1YZQA

Gppnhp-bound rab6 gtpase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
164
structure length
164
Chain Sequence
FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small GTP binding protein RAB6 isoform
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yzqA00
2ZRGA 2HXYA 4ZKEA 4C9BA 1W4CA 3Q5DA 2QAJA 3B1XA 4JL5A 3CKLA 4AWXA 4Q9KA 5FI1B 1MRNA 4CYMA 5CIWA 4DLWA 2HYIC 4EIWA 2IYZA 3CPEA 5BN3A 4MRVA 2D62A 1NSTA 4JLOA 3X1DA 3KB2A 4BLRA 2A5JA 2FSHA 2QQ0A 4M22A 2D7DA 4HYYA 4I81A 1KIMA 4B3XA 1MABB 5EUMA 2FE4A 4JIMA 1T0JB 3AP2A 4AURA 2VTKA 3AVYA 1Q1BA 2ZAOA 3OZXA 3Q3JB 3Q7PA 5A0FA 3IIKA 4M9XA 1CTQA 1AQYA 1H8ED 4D81A 3J81k 3KJIA 5H68A 4OK3A 1ANKA 1W0KD 1UJ2A 5AJYA 5BQ5A 1KI2A 1Q22A 3ZZTA 1DAMA 4DLZA 2QP4A 2VSOA 1V5WA 1F2TB 2O8DA 3THXA 2VP9A 3VFDA 2JA1A 2REOA 2R62A 4F92B 3UATA 2B8TA 3SNHA 1SVLA 4CT5A 3CZPA 5FTKA 3WNCA 1QHYA 4C0HA 1GL7A 3I8XA 4Q9LA 4BFTA 3KJGA 1P9WA 4PZZA 4JLJA 2OG2A 4DBLC 2GZHA 4BUJA 5HCNA 3D8BA 4DT1B 1XTQA 2JLUA 2V3CC 3T1QA 2DB3A 3KXLA 1TADA 2ONKA 2FG5A 1WRBA 2AKYA 4ZV4A 1YZUA 4TYYA 1NJFA 3C41J 1ZIPA 3FFBA 1P2TA 2NOAA 1RE0A 4HAXA 4O2RA 4PC3A 3AVQA 3RS2A 2W0MA 5TARA 4LZZA 3AEZA 1OXXK 2P2LA 4KU4A 3REFA 2EU8A 3W34A 2QPAA 1I2MA 4Q48A 3A1TA 4B2IA 2BMDA 3LNCA 3CONA 3A4NA 1KJYA 3SJZA 2F3RA 3A37A 3FKSA 1G7TA 2HXSA 2P6NA 2AHOA 2J0UA 4JVSB 2ERYA 1E69A 4HB3A 2EYUA 4B74A 2V1UA 3MWLA 2GBLA 1CF4A 2FOLA 3EIQA 2LKCA 3G82C 2XNDD 3LVRE 2DWOA 2O8FA 2FSFA 2QY9A 4KBGA 1PLKA 4U02A 4ZDJA 2ZJ8A 5E7JA 3CX8A 5AK0A 4LYHA 3BBPA 2VBCA 2ZSDA 2I1QA 4G5RA 2AD5A 4DUGA 1ESNA 3SJCA 1U0LA 4FXPA 4HLUA 3I72A 4MYHA 1WQ1R 2NO6A 2YOFA 3MRSA 1NF3A 4BFXA 2BMFA 2ZRMA 1G19A 3LA6A 4RJLA 2JIZA 5L3QB 1GG2A 1UBFA 2IF2A 2V8OA 4BZPA 5EZ6B 1VCNA 3BFKA 3C7KA 4XTRA 4CVNA 2D7CA 2XNSA 1ZUHA 2J7PA 4IJMA 2GTPA 1NLZA 2RGEA 1CULC 1AGPA 1IY1A 2OCBA 2OFOA 3AVPA 3HYTA 2FSIA 3CW2A 2ZIAA 3LDAA 2G1KA 2QE7A 5L3RA 3NHAA 4Q02A 4B3DA 4DCUA 1B23P 1ZD1A 4YC7A 3CRMA 3AB3A 1OYYA 4KITB 2PX0A 1NLFA 4LX0A 1XMJA 4YDSA 1US8B 5C2JB 3B8HA 1KZGB 2QPOA 4RD6A 3FPAA 4A8JC 2VIIA 3U7FB 1D2EA 1SZPA 4PQRA 1JJVA 5DH9A 2GXSA 2GXAA 2W6JA 4N0EA 1OH7A 1IAQA 1R4AA 5FI0B 5H70A 721PA 4MRRA 1GNPA 2ATXA 1RZ3A 2RGBA 1ODFA 3ZVMA 4AKGA 3KJEA 1UEIA 4DKXA 2ZR0A 5LD2C 4TT3A 1XTKA 2XOKA 4RZUA 4UJ3A 2ZR9A 3EZ2A 2VSFA 1J8MF 1Z6TA 2WWFA 1TQ2A 2IXEA 3IBYA 1LFDB 5EP2A 2OBLA 1U8AA 2ASEA 2ZE7A 4CIDA 4TZ6A 1PUIA 3VNUA 2VHTA 1COWD 2YINC 3CH5A 4B47A 1NLYA 1IONA 3AVOA 2WPDA 3JZAA 4WZAE 1W7AA 1M7HA 5CB8A 2L0XA 2DCUA 3EZ6A 4F4CA 5JSZB 2WWXA 1A7JA 2J45A 2GJ8A 2G9NA 2OSBA 2PT7A 2KI5A 1N0WA 1NBMA 2QMHA 3WMGA 2RMKA 3HDTA 5HKKA 2XTNA 4G0NA 2BBSA 1II8B 5JLJA 4H1VA 1N5IA 4FCWA 2XGJA 3O8DA 4RSGA 4GT1A 3EWSA 2QI9C 1OIWA 2YC2C 2ZS7A 3SQWA 2WMOB 1TL7C 1QHIA 2MMGA 3OE7A 4P3YA 3LX5A 4PAMA 4B3BA 1S0UA 4D0GA 4EDHA 5FR1A 1FX0A 1KJWA 5AR1A 4Q66C 1KMHB 4JLNA 2ZRKA 1M1YE 3LAWA 3UWOA 1TX4B 1A4RA 2O8EB 4JS0A 1TQDA 1U0JA 2CEAA 4TQUS 4Q19A 5TV2A 1SXJA 4E5UA 1T0HB 3CPHA 5EE5B 4BGDA 3PG5A 2X1VA 3RRZA 4WVFA 2PZFA 4A2WA 4URZR 3K09A 1E2PA 2IS6A 5EXXA 2X8AA 3ZQJA 1QDEA 4KFRA 3A36A 3K70C 2C2HA 3ZVRA 4BEJA 1YZQA 4AIIA 4B73A 3HU3A 1KAOA 2IYQA 1G5PA 2GEUA 2F43A 3U5ZB 3U7EB 2HYDA 4DZZA 1JR6A 3EXAA 2ZRJA 1Z6XA 3EWAA 1P4SA 2PMDA 5SZJA 3ZH9B 2EFGA 2FF7A 2CL6X 4AYTA 2DFLA 4OHWA 2ZTSA 4IDOA 1KZ7B 3B6EA 1XTIA 4MRNA 1YZNA 2FDCA 3T34A 2PZEA 2ZROA 5EQTA 5DSZA 1NY6A 5EP4A 4B33A 5CYPA 3QOFA 3P1JA 4EFMA 5HPYB 4P32A 5C18A 5J47A 3QQ5A 1KNQA 4Q4JB 2GCOA 4Q7KA 2GVZC 1EFRD 1T8TA 2QNRA 4ZIRB 1Z0JA 3MMPA 2IYRA 4A0RA 4LBYA 5KSYA 4HAYA 2PEYA 3OIUA 1AM4D 4Q9IA 3B1WA 4HDCA 4FCVA 4PSAA 2JEOA 4ON9A 4RVCA 4M53A 4QBGB 4TSFD 4LHVA 2OEPA 2KE5A 4LV6A 1Y63A 2ZRLA 4QGFA 4ZDWA 1GM5A 5J40A 4RD3A 3DMNA 1CBUA 4LJYA 1N6HA 1HUQA 1FPMA 1Q0UA 2F1JA 3TQCA 3KKMA 4EAQA 3ICQB 3A58B 1E9SA 2YZ2A 4TLEA 3MWYW 1QHSA 1S3GA 1RRCA 1ZU5A 2BKUA 1OFHA 1R7RA 1WCV1 1YKSA 3LBIA 2X77A 1YR6A 3TUIC 2FX3A 2J9RA 4B2LA 4GOJA 4LCBA 5GVRA 2WKPA 4TTRA 1XZQA 4O0MA 1Z0AA 2E87A 3AVUA 2H5EA 5L3SB 4DLUA 3H0KA 3QKRA 3V4RA 3QJYA 4XSHA 4QKQA 2Z4SA 5FPKA 1SGWA 2Y8EA 3MWKA 1Z8FA 2G83A 2R6CA 3UIEA 1W47A 1YR9A 3U2QA 2H7VA 1DG1G 1YZKA 1BS1A 1Z28A 4KXFB 1GOTA 1BYIA 2UKDA 4NCNA 1M34E 4H1UA 2XSZD 1CEEA 4C2UA 3B78A 2Z4RA 3U3RA 3AVVA 2BOVA 2XZPA 3Q9LA 3OEED 1N25A 5DN6D 4QNRA 2YWEA 3FGNA 1G1MA 2QAGB 2W00A 3PCRB 4M0LA 3Q7QA 4P4SA 3PIRA 1ZNYA 1UKYA 1E6CA 3DKVA 3K0CA 4URXR 2AWNA 2ODWA 2BJWA 3GFTA 4HUQA 4A9AA 2ZU6A 5FTMA 1FX0B 1E2HA 3H84A 3CX7A 4V0LA 1HTWA 2ZRDA 4M21A 3QKTA 4PZYA 1EX6A 4IFBA 3L8ZA 4XWOA 1NVWQ 2VHQA 3DKPA 2P67A 4IW3B 1A2KC 4Q47A 5HZKA 3QBVA 3I1FA 1BYUA 1OXSC 4A92A 2DYKA 1TPZA 1ZJ6A 2D74A 2QN6A 4DLRA 1KO8A 4QRHA 1JR3E 3PFIA 1E79A 4Q4LA 5KHOC 3PEYA 1HEIA 4HAWA 3EG5A 1XPOA 1EGAA 5FOTA 4CEJA 3WP1B 2IYVA 2CBZA 4LY6A 3TGPA 4NCJA 4FD2A 1R8SA 2PEZA 1SVWA 1ZM3A 2GHIA 2WSSA 3AKDA 1N5LA 1R8QA 4DLXA 3P20A 1OLOA 1QHGA 3GJXC 3H86A 3KTAA 5JI2E 3O8CA 2ZM5A 5EP1A 2ZQ5A 1XBTA 1YR7A 1ETUA 3FHCB 1FTNA 3B82A 2FEMA 1VHTA 2Z6VA 4HZUA 4JT4A 521PA 1PJRA 3GJ7A 1OH6A 1YVDA 2DY1A 2NQ2C 1Z83A 2HJGA 4GMDA 4IOKA 4UKDA 5IK2D 1NG9A 2YVUA 3RS0A 1OJLA 1W46A 3IGFA 1N2CE 2J1LA 2FH5B 5FUVA 4GRAA 4HAVA 4IVPA 4B35A 3OAAA 1UEJA 2QZ4A 4WAUA 2OXCA 4M9SA 5EE1A 2QP9X 2JJ2D 4ESVA 1WE2A 4PC2A 4TYWA 5FOUA 1IOZA 2IC5A 2X2FA 3B13B 3KUDA 4HAZA 2OT3B 4PHTA 4OHXA 1FNMA 3AP3A 3HJNA 5DI3B 3WY9A 5CB6A 3GLGE 3E5HA 2A5DA 3C5CA 3GCGA 4A4DA 2OHFA 2HLDD 1R0WA 2ZE6A 2GA8A 2QU8A 1NI3A 1G5TA 2GEVA 2PX3A 3U4QA 3NBXX 2PZGA 3CZQA 1UBEA 4Q00A 4IDQA 1W4RA 1IN7A 1E1QA 4G5GA 4LYAA 4KSCA 1R0ZA 3W6PA 3GLHA 5IF9A 4WXRA 3EC1A 1A1VA 2GXQA 3K0FB 4BZXA 3FMOB 3P4XA 4DSNA 3T12A 3UANA 1ZD8A 1HURA 3K0AB 4EPVA 2NGRA 2Q3MA 3KQLA 4NCHA 5E4FA 1XEXA 1JBKA 1MO3A 1OF1A 4KI0A 4CEHA 2R6GA 4JL8A 3H1TA 4UXIA 4W9MC 1V43A 4PAQA 3GLGB 1W5SA 2GF9A 4MYCA 4YXWD 1U9IC 4PAOA 3FTQA 5J4LA 2HT1A 1SKQA 2G1JA 1TAGA 5G53C 4PTLA 3TJZA 4EFLA 3FVQA 4PZLA 5JCPA 2F9LA 4GNKA 5G3YA 2AWOA 3MWJA 2DWPA 4JLDA 1C1YA 2NPFA 2C98A 5E95A 1VIAA 4TLBA 1W36D 2GRJA 1MABA 3BE4A 1DADA 2J3EA 4I1UA 1LS6A 4L9WA 3B5JA 5GJBA 4AKIA 3GPLA 4QHYA 4A2PA 1ZU4A 2YWGA 1II0A 2DFTA 5KNDA 1DARA 5EUQB 3G5UA 2DFKB 4E22A 1NKSA 1UBGA 2IXGA 3KL4A 2HV8A 4LJ9A 1G8PA 4DDUA 1GRNA 4B34A 1L4YA 3QPWA 3R8CA 2FN4A 4ZCLA 1JECA 3ADCA 4JZKA 2Q9BA 1YU9A 4M1MA 4PX9A 3VR3A 3O8RA 1BMFA 4IXNA 4CF7A 3GJ5A 3VR5A 3ZVNA 1RJ9B 4BPBA 1F2TA 2DHRA 3U6BA 5E7MA 5FUXA 5F2EA 1RW4A 4WBSA 5GVSA 4XD7D 2WJIA 1YZGA 1SULA 1KKMA 2QM7A 4EPRA 2GZAA 2O52A 2F1RA 2F9MA 1XFAA 2I4IA 2JIZD 2GVDC 3NDBB 5B58C 4A8JB 4OQXA 4EPTA 4US2R 2JDIA 3IQXA 2J7PD 2G77B 2P5SA 2QPTA 5L8VA 1SVIA 3I4LA 2ZS8A 4UJ5A 4DT1A 1OKKA 1DELA 3QE0A 1T5LA 4NMMA 2QE7D 3X1XA 1QRAA 4KFSA 1DAHA 3AUXA 1VECA 5C4GB 4JLAA 2YKGA 3Q85A 5AJXA 3TUZC 5LD2B 3SS8A 4Y0AA 2RGCA 4TYNA 1E1RA 1IHUA 1GFIA 3CX6A 3TR5A 4DSTA 4PR0A 3EPHA 3IIMA 1E9BA 3C8UA 3UK6A 5CLLA 4EJSC 2XX3A 1E32A 3K0SA 1SVOA 4V0ME 4FWTA 4PQFA 2G3YA 2V1XA 2N46A 2QA5A 1Q57A 3S1AB 2MSDB 5EP3A 5IRCD 4HLCA 2GKSA 3V9PA 1G4AE 4TTPA 4MDEA 2A3RA 3R9IA 4E07A 1G8GA 2XOKD 3VR4A 2EWWA 1EFHA 1RRFA 2VHUA 2AD1A 4EPWA 4KAXA 2FZ4A 3L2OB 3LQRA 3QXHA 3KQNA 1NMXA 3EW9A 3NEJA 3TW8B 2FPKA 1P61B 4FMCB 5AJVB 1TU3A 3WBJA 1OIVA 3CNNA 2G6BA 5CYOA 2I1VB 3L82B 1UAAA 1KI4A 1S9HA 1ZBDA 4TZ0A 1L7VC 2GJ9A 3N2IA 1D9XA 1ZP6A 5L3QA 4C0QC 1NBMD 3ZZUA 2WZQA 1D8TA 4B3CA 3HWSA 3QF7A 5KPDA 3ZIAA 3C15C 1YZLA 3R7WB 3RS4A 4V0KA 5C1BA 2K5UA 2ANBA 2QRZA 3EA5A 4PHGA 4AD8A 4OHYA 3W3ZB 3UG7A 2RB4A 3GD7A 3OE7D 2JJ1A 3K70B 4TMKA 5FTNA 3BS4A 4NCIA 4URWR 1GIAA 2WOOA 4MUBA 2CCJA 1GP2A 2IS4A 3PEVA 2QTVB 3DDCA 1E96A 1E9CA 1US8A 2IWRA 4DC9A 1Z2AA 2VO1A 1GTVA 4K8OA 4MRSA 1SXJD 4UNPA 4IDNA 2CL0X 1CS4C 1EK0A 2DR3A 2ZI3A 4BQSA 2CK3D 3IILA 4AG5A 4ZKDA 1QG4A 3K53A 1OT3A 1OIXA 1DPFA 2I3BA 4PPQA 2IBMA 4FIDA 4YQFA 1KI3A 1Z07A 2ZYWX 2IA5A 2BKEA 4AKHA 3TH5A 2RGAA 4KVGA 4S35A 5KOYA 4LHYA 1TF5A 1GILA 2AFIE 5CIQA 1E4YA 4MA4A 4ZO4A 3VQTA 1G20E 2FFQA 2PCJA 4GFDA 1F48A 5TMPA 2XTZA 1R5NA 1XDBA 4Q7MB 2KBEA 2ZUCA 2OCAA 4KO8A 4Q7LA 4R7ZA 4XVUA 2ZJOA 1XCPA 5FPHA 2UZIR 2Q0HA 2J0SA 1KAGA 2ZRAA 4FW9A 3KQKA 5JSZA 2A5GA 4HEJA 4NYMR 1E2EA 4ESHA 1CR0A 1II9A 4II7A 3K9NA 3WHKA 4L4UA 1TNDA 3NDPA 5FL7A 2IF0A 1XTRA 1KTVA 2N1BA 5FBWB 3WMFA 2ZRIA 1II8A 4R98A 4A6XA 2XJ4A 3NXSA 3VMFA 4YMWA 4PSVA 2EFEB 3C4JA 1UDXA 4XVRA 3GLFB 3I3SR 2BHRA 2NMVA 1P2UA 1X8KA 2OLKA 3HPRA 2IHBA 2BC9A 5LDDC 1N6RA 1ZVQA 3SN6A 3T06B 1BKDR 4NYMQ 4UNQA 1GRQA 1KMHA 3ZZ0A 5SZIA 1K6MA 1IY0A 1RIFA 3TK1A 2ZI5A 2CLSA 4TQAA 2GJAA 3THYB 2O8EA 5JJKA 3QVUA 2B92A 3VKWA 1MH1A 4RD4A 4MYTA 2KWIA 3ZD7A 1G4UR 3W6NA 3KKPA 3UG6A 3BH7A 2XZOA 4FMCF 4E09A 2ZJBA 3OIVA 3RC3A 5HTKA 4TMWA 1BOFA 2ZRFA 1VCMA 2GAAA 2FMXA 4OK6A 4V0NA 4X8LA 4DHEA 5BWMA 2WTUA 4WZ6A 3NKVA 1QF9A 3BB4A 2IEYA 3R9WA 3FKQA 2VSXA 1X6VA 2F6RA 3GLIE 1OHHD 1Z6YA 3GFOA 3LLMA 2O0KA 2DBYA 5G3ZA 3KDSE 2EVWX 4KLZA 3VR6A 3U3JA 3DOEA 2WWYA 4QBIA 1FZQA 3ZVLA 1X1RA 2GNOA 3DEFA 1YE8A 5TB5A 4Q1FA 4JBXA 1W0JD 1EX7A 1GRRA 2BEJA 4F4JA 2CHQA 5FUYA 1Z0KA 4Q4JA 3SBEA 1RKBA 4L8GA 1Z06A 3EIHA 3RS5A 1U8ZA 4ZIRA 1P2SA 3U3KA 4GI7A 2WMNB 4PPFA 2ZJ5A 4I1SA 1DTSA 1EFUA 4QBFA 2RGNA 4G1UC 3AP1A 4IKEA 4QBHA 2P6UA 2R2AA 3SI7A 4AYXA 4D26A 3ICEA 1F2UB 2VH5R 3SJAA 2CNWA 1E9FA 2UVQA 2ZUBA 4DLSA 1PVOA 4GBMA 1GDDA 2C96A 4OJQA 5D3QA 2WVJA 2BBOA 5J5CA 5DNYB 2J0QA 3UWKA 4LV5B 3ASYA 4OQLA 3FDIA 2RAPA 4CGZA 3GLIB 1KO1A 2WHXA 1CLUA 4BFVA 4W5WA 2NZ8A 3OFNA 1IQPA 4HDQB 4F4IA 3LXXA 5KDOA 2R9VA 1IXRC 1NSFA 3B1VA 3LLUA 1JAHA 2ZITA 1MT0A 2W2VA 4OI1A 5JBQA 4BECA 1T6NA 4GL2A 5EJEA 2X2EA 1DBSA 3KKQA 5JCZA 3C16C 1KDTA 4HAUA 5EE3A 1EFCA 5SZKB 4C30A 4PANA 3OEHA 4US0R 2GCNA 3EPKA 3M6AA 3AH8A 2EYQA 4JVNA 1H65A 3RS7A 1AS0A 4EFNA 1IN6A 5L3SA 3DO6A 2BMEA 3TW4A 3WYGA 1KSJA 4KCGA 4K81B 4HDOB 1N5JA 1Q3HA 3IQWA 4PXAA 4QG7A 4TYPA 4URVR 2YV5A 1Z2CA 2DFNA 1NNEA 2IUSA 2O0HA 4Q1AA 1N0VC 4QGAA 4TMVA 5JECA 4DXAA 1DAFA 1F5NA 3NHBA 2VA8A 1R0YA 2JLWA 3IO3A 3W8NA 5J4VA 3CRVA 2OM2A 5KYKA 4A15A 4Z8YA 5CK5A 1XPUA 4JLMA 3KX2A 1VG1A 3A1UA 5EXTA 3THWB 1SQ5A 3QXXA 4I99A 2Z43A 3DMDA 1OFIA 1ZYUA 2QAGA 4Q4HB 2D3WA 2H17A 3THOA 2WOJA 3DHWC 4TL7A 1CR4A 4Y0VA 2HF9A 2PH1A 3MD0A 3QPVA 1KO7A 3B9QA 3A1SA 2WJHA 4CZ2A 4YMTA 1KSGA 1HV8A 3LW8A 4MGYR 2ZSEA 2N42A 5AWFC 1SHKA 3KQHA 1FQJA 2RH5A 4JLKA 4MUAA 2CLDX 4FWIB 4H9GA 4LDJA 3VR2A 2J46A 2ZETA 4XSGA 4RZXA 3GEHA 3BORA 3NWJA 1NRJB 2ZE8A 2ZAMA 4OJKA 4C7OB 2HDNB 4FI3C 1UF9A 4YDHB 1CJTC 1ZIOA 2GESA 1H8HD 1UKVY 1E0JA 4MYUA 3AQ4A 3QXCA 3T61A 4Q4AB 3BGWA 1W2GA 3MJHA 3W5IA 3R20A 3NBYC 2ERXA 3BOSA 4XIGS 2A5FA 3E2IA 4JKYA 4M1KA 4ACBA 2ZS9A 1BIFA 1KK2A 1XMIA 1CJMA 3L8YA 2IS2A 4DEXA 1U98A 3REGA 3AM1A 1XMVA 1PLLA 1P2VA 621PA 4LSGA 4ARZB 1W49A 3W6OA 4A82A 3KUCA 4NYJR 4IXMA 4W5HA 3TE6A 5JFGA 1E2KA 3B85A 1H8EA 2EFDB 1IY2A 3C14C 1E4VA 5B2ZA 1DE0A 2PBRA 1W0KA 3HU1A 1XPRA 1OSNA 3UXMA 2IUTA 1VYUA 2OESA 1EXMA 4L9SA 1R2QA 1S4QA 5KPJA 2WJYA 1RRPA 2WKRA 1JR3A 1XD2B 1AJEA 3OF5A 1DAGA 4XWKA 1X1SA 1ZCBA 2OUKA 3MGCA 4KV9A 4AI6A 4US1R 3OIWA 4NYJQ 1G6OA 2O8BB 5DI3A 2BVNA 2XJ9A 2H92A 4B43A 2IYYA 3JVUA 1FP7A 4LOAA 4OL0A 2R65A 1E9AA 5DI9A 2O8CB 2QROA 1R5BA 2H8KA 3FMFA 1P9RA 2J41A 4M1OA 3PXGA 4GPTA 3RRNA 5DHAA 1LF0A 4PO1A 1DAIA 5JRJA 4U00A 3TMKA 1KOFA 5JWRA 1JPJA 3CUEF 4A0GA 4G01B 3AV0B 1L2TA 1Z29A 2CE7A 3W9YA 2R6DA 1OFUX 2V6JA 4XH9B 2WJVA 4UNNA 1G7CA 2XXAB 5JI3E 3K9HA 3K0FA 4OI2A 5H8WA 5FH9A 2IXFA 1TQ4A 4I1VA 3U3OA 1TUIA 4OYHA 1QHXA 3K0EA 1QHNA 1F6BA 3WYFA 1JNYA 3K0AA 4TMXA 3F5FA 2CE2X 1I4TD 2WKQA 1G21E 3FYHA 4EJSB 3BXZA 1JB1A 1DAEA 2AFHE 2JDID 3DM5A 3PUVA 1E2MA 1QZXA 5P21A 4FN5A 3WYAA 4B48A 4NH0A 5FL3A 5DLQC 3NBFA 1AKYA 1E3MA 4IDHA 4D2IA 3D3QA 3W3AA 2FSGA 3D7MA 3GLGA 2MSEB 4AYWA 5E3HA 3U61B 2VQSA 2WWGA 3IBGA 4CDGA 1UPTA 3ZD6A 1LV7A 1U81A 2BBWA 3HR8A 3LX8A 3ADKA 4QC2A 4NP6A 3TLXA 5AJWA 1IN5A 2XNDA 3WBKA 1JALA 2ZVPX 2ONJA 1MV5A 2C9CA 1NG1A 2V6IA 4M1SA 1KI6B 2GF0A 2FEOA 2CLCX 2J59A 2WWIA 1CR2A 1XJQA 1E2JA 3BFVA 2GK7A 3D6TB 4U5XA 2CXXA 1M8PA 3T1VA 1ZW6A 4M4SA 1PUJA 1XEWY 5HR5A 2JLSA 2BM1A 2ZSBA 2J0VA 1TEXA 1IJFA 2ODEA 5FPTA 4LI0A 1T4GA 1ZNZA 2VP5A 1RVDA 2OBNA 3IIJA 2YC4C 1RYHA 3WHLA 1KK0A 1CJVC 1CRPA 1GITA 4DWJA 1XXHB 1M6NA 4F91B 2QRNA 1GNQA 1KI7A 3EZFA 4LPKA 1U2RA 3WMEA 2D06A 5B57C 2EFHB 4NCKA 5JWOA 1RJ9A 1D5CA 5G40A 5GJWC 5LB4A 1MO4A 2W6IA 821PA 3ASZA 1GUAA 4MDFA 2QMUA 3DZ8A 1T3SA 3ADDA 1NIPA 2JASA 3RS3A 4XJXA 2ZSFA 4A8JA 2QEQA 1AKEA 1LNZA 3BK7A 4RFSB 1EG7A 1J8YF 3ZIAD 2CJWB 2LCFA 1DAKA 3PEUA 5EXSA 4BFYA 2VHCA 1CP2A 1AK2A 3AF0A 1S1CA 1FFHA 2B7CA 4M1TA 4B76A 4FMDB 3X1YA 5B64A 4D25A 1KMQA 3Q5EA 2WIAA 3B60A 2HEIA 1IXZA 1MO5A 2YHSA 1Z47A 1ZD9A 2G88A 4HATA 1G3IA 5F3WB 5EE9A 4G3XA 2AX4A 2GK6A 3TNFA 2BDTA 1OXTA 1ZUNB 3E1SA 2QP3A 3E70C 4E03A 2C03A 3F0TA 3VU9B 4L16A 1XMSA 421PA 3S1AA 4ASUA 2P0EA 4OI0A 5JS8A 1WA5A 1XD9A 2R6AA 5JEEA 5K8LA 5GADl 2HF8A 2VP4A 2RHDA 4KODA 1K5GA 4DLYA 2OAQ1 3T5DA 4UXHA 1Z6AA 4QL3A 2V7QA 1XTJA 1KDRA 1T91A 5C4MA 4B44A 4ZI3A 1EWRA 2OLJA 3NIBA 4NTZA 2IWHA 5J4HA 1Z22A 1P62B 1TF7A 3AVTA 4KJZA 1Q12A 5KO2A 1P7CA 1ZMXA 2J7KA 3RHFA 3DM9B 4JJZA 1KGDA 3BAFA 3T35A 1XTSA 1ZUIA 3KJHA 2QTHA 1Q1QA 4RY2A 2ZR7A 3AKYA 1Z08A 1TUEA 2XEXA 5JHHB 1G64A 2GXUA 4V0MA 3LY5A 3D31A 2B21A 4C0AC 4TTQA 2A7QA 5UKDA 1UM8A 3R7WA 3W8RA 3I5YA 2PLFA 3F3YA 4JT2A 5A5GA 8OHMA 3SEAA 3IKJA 5DGXA 2FFHA 2WWHA 3FB4A 4OHVA 2OCPA 5CDFA 4Q03A 5TXGA 4BLQA 4X8MA 1G7SA 2E1RA 3PUYA 1P60A 4POAA 1P3JA 1OB2A 5SZHB 3SDZA 2WJJA 3CH4B 1VTKA 3DZDA 3VHLB 4BEBA 3QKUA 3CR7A 1W48A 2JCSA 1JAIA 1Y3AA 2C9YA 4XWAA 3HR7A 4JJKA 1YQTA 4Q01A 1W36C 3CRRA 3CNLA 3LH5A 4GZMA 5BXQC 4DCSA 4ZDKA 1E2QA 2ATVA 2C5LA 3QUSA 1U94A 2NPIA 4ZI2A 1PZNA 1U0HC 1DEKA 3FKSD 1W5TA 2WM9B 3QENA 4A6PA 3SU8A 2A5YB 3Q8XB 4A0HA 2CL7X 1ZM4A 2GBLC 4Z1MA 4BFWA 2H1LA 4OQMA 2JLQA 3NBZC 3U44B 3GJ4A 4M9QA 3CWQA 4YLGA 4QHSA 4MQBA 1E2FA 4DDWA 1TMKA 1LY1A 1NVVR 4TSFA 2BJVA 1LB1B 4DUGD 4HLUC 2YWHA 2V55B 3GEEA 4FMDF 4IVRA 5CJ2A 1Z5ZA 5FPSA 3U3MA 2ZEJA 3QKSB 4EUNA 1KJZA 3QSYA 1G3UA 1YR8A 3UKDA 3X1ZA 5AUPB 4P4TA 1ZC3A 1PLJA 5F9FA 1JQJC 1MKYA 3VKHA 2QUZA 3X1WA 4P31A 4R2IA 1S96A 2CVFA 2AL7A 2ZRHA 3KFXA 1MRSA 1L8QA 2ZRPA 1G3RA 4GDFA 1ESMA 2CNWD 4JYBA 3GLFA 4HB2A 4B75A 2W58A 1G17A 1WMSA 4HI0E 4DCNA 1NVVQ 1RFLA 2XB2A 5TY0A 4D80A 3SBDA 1XP8A 4I1OA 4PHHA 2BV3A 1E2IA 1GWNA 1KY3A 3TSZA 3THYA 2JAQA 1HY3A 1DS6A 4CEIB 1S3SA 1ZNXA 4NBSA 1GNRA 1E2NA 1Z3IX 1NN1A 1ZCAA 3TUJC 2HUPA 2W6JD 4C0SA 1N5KA 4Q18A 2QT0A 4N1AA 3I61A 2PMKA 5JHGB 5FBQB 1TQ6A 5H1YA 5EE0A 5CDFE 1N6PA 2XSZA 1GKYA 2QSYA 4IHQA 5KSPA 2OFWA 3NEYA 4TT3D 2ZRNA 4LJ7A 4LPSA 4O3MA 1I2DA 1OFTA 1FMLA 1GKIA 1R5OA 1NIJA 3CBQA 5DN6A 3QI2A 4F38A 1OV4A 2H57A 3FMIA 3TAUA 1HH4A 1OXVA 3IDQA 1G41A 4DB4A 1IM2A 1KNXA 2D2FA 1ELOA 3LQQA 3SFZA 2PLRA 1CJUC 3LD9A 4URUR 4BLSA 1P6XA 2WPDD 3EIEA 4LUCA 3I73A 4YONB 1EESA 3L43A 2REXB 3WRYC 4O25A 4BRWA 2PCLA 3LXRA 4QM7A 2NIPA 2H18A 3P26A 3K8YA 5HKKD 1FUUA 4LBVA 2Q21A 4FMBB 4DEYA 2QAGC 1F2UA 4RKFA 2QMEA 2C78A 3VX4A 5GJCA 3LFUA 3RWOA 3GJ8A 3QXSA 4D4KA 4TL6A 2WAYA 4Q21A 4LBZA 2B8WA 2P3SA 4TL8A 2UZ3A 3IEVA 3GLIA 2QL6A 3FFAA 4DRZA 4B6FA 3AVXA 1I4DD 1SXJC 1VG0B 2RGDA 3KFVA 1VPLA 1XD8A 4KBFA 5G41A 3K09C 2Q3FA 2GCPA 1GVNB 5DIFA 1T3HA 4LJ6A 2NO7A 3ZJYA 1ZM2A 1AN0A 3IPXA 1Z6GA 4IEIA 4N0DA 2F3TA 2IT1A 3CRW1 5JJLA 2QG6A 1IJEA 3W90A 3VR1A 3GEIA 3SYKA 3KXKA 4KSBA 1VG9B 1UKZA 3GJ0A 5IK2A 1XU4A 1ZNWA 3PUZA 1JPNA 1JXMA 2F1HA 4GOXA 2R8RA 3M0EA 3PVSA 4L15A 3ZYCA 1ZAKA 3T15A 5D3MB 3RVBA 1T5IA 1W2HA 1XCGB 3OESA 2GZDA 1DO2A 2IYUA 3QVVA 1M7BA 4B2PA 1OW3B 5JS7A 2ECKA 2ZI9A 4BLTA 2JJ2A 3NG1A 1Z63A 2RGGA 3HPQA 3SFVA 2FFAA 3DVLA 2JATA 2EWVA 4UNRA 4WXPA 3GJ3A 1G8FA 3ZDQA 3RYTC 3F8TA 3BFXA 3KZ1E 4HUTA 3L0OA 1P75A 4QXAA 5KUTA 1N0UA 3NVAA 2HLDA 2IYXA 1G6HA 2V4ZA 4NYIR 4D4LA 3THWA 2Q3HA 4Q7JB 3DOFA 4UXJA 4Q4HA 3CPJB 4BFZA 2CHGA 3QEOA 3QF4B 1JR3D 3PQCA 4P0TA 5KDLA 1JXOA 1YZTA 4MKHA 1JEDA 1N6KA 4JLBA 2FPMA 2QTFA 4V03A 2VP0A 2ZUDA 2OE2A 3QG5A 4FINA 3TBKA 2LWIA 2ORWA 4RD2A 3TSOA 1HE1C 4QJ5A 1GL6A 3CF0A 4NYIQ 1Z0IA 4TLAA 2ZPTX 1JQLB 3SR0A 1NL3A 5FOXA 1WDTA 3RRMA 1D9ZA 1LF5A 2CCGA 3CF2A 4C2TA 4C7OA 4YXWA 2QENA 4TQ9A 4LK2A 5DHFA 1G3QA 1T9HA 2BCJQ 4LBWA 3B1YA 1U9IA 4DJTA 1QHHB 2JJ8A 1JEEA 1S1MA 3CB4A 2J87A 3EZ9A 4Q4AA 1JJ7A 3LVQE 4LYFA 5FTLA 1MO6A 2NO9A 1E98A 1HT2E 4JSTA 2WWWA 3KKNA 2QBYB 4BFUA 4J0QA 3VHXA 1N6OA 1VKJA 4EQ6B 3ND9A 4Q1BA 1AGRA 1KO5A 3MG9A 4WW0A 4JLPA 2OAP1 4ARZA 5JRZA 1G8YA 2V9PA 3VNVA 4RKEA 3PEWA 1C4OA 5J4YA 3FMPB 5AUNB 1E99A 2EFCB 1OXUA 3GJ6A 1FNNA 1HQCA 4XVQA 4B32A 4AG6A 1HT1E 4NONA 3GFPA 3IEUA 4Q1CA 2IX3A 3ADBA 4JBYA 4HLQB 5FUWA 1MR3F 2ZVQX 1EFTA 2R44A 3K0CC 1XD2A 3BRWD 4C3ZA 4PO9A 2J5XA 2ODNA 4IOLA 4LV8B 3ZS8A 3BH6A 3AGPA 4XD7A 1OB5A 3L0PA 4LWZA 2O8BA 2HJVA 3FWYA 4G5OA 4CT4B 2BMJA 5KU1A 1X8JA 1O87A 3OIYA 2OZEA 1Z0FA 2CMKA 2ZRCA 3SJBA 2Q6TA 2O8CA 2AN9A 3GP8A 5CITA 2OO7A 1WBBA 2W0SA 2A2ZA 5C46F 1VCIA 4ZCMA 4URYR 2REBA 4JL6A 2Q9CA 4QHTA 2IUUA 3IUYA 2JLVA 2V54A 2VRWA 4B6EA 1E79D 1XEWX 2VF8A 2EW1A 3KQUA 2XXAA 2IEZA 2W6ID 3V4FA 3AKEA 2D4HA 2PJRA 2OILA 2QGZA 2C9OA 4PC1A 3AF1A 3NTUA 4XTCS 2C77A 1XB2A 2WJGA 2MMCA 1P72A 2XITA 4MH0R 5IT5A 1VDZA 3MLEA 1NMYA 4EJSA 1KDPA 2WSSD 121PA 2WICA 2QQEA 4HB0A 2XTMA 4OBEA 1SVKA 4M2LA 4LC0A 1TEVA 5HCIA 3PV0A 1NKTA 4OKSA 4EKDA 3IO5A 5BYJA 1CR1A 3UPUA 4YMUA 4HB4A 3RC8A 3TVTA 5KDDA 3KKOA 1FW6A 3JVVA 2F55A 3K1JA 3WP0A 5CM8B 2IW3A 3EA0A 3OAAD 4CRWB 3LBHA 2ZSAA 4KYUA 3I5XA 4DDTA 1KI6A 3UMRA 4Q1EA 4PO8A 4R9UC 5FPYA 4PC7A 1T3LA 2O0JA 2O8DB 4EPXA 3THXB 4WA7A 1AS3A 1HYQA 1AIPA 5HE8A 5K8IA 4QJ3A 4ASUD 2HT6A 2JLRA 4NPHA 2QT1A 3RANA 1T8UA 3V00A 4W7SA 2BIFA 1PV4A 3RAPR 1LTQA 3AKCA 4IOMA 1J99A 1D2NA 1CU1A 3EX7C 2V7QD 3LO5A 1XXHA 5CJPA 1OH5A 1E9DA 1G7RA 4DIDA 1TTTA 3GQBA 3RWMB 4F7WA 1P5ZB 4M8NE 5ANRB 4RZ3A 2VHJA 1E1QD 4QGHA 4BRUA 4LHZA 3HP1A 2FJUA 4MGZR 2ZRBA 3H2YA 4KHZA 3TRFA 1GL9B 4PQYA 2NO1A 1JI0A 1VCOA 1S2MA 4ILEA 3B2EA 2A9KA 3CNOA 4LJ8A 1Q1ZA 2C99A 3SOPA 4OI4A 1VMAA 1NJGA 2PT5A 3AF2A 1E2GA 3N5CA 4JMPA 1X3SA 2PJZA 4RCYA 4C0BA 1R0XA 2CK3A 2NTYC 3CO5A 1W36B 3CLVA 4RFSA 5FR2A 1N6NA 1AA9A 4C0JA 2CJWA 1BH2A 1SVMA 2AKAB 1MOZA 2F1IA 1CXZA 2VP2A 3K70D 2J0UB 1NMZA 1IXSB 1FTSA 3UMFA 5KSZA 3CM0A 3U7GA 1G18A 3CF6R 3CIOA 3FHOA 2YOHA 4GSYA 4LGMA 3W5JA 4DLTA 1K8RA 4Q9JA 5F9HA 3PITA 2O8FB 1WF3A 1P73A 4RD0A 3RABA 1IN8A 4JBWA 4AY2A 5K8TA 3BIFA 1OPXA 5EXPA 1ONBA 2ZJAA 5CK4A 5DISB 3VU9A 4B3GA 1W1WA 1LVGA 3L0SA 4WIAA 4QM6A 4GOKA 3SYNA 1WP9A 4B71A 4BWYA 2B6HA 2QM8A 1O3YA 1ZM7A 3A1WA 4MRPA 3TKLA 4NL4H 1KY2A 4OQFA 4Z1MD 1J70A 4LJ4A 6Q21A 5KTYA 2JGNA 4Q1DA 5K8UA 2ORVA 2RCNA 3WRXC 4DVGA 1DG3A 2C04A 2XB4A 5BYKA 2BWJA 4JVMA 1BMFD 3VTKA 4RZ2A 5AUOB 3EASA 4X8OA 1E9RA 5LB2A 4IDPA 1RRGA 4NKRA 1Z0DA 1E0SA 5AUQA 5LBIA 3I8SA 1HA3A 3PUWA 4PHFA 4NZYA 3G0HA 4TLDA 4WZBE 4QNMA 1XRJA 4ZPXA 4MGKR 1NBME 5E7IA 1K5DA 2HCJB 2ZYVX 3HYRA 1LW7A 4A0FA 1XXHE 2G0TA 3NC1C 1B0UA 1A82A 2YYZA 1OKKD 1KK3A 1ZRHA 1N6IA 1J2JA 3RNLA 1VHLA 3SYLA 1CJKC 2IYTA 2H16A 4NHOA 4F93B 1OHHA 1QVAA 2ZXUA 1KSHA 5ELXA 1E1RD 4MGIR 1FOEB 1VYVA 3I32A 1SXJE 1UADA 4XOIA 2GWHA 3AVWA 2WV9A 1ZINA 1F3OA 2OXRA 3R8FA 1QVRA 2ZREA 1U99A 2AXPA 2WIBA 4D0NA 1SVSA 2W83A 5TDHA 4QGGA 5EZ5A 4LC1A 1W0JA 1XZPA 5DYIA 1WB9A 4MKIA 3A4LA 2P6RA 3VAAA 3JZMA 2BCGY 3A4MA 2GJKA 2RKOA 2FA9A 1FMJA 2VPPA 2ZJZA 4KLNA 4I4LA 1WXQA 2Z5FA 3ZLJA 5DE3A 3NC0C 1VYTA 5KNBA 5JZVA 1WBDA 3EAQA 2NG1A 1NN0A 4M1YA 4DSUA 3Q72A 5FOVA 4D4JA 1NP6A 3QBTA 2QSZA 4P33A 3U44A 2NZJA 2OBMA 4A1FA 3ONWA 4BLPA 4GP6A 1HE8B 1KK1A 4RFVA 3SHFA 3O8BA 1C9KA 1U90A 4BFSA 5F98A 2RHMA 3TR0A 4Q9HA 4G5SA 5FBLB 3BWDD 4RCZA 2AXNA 3QY0A 3WXMA 1J7KA 1W44A 2ZYUX 2OFXA 4HLDA 3WNDA 4MKGA 1XCMA 2ZI6A 3QKSA 5M04A 2JLZA 1SXJB 1N3BA 2FZLA 4IRUB 3H4MA 1Q44A 1Q20A 4A36A 1FP6A 3HU2A 1QG2A 2SHKA 3UMSA 5A4JA 3AGQA 3RSLA 3PUXA 3GMTA 4EPYA 4W5JA 2DWQA 1GAJA 1G3MA 3EARA 1XNJA 2O5VA 4LRWA 1LS1A 4ITRC 2JJ1D 3B9PA 1DVRA 2JLXA 1E0KA 2Q9AA 2F43B 1X86B 4OQNA 5J4KA 1EWQA 3A1VA 1YRBA 2RGXA 3FHTA 2XAUA 4D0LB 4PFSA 4CEIA 1Q3TA 1FL9A 4BLOA 1IBRA 5HZHA 1ZM9A 1S8FA 1NVXQ 1DO0A 2BM0A 1COWA 4MKFA 4DB2A 2ZI7A 4BE7B 1SKYE 2X19A 2Z83A 1UFQA 4AK9A 1A5TA 4D6PA 4KFUA 5FTJA 3PJRA 4X8HA 5JMTA 4TN1A 3LBNA 2GCOB 3BB1A 1UDWA 4ABYA 2VF7A 4Q5IA 2ORIA 2KB0A 1M2OB 2R6FA 3B7GA 4C4PA 2KSQA 4K46A 2CCKA 3ZGXA 2YJTD 2ZYTX 2ZJYA 2FV8A 2W2XA 4LYJA 3NH6A 1OYWA 2CVHA 3EZ7A 3VKGA 4KFTA 4V0OA 1KI8A 2TMKA 2GEDA 3R9XA 3QG1A 1FQKA 3A8TA 4NE2A 3X2SA 1S9DA 2NO0A 3QNUA 4ERNA 4IOJA 4DLVA 2IHYA 5JWHA 1R6BX 1CIPA 3RDPA 3CRQA 5GJVC 2QORA 3IHLA 5L3VA 3SZRA 4AKEA 5FL7D 5BN5A 4N3NA 3AF4A 2QMOA 5FBVB 2ZU0C 1NY5A 4IEEA 1SKYB 4D82A 4GMXA 4OK5A 5JEDA 5CM9C 4Z51A 3LRPA 1KKLA 4TLCA 1E0AA 4PC6A 2CDNA 1D6JA 2CHVA 4QFMA 3FE2A 2BBTA 2VL7A 3LWNA 5BN4A 3PR1A 4JVLA 2VEDA 2YWFA 1H8HA 4TMZA 2GJSA 5DYGA 2FWRA 3U6KA 4DCVA 2E9SA 3OHMA 3MCAA 1XWIA 4QOSA 4ZCIA 3QKRB 3ZQ6A 3MFYA 3M1IA 1G9XA 1U8YA 1XEFA 1J90A 1M74A 1AS2A 1KHTA 2AK3A 1VG8A 1YJ5A 3A6PC 1KYIA 1NVUQ 4AC9A 1G291 2ZJ2A 1AQUA 4C0KA 1GKUB 2VP6A 5FOWA 4KVAA 1KI1A 1M7GA 1F60A 2FU5C 3ZS9A 1E94E 4BZQA 1EFRA 1VIYA 1XJCA 4UQOA 3KB1A 3KXIA 5D3MA 1E9EA 4LHWA 1G5RA 3FOZA 1W4AA 1DOAA 2ODBA 3SE0A 4ACAA 3EC2A 1R10A 4DSOA 1RPZA 2KBFA 1G8HA 4GP7A 4P4SB 2IYWA 1AZSC 1P9NA 2FGKA 2IS1A 1OE0A 3MAAC 3QIAA 3T5GA 2EQBA 2IYLD 3BH0A 4HUQB 5JJIA 3ECCA 2VYFA 3SHWA 4CW7A 2P5TB 4U7DA 3MSXA 1Q21A 5FFMA 4JSYA 2ZE5A 3C5HA 4HSEA 4RD1A 2AR7A 3PENA 3BERA 4TL9A 5HE9A 1NN3A 5FBRB 1XF9A 2WBLC 2IK8A 3DL0A 3LW7A 2XZLA 1D2MA 3GLFE 1RYFA 2P65A 2RGNC 1IN4A 4OHZA 2FGJA 4FCTA 2WAXA 3K9LA 1TU4A 3IPYA 3QPUA 1GZSA 1G16A 4DCTA 5B30A 4JKIA 4PPGA 4WOPA 3NH9A 3L0IB 2A78A 4BASA 3EPLA 3P32A 4GZLA 3QF4A 3T1OA 2GILA 4NDZA 1BO6A 2ANCA 2GAOA 2IYSA 3U7HB 1XX6A 2OCYC 3O47A 1N6LA 4KYIB 5KSOA 4CEJB 2KJQA 1CRQA 1KDOA 2YNMA 4UNSA 3I92A 3BC1A 3OFND 3N2EA 5AJZA 3BD9A 1NN5A 2OV2A 3TIFA 2FNAA 1XJ0A 3WNBA 2AK2A 3BB3A 3CWZA 3SC3A 1Q1EA 3KTAB 3ETLA 1YRAA 3N70A 5IDVA 2FFBA 4D4MA 3IHWA 2A30A 4HZUB 1ZC4A 2DPXA 4LJ5A 4TMTA 2FPLA 3SQXA 2GETA 3AF3A 2QGNA 3P27A 4QJ4A 1UBCA 3TSWA 4R71A 3AUYA 5DO9A 1TF2A 4Z54A 4YMSA 5LPNA 2BEKA 4A2QA 3GLHE 4C0LA 3OEHD 3LV8A 4MITA 4S2EA 2WSMA 2HCBA 1QHHA 4NU0A 4O2LA 1AZTA 4V02A 3OEEA 4TWZA 1I4LD 4P4UA 4LJAA 2LKDA 4PSKA 221PA 1CKEA 4M9ZA 5FOSA 3CR8A 3B1ZA 2QBYA 1YHNA 1FUKA 4EQ6A 4DIEA 2MSCB 1KI9A 2IL1A 3ND8A 2D2EA 3VX3A 4Z8XA 4YMVA 3TVDA 2G0NA 3TAHA 3QXJA 2B7BA 1QBKC 4IFEA 2YOGA 4L5BA 3U60B 3T1TA 2W2TA 3DPUA 5IHPA 1X8LA 3RLFA 4IVQA 3RRYA 5BW8A 4R2HA 4TYQA 3U4QB 3TQFA 1SHZA 2C8VA 5TVKA 1UKEA 3M4YA 4M1WA 4B3FX 2C95A 5KNCA 3I62A 1KO4A 3MJRA 3QEJA 1HQYE 3P4YA 4DDVA 4JLVA 3GLHB 4PPNA 2F7SA 4JYCA 2Z0MA 2ZANA 2GDJA 4HZIA 2VLIA 3RSOA 1RC8A 3BJIC 1E2DA 1L4UA 3MUFA 2JLYA 4LHXA 2PL3A 1E2LA 5CLQA 1GSIA 1A2BA 1OH8A 3EPJA 1XEXB 4ZDIA 1KSFX 3K9GA 4CEHB 4G5QA 1W4BA 2ZI4A
chains in the Genus database with same CATH superfamily
3WHIA 2ZRGA 3OD5A 1G4HA 3BBLA 1KFJB 2ROQA 4CCYA 1DT3A 2HBYA 5ALKA 1YMQA 5ALYA 3B1XA 4O4IB 1GZ4A 1K1EA 3CKLA 5DW3A 1M2VB 5L53A 1KH3A 1MRNA 1Z7BA 4FDTA 5FO1A 4DLWA 1PBNA 1G2PA 1P2FA 1NSTA 4JLOA 3KB2A 1L5OA 2B5VA 2C2YA 3PE6A 4KLAA 1XGKA 2O50A 2QTGA 4ENPA 3IHKA 4HYYA 2QM3A 3DXYA 4I81A 1DZIA 2HX1A 4ZVPA 1PO7A 3IUSA 1PN3A 2Z2JA 4JIMA 1T0JB 3UUEA 4EHBA 1SOUA 2VTKA 1B14A 4MVJD 1XQ6A 1Q1BA 2FWIA 2ZAOA 2Q99A 4C20A 4MLPA 1EX1A 5BMVA 4D81A 4PS0A 1AU9A 3K9BA 4UE2A 1ZPDA 4MMYB 1A5SB 3GUHA 2YHBA 5JUWA 1ST2A 2FQXA 4YEDA 5AJYA 3LC1O 2P9HA 3G49A 5DHPA 3EISA 4KYVA 4B7XA 5LOVF 3EFBA 2VZ0A 4DLZA 3ZV7A 4B46A 3LUDA 1V5WA 2CXSA 4KRYA 4D42A 1QP8A 4ETWA 5IT9A 1SZJG 1F2TB 1IOLA 1SOWA 4I36A 3HY3A 5SYNA 2DETA 4KR3A 2XT0A 2WTNA 3R4CA 4D0RA 4F92B 4ES6A 3PEFA 3SNHA 3AOGA 4PLFA 2C0PA 5FTKA 5LQUA 2WM3A 1DRUA 1EVJA 3BE8A 4YMGA 3F6YA 4MDHA 1U3TA 4YS6A 1GZ6A 4IM7A 2BHLA 2ZBDA 4TS4A 1XRRA 2OG2A 3ENZA 3FBWA 4DBLC 3OY2A 5DHSA 3D8BA 2RFLA 3PF8A 3Q0TA 4I5GA 4DPMA 1PT6A 5F78A 4DT1B 1M0SA 3ZLTA 1IY9A 3GVPA 2JLUA 3T1QA 3UTCA 4JKOA 3CURA 3KXLA 3IUMA 1HE4A 2ONKA 1WRBA 2AKYA 3BE6A 1PI3A 2Q3BA 3OP4A 1MN6A 4GVPA 2Y05A 3PHGA 3DE3X 1C7QA 4HBZA 2J3QA 5LP6B 1FB5A 2JVIA 3FFBA 3ISVA 2MIIA 4D3YA 1WSDA 2Z3ZA 4GX5A 4HGRA 5KIAA 1J0CA 1S7GA 2BFCA 2XGMA 4LZZA 1OXXK 4V24A 4ZVQA 3SNKA 4AL4A 1T4CB 3PNSA 2WQ6A 2OOSA 1DWQA 4BVJA 4RA6B 5ESRA 3QUQA 3RBZA 1NQAO 3E3AA 3MMSA 1TZMA 2N1MA 3A1TA 4Q48A 4DRXA 2C82A 5KWJA 2DC1A 3CONA 4CI9A 1O0CA 2PL5A 3R75A 4QDTA 3UAVA 1IM5A 1YB2A 2GRAA 1Y4UA 1WW8A 2P6NA 1E69A 1CEXA 1Q11A 4EF6A 3IV6A 1CJBA 2XKAA 3DEAA 4LFAB 3MWLA 2N75A 3A0RB 2E2WA 3BEOA 4BNDA 1FXSA 1BE1A 2XNDD 1FFXB 1BXGA 3SF8B 1NM5A 2FSFA 3GDHA 4M89A 3U62A 4M6WA 4ZDJA 1JSXA 3N7AA 1WB4A 1GZ3A 2I7CA 4ML3A 1H4TA 1LNSA 4EG6A 1UMKA 3BBPA 4G5RA 2I1QA 1DIOB 2AD5A 3FPBA 1ESNA 3IJEB 4RJJA 4JI6B 3RHZA 1NW4A 4RTLA 1ORWA 1BJTA 1CSEE 3MRSA 5DW0A 1NF3A 2EF0A 2MT9A 2ZTLA 3E7PA 4BFXA 1G19A 5FWXA 2A59A 5L3QB 2C2MA 4BZPA 1R0RE 1WEHA 4ER6A 1VCNA 3CVOA 2Q2WA 5JTTA 4XTRA 3A9TA 4IGAA 3CBGA 3S0JA 2GTPA 1DFIA 4GS5A 3H3XA 4EKYA 2R1UA 4DWOA 1M10A 2OCBA 2OFOA 2YXPX 3AVPA 2XYVA 3MWDA 2ZIAA 3MCUA 4RGBA 1C8LA 2BDEA 2Z30A 5L3RA 1V4VA 1R12A 4B3DA 1I2BA 4DCUA 1AQNA 1ZD1A 2F00A 3AY3A 1E60A 3FPKA 3LGAA 1AUXA 5IHXA 1OYYA 4RELA 1T25A 4KAFA 1W73A 1US8B 5HYVA 4FGKA 1IC6A 4WL0A 1M66A 1Z39A 5HFJA 1KZGB 1T0UA 1AK1A 3U7FB 1JHUA 4JFAA 4Q3AA 1F06A 4BVFA 1Y3CE 5I7WA 1VE7A 5I9TA 1OH7A 3U56A 3MGBA 4C4YA 3R0JA 5FI0B 721PA 4RMIA 1P1HA 4ZICA 2ATXA 1RZ3A 2WYVA 4FP9A 4MS1A 4U39A 2RCYA 4AKGA 3KJEA 2ZPUA 4FGUA 5FA8A 1IUKA 4DKXA 3VYVA 3NGLA 4RA9B 3DEKA 3EOAI 4RVHA 4TT3A 4U7HA 1XTKA 4P82A 4E11A 2BHNA 2XOKA 2QRVA 3I9OA 4OUDA 3RO7A 4EEKA 2VSFA 1Z6TA 2WDZA 3IBYA 1HRKA 3RE1A 1LFDB 1YS4A 1M1UA 2OBLA 2A0XA 3LE8A 4GQIA 2R7AA 5EJGA 5AKEA 2ASEA 3UK2A 3UJ8A 4B6PA 5HM8A 1DV1A 1T9GR 4OP2A 4DA9A 3AF5A 3BHNA 3ESZA 5JASA 3OG9A 4TZ6A 3IURA 2JIPA 1JXAA 4YN3A 4ARCA 2WEKA 2CXQA 4P7KA 2F1KA 1EZZA 4ZJZA 2O5EA 1IONA 2WPDA 2O2IA 1M7HA 3RAGA 2A0KA 1ZIXA 2DCUA 3EZ6A 4NPCA 3VYRB 3BXHA 3BMXA 1A7JA 1MB2A 2B9EA 4UM5A 1YZ3A 2GJ8A 2WU3A 2XQIA 5CT4A 2COUA 2I3GA 2G9NA 3HN6A 2HQRA 1FSPA 4Q9AA 1RKVA 1N0WA 2Z6QA 1O58A 2ATIA 3HDTA 4UUNA 4XRRA 3RFFA 2ABWA 2R8BA 1YQ9A 2EX0A 2QNBA 3AEQB 3GRUA 2YN4A 1ZRNA 2LE0A 3GAZA 1BE0A 3K16A 4MINA 1XTVA 3EGEA 1N5IA 3SQOA 4E2XA 4R4JA 3NHUA 4JGGA 1I3KA 1X15A 2GASA 2QI9C 1OIWA 2ZS7A 4UVHA 5IC6A 1SHUX 4MR8B 4W1PA 4LZWA 2FXVA 2MMGA 4PAMA 3C8ZA 3ZUGA 2C4TA 5C53B 4P83A 1GHTA 2VZEA 5FR1A 1FX0A 5LQDA 1ZCFA 2YFYA 3MYRA 5AR1A 2ZRKA 1Z88A 2EBWA 3OT4A 3UWOA 3BGDA 1A4RA 2O8EB 3TRIA 1U0JA 1GRCA 4FFRA 4N0QA 5TV2A 2AN4A 4NVRA 4U2EA 1TCBA 3FCCA 5EE5B 2AGVA 4BGDA 1TM2A 2X1VA 3PG5A 1E1KA 1KFEB 2JGLA 3RRZA 3K09A 1BEEA 1O6ZA 3D43A 1CDZA 3OZIA 2IS6A 1B76A 4GR9A 1XVLA 4EI2A 2HBQA 1O9BA 2X8AA 2W98A 4RVSA 3YASA 3ZQJA 4YJFB 1TZJA 4QQRA 3QFFA 1Q15A 1R0SA 1JDJA 3HU3A 2EZTA 1G5PA 2IYQA 4A5SA 2CT8A 4DZZA 3I9JA 1P4SA 5K20A 2XQJA 3JQCA 1A1SA 3UT6A 6ADHA 1VIMA 1P5JA 1WXHA 3SXUB 1ISIA 5C7IO 3PPWA 1A69A 2ZSHA 4MQFA 3C6BA 5D5QA 2OXTA 1EHIA 2PZEA 4J9UE 3V7YA 3VNRA 4B33A 4EYOA 1FE8A 4ER5A 4L78A 4GEGA 5JOQA 1T6YA 5C18A 3C6MA 3VC7A 1R6TA 3HYNA 1M1YB 2DSNA 3NVMB 3HDGA 3QX3A 2GVZC 5L4NA 3K0BA 2Z6UA 3N2GA 4U3JB 2QNRA 1Z0JA 4R40A 1M2OA 5CHEA 3AESA 3R7LA 1IZ7A 1AT1A 1RYDA 1Y34E 1ZXLA 3WLSA 1ZHFA 2H4ZA 4NI5A 3RIGA 2A92A 3WWPA 1RC0A 4FJ1A 4Z9YA 1ISSA 1O6FA 4HDCA 1VXRA 5CGQB 2O2HA 2VDQB 1JZTA 1ZG3A 2JAOA 4FCVA 4QATA 1KS9A 5HE8A 3F6EX 3PT9A 2C7BA 3GV0A 2KE5A 4QGFA 1Y63A 4BRWA 3WIVA 1GM5A 2OV1A 13PKA 3CV3A 4OKIA 2IYPA 1FPMA 3B2NA 3HA3A 1UXIA 3CRNA 3GUUA 4X62B 4EAQA 1F17A 1UMBA 5E6SA 4XJVA 1WETA 3ICQB 3A58B 3L6BA 3E15A 1Y48E 2AR0A 2FG6C 3HCFA 3Q2KA 4OYLA 4I9FA 3F4KA 1EA5A 3IIEA 2BKUA 5BV7A 3D6AA 3KL2A 3AEUA 1R7RA 5HKOA 3LBIA 3LBFA 2X77A 3F6SA 4XZ3A 1YR6A 1EGHA 2FX3A 3TUIC 2J9RA 4OQ4A 1S6YA 2EG5A 4GOJA 1SCKA 7REQB 2A8YA 4CQMB 1I9CA 4LF4B 4QQNA 4BATA 3LJKA 3E5RA 4IG4A 1OWPA 4MR9B 1X39A 3ZLVA 1ZVMA 4L22A 2GD1O 3NI2A 5K0BA 3F8WA 2YDXA 4UTPA 4OXQA 3FRIA 4YAOA 1BQ4A 4DDHA 2ORED 1N0IA 2RHOA 1LLUA 1Z8FA 3GD5A 2G0AA 5KVVA 4HDMA 5K0SA 3ENQA 1C9MA 2H7VA 3KDPA 2C4KA 1DFHA 3NKLA 1PEDA 1YNOA 3CGWA 1GQQA 4R9SA 3QUTA 3T9BA 3IT2A 4YX9A 1HR0B 4BTLA 1NW3A 1M34E 1RJWA 1YULA 2ATEA 4NCNA 3ZN2A 4YRBA 3HCBA 1YF3A 2RGRA 3DVSX 1HYHA 5FI5A 4C2UA 2W43A 3U3RA 4TWBA 2VPYA 3H5NA 3HY6A 1T13A 1YXMA 3Q9LA 3AKZA 1YK0A 3OEED 4K9MA 4DY6A 2P3QA 4ISCA 2PG3A 3I2IA 3LT2A 2XWPA 3PGMA 4FLMA 4G8JA 2FE1A 2ZWAA 5K3SA 2VUTA 2Q5FA 2QAGB 3GRYA 3PCRB 3O7MA 4RS3A 2W4QA 3DKVA 1E6CA 3K0CA 4LSMA 4URXR 4N12A 3PEEA 5GM1A 2BJWA 4X7RA 10MHA 1VA4A 1FU4A 4QU8A 4A9AA 2VQFB 2ZU6A 1B0AA 2GYYA 3H7IA 2I0FA 3LDFA 5HGJA 2PWAA 3LHIA 2P3OA 4KV7A 4M21A 4HDRB 3QKTA 2CFCA 2L82A 1P6UA 2ZUVA 3IT0A 1FY2A 2QXYA 4PW0A 4RUKA 4L50A 4U8HA 4XWOA 1Q0PA 2HA2A 3L5KA 1NVWQ 1B8OA 5SV2A 3ZCXA 2P67A 1HXHA 2QMQA 2R6R1 3VHRA 1A2KC 1XZJA 3I01M 5DNDA 5CA1B 4EKGA 5HZKA 1JQBA 3QBVA 4FFWA 4YCAA 3A25A 4RX1A 5AXBA 3V55A 1Y9ZA 1ZJ6A 3OPYB 1MDBA 3AR3A 1QS0B 3L7CA 4ENWA 3THRA 4PG8A 1MEOA 4IIEA 4Q4LA 4WESB 5EJAA 4V1CB 1TZBA 1IUNA 1OQAA 1R15A 2VEOA 2JAXA 4JUDX 4RETA 4C7JA 4HAWA 3PRHA 4Q15A 3EG5A 1N3LA 1HLFA 1EGAA 3IP7A 1PJLA 4Y6GB 3WP1B 2L2QA 1U4SA 2CBZA 1X0XA 2HSWA 2WPNA 1JKMA 4LY6A 4XW2A 3VR0A 3SC4A 3PQ8A 3EIUA 1E3LA 3P96A 5IU6A 3O0DA 2O2JA 3DR5A 3AXSA 3VH3A 1SU8A 1SVWA 4N49A 2GHIA 2WSSA 4MW1A 4DLXA 2WSYB 3P20A 1A9RA 5LOVA 4DV4B 1YVPA 1QHGA 1RJGA 5IJ0B 3DEJA 5JVDB 3QF7A 1LZLA 1XBTA 1ETUA 3FHCB 1FTNA 4HZUA 4MW5A 1PJRA 2R11A 4LHSA 4Q34A 3V32A 4IMIB 1OH6A 3ZXXA 2ZXFA 4AO8A 4QRDA 1DTEA 2OORA 1J0BA 3TI9A 4BNMA 4XKJA 5HUHA 1D07A 1NG9A 1OX4B 3HZRA 3NWPA 2OCLA 4FFBB 4G1MB 3VA7A 4K8RB 4FKBA 4IVPA 4D98A 1J0DA 1MH9A 3VNAA 4PBSA 5LCXA 2QZ4A 4M9SA 1GEGA 1Z33A 2QP9X 4OQZA 2JJ2D 4WNCA 1WE2A 1ADYA 2EC5A 5FOUA 2MHCA 1IOZA 2AG1A 1ULTA 1XELA 4HAZA 4UNIA 4PAWA 1VI2A 1BW9A 4KXQA 2ZAIA 5IM4F 2E21A 4FILA 5J2UA 1XVUA 1PVVA 4FX5A 3RVLA 1GGMA 4LI3X 5A0VA 1DIBA 3ZXIA 4LN1A 1QM5A 2OHFA 4HYTA 1V3VA 4KL8S 1NZFA 1GAWA 4OREX 2HLDD 1R0WA 4PZ0A 1CB0A 1T5DX 2Z58A 2AOUB 4L3WA 4K2AA 3U4QA 5JU6A 2ZSJA 4AY4A 3E7WA 4BOYA 1JJIA 1V11A 2PZGA 3HADA 4WNAB 3W9SA 5FV7A 4KSCA 5JNTA 3ITNA 1QKIA 4XJSA 1XO1A 1C30A 5CNIA 3IEPA 3ES9A 3EVAA 4MUIA 1IUOA 2RBGA 5ICEA 2I34A 3CYFA 4BO7A 4CMCA 1P18A 4NEQA 3K0AB 4DCMA 1HOTA 3PDCA 4EPVA 5A9SB 3EZLA 2Y1KA 5AFSA 1DJPA 1WW2A 5E4FA 1J2YA 1V7QA 2CUNA 3L41A 1MO3A 2H52A 4LOKA 3JVDA 3TBFA 3L6DA 2QMYA 2R6GA 3H1EA 1XKTA 5FJIA 2AUNA 4XB6B 4AY5A 5JYEA 4PAQA 3GLGB 1PD1A 4EVIA 2FCRA 2GF9A 3G0CA 2V96A 2CFRA 2FP3A 4H2DA 1VJDA 4PAOA 4LXQA 1XTTA 1ADJA 2IGBA 1SKQA 1TAGA 3JVIA 4PZLA 2H0RA 2GZ3A 4YWHA 5G3YA 3MWJA 4OIFA 1U3FA 4J91A 4LRUA 4Y2VA 3JWJA 3D7LA 3Q3CA 1YK1A 1PNRA 1C1YA 4EM6A 1VJ5A 1YONA 5DSTA 1YNSA 5H4GA 4C30A 3N39C 2NQTA 1VIAA 1W36D 1CX9B 1CY0A 3LK6A 2PO7A 3BE4A 4DUZB 1DADA 2IY9A 1DXYA 2J3EA 1RM3A 3HUDA 3GBVA 4I1UA 4L9WA 4A73A 5TQJA 4JK3A 4ZAGA 5GJBA 4AKIA 3UWPA 5DV9A 3S99A 3FNQA 4EB3A 1RSZA 1JLRA 2YWGA 3A04A 3CLSD 1DARA 5JMOA 1V1RB 1VZ3A 1AXRA 3EVGA 1A7AA 3G5UA 2P7HA 5EUQB 3TQSA 3KL4A 2KHZA 2HV8A 4LJ9A 4C5BA 1G8PA 2AF4C 2Y0EA 5JAOA 1HC7A 2I6UA 2NN3C 4FQ8A 2HMUA 1ETHA 4WLVA 3GG2A 2H65A 4JZKA 2Q9BA 4M1MA 3T7DA 4C06A 5HGXA 1BMFA 3WRXA 2C5HA 1XDSA 4IXNA 3EWIA 4XE5A 3VR5A 5JC8A 4KQGA 3E9RA 3I09A 1V95A 3WA7A 1CQIA 2FPPA 5E7MA 1JHVA 2VJDA 1LPPA 1J0AA 4EB8A 4L5IA 2OD9A 3O7WA 3GEDA 1DQRA 1SG0A 3MQ2A 4AN0A 1SULA 2C61A 1U7TA 3CCCA 3GRZA 3AIIA 3QTLA 2GZAA 4DZRA 4EPRA 3U4DA 2F9MA 3W5VA 3L1JA 4WBNA 1T9BA 1LEHA 5GWXA 4FN4A 2D8MA 5B58C 2W42A 1ID8A 1THZA 1SKBA 1B1CA 1DSSG 1NVBA 3ZQUA 3K8QA 1SVIA 1BX0A 4OPMA 1BVHA 5FWDA 1UC9A 2GZRA 2ZS8A 3LU1A 4PYIA 3TTSA 1VLQA 5A1TA 4NMMA 2G82A 2QE7D 3DW3X 1U3WA 4L5YA 3X1XA 2C5BA 5F52A 3UUFA 4F45A 5G2OA 1VHJA 4FYPA 4RF2A 1KEUA 3Q85A 5AJXA 5C4GB 3IE0A 3L84A 3ISTA 3JZFA 3RYFB 3N0RA 1Z0ZA 2BAGA 1IHUA 1GFIA 3TR5A 3MD9A 1F9AA 1UFKA 3JTMA 2FMTA 3UK6A 2PKCA 4C5AA 2AXEA 5DBEX 1RYNA 4EJSC 1GPWB 2XX3A 3AY6A 4HQFA 4KIWA 1SVOA 2IRWA 2ZUUA 1KDZA 2UZAA 5KHOC 3EVNA 4PQFA 4WERA 2G3YA 1T36B 2V1XA 1HMPA 3MWEB 3TVYA 1E3WB 3AHDA 4WCFA 5BUQA 3S1AB 2MYNA 3GU3A 3H13A 1OBOA 2A0FA 2B61A 4KW7A 5ECWA 2G9RA 1QYVA 2CLHB 4HLCA 4FEEA 2BGUA 3V9PA 4TTPA 3BGIA 2A3RA 4BN5A 1F2VA 1ZD4A 4E07A 1G8GA 2YIVX 1S8OA 3VR4A 1WJGA 3VJMA 1JMKC 2ZYRA 1LRJA 2VHUA 3TFOA 1MA3A 5ILGA 1AB5A 2P8JA 3BL5A 3DMYA 3LQRA 5AXAA 4UTNA 3WGQA 1QVVA 3LQKA 3TW8B 2VNSA 3K35A 1XPJA 1SCIA 2FDXA 1GQ2A 1TU3A 3UJCA 2PRSA 4FYXA 4DBVO 3NIGB 4UEQA 5CFLA 1XZLA 5CYOA 1RQRA 2Z1NA 4RWEA 1UAAA 1KI4A 5HS6A 3K4HA 4WN3A 1QFZA 2Z8ZA 2EZ9A 3LQ2A 1UPCA 2OENG 2VN8A 3L06A 3L05A 1IY8A 5JBIA 5BPFA 4IHJB 4XR9A 4EO9A 3OLYA 4Y2RA 4N5HX 4K9DA 5CLGA 4B3CA 3A1EA 2NZWA 3HWSA 3NT4A 1U2EA 3X0DA 1WNFA 1ZMBA 1E2UA 4OXNA 4TXHA 2JGFA 1B74A 1F0KA 3S28A 1JTVA 3I42A 3KXDA 2ANBA 5MHTA 4PHGA 1S7CA 3UG7A 4E5KA 1IRXA 5ES3A 5A03A 3OE7D 3LECA 4MVCA 4DQXA 4URWR 4OLHA 3EEBA 2OPBA 3U4MA 2HA5A 1GP2A 1WS6A 2D2VA 2RAFA 3T5CA 1OWOA 5KSWB 1NBOA 3DDCA 3KSAC 2BEWA 1Q95A 1Z2AA 2VJYA 1EPUA 3OKFA 3CLKA 5CNMA 4XOUA 2O4CA 4K8OA 3OT1B 5BW5A 1RTKA 4OQYA 3ZWNA 2QRHA 4F9EA 1N0HA 4BXOA 2VNAA 1QTIA 3GT3A 5E6RA 1Y8AA 1F7VA 3M2TA 1CQJB 2GBFA 2OB2A 1QG4A 4MNTA 3CVXA 4J7CA 1OT3A 2BUCA 3V7FA 3INYA 1VJCA 1T2CA 1VL2A 1TJ3A 2CLIB 3B9BA 2IHKA 4QPJC 2IBMA 2DUUA 1L6RA 1LC3A 1ZUWA 4KQMA 1YU6A 4LZNA 3LZDA 4KR9A 1KI3A 3E9EA 5F35A 1KF0A 3DTVA 3RVRA 4AKHA 4RK1A 4PZPA 4Z9AA 4CXMA 1BMQA 4LHYA 4ALNA 1SOAA 3E7DA 3PGLA 1JFSA 4G2TA 1KA9H 4ZI7B 3D6FA 1ICIA 3FOEC 2K7ZA 1QO9A 4UHEA 4Y2PA 1TVEA 5TMPA 1R18A 5E8RA 1RFGE 2OCAA 4IHKA 1DEOA 1P9OA 4IQ8A 4L7QA 1W76A 4IG9A 1UQUA 1JDNA 4CPDA 4LKRA 4MQMA 4NIMA 2Q0HA 1W1UA 2CFIA 1XAIA 2ZIXA 3H5VA 4WRRA 2PM8A 2REQB 4LEIA 3NM5A 1NWCA 2Y6VA 2BMAA 3PGVA 4UEOA 2YWJA 3BF8A 4NYMR 1ECPA 2I2WA 3P2MA 1HPLA 4FOTA 3TZHA 1BA3A 1CR0A 4PSCA 3LCMA 4GO1A 3D7NA 3K9NA 1A2QA 1TNDA 2ON6A 3D54D 4WNIA 2Q5HA 3JV7A 4ZN6A 3CS3A 3IDAA 2IF0A 3KJNA 3LYLA 5C80A 3N0WA 1J8QA 2ZRIA 2B78A 4NDNE 5JS1A 4R98A 3NWEA 3TL3A 2I62A 4TLLB 4W8HA 3NXSA 1NZDA 1RYZA 3VMFA 3W2GA 2F8TA 2FR8A 1TZCA 1PYOA 3BWXA 3ONDA 4RPLA 3UF0A 3I3SR 2X15A 1MOPA 1GG5A 1P2UA 1NNSA 4TTSA 2C3MA 1OR8A 3WB0A 1VE9A 4TM8A 1X8KA 3HPRA 4IBOA 4GM1A 4WADA 3RAFC 1VQ1A 1N6RA 1B6RA 3SN6A 5J3JA 4UNQA 1KMHA 3GROA 4BV8A 1X1QA 5TC4A 1PR2A 3ZZ0A 3TK1A 2C59A 1G20B 2P41A 2ZI5A 3DAFA 4OQEA 4R1QA 2GD2A 4S1PA 2R1TA 4V2IA 5HJ5A 1ABBA 4FR2A 3EXEB 2B92A 1PGOA 1NHWA 4BGUA 1MH1A 4LOLA 4RD4A 2W6QA 3QA3E 3TBHA 1BN7A 4DFDA 1VIVA 4D99A 2VHVA 3UG6A 1OLSA 2NU9A 2YYAA 4LW8A 3BH7A 2DPGA 4FMCF 1F9EA 4PLYA 3Q8MA 1JHOA 2FPIA 2I4LA 5L45A 1CZUA 1Q6YA 1BOFA 2Z9CA 1VCMA 8AT1A 1OLXA 2GAAA 3EBPA 4V0NA 1SR8A 2EZ8A 1LJLA 2FZCA 2J48A 3PQDA 3PFWO 4X8LA 3ZV3A 4DHEA 4IPTA 1WSBA 5C1PA 2IEYA 4EW6A 4D8WA 1Y1TA 3FKQA 4RABA 1AF4A 4UM9B 3LLMA 3H9BA 3M9WA 2DBYA 4CCYB 4MVXA 2O2SA 3EXHA 3KWLA 2JFYA 4R51A 1D0IA 2VQDA 3TKLA 2EVWX 2FYTA 4MYDA 1H0RA 4IQFA 4KLZA 3C8MA 2F2TA 2PD4A 3OC6A 1X1RA 1DC6A 4KH0A 3GN2A 3LWZA 1L9XA 1K6JA 1QVZA 5FPQA 1O54A 2AE1A 5F1KA 3IOBA 4YJ2A 2CHQA 3GAFA 4YBZA 4Q4JA 3DEZA 5C8YF 4RY8A 3HB5X 4L8GA 4OGFA 4KUGA 4YQYA 2FJ0A 2QHXA 3IVXA 3HBLA 4HDNA 3OICA 4CTMA 4LMAA 4R1SA 1P2SA 3U3KA 4GI7A 5I8ZA 3LS2A 2ZJ5A 3GN1A 4I1SA 5A9RA 3WG9A 4QBFA 3FUCA 1WLSA 1R6XA 4BNHA 1XZGA 2YWRA 3AEXA 2O7VA 1F2UB 3C3BA 3PNYA 1PHPA 3SJAA 2ZUBA 1AXGA 3AO0B 4F3TA 1I7DA 3FWNA 4HGNA 5D3QA 3KPWA 1PDVA 5JXHA 2BBOA 2J0QA 4TMFA 4BO3A 3PNMA 3GFQA 4H31A 2XRMA 4LV5B 4RHUA 1I32A 4CLRA 3ASYA 2Q2QA 1JFRA 3Q3EA 5IF3A 4HQ0A 1BFUA 3TAXA 2FHPA 4BFVA 2JEYA 3OFNA 5CBKA 3DLIA 2ODTX 3IEXA 4FFNA 4IDDA 2JPDA 4N18A 4TUYA 3VU0A 2FP4B 3MYYA 1VJTA 1XP5A 1MT0A 2ZITA 4OI1A 5B12A 2C94A 2VLBA 3JQDA 4ECEA 3IEMA 2UVDA 3HS3A 5JQGA 1ECJA 1GPYA 1Z0SA 3QVXA 4FBMA 4D46A 3V8RA 2G63A 1GYQA 3KKQA 4HADA 5EE3A 5SZKB 5HA5A 3QBDA 5IM4A 5IG2A 2H1RA 4KGVA 3EPKA 1P1IA 1UBNA 1H65A 1K0FA 2BSAA 5KNDH 4CKWB 2CNOA 2XDYA 3LPCA 2VOJA 3N1UA 4MAFA 3KJZA 1PUXA 3SQNA 3HBNA 3KYCA 3WYGA 4S3MA 1N5JA 4O2BF 5B7QA 3GDWA 1E5LA 5HW0A 1VSQA 2I87A 4PXAA 4TYPA 3VR5H 1X9GA 1SKUA 2DTDA 2O0HA 2OORC 5A71A 3WLJA 4EGJA 5A2GA 2HW8A 4TMVA 1R8JA 5DTJA 5B6IA 4DXAA 4BVLA 2LGJA 4YAJA 3WRYA 3AHIA 5K8VA 5DXAA 1RXIA 2HBZA 4DC1A 4TRJA 5TPWB 3M9LA 4F46A 4ZYXA 1UC8A 2BFNA 3C8HA 3O4GA 2FPUA 4FSDA 3SVZA 1VG1A 3HUFA 1VXOA 3THWB 1HO3A 1YJAA 2JGEA 1M54A 1OFIA 4MICA 4Q4HB 5GZ6A 1NF9A 1MQ8B 3THOA 2WOJA 4TL7A 4HDKB 3TD2A 4FYMA 1H6DA 4Y0VA 1R9JA 2PH1A 3WWYA 2HJHA 3V4VB 2XE6A 3H97A 4JFRA 2YY6A 4KDRA 2FRXA 2J3DA 3WBFA 3HJBA 1HV8A 4DADA 3HN7A 3C5WP 1QIFA 4F3YA 5AWFC 4EY3A 3JAMA 2P2SA 1QGAA 3AERA 3T5AA 3PXBA 4GW3A 1SHKA 2CLDX 3JR3A 3N8KA 3EFEA 2ADFA 3IH5A 3U9LA 1BU5A 4RZXA 5DPMA 1RHRA 3ZWCA 5E9AA 3NWJA 4MUJA 2HGSA 3LT0A 1FNBA 4FC6A 2H51A 4RY9A 1W87A 1M34A 2PQ6A 3PS9A 4PO3X 5L7YA 1K2VN 1S3IA 2PZLA 5JSFA 1EXDA 3E3LA 1TYZA 3AQ4A 4MYUA 4G37A 1XMPA 2JHFA 3SPXA 1CQZA 2C5AA 3BGWA 4JX9A 2VJPA 3VR4H 3VISA 3CVJA 1UOQA 4JQYA 3D3WB 1GZ7A 5K8JB 2IS2A 3SXJA 3SEFA 5B3KA 3LLSA 4GOLD 3CZ5A 4PCUA 4R54A 1L3CA 4ARZB 2P27A 1UAGA 1EUQA 3R5XA 3KUCA 2JHAA 4PF1A 1TW2A 1WCIB 2ZR8A 3TE6A 4WKNA 2WHPA 2XDQA 3B85A 5EA2A 1H8EA 1H9CA 3ZTTA 5F77A 2H31A 1DE0A 1YDMA 1Z73A 4ZANA 2V6GA 3UHFA 1W0KA 2W93A 1DIRA 1YR3A 2ASVA 3QQPA 3OZBA 4OH1A 4HR7A 4D9HA 4WBNF 4L9SA 5KPJA 1S4QA 4JASB 2V97A 2WJYA 4L0QA 5B36A 1W8DA 2J85A 5HRCA 9LDBA 3AG5A 4C6TA 4XCXA 1V47A 1Y8QB 4BKPA 1EK1A 5AESA 1EVKA 5F51A 1MAHA 3OT5A 4LGVA 1C1HA 1L5VA 2XJ9A 1PJBA 5KNDA 3QVTA 3AUTA 2W8BB 4LOAA 1EVLA 2E89A 2R65A 4KNVA 3FFTA 3I23A 3FPJA 3BKXA 3TW6A 2O8CB 1KIAA 1Q3KA 1DBPA 3FMFA 3KVNA 2IEIA 2O1SA 1P9RA 4LVCA 1BDJA 4ZQIA 1E4OA 4Z53A 1V6SA 2FW0A 4GPTA 3L07A 1LF0A 3PXGA 1DAIA 1P74A 4V3BA 5JWRA 3MSCA 2QDXA 4DV0B 3UTDA 3T5PA 1YOVB 1XRPA 3G9TA 4A0GA 5D87A 5JAMA 1IDN1 1PJCA 1QCYA 2R6DA 1CZRA 1Q92A 2Y3IA 4FOLA 4U7JA 5I7OA 1X80B 2YUTA 1BC5A 2MSWA 3L8CA 4OI2A 2YNMC 3LCUA 4I1VA 2UZ1A 3DNFA 3ZU4A 1O9HA 1FNSA 3RV3A 5IJXA 1UFVA 1QHNA 1F6BA 4M49A 5GY7A 4FGJA 2CE2X 5HRUA 3FYHA 4EJSB 5LJLA 3IBFA 1DAEA 3PUVA 3DM5A 2I4MA 1UZUA 3JR7A 2XE7A 4M46A 1EQAA 4MO2A 3WYAA 2DQYA 2CSUA 3NBFA 2Y1GA 5DLQC 1FP2A 1R37A 2C84A 2P9FA 4FNOA 4IDHA 1KWGA 1UP6A 5HILA 2CVQA 1E3MA 3VZCA 3HKDA 4KQ6A 1NRIA 3TLKA 2Q45A 1MB3A 2GN6A 1UPTA 2R7MA 4YRRA 3ZD6A 1B8PA 3U7IA 2A35A 3ORFA 3TLXA 1C0KA 3BCUA 2CKMA 1U7WA 2AN1A 4PV7A 1MV5A 2C9CA 1ZDMA 4EF4A 3V1LA 1JHRA 1C7ZA 4DMLA 4QYTA 3WZ2A 5IBRA 3BRWA 2FEOA 3VC1A 1BTOA 4I1YA 2WWIA 4WCFC 2NAFA 5IUKC 3VH1A 9ABPA 1JLLA 3BFVA 4PGGA 4YT4A 3FXAA 1M8PA 3BTVA 1X3LA 3JWHA 4WZBB 5HKLA 1TYBE 4HWTA 1NUTA 1JDBC 1ZW6A 5HIJA 3OQOA 4DIKA 2CHFA 5HR5A 4JQZA 1TEXA 1JJBA 5EKDA 4CTOA 1T4GA 3IIJA 2WYIA 3ZCRA 1RYHA 1WXFA 4R2JA 1CJVC 2AFHB 4L76A 4YLEA 3DHNA 3EAGA 3GHHA 5DXFA 3FSGD 3WA6A 1GNQA 1M8GA 2PSSA 5AW0A 1U2RA 2ZCUA 3UHAA 1LJ8A 1FYWA 2E0IA 3CSSA 3ZCPA 2D06A 4NCKA 1QGDA 2D5CA 1DU4A 1RJ9A 1MC4A 3PCXA 4OXIA 5G40A 3J81A 2JIRA 3JTEA 1MO4A 1BMTA 2HU5A 5I9IA 2LV8A 821PA 4NBLA 1GUAA 3EGOA 5D8DA 3D8HA 1O4WA 1GARA 2QMUA 4LZPA 4RH1A 2VT2A 2WUEA 4UFPA 6ABPA 1NIPA 3QLJA 1NPDA 2J9YB 3JALA 2ZSFA 3V1YA 4UM8B 1H66A 1U5BB 4JJEA 2GO7A 1UPAA 2QEQA 3MCWA 4QSMA 2EKPA 1AKEA 2PX8A 2AYXA 4FDAA 4RFSB 4E5DA 5CFOA 1DAKA 2MR6A 5KZMB 2QNIA 1AK2A 2NP7A 3TD9A 1S1CA 3U1VA 3E9QA 3GRCA 4RNDB 1M6EX 3X3HA 5B64A 3Q5EA 5ALUA 1SOMA 3HDVA 4YI3A 1W5EA 3VO8A 1EDOA 2VTDA 2HFJA 4GYWA 5K4AA 3FWHA 4ESOA 2HEIA 2HCFA 1R1DA 2WP8J 1MO5A 3A06A 1MW9X 3DHEA 3KQYA 2G88A 1YWGO 1G3IA 4JBNA 4AW9A 2MYPA 2KQUA 2IGTA 3U1BA 2UYGA 2XD4A 2FZVA 3H1BA 2BKAA 3MRXA 3TNFA 2G5TA 1T8PA 1OXTA 3U17A 1ZUNB 3EEOA 4E03A 2OCIA 4C89A 1VBKA 3F0TA 1E64A 2IYOA 3P45A 3IDSA 4RIIA 421PA 1UM9B 2PK3A 2X40A 1C1DA 5AKYA 5BRAA 1WA5A 5EKTA 5K8LA 4DM7A 3HXMA 5C7LO 5J2TF 2RHDA 2G5GX 2XUQA 3PFHA 2OAQ1 2EX4A 2X3UA 2DULA 4RK0A 3GLKA 2BLNA 4MRAA 5LN1A 2FWJA 2H00A 2QTTA 3RYHB 3H2ZA 2QTRA 2PY6A 3C1AA 2XLCA 1JYFA 3DDUA 2VXCA 5ALRA 5HFAA 1KU6A 1TK2A 3B3FA 4BJ1A 3ITKA 4B44A 5C4MA 2SNIE 4ZI3A 4NTZA 2WWTA 2BGIA 2M6SA 1JJAA 1PSWA 2RBEA 1UBJS 3NIBA 4XDGA 3GJQA 3MMXA 4IF4A 1HNXB 4Q24A 3LUFA 1ZMOA 1D1TA 4LF5B 3AVTA 3IKMB 1P7CA 2J7KA 4B8ZA 1KQFA 3ER9A 2OAGA 1KGDA 3BIOA 1KDVA 3UXHA 5B3JA 3BAFA 3P0IA 2Q9UA 2XECA 3C3WA 3ROMA 3MJTA 1TVKA 4F72A 2EX1A 2ZIVB 1ECBA 4LNUA 3TQHA 3AKYA 4N5NA 1TUEA 2XEXA 1KQPA 1MLDA 1BFKA 3DE0X 3RRBA 2UXCB 1T26A 2ZUFA 1ZY2A 4OQDA 1DBVO 3ESXA 1JHZA 4C0AC 2ID7A 5HJ2A 5KQLA 3SZMA 2FR8C 1SXGA 4K6KA 1FIUA 3F3YA 2B4KA 1GCAA 1ZWLA 1M8KA 4IUDS 3C43A 3WWCA 5A5GA 5DGXA 2VZ8A 2FFHA 2WWHA 3AQIA 1MJHA 3RUAA 2HA7A 3G0BA 4QVIA 3FUWA 4Q03A 2ECPA 3W5SA 1IOVA 3LWDA 2QZ9A 2FJPA 4EDFA 1P1BA 5HMMA 4ZZ1A 2PUVA 3PUYA 3KR9A 5C8YA 1XKLA 3K05A 4L3VA 4X3CA 1OB2A 2QTVA 4N65A 4ZCSA 3MXOA 1GQSA 2YMQA 4YMLA 3DZDA 2Z1DA 2Z2IA 2WNHA 1W48A 1Y6QA 2JCSA 4FZJA 1Y3AA 5AW8A 3HXKA 3PXUA 4Y2UA 5EKSA 4M60A 2VJQA 4JJKA 2ZUTA 2IP2A 1W36C 1QH9A 1C3EA 1DMRA 4DCSA 2ATVA 1H0KA 4C7KA 2PV7A 3LOUA 4XLTA 3AJAA 1E62A