 3RFUA 4B9AA 4IWYA 5KKNB 1T4MA 1N32B 1VYTA 3HZOA 2LW7A 3REQB 2Z83A 2JLCA 5EWJB 2RJ3A 4MKHA 4FFMA 4KKVA 4HEA6 4EF5A 1DDOA 2CVZA 4DV6B 5JZOA 4TKUB 4Q7QA 3KT0A 4M6WA 4LMBA 3B1VA 5DNDA 5ELXA 1FFWA 3VPBA 3AERA 5G2OA 4DQVA 3IBYA 1H9AA 3GPLA 1I01A 2PZEA 2I03A 3DZIA 2OO5A 3R8FA 3F3SA 3I45A 1IZ7A 4R81A 3IUPA 4RVDA 3SQXA 4IL5A 4D8TA 4P98A 3C16C 4Q6WA 4DQUA 1CLUA 1YZQA 3KUXA 1WXEA 5BN3A 2FR8C 3EY4A 3PC4A 4JI7B 1BG6A 1DI0A 4MUEA 1S2NA 2FMFA 1E4OA 4KQCA 4MHTA 5FNZA 1R50A 2R6HA 4GBGA 4PHFA 5FO0A 2OG2A 5I5GA 5ESWA 2ZREA 1X1EA 4RLHA 1OVMA 4TKVB 5REQB 1C1HA 3VYRB 4BRWA 1SUDA 4UCWA 2VHZA 3X1WA 4YEDA 3U1VA 2MT9A 4ZO7A 4GG1A 3KCQA 4V38A 4AYXA 3HBFA 1L5WA 2OAEA 4M38A 3VSAA 3H2KA 4A36A 2XZOA 1XWWA 1ETUA 4O4HB 4M8LA 4WZ6A 4HB2A 4DFDA 2YASA 4DKXA 2BMJA 1W35A 1LS1A 4PNPA 4K88A 1M10A 3KVVA 4PTYA 5CHYA 3OHPA 5GV8A 4EGJA 4WJZA 1AGXA 5FA8A 4QECA 1NW7A 2NVBA 2P2NA 1ZH6A 3M33A 5JNUA 4GC9A 1A3CA 1QF9A 1ZK1A 3PE6A 4XVHA 3LF2A 4DSAA 2OVBA 4QFMA 2F1HA 4CM5A 1YB1A 1WHSB 3OLQA 5AW1A 3VH4A 4IP0A 3FPCA 3GAAA 3WWEA 4BKUA 5BN5B 1ID1A 2IYLD 2BFAA 1J90A 3OE7A 1FJ2A 9ABPA 2OG1A 4FBGA 4PYNA 3S8EA 3H5NA 1UK9A 3RVLA 3A6LA 2GCNA 2PJDA 2AYXA 2RI1A 3D5QA 1Y80A 5JSZA 4IO1A 1TZ2A 3LV8A 3SLGA 1L7DA 1ODFA 2H51A 3HM2A 3LCVB 2V7PA 4ZREA 4AZ3B 1HE4A 4Z3OA 1E5LA 2W2VA 2GILA 1TM5E 4LXIA 3DBHB 4GZLA 3D4IA 2FFAA 4FLFA 1RWKA 3AETB 3ABZA 2LXNA 2KJQA 1I3KA 3L04A 3MOGA 1H2AS 1T0JB 2ZU0C 4LKRA 3DDZX 3GEIA 4I8DA 4L0QA 1AKWA 1RI4A 2HDOA 2PRIA 3ELYA 5CNMA 2BW0A 4Y2SA 4ZD6A 5K3FB 4DANA 4EMSA 4DR1B 1J0CA 1O95C 1WCIA 3K0CA 3NEJA 4MR8A 2I2WA 3EVFA 4TRNA 1OE0A 2R44A 1KETA 4LVOA 4QU9A 1JEYA 1PZFA 3VNSA 3T3PB 3CX7A 2Q1YA 2DP4E 2A1TS 4KE8A 3AVXA 3BWVA 4PNZA 1KK1A 3USCS 1QFXA 3UK7A 1V5FA 3TTYA 2BGGA 1CNEA 3Q9SA 3B6IA 4IMIB 3V6LA 3B3FA 4XJSA 4EB6A 4BLSA 1UBLS 2J3IA 4IMJB 2E1PA 2A88A 1C3OA 1NOIA 1DJLA 3L40A 4KMOA 1PJZA 1Q0ZA 3TR5A 4BN5A 4MLCA 1JLKA 1FNBA 3MLAA 2ZXFA 3AL0C 3ANMA 4HVTA 4NMLA 4F3NA 2HT6A 4RZQA 5UKDA 2BSAA 5DBIA 1T2UA 4B47A 2VJDA 3NBQA 3MQFA 4HY3A 4IJKA 1SIWA 3DVSX 5BOSA 3C39A 3REOA 4A8JA 3QWIA 1JSRA 1QQTA 3DP9A 1EAYA 3BA6A 2QD1A 3FJOA 4G6ZA 4PSCA 3JQ9A 1J0AA 4U2CA 4W1SA 1WB9A 2VJLA 1Z7EA 5GZ6A 5KEIA 1GT6A 4W7HA 1XQWA 4A3SA 3E1GA 4JFRA 5BSTA 3DKRA 3M1YA 5EQJB 1SC1A 2R60A 2C0PA 1TQ4A 2JI8A 3OPQA 1CY7A 3DYVA 5BYBA 4IHKA 1T15A 1SQSA 1U90A 2C96A 3CLRD 3ZDCA 2GOYA 4KRYA 4N8SA 5KCMA 3TQQA 4BZPA 2BFDA 2ODWA 2C5HA 3D7RA 3EB9A 4X45A 3WGLA 1JDVA 3RAJA 4ALLA 2PYDA 1MUUA 2JFWA 5AI0A 1M6HA 3Q10A 3TQSA 3TFOA 3FB1A 1KBOA 1TW3A 3BF8A 3O8NA 1QNFA 4FYKA 2J3QA 1DCFA 1HORA 5EZ5A 4KXVA 3SZLA 1CJCA 4BNFA 1OB2A 4AS1A 3VZQA 1W75A 4EM6A 4UHCA 5EJ6A 4XLTA 1K27A 1YDEA 2GD2A 1LBQA 2PUGA 1KORA 3ZKWB 1F2TB 2OD7A 3ETNA 5L9AA 3EUAA 3WDLA 1JJAA 5KU1A 2KPOA 4PZAA 4FKBA 4LVNA 4YJDA 3C5HA 1NHGA 5K0EA 1WM1A 3P2IA 4JLJA 3PC8A 5FNVA 3O95A 2A0YA 1F60A 3H5TA 3DLAA 1O0CA 2PX4A 3F6EX 3VU0A 5B3LA 2V9CA 2FRVA 4TV9A 2X41A 2PD3A 3WJ1A 5ED4A 2DG2A 2Z5LA 4FN5A 1MV5A 1IHYA 4LGYA 4PSVA 1CY6A 2R3SA 4BNXA 3M2PA 2XMZA 4CM8A 5CEFA 4JQCA 4M3NA 2FMKA 2AXQA 2XTMA 4EI9A 2VXYA 5JNVA 3PCTA 3QVGA 1GN9A 1G59A 2W90A 5KOJB 1QKKA 4A2CA 1K7YA 1Q92A 5K20A 1ZGBA 2CVFA 5G4KB 4L5IA 2JK1A 2VH5R 5DM70 4UNQA 4MDFA 4I4CA 3QFFA 5TPZA 2QLJA 4DLAA 5CB4A 4U3JA 1NQAO 2Y0PA 1K66A 1Y1RA 1CJBA 4LA4A 1SXJD 4BKOA 4ENWA 1Q0SA 2JHGA 2ZI9A 4QLOA 4XRRA 4YAJA 1E2GA 4JD5A 2HBRA 3OPNA 4MW9A 5NULA 2C9DA 4H6XA 4MW6A 4Q02A 5BQPA 1TGYA 3W78A 4D97A 2H29A 1UBTS 4DSZA 1VKZA 3F2VA 1XN4A 2W83A 4LS3A 2VDMB 3UA4A 3P0HA 1NJGA 3OCZA 4HQNA 5KOHB 1L4FA 3NUQA 2ORED 1YAHA 2X2OA 5I7EA 1RW4A 1JQKA 3S28A 3N87A 2FE1A 2VQFB 4QREA 4DCTA 3E8XA 3ZDFA 3LMKA 1I13A 3F73A 2CFIA 2BM9A 1C14A 2PH5A 3O1JC 2UYCA 3Q6IA 2EX4A 1W2HA 3ANLA 3W6OA 1QJCA 3FDZA 1VBKA 3W5DA 3JZAA 4FPXA 4RVSA 2Q3MA 5HKBA 1VBFA 2A0UA 1WLYA 3FHOA 2JCSA 2GDJA 3BD9A 1I8TA 1LBEA 2DFVA 1JG3A 3CR8A 3FGZA 1LQUA 1SK9A 1YO6A 1XZCA 2AIRA 4GSKA 4M54A 4ZT7A 4B3FX 4FMCF 5JH7F 4Q1AA 4XJVA 3BGWA 4DMGA 1BHQ1 3A6ZA 3K53A 2CL5A 2PKQO 5DCUA 3R8XA 2RGYA 1T43A 3DEJA 1H6CA 1KJ9A 2QTBA 2PSJA 4XGQA 5IAEA 4EW3A 1D4OA 4HAIA 4WZBA 2X6QA 1ZHFA 2HWWA 5LCXA 2QM7A 3M6UA 4A15A 2IXGA 3H6HA 5KU7A 4RE5A 2XKBA 4Q6BA 2EJTA 1KTIA 1RQ2A 1JQJC 4MQ6A 3M6LA 1NVEA 3EIFA 5CT6A 4ZU1X 4RVUA 4DC0A 4CMEC 4QTTB 4B43A 1SUPA 2XVZA 3PQ8A 2REXB 2OK7A 2I1WA 1XWFA 2I4OA 1JNXX 3C1OA 3C4JA 5A05A 5JMPA 1IJBA 1GKIA 2V7EA 1OGYA 1Y3IA 3WS7A 1WX1A 3U4MA 1MVLA 4FLMA 5EA2A 2FWRA 3EVAA 1EX6A 1H66A 4ZZ1A 2WT4A 1P5FA 3B1KA 2WZBA 4EUSA 1F0PA 3OIDA 3PDCA 1JT2A 2V55B 4Y6RA 5IZCA 3TW6A 1ZLXA 2ZUEA 4N3CA 5JXWA 1ORRA 2OD2A 2B2XA 4OI1A 1LWNA 4BVFA 3R3JA 2OSBA 4JUIA 3WJ2A 3MRVA 1RQPA 1XOIA 4KIGA 1IUOA 2XBLA 2QORA 3CF4A 1UDAA 3TKYA 1U94A 2GJAA 5EHXA 5HKKA 1BGXT 4BLWA 4D9NA 5EE3A 5IH7A 1M2GA 4Q00A 3NLLA 3IAAA 5KTPA 3E9DA 5IJWA 4KDCA 2RHCA 5BYAA 2WWIA 3WNVA 3DEKA 2UXBB 5DX8A 2GVZC 2V0NA 3NP9A 4DNXA 3A0UA 2PY6A 1UC9A 4ILKA 5A3VA 3HBLA 4JJ8A 2V3VA 5BR8B 1BMDA 3Q0EA 1Z2OX 2QY6A 3IFSA 2G67A 2DFDA 3AZQA 1VJ1A 4K28A 5JC1A 4DC1A 3CF2A 1ODTC 4IEFB 3DT9A 2PMDA 4OGWA 4LHVA 3CMMA 4A10A 4BNDB 3GT3A 3UW1A 2RK3A 5KNBA 4B3JA 4B6PA 1IPHA 3VHXA 3M4NA 5DSXA 2DEUA 1RHQA 3PGMA 3CZMA 4Z0NA 5F35A 4MR9A 2F43B 3CNNA 4FFLA 3CQ9A 3MTEA 3I9JA 4PC2A 2HRZA 4RJTA 5G1OA 1KAEA 3G9UA 1QHYA 3KVYA 4OLAA 3HYTA 3RC9A 3V00A 1ZM7A 1Z39A 2IZ6A 3GVXA 4E1BA 3S99A 5HWSA 5I01A 3QPVA 2FZWA 2VK1A 2NO7A 3CZCA 4OLFA 4U2KA 4IIYA 5K8LA 4BEWA 1WF3A 3ZJ4A 3V8EA 1Y6QA 5HFJA 1IAVA 3GR6A 4KPYA 3M9LA 4N0EA 5LLDA 3A36A 2DPHA 4RIIA 1HOTA 1G4UR 1XA3A 3NVAA 4TRMA 1RAHA 1EB9A 1YRQA 4F4JA 2ZM6B 1SBYA 1HDEA 1L5VA 2P2YA 1XQXA 3ZXXA 2P0AA 5JD3A 2Q28A 1Y4DE 2EZ8A 3NHUA 1LDYA 4B85A 3D0OA 5AUOB 4KL8S 3OU6A 4DXAA 1SUFA 4O0LA 2Y0EA 1NONA 4HBZA 1E2EA 1A2QA 1BVYF 4HDSA 5DW3A 3GQBA 3TRHA 1KBQA 3H7IA 3ZWYA 3I4FA 4ARZB 2YZGA 2C9YA 1ZS9A 4MGYR 1KY5A 2IV2X 3WRYC 1T2DA 4HS4A 4CKBB 3U7HB 3SSNA 5BNWA 4Q39A 2BELA 1UJ4A 1YOVB 2VPQA 5J1TB 1IVNA 1TC2A 2V65A 1LI7A 2C95A 4IBOA 1EYZA 4YC7A 3TOZA 3TRIA 5BY2A 4P0PB 3HYSA 2R48A 3OFND 4MV8A 5KWVA 1HRKA 1T2FA 4R2LA 1G5RA 1PQYA 2I7DA 4AUKA 1ZINA 2QKYA 1C9KA 3MFQA 4TYWA 5CYOA 4IJWA 4H0FA 4TWIA 4R9SA 2HMYB 5DLDA 3M6AA 2ZYAA 3VDQA 3WYFA 3HEBA 5FB3A 4TVSA 4E1AA 2Q0QA 1W96A 2JEYA 2CHFA 4BNHA 3AUTA 5AKZA 5IVPA 3AQ4A 5DTEA 3RANA 5EIBC 4FKZA 1RAIA 3ZGOA 1WRBA 1DOHA 2DWUA 3IEPA 4E88A 1ZGAA 2OFXA 1JLRA 4CKWA 2ZM5A 2G7MC 2GUGA 2J9FB 3B1XA 3D9QX 4GPD1 4OUDA 1OT3A 3K9HA 3LY8A 1CQIA 1G3RA 4EY3A 1K5HA 3PJDA 1PBNA 2XE8A 3UAVA 3HJBA 1UFKA 5ILQA 1ZBDA 3VZRA 1LTQA 1G6KA 3ACDA 2EEPA 4YA6A 3ZWBA 1ISFA 5DCYA 1BDJA 2F2TA 2DX7A 1N1EA 1MR3F 2A0XA 5HVNA 1G64A 5KJEA 4CNQA 5GOZA 1PTJC 2GBFA 3PQ2A 1DKPA 3NC1C 3OC0A 2FZVA 3D3QA 3H1PA 1UKYA 3DL2A 1Z22A 4IV8A 4I50B 4NOMA 1UDBA 3HP4A 4RYDA 5LA6F 3QKSB 3JQPA 2NN3C 5AM5A 2GM3A 3W5JA 1OWOA 1VP3A 4B2YA 5CLFA 4V2UA 2C61A 4GECA 1KI3A 5ERYA 3HSYA 3BGVA 4GYYA 1KO4A 3ZZMA 4X3OA 1XLVA 4G07A 1M1YE 1KJWA 1A69A 3IDQA 1UINA 2QTRA 3KZXA 2QV7A 5H70A 1J5EB 4Q3LA 2B6NA 5A7GA 1E3MA 2WLSA 3WK7A 1CNMA 2A1TR 4HT3B 2WFMA 4XQGA 4E3ZA 2O8EB 2ZIFA 3TVYA 3VUFA 2VBCA 4CW7A 3CURA 2O7RA 5EMLA 3D3WA 3BMQA 2JA1A 4REMA 2VAXA 2J7PD 5BSMA 4OM8A 4DDKA 2QTMA 2WAAA 3GHYA 4JIMA 3MC1A 4TM7A 3D8SA 4E14A 3CVWA 1DSSG 4MUKA 1L7RA 1D07A 3NM5A 1J9EA 3IP1A 4J90A 3NQ41 2P41A 4IX9A 4A92A 2I4LA 3UT5A 4EO7A 1R74A 2PH7A 3ELUA 2REQB 1UM9A 2SCUA 4WV3A 4B8WA 4PC7A 1NSFA 1YHYA 2F8LA 2PLRA 1E66A 3G79A 1JXMA 4MJLA 1Y37A 4X44A 3N2YA 1OPRA 2GKSA 4LBVA 5C5CA 3AWIA 3PD1A 3HDQA 3GFTA 2I7VA 2R8XA 5E8JA 2IHUA 4BRSA 1OREA 4G0OA 1Y7PA 1VHLA 2CE7A 3V2HA 3EMKA 3OEEA 1WSDA 3OUZA 5GGYA 2IY9A 2WJIA 4YMUA 1FQKA 2HHAA 3QVLA 2K87A 1NNLA 4C30A 3PL5A 3F74A 4AJJA 1R0BA 4QTUB 3LPCA 3VKUA 1HT3A 1I3LA 1WNTA 3DV0B 4WLEA 3ZS8A 1WHSA 2EF1A 2XSZA 2Y9PB 4K6OA 4QUIA 1P3JA 1PLJA 3QKWA 1U1DA 4M7WA 4N5DA 1DPFA 5DULA 4OLBA 2JG3A 2QN7A 1DIRA 3A6PC 3OURA 1CXZA 1XQYA 1VCIA 2OHXA 4ZI5A 4ENRA 3OX1A 3UCEA 3GXOA 2CNDA 3PXCX 1W9HA 5FBKA 1GNVA 1GUZA 2JJ1D 2JLVA 5ESDA 3Q15C 4W1PA 1O94D 3TDKA 5LWQA 1A8QA 3REFA 1AHHA 2PX6A 2RHBA 4Q1EA 4OHOA 1PSZA 3LGAA 4NCJA 3EA5A 4XFDA 2EKBA 1YCFA 5J63A 1AT1A 4MRPA 2I71A 4P3XA 2Z2IA 2CUTA 3E23A 3HSSA 5BSKA 3EVNA 2Q07A 1CUBA 3ITKA 4BP3A 1JEEA 2C78A 3NU1A 4GI2A 3OQ1A 5AK0A 1TRKA 2JRLA 3IBSA 1KHHA 1M8GA 3DJFA 4MVJF 4KFUA 1ZEMA 1AG9A 4P5PA 2JLZA 2JGJA 3QX8A 5AUQA 3WFZA 1E1RD 5E7IA 3ZCPA 4HF7A 4QQ8A 1D2HA 1L5RA 1MRZA 3FSGA 2FWNA 4GW3A 2A4KA 3GCGA 3WLMA 4AB1A 3HO1A 3KTAA 1X2BA 3ILXA 4ZDJA 2LVBA 3B7GA 1PUIA 2C31A 2YVQA 1J2TA 1GRVA 1L7EA 2W4IA 2WMYA 2F62A 3KHKA 2VP3A 3KPUA 3ZU3A 2ZWIA 1IPFA 4C3ZA 4DNPA 2O0HA 1BA2A 2WKRA 1NAIA 2ECOA 3FVVA 2WU1A 2RHLA 3JASA 3N58A 5EZYA 4ZVOA 5FI3A 3CZ5A 4I5EA 4WXEA 2XZLA 3U5ZB 2GO1A 3K0FA 3FGOA 3QU9A 2UDPA 1B4DA 4MQFA 2X13A 4GXNA 3WJAA 5AVWA 1T9HA 1HE5A 3WADA 2CYCA 1QO7A 1CRWG 5DMXA 3HKBB 3MLEA 1WB5A 3Q5DA 1II8A 2EIXA 2H52A 4BLRA 2R8OA 1NGSA 3RF6A 2FVYA 4CKBA 2HHHB 1TUBA 2R751 4HDQB 5CAEB 1SU7A 5FWYB 5T6MA 4E08A 4N6OA 2UUCB 1KDTA 1JG6A 5AD1A 4MPDA 1H1LA 3UWMA 1CUDA 1ZGZA 2GK4A 4JGGA 4WEQA 2YJGA 3QPAA 2BFMA 2ZB8A 3AR2A 3QKRA 1IN1A 3GRZA 1USWA 1VI2A 4J4TA 2G70A 5DYNA 3RWOA 3K0KA 4DCNA 2SNIE 1UPXA 2GN0A 2WSIA 1U98A 3D7NA 4K6MA 3P1JA 4MKRA 2JI6A 2H3EA 1S3IA 5FKJA 4ATNA 5DX1A 1JR3E 1RKVA 3D3WB 1EE1A 4RNCA 4BXOB 3OZIA 2EG9A 5CFNA 4C4YA 2FJPA 2PEZA 3ECCA 2QS9A 5JI2E 5KAPA 4IRMA 4KNWA 1N5MA 3HH8A 2QTNA 2J9FA 4KUGA 4LHZA 5LU8A 1LPOA 3A7EA 4DAEA 1JA0A 2FCRA 3PQ3A 1N1DA 1BDBA 4S2UA 4R1QA 1ULUA 1Z5GA 4FONA 1BOOA 1UJMA 1WY5A 2LGJA 3CFYA 4BVEA 1F06A 2YS7A 1CBUA 3D1LA 3Q1KA 1AXRA 4RU1A 4S1TA 4CM9A 2R1UA 4Q3DA 5A2GA 2GEBA 3DEIA 1SU6A 4B7CA 1M6NA 1F14A 1XQ9A 1AKQA 1Z7GA 4HSGA 3MMSA 4ZIRA 3R1IA 2Q5CA 3D6MA 4LX8A 4R2HA 3W3ZB 1PAUA 1YHNA 2QE6A 3NB0A 4GVXA 2QZSA 3T9BA 1QDUA 4DSOA 5L7TA 3FHTA 5K5EA 1F8UA 4FFRA 5F12A 4DJTA 3EHEA 5JPCA 3M5CA 4HGPA 4F2WA 4DR3B 2XTJA 1MO2A 3AR4A 3DTTA 4EBBA 2D6FA 1B8PA 1RWXA 5F2OA 2XKAA 5C8VA 4GP6A 5JWOA 2CXRA 4W5TA 4B4OA 5F21A 5L45A 2WQ7A 4EEKA 4ZDKA 3QF7A 4OOFA 1SM4A 1AZSC 1X92A 4X7PA 4AZWA 4BLQA 3VR6D 1ZK4A 4IIEA 1I6MA 2YWRA 5GM2A 4U2DA 2PZBA 2QTCA 3NOVA 2XUDA 1O5TA 2PBRA 2XNSA 2B20A 4RTOA 1O6FA 1KDVA 2P2CA 2POQX 5DYTA 4J16A 1R9MA 2GRJA 3B9PA 5DK6A 3DYIA 4QYTA 2FXVA 4PNEA 3PGA1 5I51A 5L3RA 1M6VB 2G40A 2PZKA 3IJ5A 1WO8A 2WPDD 1RPNA 3PR2B 4LDJA 1UMDA 2EL7A 1L1RA 2DY0A 2N1MA 4EY8A 1V9LA 1H65A 5E2BA 1FRNA 1YZHA 1YRHA 2OCGA 4C20A 2ZAGA 1MT3A 2QTFA 3F6YA 4LRUA 4X54A 5AQEA 2GA9A 4OQ4A 4D44A 4DA4A 1U28C 3D64A 3QLUA 1TM3E 3IKVA 3JAKB 4OXNA 3ZG6A 3GJ5A 3NBAA 4URHA 1C3JA 1A8UA 4J16C 3TQIA 3IP5A 1ZCFA 3L18A 5HJ5A 3NRCA 1JDUA 3DDNA 3TMYA 1UF9A 1A8PA 4DF3A 3LHKA 4DPKA 4R71A 2C2WA 3N3BC 4FFBB 3AL3A 4I6JA 1THZA 3K5IA 1DAMA 2AOVA 1G17A 3BT7A 4LFCB 2OPBA 3KLPX 5HTOA 3JYQA 2A0FA 3OKAA 4KFCA 2QIOA 2VSYA 3K92A 4S3MA 1XQ6A 1H2BA 2I67A 5DNAA 3B6JA 2C2GA 3FAKA 5AYVA 5EE9A 2QW8A 1OFTA 4IWNA 3ZN2A 1RRVA 1PJ2A 4M7OA 4E4TA 5FFMA 1FYXA 2LR0A 5BN1A 3DBLA 3WQQA 2JJQA 2H0RA 1Z07A 1OTHA 2QRUA 5CEEA 1EQ2A 1T5OA 2QN8A 1VCNA 2QRLA 1MF7A 1ZXXA 2UYYA 3UMCA 3ACBA 3LG2A 1EG7A 1B93A 4QARA 5TF4A 2NXWA 2XB9A 2ZB2A 5BUQA 3HU3A 1B8NA 2DKOA 3DUFB 3HU2A 4NICA 1EDDA 1WLSA 4IQ8A 4DJEC 5JYDA 3EVCA 1WBJB 2C3UA 3LC0A 5B7NA 4W9MC 3H2JA 4CDGA 1U3TA 2NYUA 5EZSA 4RMGA 4UBLA 2BGUA 4HZUA 4RPIA 2UZ0A 3K8OE 3VJKA 4LJLA 4D0RA 2OWEA 5C46F 3CWZA 4TMXA 1V1MB 2W42A 5F5XA 5A9SB 4AM8A 4M0EA 4QYIA 5J2UF 4YS6A 1E3DA 1Q7TA 4FGUA 2WF9A 3CZQA 1QV6A 1V48A 3HUTA 3HXMA 4LE1A 2VYNA 1V8OA 3UJCA 4BXOA 1WKBA 1VGRA 4FE4A 3DZFA 4JIGA 4DV0B 1U2GA 4RH1A 3UJ7A 3G59A 3PLRA 5HUJA 4KWIA 3D7KA 2UVPA 4AICA 4LBWA 3N07A 3K1JA 3C14C 1SB9A 4IJUA 1D6SA 2Y1EA 2P1RA 5CJJA 3ZV7A 3QVUA 2FPSA 4I19A 2JGDB 3L2OB 3EF3A 4ZQIA 3IGFA 3L6BA 2OENG 2AFIA 1HKHA 3H65A 3TRDA 2HH9A 4C05A 4I36A 4NS1A 4BNDA 1EIZA 2CKDA 3LE8A 1I2CA 3I64A 3FSRA 1PQ4A 1WCYA 4QUDA 1MD9A 4YCSA 2XXAB 5ESXA 1ZOOA 4RA6A 1ECJA 3IDFA 3FWPA 3JVUA 2AJDA 2C04A 4FX2A 1P1RA 1QS0A 3OE1A 1N9ZA 4K86A 5CT8A 5J4YA 3A31A 4P7JA 2P35A 3CW9A 3DLTA 4IHJF 3SHQA 4ZYLA 1S8FA 2XCUA 4QICA 1ZCAA 3KZMA 4P84A 3O26A 4E5SA 2GJ9A 4G8JA 4MPPA 4N8EA 3DZHA 2BZGA 3QY0A 1BWQA 2QTGA 3WGKA 1NWHA 3JV7A 1CQIB 1LQ2A 1DUVG 2DWCA 3CJQA 1JKXA 3AF5A 1X1RA 4LHEA 4RKYA 3V46A 5C7IO 3LM8A 4UTNA 4RTSA 1F2UA 4TMVA 2EDCA 2MSNA 2VDUE 1PG5A 2V7GA 4M53A 3ND6A 4P5DA 3RS0A 5IH3A 4CTMA 2WUEA 3I2GA 3N2NA 4KYVA 4L3VA 4CM4A 3FOCA 4LECA 3RKSA 4JLAA 1JL3A 3GAZA 2VNJA 4D3YA 1J2UA 2OCDA 1N7HA 1XTBA 4RKRA 5FAKA 3CH6A 5A1TA 1BMFA 4HDSB 5EP4A 3WRWA 4B0PA 4EHKA 2R97A 1U3UA 2ZG6A 1RRKA 2QGNA 4NOLA 3T1YB 5TJHA 1CV2A 1F3LA 2I3ZA 1AOXA 1PWZA 4EKEA 3V7YA 1GTRA 2O8BA 5MFZA 4I1YA 5EGSA 1SELA 4L9SA 2BZ0A 1GA6A 1U9IA 2ACWA 1VJ5A 2W6MA 4PX5A 5L3ZA 4IHJB 1K68A 5BVGB 4G0XA 5AIAA 4QU8A 4Q1FA 2CLOB 1UFVA 1TCAA 1IHPA 2J0SA 3WYGA 3AEUB 1AS2A 2ACEA 2EDAA 4JH0A 1P1BA 4S1NA 1C0EA 3VUEA 4HQ6A 4YLYA 1WPXA 1QRSA 4PBRA 1KMQA 2BEWB 3KOWA 1U80A 1JFVA 2NSHA 3SC3A 2GCOA 3HR8A 1W5SA 1Z18A 3UWKA 2MSDB 3MWDA 4KB5A 1WSAA 1S4QA 2JCYA 3MBOA 1X87A 4Q34A 4QOSA 3ROFA 4D7AA 1TU4A 1LI5A 3PXAA 5TQ0A 2FEXA 1ESCA 3C24A 3TK1A 4B3DA 3NFRA 5JJIA 3HJFA 4NDNE 3IHLA 1RADA 5AVOA 1DRKA 1RWNA 3PDIA 1SD2A 3I1IA 1COZA 5DBOA 1CUFA 4Q4AB 3BEDA 2BMDA 5C0OE 1QZTA 1EUYA 5AHWA 3VYTB 3A8TA 3AB7A 2QAIA 3DB1A 2Z95A 3R6GA 5CM2Z 1JEAA 1MIOB 1PG2A 2XAUA 3I28A 3NHFA 4RYLA 4QJ5A 1T9BA 1ZD2P 4X1OA 5AVKA 4YXWA 2HMVA 3EC1A 3RT1A 1Z06A 3DAOA 3JRNA 5HF9A 4XTRA 4DQDA 1SU4A 1K9SA 4UHEA 4AMYA 2OXEA 1EM8B 1FX0B 1HURA 3SX4A 2PX0A 1DQSA 1OA0A 2XPCA 3EZXA 3F9IA 5CDFA 3ICCA 4HXGA 3IILA 3SMQA 5D3KA 1JMVA 1QGDA 2W2KB 5BO5A 3ZIAA 8MHTA 4BLPA 3G2IA 3I9NA 1QYWA 4RLQA 5E8RA 1HOXA 4QSHA 2AXPA 3EFBA 3UUWA 5LYJB 2X19A 1W36C 3KO8A 3CSSA 1BDHA 1CUHA 2R11A 3OCCA 2H0AA 3EDCA 4K9SA 1HT0A 5ISMA 3BWCA 4I3GA 5AUNB 2H31A 2IZOA 2Q8QA 3H0EA 4OXRA 2FY8A 1XZKA 2PVCA 3M1LA 2GDZA 2DETA 1P62B 3BM5A 2XHZA 3RF7A 4HNUA 1ZL2A 5F9MA 4NZOA 3B70A 1M66A 3A2NA 4HDRA 4PYLA 1P1HA 1R4ZA 1SQ0A 3UMFA 2F1KA 4D4GA 3CO0S 3FOAA 2REQA 1Y8RA 4YRCA 1A5BB 4A7PA 1M0TA 3PSHA 1PTJA 2VTDA 3JWGA 4WA7A 5CGZA 3IMKA 3ZUGA 2XR1A 2BMVA 1NP3A 3PLNA 4RZ3A 2OO3A 4EHHA 1UR5A 1MJ5A 2X22A 2CV2A 1SHZA 1W5AA 2WVJA 3GZNB 1EWYA 1Q3KA 3WZMA 4Q15A 1EXVA 1I4WA 1T8RA 2VTKA 3MGAA 4AS3A 4D4LA 2X0FA 1GKLA 1K8XB 3IRUA 4MAMA 3EQ6A 4B40A 2FWBA 2HPVA 1HG1A 5FQNA 4Z1OA 2HFKA 3LVFO 1U11A 3JATA 2O2GA 3RRNA 4IVRA 2E1RA 1V16B 3ORHA 3K70B 2Q3LA 5CTJA 4ITRC 2Q4BA 1XVLA 1E6WA 3L41A 1B8VA 3QVJA 4YGYA 3TX6A 2XMCA 4RJKA 4OHFA 2PZ8A 4IWXA 3T3OA 2Q2OA 1EFHA 3OTIA 1QU3A 3N59A 5C5EA 1G38A 1CUGA 3BOSA 1U04A 2ZP1A 3ZC3A 4KR3A 4ENUA 5FUYA 1R5OA 4ZAGA 1FSPA 4ND8A 5EWJA 1PZGA 3PNPA 1F12A 1SC3A 4QUEA 3ZDYB 4XYBA 3EG9A 3I9LA 1V45E 2HKIA 1Y3HA 1L1FA 5K2OA 1AZLA 2VUTA 3I6BA 2JLQA 5FI5A 1HPLA 2EWVA 2BMFA 1C0IA 3ZJYA 4Y0VA 5FDFA 1XO1A 3VNVA 1W4ZA 3RC8A 3DDWA 3FYUC 5D6OA 1D0SA 1KKLA 3PU6A 1EVKA 3UC9A 2FX2A 2I1QA 3CKMA 3U62A 1PJSA 3A14A 3E27A 3TJRA 4PYRA 5JVDF 1CR2A 1LNSA 1BHO1 4G4IA 1EIWA 4OX9Y 1JDZA 2QQGA 3N53A 4UHHA 3SIPA 3CWCA 4PO8A 5DU2A 2QMEA 5KWIA 1QKJA 4AMUA 4YPOA 1W0KD 1U3VA 1ZCBA 1B26A 3UXYA 4LDNA 3CZRA 1Z6PA 2H8GA 3O1IC 3TLKA 3L8YA 4IIGA 4DBLC 2I1LA 4B87A 1UJNA 2WPDA 2BSXA 2N46A 4LRTB 4UQOA 5D5QA 1YNOA 3L43A 3R7DA 2W6QA 1TQDA 2PSDA 3HYCA 1V35A 2JZOA 1M2OB 4M9RA 4W9RA 4KBGA 2FHSA 1Z6GA 1F2UB 2ET6A 4JLSA 5DYGA 3NONA 1GYRA 1PFQA 4I1PA 2B8JA 3WA7A 4F96A 2HJRA 1U5AA 4I55F 1JFLA 1FXWA 4FZ3A 5AT1A 2AHRA 3I37X 4G0PA 4QYWA 1Y5MA 1JA1A 5CVJA 1KE1A 2NTNA 2FSVC 2FWAA 2IZ0A 2VAPA 3P9QA 4BAZA 5EHZA 4NAUA 5HYVA 1E1LA 3ZHUA 4XYLA 2FN3A 2CL0X 3FX2A 3ISTA 4DUYB 3RIHA 1RLIA 2Z2XA 1YA6A 2PQ0A 4FVTA 3EVGA 3I53A 4D0NA 1PQUA 1IUNA 4EGFA 2G1KA 2HMAA 4P4SA 5I7RA 1ACLA 1G7SA 3MD9A 4II7A 4KO2S 4NE9A 4JLUA 3NV9A 3JQAB 3PHIA 3CLKA 1S89A 3DOEA 2GUWA 3FMGA 4TYPA 2CZQA 2V4MA 2Z4RA 4L50A 3BCUA 2VJNA 4LZOA 1QPGA 2HSDA 3DR3A 4GI3A 1R0YA 3PXUA 2MOKA 4CV0A 4EA8A 3CVYA 4P7KA 3E3NA 4IIDA 3MG9A 3UCFA 3Q7PA 5HZKA 4N18A 3T7DA 3PQ7A 3IUSA 5C51B 3ENNA 4R7GA 5DKFA 2GCOB 1E62A 5FYQA 4FIZA 4JBNA 2GAJA 3WIBA 1K3UB 3ZJ5A 4YRZA 3ONDA 2R8PA 2V97A 3L5OA 4ML3A 1MP0A 2P9GA 5FO1A 4X41A 16PKA 1K0FA 1VL5A 4EHAA 2WVAA 1H5UA 3JPYA 2HF8A 3DLHA 3WYEA 3NDRA 5BYJA 2OA0A 3RS4A 4DWVA 1RJ9B 2WP8J 5FBLB 3FPKA 5JI3E 2IE8A 1WD7A 2J59A 4OXYA 2OCBA 2Y77A 4CMEA 4ENVA 1TADA 2HCTA 1GTJ1 3KTFA 3O91A 4HNSA 4MUYA 2NSDA 3PA6A 5ED0A 2VNSA 1C8VB 5THKA 5AJXA 3V32A 2RONA 3OJEA 3GAMA 1LSSA 5ALDA 3ZV3A 5BSHA 1YU6A 1Y82A 3KYDA 4HH1A 1B6RA 3C3DA 3ZIUA 1QH1A 4OA5A 1Z6YA 4QATA 1A72A 1UZAA 4POAA 3U3OA 1AS0A 4EPTA 1UPUA 2FSVA 3QOWA 1NRWA 3MINA 2W2KA 3WMEA 4E2ZA 3C7KA 3OJWA 2HZBA 4C7MA 3OLXA 2C9OA 3CLVA 4K9NA 3PEEA 1J21A 3QLEA 4UCQA 1T5IA 3MTIA 4N3GA 3UMYA 1YVRA 3AIMA 1I7NA 3IMGA 3O73A 4QGHA 5TPWA 2XT0A 4HWOA 2D5IA 2XF8A 3WV4A 4URXR 5KYYA 1J8FA 2E4ZA 2ZYGA 1G5FA 2NZ8A 4JENA 4INJA 4BJ1A 4F2GA 3L6RA 2G06A 3A3YA 3RVDA 4FWIB 5FYDA 3OMWA 1YBHA 3TIIA 2XUQA 3VI4B 3I92A 4DLLA 1UP7A 2BGWA 3QHAA 4C88A 2WM8A 1E5QA 3BPSA 2DJIA 4FYYA 3TXAA 4NU6A 4C89A 1IMJA 2RGRA 5C9ZA 1G19A 5DBEX 1RWVA 4JDUA 1Q1EA 3TKAA 3DG9A 1XTJA 4ZU3A 3DTYA 1NFFA 4N47A 1IQUA 1Y4ZA 1C0KA 4UXHA 5HEKA 3RIMA 4PQEA 4EVRA 4BUCA 5IHXA 5KNBD 1H8HA 1ZKDA 5A7FA 1RM0A 4KQWA 2HMWA 1Q3TA 3PVSA 3L0CA 1EEXB 1R4MA 3IEVA 5IP5A 3QBVA 4A1FA 2VHCA 1ZJWA 1B7GO 3QSGA 4LC0A 2FQWA 5JSKA 1U0NA 3G2LA 4OHYA 4HWSA 3A4TA 2QQ5A 2VJKA 3OQ6A 1GLGA 3NOXA 2X2FA 4YI3A 4YJ2F 3VH1A 1MOQA 1CJKC 3KVNA 1NZFA 4RW0A 5CX4A 5ALMA 1IQ0A 3MWLA 3BDAA 3QIVA 3UH0A 2AWOA 1J0EA 4GOJA 5J47A 1DAOA 1K89A 4XLZA 3LHDA 2XRFA 3NKLA 2TSYB 4IDQA 4D57A 1IULA 3CB4A 3IKJA 5JWRA 1QIFA 2X0NA 1L7AA 1VC2A 1T6ZA 4GQAA 1T9KA 4UNSA 5G3YA 1ZSYA 2IPNA 3JYHA 5JS2A 2A9QA 4M1YA 1NV9A 3AOGA 3IBTA 4MSUA 1JBEA 5CNIA 3LWBA 4E6PA 3JSXA 2F3SA 3C97A 5KTSA 4XVRA 1YRYE 3SSMA 1STOA 4Z7JA 4CDNA 2I7CA 2P6OA 1G63A 1HE8B 1KYTA 1DWQA 2R96A 1ODSA 2PL3A 4QBHA 3HO8A 4QLAA 2ZR7A 4MAAA 3EXG1 3FROA 3G1UA 4AFNA 3I04M 3QF4A 4BNLA 2QP3A 2D06A 4PYQA 3RAEC 4ABYA 5E1OA 3GFGA 2QSUA 1RXSA 3E53A 4F85A 3Q9UA 2ZJ1A 2YZ2A 3CG0A 8OHMA 3DPIA 1GGMA 4OYYA 3I3OA 3CLSC 1H0HA 3HBMA 1I4EB 4WFIA 4E0BA 5DGDA 5C7YA 5CB0A 4Z0TA 1KDZA 2E82A 1JFTA 3ETJA 2XGJA 5BQ5A 2GXQA 3FM9A 2BI4A 1ZIDA 1E1QA 1VFPA 4BMYA 5A6VA 5IKOA 2F8TA 1H2XA 4I14A 1T6BY 2HU5A 3MT7A 2WPNA 1SCKA 3CH7A 4IOKA 1I7PA 2AMLA 3E84A 4BIIA 4IG4A 2L0XA 3EK2A 3C3PA 2GI4A 4TZ6A 4XVUA 3KSZO 3HCAA 4UZSA 2I2CA 1AMOA 2G0NA 4FR5A 4RANA 5CJ2A 4AN1A 4FGSA 2R8RA 1Z8HA 1M74A 1XROA 4DLTA 5AK5A 1U4NA 2DECA 1UJBA 3CY6A 2VJMA 2CC2A 3UHAA 2O8BB 1WUJS 2F90A 3DCIA 4DS3A 1CE8B 4GOKA 5A6SB 1PX2A 1VPLA 1N5IA 3P2OA 3B1WA 3CKLA 4O2LA 1H0RA 3GDFA 3KE9A 3OPYI 2OHHA 4RETA 3E22A 1TXGA 4V02A 3BE4A 1K6IA 4WMLA 2XXAA 3KYDB 1JLMA 2HA7A 3OCWA 4HB0A 1B16A 4HNAB 4IQ4A 4K9MA 2DFNA 1FRFS 4GX1A 5EE5B 2XKKA 1UPAA 4QDUA 3F4KA 5KQSA 3Q3GE 3BB3A 4AQYB 1GG5A 3UAYA 4AMBA 1AHPA 1IQPA 3AW8A 1Z5ZA 4QA9A 3Q8LA 1V7ZA 3PF8A 4H3HB 1V25A 2HU7A 3FA2A 5DM4A 1PF7E 4JBIA 3H83A 2OEPA 3RBVA 4Y7CA 3VISA 4B09A 4E33A 5J4HA 2B3TA 3Q3CA 1U02A 4OHZA 2HLNA 4X20B 3N0TA 4YQEA 2VSNA 3EAGA 5AKXA 4BMSA 4D3DA 1CZRA 3BBLA 5FHQA 1YRAA 4EHFA 3ELBA 1D9XA 1O95A 1SKYE 1W88A 3K0CC 1RI1A 4IILA 2P4SA 5TVGA 5BWLA 1Q0RA 2V3CC 4IH9A 2O0MA 3T5MA 2X86A 4YCAA 2BFFA 4Y9UA 2FZ4A 2PT6A 2X9LA 3CEAA 4YJHA 5BWCA 4X84A 5KQMA 1GL9B 4TN5A 2RHOA 5EZ6B 2O3QA 5FORA 4R1UA 4K05A 4UFNA 2WJAA 3NAQA 3L8EA 1TJPB 3FUXA 4PZ9A 3Q87B 521PA 4JSTA 2IC5A 3IEUA 1CEQA 1EZ4A 1GQFA 2HMUA 3QIAA 2F1RA 4YP7A 3ESZA 2AN9A 2JJ2A 4YCMA 3NHRA 1FP4A 3HGTA 4CG1A 2VJAA 4J1TA 2XD9A 3SJUA 4KLRA 1I1OA 1RJFA 2A6PA 3DMGA 1N0VC 4KWTA 3O83A 3STWA 4WY5A 2FFRA 2EZUA 5DP2A 4YV2A 2ZU6A 3D8TA 4F4CA 2F8MA 4YMWA 3X1XA 3FTEA 3NTOA 4NVRA 2A14A 3UIEA 3LZDA 4FNAA 4QQNA 1MX5A 2GF2A 5HQ3A 1UKZA 4R1TA 5LNK6 3HB1A 2IVFA 4BO5A 2R7KA 5CYPA 3DO5A 2W6ZA 5JASA 1Y8RB 2VDLB 1P5JA 1KJNA 1GPNA 1PT9A 1ZEJA 3JWPA 3TJZA 5KC9A 1QZZA 1JBKA 3D2AA 2TMKA 4GSLA 4WLOA 4FINA 4ZZIA 5HJEA 4DIMA 2F4NA 2GNPA 3RRFA 4DIFA 1QTRA 5B64A 1G6Q1 1FBNA 2OGUA 4G25A 3SDSA 5B1YA 1QQ7A 3LPDA 1YR7A 1GV0A 4PV7A 1AIPA 2YNMA 4R9UC 3ROGA 3VU8A 1FYWA 4EKNB 4P0QB 1YKGA 4YALA 4EB6B 4PRZA 3NHBA 2C7PA 1FY2A 2X42A 1KI9A 3GJZA 1LPMA 1WXHA 3VOAA 4ON9A 3WK9A 1E2BA 3OJXA 1F0NA 2YQ5A 3RADC 3BQMB 3UKJA 3ZY2A 4UC0A 2GARA 3CO5A 2B4AA 2PCJA 3N3AC 4XCXA 5ICMA 1NKVA 2OO5C 2ZAMA 4PRLA 2R6JA 2HLDA 1UXJA 4F4HA 2AXNA 1OI4A 2BJWA 3CNHA 1XZHA 3N05A 4K2AA 4LYAA 3OEED 1P72A 2WLTA 1UXHA 4OPMA 4HH0A 2D4AA 2VEDA 1T6XA 3KG2A 2ZTVA 3NIWA 4EO9A 3ZZTA 3PUVA 1R0KA 1SIOA 5EESA 3ESDA 4P4LA 2YYAA 2VT6A 3HGMA 3IURA 3UUEA 1XXHA 4G5YA 4IYJA 3OU2A 4HAYA 2BZ1A 4RVNA 2V6FA 3HWWA 4QG3A 1NXOA 3D7SA 1FC0A 1H9BA 2K7ZA 4U0JA 4J9UE 5DVZA 3PEWA 1KOJA 1EX9A 2ZBFA 4B6QA 1TZKA 4MQEB 3IAXA 4JOCA 3T7RA 2WTUA 2FRDA 4BPRA 2PIDA 4OP1A 1IM5A 1NZJA 3B6ZA 3VR0A 1EWQA 4X1KA 3KFLA 1ORVA 3P97A 3LTNC 2FUNB 2G9ZA 2H1RA 2WBLC 4Y2YA 3GARA 3R9XA 2WILA 2C1XA 5LZ2A 1TM1E 3OZVA 3R6DA 4LJ4A 2X3UA 4OUDB 3GFOA 1HNWB 3GFVA 5CLIA 4JZKA 4ARCA 4CGZA 2O3SA 4MV4A 2ODPA 1YB4A 3EXIB 3KJHA 1P80A 4E7PA 1GL7A 1M7HA 1K8QA 2NG1A 4JR1A 4MKZA 1A9RA 4F6RA 4IIUA 2OBXA 3W2IA 5IDQA 3V1TC 3OQOA 1Y81A 3PT5A 4AL4A 4AZSA 1GNRA 4LY3A 4PG6A 1A7JA 2P2SA 1XT6A 4L3OA 3OE5A 4UXIA 1IY1A 1CZLA 1U2GC 3WYDA 4L7QA 7REQA 1GG2A 1FUEA 2GQ0A 2C2BA 4RY2A 3GP5A 2Q5JA 4MVJE 1E4YA 2CLHB 5HOQA 3PGKA 1TCCA 3QJGA 2WJHA 3HDGA 5H82A 1GGNA 3P0EA 1KY2A 2MCFA 1WMFA 1G2IA 4ZAXA 3ZXUB 5HIIA 4MB0A 5JECA 1CEEA 3L01A 2NGRA 4FX5A 3RG2A 3BBPA 1BEZA 1HYBA 3FMIA 3GT4A 4PZLA 1GRRA 2AZDA 4KSBA 4DV4B 1WSWA 3CUEF 3LNCA 3WQRA 4KYTA 1SBZA 3IV6A 2ZJOA 3DOUA 4ANFA 1YUBA 1M8JA 1YAJA 2X0KA 4G97A 5EPEA 2OGZA 4PZYA 4P7FA 3S2IA 4ZPJA 1JIUA 4I55B 1U28A 4Z4HA 4I6EA 4WKPA 1AKVA 2P3LA 2C92A 1ZJ5A 3AUYA 4HFJA 5LXTF 4BKRA 3H13A 5DHFA 5PNTA 1N3BA 1E2KA 5KREA 1HNZB 4UEKA 5BORA 2ZVDA 5H68A 4QE3A 5DTMA 3I3SR 3PIRA 1BHJA 1YACA 2DXIA 3R5HA 4NARA 4OH1A 1L5GB 4ZOAA 1PTKA 1SXJA 2PWPA 3A3OA 4KFRA 4X20A 1RKUA 1S5PA 3JZMA 4E5KA 1TAUA 1TPZA 2GHQA 3ZJVA 1E1QD 1GU1A 4WK2B 5TNXA 5ICEA 5KZMB 2ESRA 1XKLA 3ADKA 2W9XA 3UEOA 4UAUA 2C4HA 2I6FA 1Z2NX 2OQ2A 4LXXA 4LF8B 1D7AA 5AKHA 3CNOA 3QPWA 1LDBA 1US8B 4LSGA 4EW2A 1SXJC 5BT8A 4AQ7A 2B4QA 1XELA 4QUJA 2D1FA 1MAHA 2Y1LA 4O5OA 2ZQ5A 1T35A 2P79A 3MHTA 3FWNA 4KR0A 4C5AA 1N5LA 2O05A 1GTG1 1WXFA 1SUBA 3BQ9A 1RC1A 3EZ9A 3O3OB 1QG6A 3VH2A 1V6AA 1A98A 1YS4A 1Z4PX 4LNHA 1GTVA 1RXYA 5TF0A 2GVDC 2WR8A 3W2GA 1XDDA 3AUJB 1G1MA 4Q9JA 3PKIA 4GWGA 4UQPA 4OBEA 3T15A 3I9V6 1NY6A 4QGAA 3IJRA 2FW1A 1XRSB 3MJRA 4FZJA 3EXG2 2BEJA 4TWAA 3ZBTA 1WU7A 2YYSA 3P2JA 3R5XA 1FNMA 1MJGA 1SKYB 2JAOA 2Q4TA 3DD5A 4NNOA 5K09A 2M2IA 2MYPA 5K03A 5K8CA 4L6IA 4QBFA 1QUFA 2OY0A 3BIXA 4G86A 2ENWA 3TW0A 4OJNA 1DZ3A 3IDSA 4B4KA 4EDFA 1BKDR 1NULA 3KALA 4XR4A 3FVTA 1TKRA 2W71A 4DLXA 5ADHA 2GAOA 4YCJA 1HDCA 3C3AA 3T35A 2IS4A 4ARVA 1QB7A 3QU4A 1DIAA 2BC9A 1DZIA 1VIDA 5EUMA 1SRQA 3G9TA 4MYTA 1MPTA 4RGBA 5HE8A 3FTQA 3HB5X 2O7QA 4DQLA 5KC8A 1ZO8A 3C3XA 2BEKA 2GZMA 4A03A 4Y9RA 4D9JA 4A5SA 2QXYA 5LP6A 1P9OA 1U8UA 3VRHA 5CDGA 3W5UA 3L1VA 3QV1A 4TT8A 4L3WA 4MZXA 4BB6A 1KVTA 4M4SA 2ECQA 1DIGA 3KDAA 4L8WB 3KB2A 2NSLA 3WLPA 2GAFA 2G4VA 2Q41A 4CWAA 5DP1A 2VDWA 2YV1A 2R1VA 2F67A 3PRYA 4FYHA 1R3UA 3MWGA 4RIEA 1NJ8A 1XTZA 4N54A 1YCDA 3ETCA 2OC9A 2C29D 1PK8A 3I5UA 4B0OA 1M0WA 1LB1B 1W76A 2X5JO 3K35A 2NPFA 3A6JA 3BX1A 2B7CA 1YB6A 1GZVA 4UUNA 1HE3A 3MAGA 3GMDA 1AB6A 2NUBA 3HFJA 3IKLA 3R3WA 1S0UA 2RHTA 4YAEA 4XOUA 1S2DA 3W34A 4B6GA 2Q5QA 2P7IA 5CGQB 1OUMA 1JA9A 3CRNA 4RJIA 4ZVRA 4TUYA 1J07A 1NBEA 3IB6A 1ZH2A 5A2QA 3UVEA 2C5BA 1JECA 3VA7A 1O5IA 3LDFA 4TSKA 3TLCA 3WQSB 4YB8A 2RHHA 1Q3HA 4CUZA 3H8JA 4JP2A 5JQGB 3P7MA 3VX3A 1CB0A 1FTYA 1G20B 2GEVA 1FRZA 4Y7DA 3OJOA 5GIOE 3PX2A 1JHXA 1YKFA 2OAQ1 4MWCA 4RESA 4F9FA 2Q5OA 2EQBA 1SCJA 2QYSA 3QA9A 3L5KA 3RU7A 4O4LA 2C3PA 1JZTA 2YMMA 1QMGA 1GDTA 2KLBA 4B7XA 2BKVA 2ZPAA 2P9JA 4C03A 4RZXA 3IAS6 4MVWA 4EFLA 4MGIR 4PO9A 2ZW9A 3RU2A 1XTIA 1PO7A 3EUFA 2EU8A 3RJMA 4EHBA 2OFFA 4ZI3A 4WFQA 3B1JA 4KLCA 2XW6A 4LZJA 4UJ5A 1G41A 4LK2A 4WN9B 5TT1A 3RVMA 4X6XA 2LP4Y 2OZLA 5CB4F 4EGSA 1VL1A 4D2IA 4U63A 4D3FA 1L4BA 4R2MA 1IBSA 2J5QA 4PLPA 1DS6A 5AVXA 3PEUA 1TO2E 2RAUA 3C5WP 4EGAA