1YZQA

Gppnhp-bound rab6 gtpase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
164
structure length
164
Chain Sequence
b'FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small GTP binding protein RAB6 isoform
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 57
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yzqA00
3AF1A 3S1AA 1Q12A 3ND8A 1FP7A 2KBEA 5HE9A 4IDPA 5L3QA 3KQLA 3DO6A 4A8JC 4WA7A 3NHBA 1DE0A 2ATXA 1W47A 1IXSB 4KYUA 4PQYA 2OBMA 3TW4A 3L82B 3THXB 5E7MA 2X2FA 4BRUA 3C8UA 5JSZB 3MMPA 1FW6A 4LBVA 3UG6A 2ZI6A 2XNSA 3WNBA 3QF7A 2O0HA 2ODEA 3AB3A 3AH8A 2E9SA 1E4YA 1IAQA 2BKEA 2BMJA 2VTKA 3QEJA 2ZRDA 4TTQA 3GLIA 2VO1A 1JBKA 3GEIA 2IYUA 3MFYA 3HPQA 4AI6A 4ZIRA 3BRWD 2VH5R 4FMBB 4HAYA 1CU1A 1ETUA 4MGZR 4JT2A 4KHZA 1JR3D 1GDDA 2BMDA 5FOTA 3MWLA 4TYPA 2WOOA 4EFMA 3EWSA 2D7DA 1NMZA 4TT3D 2CL0X 5FBRB 1H8HD 4Q7MB 4KYIB 4DDUA 5FBQB 2VIIA 4RD2A 1TMKA 1Z47A 3B9PA 3I5YA 3L0IB 2QMUA 3RWOA 4PPQA 3ZJYA 4EPTA 2ZE5A 5H8WA 1LF0A 5DLQC 3AP2A 3G82C 1TQDA 1MO6A 3UATA 3GJ8A 3WBKA 2EWVA 3IPYA 2ZRBA 3PUWA 4HZIA 4B44A 4P4TA 2QEQA 3FTQA 3ZVRA 2GXUA 4Q18A 2JJ1A 1XP8A 3CRVA 1DBSA 3SYKA 4YMTA 4HAXA 4BWYA 4ARZB 1W36D 3T1QA 3AF3A 3BH7A 5EE5B 1KI6A 3OIWA 2IS2A 4GZMA 1E1RA 1ZRHA 1KSHA 4X8LA 4UKDA 4MRSA 1XJQA 4DDWA 4KCGA 4MKIA 3C5CA 4R2HA 1AQUA 5JRJA 2RGEA 2F1HA 4GDFA 2SHKA 1TADA 1G3RA 1GTVA 4D0LB 4FWTA 1AN0A 4KBFA 4YMUA 4II7A 4M9XA 4R98A 3I72A 4XTCS 1DEKA 3LLUA 2JLVA 3X1XA 2QGZA 1R5OA 5BN5A 2ZANA 1CRPA 121PA 4OK3A 2ZUCA 4MDEA 3PVSA 4IEIA 1IOZA 2ASEA 2XZOA 1PLLA 5AWFC 3ICEA 2AK2A 1CR0A 2VP2A 4F4CA 5GJWC 5CJPA 5LD2B 1EGAA 5IK2A 1GFIA 3LW7A 5G53C 2VF8A 5CDFE 1JJ7A 2C03A 4TMXA 1VCIA 3FKQA 2Z43A 4ESHA 3HP1A 4B71A 4G5QA 4NBSA 1QG2A 1N0VC 3NC0C 1XU4A 3K70D 2NG1A 2ZR7A 1N5IA 3LW8A 2QPTA 2ZRMA 2O8FB 3MJHA 2OM2A 3L0OA 1UPTA 3TJZA 2QAGC 3U6KA 4NCHA 4WVFA 2P2LA 2CCGA 3JVVA 2LKDA 4JL5A 3TH5A 4IRUB 2W2TA 5HZHA 2QPOA 1TQ6A 2J0UA 1HH4A 2AD1A 4DLTA 4LC1A 4FWIB 4MITA 1MR3F 1XEFA 2QI9C 3TR5A 2WIBA 5HTKA 1KI9A 2RGAA 4PXAA 1E0AA 1IONA 1CEEA 4IFEA 2YC2C 1HV8A 2FEMA 2XSZD 2FFHA 3EW9A 2OCYC 4C9BA 2QN6A 4Y0VA 3I61A 1Q0UA 2OZEA 2Z83A 4TYQA 2O8BB 2GK6A 4BLQA 1U94A 2GCNA 4PQRA 4C0KA 3W8RA 4LI0A 3AKDA 1ZIOA 3L0SA 3L2OB 2G9NA 4GT1A 2QBYB 1X8LA 1N6RA 4P3YA 4BLOA 1OLOA 1WE2A 1P7CA 2WJIA 1KDRA 2ZJZA 3BGWA 5HPYB 4L8GA 1ZUHA 3FVQA 5FBVB 3GLHB 3KXIA 4NP6A 1PZNA 1KK3A 2VF7A 5A4JA 3VAAA 3EIQA 2DFLA 3QKRB 2AN9A 2FDCA 2ODBA 5EE0A 2GJSA 1DAEA 3NVAA 2A78A 2JAQA 1JEEA 2GEDA 2R62A 1MABB 2VSFA 3IUYA 4ABYA 2ANCA 4KBGA 3K70C 2GEVA 2XITA 4GPTA 3U3KA 5J40A 5B64A 1MV5A 3TQFA 1FUUA 5JRZA 2GEUA 3LNCA 4BQSA 1KK0A 5DGXA 1VMAA 3ZIAA 3VNVA 1E79A 3VR4A 1W5TA 1FQKA 2WIAA 4ZI2A 2QM7A 3IQXA 4OJQA 3WP0A 2J0SA 4TYWA 4WOPA 2NO0A 3P27A 1RRGA 3U7HB 1RJ9A 4HI0E 5EP3A 1OXUA 2N1BA 2OBNA 2R2AA 4FXPA 4QGAA 4V0NA 4ASUA 1PUJA 1ZU5A 2FZLA 3RC8A 1KSFX 1JECA 5KYKA 4BUJA 2DR3A 2W0SA 3MSXA 4LCBA 2ZU6A 3U6BA 3OAAD 3OEHA 1C4OA 4NCKA 5KNDA 4TLCA 2QT1A 1NSTA 2Y8EA 2O0JA 3K0EA 3LWNA 5FL3A 2IWHA 4DLWA 2VQSA 4B34A 1G8GA 2EW1A 2DWPA 4BFXA 4B33A 1CKEA 3ZQ6A 1Z83A 3PEVA 3KZ1E 3VNUA 1GSIA 1ZMXA 2C8VA 2XTZA 3U44A 1II8A 1T3LA 1TAGA 4DEYA 5J4KA 5CB6A 3EZ7A 3BWDD 2KI5A 2ZRGA 3NBXX 4G5RA 3T61A 1S2MA 2Q9CA 2OAP1 4ZDWA 3OFND 4JLAA 4ACBA 1PV4A 3CF6R 3WMFA 5B58C 4OYHA 2PCJA 2XX3A 1KNQA 3QF4B 1XXHA 1JQLB 2G3YA 3QUSA 3RYTC 1T0JB 4HLDA 2REBA 4YDHB 2ZAOA 5KNCA 4AC9A 5AUNB 2CHGA 4Q4HA 2EFHB 2ZE8A 2ZJ2A 4C0AC 1UEIA 3K0AB 3KXLA 1E2DA 5AJYA 1O3YA 1P2SA 3GJXC 5A5GA 4WW0A 1QHHB 1GL7A 1VHLA 3E2IA 3ZVLA 3KX2A 2FH5B 4Q02A 1KO1A 3I5XA 1WF3A 3LLMA 4RZ2A 4V0LA 5L8VA 4CVNA 4Q4JB 2ZS7A 4F91B 5C18A 4KAXA 1F48A 3GMTA 1OXXK 2HDNB 1OKKD 4QFMA 1OXVA 2QQ0A 2VYFA 4HDCA 3QKSA 3OE7D 3QKUA 5FI0B 3UIEA 3RS4A 2WV9A 5AUOB 3O8RA 1U2RA 3ADBA 4I4LA 3K0FB 2FMXA 4IOLA 2CLDX 5EP2A 3SC3A 4MUAA 3UMRA 4OQMA 2GK7A 1ZM4A 2YOFA 4TZ0A 3BFVA 5FPHA 2FNAA 1NSFA 2JIZD 3IHWA 3S1AB 2R44A 3NDPA 4FINA 3K8YA 1LTQA 3CX6A 4Q66C 4PX9A 3C14C 1W4AA 3W5IA 1EFRA 1CRQA 2GZDA 2AD5A 2W0MA 3PENA 1U99A 4ZO4A 1YZNA 1FX0B 3M1IA 4DLYA 2O52A 6Q21A 4U02A 2BMEA 1OT3A 4RCYA 4YMSA 5F2EA 3UANA 4LK2A 3BFXA 3DHWC 4O2RA 5L3SA 3DVLA 2HUPA 3DKPA 1DG1G 3BD9A 1R0WA 4XSGA 4ZIRB 2QENA 4QJ5A 1WQ1R 1Q3TA 1YZTA 1UKVY 4KITB 3WNCA 1N6PA 1KGDA 5DN6A 3VX3A 2CVFA 3EIHA 2HJGA 2ERYA 4HUTA 2KSQA 2RGXA 3RHFA 5JSZA 4G3XA 3THXA 2BEKA 3F3YA 4FW9A 3DMNA 2AL7A 2BM0A 3R9IA 1WDTA 1L8QA 2MSDB 4ZCLA 3K1JA 2GNOA 4GOKA 3ADKA 1HQYE 2R8RA 4A0FA 1TF7A 4PC1A 3TUIC 1RC8A 2QROA 5DNYB 1SHKA 3PXGA 4TYNA 2GBLC 3GJ7A 3AQ4A 3TE6A 5CLLA 3QJYA 1YU9A 3AF0A 4Q7JB 4EJSC 1A82A 2G88A 4J0QA 1R0ZA 1CR2A 1NG9A 3AVYA 4KJZA 3EIEA 1BOFA 1RRFA 4UQOA 4D4JA 3AF4A 1Z6AA 2C95A 4FIDA 2QE7A 4LOAA 4DBLC 5L3VA 4V03A 5L3RA 2ZRKA 2P5SA 1E2FA 4LHVA 4D81A 2FWRA 5JJLA 4D0NA 3GLFE 1A2KC 5EE3A 3EPJA 2IS1A 1KI6B 4JLKA 3OHMA 2ZI7A 3WHKA 1NY5A 4NYMQ 5J4VA 3K09C 1G8FA 5FI1B 2OFXA 1LFDB 1R6BX 4BFWA 1H8EA 4O2LA 4HSEA 1EESA 1GRNA 4LHXA 2IYYA 1W7AA 2ZITA 1W5SA 2V7QA 1E3MA 1KO5A 3LBHA 1MO3A 2CNWA 1Y63A 2P5TB 2R6AA 3EASA 3OEEA 1R2QA 4JLMA 3RS5A 4ACAA 3EA0A 2JA1A 1XJCA 1E9EA 1YZLA 4QHSA 5BYKA 4QBFA 4ARZA 4XWOA 5B57C 4V0MA 2YWGA 4UNPA 2ZRJA 3U61B 1NJFA 1GG2A 2AHOA 4BEBA 4MKHA 3NBZC 4NH0A 1BH2A 2QU8A 3CRRA 5CK5A 4E5UA 1NVWQ 2C9OA 1G5PA 3KKPA 1Z08A 1UDWA 1VYUA 2H17A 1SVSA 2VHUA 1SVLA 1YZGA 2J46A 3B1VA 1HURA 4NDZA 1EFTA 2KBFA 1F6BA 1TEXA 2F9MA 4Q9KA 3TVDA 4D2IA 4CIDA 1D9ZA 3Q5EA 1OFIA 1KK1A 4NYJQ 1UFQA 4TMTA 3SE0A 3KL4A 4RCZA 3FMFA 1ZNZA 1AS2A 5K8LA 3B1YA 4NYIQ 4MRNA 2OBLA 4XH9B 4B2PA 2N46A 3A1TA 1E2MA 1L4UA 4CF7A 4F92B 3I62A 3EXAA 2PJZA 2Q3MA 3AP1A 2V3CC 3OIVA 2HV8A 3A4NA 3L8ZA 2DWQA 4QGFA 3FOZA 3BJIC 2ZYUX 2REXB 3KKNA 2FPMA 2QAGA 5FTLA 2O8FA 4A1FA 4YONB 3ZIAD 3I8SA 4LSGA 4DCUA 2HLDD 3ZZUA 3NBYC 4HB3A 2IYWA 2CLSA 2HT6A 1OFTA 4M1SA 3LX8A 2ZRHA 4L16A 3CONA 2J87A 3V4RA 3TK1A 4ASUD 3VHLB 1KI1A 1N0WA 2WZQA 4JZKA 3EZFA 2OLKA 4XJXA 5KOYA 1ZW6A 4S35A 1Q1ZA 1PVOA 3UWOA 3NG1A 2OEPA 4MKGA 3ZVNA 1JJVA 4LJAA 4JSTA 2O8BA 2MMGA 3BB1A 4DJTA 3C41J 3MCAA 1E9SA 1R4AA 1XEWY 2ZRCA 2VP4A 2C2HA 2CJWB 3KKQA 4TSFA 5EXTA 4A0RA 2FZ4A 4OQXA 1QDEA 3CWZA 4ON9A 2NGRA 1CIPA 2QBYA 1G41A 4KO8A 1W4RA 4PC6A 1G7TA 1N5KA 3KJIA 4DVGA 4C2TA 3PEWA 3W90A 1E0KA 1SULA 3TUJC 2RCNA 4XD7A 3W34A 4M9ZA 5J47A 2G6BA 3A1SA 2FEOA 2ORVA 5FL7A 5CDFA 2ONKA 2ZQ5A 3GLHA 4DLUA 1OV4A 5F3WB 2EFCB 3DOFA 5BXQC 3AUYA 3QKRA 3VKGA 3BC1A 1Y3AA 1BYIA 2GESA 3AKEA 2B21A 1HYQA 1G291 3SFVA 3K9GA 4BE7B 1SXJE 3AVQA 1MABA 4R2IA 5KHOC 1S3SA 3NKVA 2OXRA 4QBGB 2IYRA 1CR1A 1G7CA 1NVVR 4CT5A 3WHLA 3IILA 4TQUS 1FOEB 4Q1CA 2HF9A 2OAQ1 4UXIA 1B0UA 2A5DA 4L9SA 4B74A 4B3XA 4POAA 3LH5A 3I4LA 2Q9AA 3D6TB 2XJ9A 1BMFD 1NLYA 1XCGB 2GRJA 2YWFA 3IQWA 4ILEA 3A36A 2QTHA 3CO5A 4OKSA 5ANRB 2G0NA 1Z5ZA 5D3QA 4DUGA 2D06A 1OPXA 1KI3A 2IYSA 1U0JA 3R8CA 5EZ6B 4BZXA 1T5LA 2JLRA 4BLRA 2QPAA 5E3HA 1T5IA 3PEUA 1DAHA 3MWKA 5FR2A 2V6JA 2FSGA 4HAUA 5BWMA 2OT3B 3PUVA 3U3RA 1X8KA 1JPJA 2J5XA 1XXHB 421PA 1ZUNB 2NO9A 5JCZA 4E07A 2D74A 2J41A 1HTWA 4X8HA 4Q4HB 1NI3A 3K53A 4ZDKA 2VP5A 1GUAA 3JVUA 4Z1MA 1W0KA 2GF9A 4F7WA 2EU8A 4JVNA 4QM7A 1SXJB 1U9IA 2J59A 2YJTD 2QORA 3LBIA 3Q8XB 4DLXA 1CJMA 1KI8A 4LV8B 4A36A 1YHNA 4HYYA 4B2IA 1UKEA 4AG6A 3QF4A 3SNHA 2QRNA 2VLIA 1N25A 4RJLA 2IYTA 1XCMA 2C04A 3H86A 3QVUA 3UKDA 2BBOA 5IRCD 1FNMA 4IJMA 4LYJA 1G9XA 3RS3A 3K0AA 2GF0A 4IHQA 4ZDJA 1U81A 3L8YA 1QHHA 1KO8A 4OI2A 3WNDA 4A2WA 1G16A 1U8AA 3QI2A 2BDTA 2IW3A 5BN4A 2JDID 4DB4A 4O3MA 5GADl 3SYLA 1JAHA 2YOGA 1IQPA 4FMDF 221PA 4Q4JA 5AUQA 4D80A 2JLZA 4NU0A 1G18A 2VA8A 4BLPA 1Z0FA 2MSEB 5DI3B 3TKLA 1LB1B 3K0FA 1M7BA 5B2ZA 3KQUA 2PBRA 4URVR 2F9LA 3EX7C 2QM8A 4UXJA 3RRNA 1YR6A 3RVBA 4AD8A 1IN8A 3DOEA 1E6CA 1SVIA 2QNRA 2PT7A 4A8JB 1W49A 1E9BA 2ZSDA 3CX8A 1FTSA 4RZUA 2W6ID 2A2ZA 4GP7A 2WJYA 3U60B 1IY1A 2LKCA 2PLFA 1E2QA 3MRSA 4M4SA 4TLBA 4EPXA 2CK3A 1A2BA 2D7CA 2BC9A 1SQ5A 1XD8A 4OHZA 4YXWD 2GXAA 3HU1A 1CJUC 1VCOA 4PC3A 1FX0A 2QMHA 1Q57A 2QZ4A 4GI7A 3CPJB 1XBTA 3OIUA 2PX3A 3UWKA 1ZD9A 4QKQA 2V7QD 2QMEA 1VG1A 1JI0A 4QNMA 3W5JA 4Q48A 4RD1A 1NN0A 1DAMA 1AZSC 1PLKA 2REOA 4P32A 1W2HA 1RW4A 4PPGA 4MH0R 5DE3A 1P2UA 3GLGB 1R10A 5IHPA 2WAXA 1UJ2A 2FOLA 1G4AE 1X3SA 3A8TA 5CB8A 1AKYA 3EZ9A 1JR3E 2IF2A 2BWJA 2GAOA 3GJ4A 3QPVA 4FMDB 2IEYA 4JJKA 1V5WA 2NQ2C 2GBLA 2G77B 2PT5A 1KO7A 1E2NA 5JWRA 1Q1EA 2R65A 3AV0B 3C7KA 1VHTA 4YC7A 2PJRA 2AWNA 3EARA 4DCTA 2J1LA 4JIMA 4DHEA 4I1SA 1F2UB 4LRWA 1RE0A 1T91A 1RRCA 2ZYTX 1E96A 2J7PD 3FHCB 1CJTC 2Z6VA 4CGZA 3GCGA 1LF5A 1OE0A 1NBMD 1ZM9A 2FFBA 2DYKA 4MRRA 2EWWA 1KO4A 2JASA 3EC2A 3QKTA 1OH5A 1VIYA 2OILA 3HU3A 1U8YA 3WY9A 1W1WA 2ZYVX 1NBME 3UMFA 2WJGA 3H0KA 4URYR 2EVWX 2WSSA 1XPUA 3E70C 3B1WA 2NO1A 5A0FA 4BZPA 1U90A 4JL6A 5FOXA 1Q44A 1A7JA 1O87A 4HLUA 2FFAA 3SJAA 4A4DA 3M0EA 3RRZA 1BO6A 3CBQA 4W9MC 1E2GA 2FGKA 1TTTA 4KLZA 4RD4A 2HXYA 1E9CA 3I92A 1JR6A 4HUQB 3FYHA 2KWIA 3NEYA 1ZC3A 2BMFA 2CHQA 2ZIAA 5DIFA 1IY2A 2GXQA 1RRPA 4TYYA 3KDSE 4I1OA 3QENA 4PHTA 3KJGA 2P6RA 2W6JA 4AKHA 3H2YA 5C46F 4MGKR 2JGNA 3CRW1 3PITA 1NP6A 2C5LA 3VR3A 2ERXA 1DAIA 1G8YA 1AS0A 2ZUDA 3RANA 4B32A 2ZETA 1XNJA 4MQBA 2P6UA 3NWJA 2WM9B 1XJ0A 2QAGB 3BK7A 4C7OB 2QRZA 3MWYW 3AGPA 3CB4A 2WAYA 2FSIA 4PC2A 5FL7D 5JBQA 5GJCA 1E9AA 1Z8FA 2ZJOA 1J8YF 1DELA 1G3MA 4WZBE 4B2LA 5JHHB 2JLWA 3A58B 1C1YA 2ZUBA 5C4GB 1TNDA 5JJIA 1W36C 2Q6TA 1D2MA 1Q21A 3O8DA 4H9GA 1VPLA 4A2PA 3RS2A 1JXOA 1G8HA 1ZNXA 3RNLA 3SEAA 4M53A 2A5FA 1IJFA 3FE2A 1LY1A 4M22A 2V1UA 5DSZA 1S1CA 1OXSC 3Q9LA 5G40A 4HZUB 3RS7A 2FF7A 3QSYA 1GKUB 4H1VA 1MRSA 3X1YA 1OFHA 4BFUA 2R6GA 3LQRA 4US2R 2H92A 1G5TA 4PAMA 4QJ3A 3EAQA 2QAJA 2V1XA 2EFDB 1FMJA 4JVLA 4N0DA 5FOUA 3T06B 2F55A 1LW7A 4O0MA 2B7BA 1TQ2A 5TVKA 2NIPA 4LV6A 4JKIA 4IVRA 5SZIA 4UNNA 4MGIR 1EX7A 1XFAA 1Z2CA 1D2NA 5CLQA 3LVRE 4I1UA 2YINC 1Z6YA 2V9PA 4IVQA 1US8B 2ZJ5A 1X8JA 2EYUA 3QPUA 5FOSA 2QMOA 2CDNA 4GP6A 4PPNA 1M7GA 1TL7C 1A5TA 1T8UA 2O8DB 2ZRIA 4TZ6A 3K70B 2CJWA 3DZDA 2ZROA 4LBZA 4RKFA 1RVDA 4B3DA 2WJJA 1OXTA 4WIAA 1N6NA 2FU5C 4LZZA 1DS6A 1UBGA 2DY1A 2GILA 2ZRAA 4NMMA 1OIXA 4Q9LA 3KFXA 3CM0A 2DHRA 4OQNA 1W0KD 2ZAMA 3AUXA 4IVPA 2BVNA 1PLJA 1WCV1 4LJ6A 1KMHA 5FPKA 3CRQA 3VMFA 3AVWA 4XWAA 1P75A 3NEJA 3GJ3A 4QBHA 4QRHA 3KB1A 3R20A 3W3AA 3RAPR 1N0UA 1UKYA 4MYTA 4F4IA 3GPLA 5JJKA 2P3SA 4EFNA 2F3TA 3T1TA 3GJ5A 3FHOA 4GRAA 2GJ8A 2XOKD 2XNDA 4DT1B 4O25A 4Q9JA 3C5HA 3QXCA 4JL8A 1FPMA 1WP9A 2RHDA 1NL3A 3D3QA 1G5RA 1GP2A 2A5JA 3CUEF 3EG5A 4S2EA 1PUIA 4Q21A 4ZDIA 1UBCA 4LUCA 3P32A 4PQFA 1KDPA 4Q01A 2WPDA 1L7VC 4PO8A 5KDOA 4Q00A 1FQJA 5LB4A 4ZKEA 3RC3A 5H1YA 3AF2A 2J0VA 2WWIA 2HEIA 4HB2A 4A9AA 3SQXA 2VHTA 2P65A 4I81A 1GRRA 2GAAA 1NLZA 2YOHA 2ZI4A 3K0CC 4JBYA 3I1FA 1W4CA 4DCNA 3REGA 2D2FA 1G7SA 4B47A 3GD7A 5CK4A 1E94E 4ZKDA 4GSYA 3PQCA 1TX4B 4PZYA 3WRXC 3B9QA 4MYCA 3LV8A 1ZNWA 4NL4H 3ECCA 3B85A 4NCJA 2CK3D 4IXMA 2IHYA 2WICA 3VQTA 1ZNYA 4LX0A 2C9YA 1DARA 3FMPB 2WWFA 3MJRA 3CX7A 4AY2A 2IXGA 1SXJA 1AGPA 2WHXA 5KSYA 4JLBA 3QQ5A 4E03A 2AFIE 2RGNC 2VSOA 3AKCA 4WZ6A 3KTAB 3FDIA 4DDTA 5EP4A 3WP1B 3WRYC 2I1QA 3CF0A 5EE9A 1WXQA 4GMXA 2AWOA 2NPFA 4LPKA 2O0KA 1N6OA 1UKZA 2RH5A 5JLJA 3AVXA 2RMKA 1E9DA 2AXPA 1E1QA 1FUKA 4V0KA 1EG7A 2ZE6A 1SKQA 4D4LA 1OIWA 1T8TA 4A15A 4BFYA 3RABA 1N3BA 1UBFA 1E2PA 2Z4SA 3N2IA 3A1WA 5KSOA 1NIPA 1DO0A 5HCNA 3SDZA 3ZD6A 4DSUA 3B7GA 4TTPA 3ZYCA 1J90A 1VCNA 1KNXA 1ZU4A 2NZJA 4A2QA 4QBIA 3PIRA 1T6NA 2A7QA 2ZREA 5TDHA 1R0YA 5DI3A 1J99A 1KJYA 1XMSA 2PLRA 4CYMA 4EPRA 3EPKA 5AJXA 2GVZC 3SOPA 3KJHA 1A1VA 3K9HA 2P0EA 3W9YA 2WMOB 1U0HC 2JJ1D 3PUXA 2BOVA 3VTKA 4JLOA 3QBTA 1R7RA 2CBZA 1Z3IX 1N2CE 4A8JA 4LJ4A 2FPKA 2XB2A 2R6FA 2IYXA 4P31A 5BN3A 5DHFA 4DB2A 1E1RD 1II0A 1Z0JA 4B3BA 4RD3A 2IUSA 4TMWA 1Q22A 3QBVA 2FE4A 2FGJA 3B13B 3VR6A 4DSTA 2OFWA 4RVCA 2D4HA 4US0R 5FUVA 1EXMA 2I1VB 1AKEA 5TV2A 4W7SA 1K5DA 4W5WA 2OXCA 3Q3JB 4EJSB 1F2TB 3X1WA 4Q1AA 5F9FA 2B8WA 4GBMA 2IA5A 3VU9B 3CIOA 5EQTA 4EIWA 2IC5A 3A37A 2BJWA 3QEOA 3HR8A 1XD2A 2J3EA 3GLGA 2ZSEA 2C99A 3AP3A 3MWJA 2P6NA 3HU2A 3LQQA 3SFZA 2W6JD 5IK2D 5HKKA 2L0XA 4B75A 1KI4A 1B23P 3F8TA 1E2IA 1OH6A 5GJVC 2QA5A 3GFOA 1EX6A 4MRPA 1D6JA 3K9LA 1KZ7B 2B6HA 4TQAA 2PMDA 2QTFA 4C0SA 4F38A 1G3UA 3ZH9B 2AR7A 1QZXA 4JLDA 2ZS9A 4TL6A 1QHNA 5KDLA 3RWMB 1F2UA 4DRZA 5DHAA 1KOFA 3BOSA 3QG5A 1QG4A 1S96A 2B92A 4C0BA 4F93B 5FPSA 4C30A 4DC9A 5C1BA 4KXFB 1KZGB 4B3CA 4TLDA 3DPUA 1DO2A 4URXR 2AFHE 4PC7A 3OZXA 4L15A 2UZIR 1XF9A 1SHZA 3R8FA 2CLCX 2HCJB 1XTRA 4HDOB 5CM9C 4NPHA 1OB5A 1GNPA 3Q5DA 5EP1A 2J9RA 2PZFA 2DFTA 2QL6A 3H4MA 1P5ZB 3B1XA 3W3ZB 3EPHA 4P0TA 3KXKA 4C0JA 1GRQA 4JLJA 3K0SA 3BB3A 3IGFA 2CCKA 2H7VA 4HUQA 4IKEA 5DI9A 3CPEA 1JR3A 1CJKC 5C2JB 3GLFB 1XTQA 4OQFA 3QXSA 4C2UA 2ZI5A 4JLVA 2KJQA 3BBPA 1H8HA 1G17A 1RFLA 4MA4A 1E2HA 3KUDA 4R7ZA 1Z07A 1CP2A 4G5GA 1N6IA 1XEWX 1N6HA 3B60A 2IHBA 2ORWA 3AGQA 1IN5A 1G4UR 4NKRA 1GILA 5FBLB 1W4BA 2VSXA 4CW7A 1VECA 3BAFA 3ND9A 4RSGA 3TUZC 4RZ3A 5CJ2A 1E79D 3PR1A 4C7OA 3CLVA 1EWRA 4GOXA 5E7IA 1WB9A 1KTVA 1FTNA 2C77A 5UKDA 3NXSA 1QHXA 1K5GA 1W0JA 1TU3A 1QVAA 5KSZA 3ZQJA 2E1RA 3CRMA 2WWGA 4OK5A 4EAQA 2ZRPA 1MO5A 3QE0A 4HLCA 1HY3A 2J7KA 3ICQB 2BCJQ 3A4MA 1N6LA 3OEHD 2JJ8A 2KB0A 4B35A 1CR4A 1DOAA 5D3MB 4HZUA 2HF8A 4HAVA 4IEEA 3GEEA 3P26A 2ORIA 3LDAA 4L5BA 4DKXA 2IF0A 2X2EA 4FN5A 1YRBA 4N0EA 4EQ6B 4URZR 3PUYA 4EUNA 3ZD7A 1J7KA 4HAWA 4IFBA 3CF2A 2IT1A 1GAJA 2CXXA 2WPDD 3SN6A 2GA8A 2ZSBA 1HQCA 2D62A 3QNUA 4AIIA 1KYIA 1R5BA 2O5VA 2IS4A 3FGNA 1Z0KA 4BFZA 4IDHA 1J8MF 4RKEA 1SKYE 2IK8A 1CJVC 1GNRA 1KMHB 2VPPA 1US8A 1G8PA 1QHGA 4MYUA 4V02A 3VFDA 5F9HA 3CW2A 1RYFA 1U8ZA 2O8DA 3R9WA 3BB4A 2WWXA 2PCLA 4LYHA 4DWJA 3PEYA 4M2LA 2J0QA 2QGNA 4QGGA 2F43B 5BW8A 4TMVA 5E4FA 4AK9A 1CULC 5HZKA 3PFIA 3ADDA 4NYMR 5DO9A 4LGMA 4HB4A 3K9NA 2IYLD 5JZVA 5FTKA 4BLSA 4RFSA 1GKIA 1FL9A 4PHHA 3FFAA 2XEXA 5HE8A 4X8MA 1NNEA 3AVTA 2ZVQX 3VX4A 4BFVA 4P33A 2B7CA 3REFA 1PJRA 3O8CA 1W48A 1MRNA 4AG5A 1KK2A 5TB5A 2FG5A 4LJ8A 2BCGY 4JS0A 4L4UA 4Q03A 4EKDA 1KI7A 4WXPA 4DT1A 4ERNA 2CVHA 2YWHA 1IN6A 1ZM2A 2FFQA 2XB4A 3BXZA 4HDQB 2XXAB 3BH6A 5EXXA 1QBKC 2H18A 3QY0A 3IDQA 4PZLA 3WYFA 2OUKA 1E1QD 1TF5A 1KAOA 4FMCF 3U3OA 4JJZA 3T5GA 1RZ3A 1XCPA 2GETA 2ZR0A 4D4KA 3I73A 2TMKA 4LYFA 3WMEA 3BIFA 1SKYB 3O47A 5CIWA 1RYHA 3H1TA 3LVQE 5FH9A 1EFRD 4NE2A 4JT4A 1OIVA 3FB4A 4KODA 3GJ6A 3DMDA 3FPAA 4KFUA 2ZEJA 3T5DA 4TL7A 4TLEA 2GKSA 2GJKA 2R6CA 2VHJA 2DBYA 4NYIR 4OI1A 3FHTA 1S1MA 1NLFA 5EXPA 1XZQA 4CEJB 2D2EA 2ZU0C 1AS3A 3KKMA 3TAUA 2JJ2A 1KIMA 4A82A 2OESA 1T3HA 5DN6D 5FR1A 2HXSA 4QC2A 1WBDA 3B5JA 4AWXA 4PHFA 3A6PC 1F5NA 1UADA 5LDDC 4LJ7A 2FA9A 2VHQA 2RGBA 3FFBA 4LC0A 2DFKB 4PHGA 4EPWA 3PG5A 3SI7A 3ZS9A 1JQJC 1YZUA 5M04A 1MH1A 1G6OA 1I4DD 3KTAA 1E2LA 4CEHA 2IL1A 2QUZA 1XMIA 1AQYA 3OAAA 5SZJA 3HJNA 1P3JA 3RRYA 2G0TA 4CRWB 5K8UA 1IXZA 4RY2A 3A1VA 3KUCA 1CTQA 3THYB 1G1MA 2WWYA 1UBEA 4I1VA 4FMCB 3GEHA 1VYVA 2JLUA 2R9VA 2QE7D 5JECA 2ZRNA 5HKKD 4ESVA 2WMNB 4FCTA 3TSWA 1S3GA 3EC1A 1ESMA 2OE2A 2QT0A 3SS8A 3T15A 1EK0A 2OHFA 2ZTSA 3TQCA 3U7EB 4KFSA 1QHIA 1X1SA 2IWRA 1NVUQ 3UG7A 4NTZA 2BM1A 1XDBA 1E0SA 2Q9BA 1H8ED 1T9HA 1WA5A 3MG9A 3OFNA 2XZPA 1RPZA 5KTYA 1I4LD 1CF4A 1G6HA 3MLEA 2PH1A 2UZ3A 2RGDA 1CXZA 4M1KA 1GL6A 2CNWD 3OEED 1NRJB 3NIBA 3P4XA 3CWQA 2FSFA 1VTKA 1I2MA 2QY9A 2X77A 5FTNA 2IYQA 2F6RA 1YKSA 2J45A 3AVPA 4AKGA 4NZYA 5KUTA 1XD2B 4DCVA 2ZJBA 1KSGA 1HT1E 4LDJA 4ZCIA 2HYIC 4PZZA 2OO7A 1E98A 2X1VA 4V0ME 5KO2A 3FMIA 4PR0A 4LBWA 2RGCA 4LHZA 1XPOA 3TAHA 2VP0A 3QOFA 1J2JA 1F3OA 2YZ2A 3KQHA 3T1VA 2IS6A 3W6OA 1ZVQA 2XZLA 4H1UA 5IT5A 2CEAA 3WBJA 1UM8A 1OKKA 1P2VA 3Q85A 4G0NA 4EJSA 3OE7A 3P20A 1F2TA 1AGRA 2OSBA 1ZBDA 1DPFA 1TF2A 2PZEA 2H16A 1RKBA 3VU9A 2C96A 2JLYA 2GZAA 3V00A 2RGGA 3TBKA 1W2GA 1D5CA 2IYZA 4CT4B 5JS7A 3IPXA 1QF9A 1QHYA 2JIZA 4Q4LA 1WBBA 4PPFA 3LBNA 3TVTA 2JCSA 4YDSA 4DLVA 2ZR9A 1D2EA 1ZD8A 3SHFA 1DADA 3PCRB 4LJYA 1A4RA 4CEIB 2X19A 5HR5A 5H68A 3K09A 4EPVA 5HCIA 4AYWA 4QHTA 4B76A 4GZLA 5TARA 4CZ2A 3EA5A 4RFVA 1Z0DA 2C98A 4FD2A 4C4PA 2BEJA 2QP4A 1S9HA 3BORA 1UDXA 1XWIA 2FPLA 4JBWA 4AYTA 3IO5A 1W0JD 4PFSA 4U7DA 3I32A 4LYAA 4R9UC 3B2EA 2YKGA 1OW3B 1FNNA 3MGCA 3WYAA 1VCMA 3JZAA 4M9SA 2GWHA 2WWWA 4D0GA 3MAAC 2Q3HA 4G1UC 4JYCA 5GVRA 3ZS8A 2HT1A 1ESNA 2V54A 3U3MA 1GVNB 2EQBA 1Z63A 4Z8XA 1XTSA 4OL0A 3IEUA 4B3FX 2V4ZA 3RS0A 3U4QB 3P1JA 4BGDA 1ZM3A 1JAIA 4XSHA 4QL3A 4TMZA 2QTVB 2Q21A 1GWNA 4TSFD 3CNLA 4G5SA 2UVQA 3B8HA 1KKMA 3KQNA 2PEYA 1Z28A 3EPLA 4F4JA 1Z0AA 1GL9B 3DEFA 3AVOA 4XD7D 3GP8A 2VRWA 3CZQA 2JLQA 2XGJA 2ZPTX 3GLFA 2WBLC 1KJWA 4C0LA 4MDFA 5LD2C 1W36B 1TUEA 2OV2A 3GLHE 2CE2X 5LPNA 3OESA 2WOJA 2WKPA 2ZRLA 4BRWA 1T0HB 1KY3A 1NF3A 4AKIA 1WMSA 3B1ZA 521PA 2IXEA 4QG7A 2BHRA 4NCNA 3IKJA 1ZCBA 1QRAA 3E1SA 1GZSA 1VG8A 1Z6GA 2WKRA 4DIDA 5CM8B 2NOAA 3IHLA 1CLUA 1GIAA 2GZHA 2BBSA 4M8NE 5JWOA 3J81k 2XJ4A 4Y0AA 3KB2A 5J5CA 1VG0B 4PSVA 4OI4A 5FUYA 3OIYA 4U5XA 4BFSA 2VHCA 1G64A 3NC1C 4P4SB 4V0OA 2PEZA 4DUGD 1VG9B 1ZUIA 2UKDA 1V43A 1S8FA 1KAGA 2YV5A 1FFHA 2VL7A 2ZI9A 1Z6TA 4Q9IA 5CIQA 1RIFA 4QXAA 4US1R 1I4TD 2E87A 4TTRA 2RHMA 5D3MA 1XMVA 2NZ8A 1HT2E 3R7WB 3HYRA 1JEDA 4LJ9A 4EQ6A 2DB3A 3HWSA 2CCJA 3NBFA 4MKFA 3LRPA 4JLPA 1HE1C 1SVMA 5KPDA 4HATA 3TRFA 2BIFA 5KPJA 3FKSA 3ZLJA 4LHYA 5SZKB 4YMVA 4FI3C 1R8QA 4Z1MD 3SJCA 1YR9A 1AJEA 4RFSB 1NKTA 3B78A 3N70A 1TQ4A 2A9KA 1AA9A 3KJEA 4WZAE 4NONA 4OQLA 4DDVA 1DAFA 1QVRA 4JVSB 4WXRA 4D82A 5G41A 3U5ZB 5C4MA 3DL0A 2EFGA 1Q3HA 2W83A 2F43A 2JJ2D 2PX0A 1SVWA 5JS8A 1Z22A 3VR2A 2IBMA 2FJUA 2HLDA 2DFNA 621PA 3BFKA 1IN4A 1E99A 5DH9A 1P9WA 1ZD1A 2GVDC 4IOMA 5BQ5A 4GNKA 5FPYA 2D3WA 1ZM7A 3LXXA 4DCSA 2N42A 2WJVA 5JHGB 4DZZA 4ZI3A 2V8OA 1NMXA 3T35A 4LY6A 1XD9A 2JATA 4GL2A 4Z8YA 2H5EA 4YQFA 1EFHA 2RAPA 3RSOA 3VKHA 4EFLA 4UNRA 5E95A 1DAKA 3M6AA 4QHYA 3SJBA 3F5FA 3LX5A 1YZQA 1GITA 2I4IA 2HYDA 4PAOA 4QJ4A 3TGPA 2XXAA 3G5UA 3AEZA 1EFCA 2ZJAA 1NJGA 1M7HA 1IHUA 1XTKA 4LPSA 2QSZA 4OK6A 4DSOA 3QIAA 3NHAA 4M9QA 4IXNA 4LBYA 3D31A 3CH4B 2XTMA 2OCPA 2NTYC 4FCVA 2G1JA 3CKLA 1DG3A 1P60A 2OCAA 3NH6A 3DM5A 3CZPA 1TPZA 1ODFA 5LB2A 1K8RA 1VYTA 1R8SA 3ETLA 721PA 2V6IA 2JLXA 3VKWA 5EXSA 4EDHA 4JLNA 2O8EB 3ZZ0A 1SVOA 1U9IC 3IIKA 2AKYA 2EYQA 3VR5A 2VP9A 3IIJA 1NG1A 4PSKA 3THWA 5FBWB 1OH7A 5JEDA 4CEHB 5J4YA 4Q9HA 2IUTA 3RRMA 2WVJA 3VHXA 1N5JA 2GDJA 3TNFA 3W6NA 4TMKA 2ATVA 2WSMA 3BS4A 1Z06A 3SJZA 3GLIE 5FOVA 4CEJA 1NY6A 4A0HA 4I99A 1G20E 5F98A 3KQKA 3IEVA 3NDBB 5EUQB 1D8TA 1SZPA 1IM2A 4LWZA 4HEJA 1E9RA 2Q3FA 2W58A 3TW8B 2JEOA 1P2TA 4B43A 5FTJA 2YWEA 1XB2A 5DYGA 1E0JA 1BMFA 3F0TA 4IDNA 1XEXB 3Q7PA 4N1AA 2GJAA 4XVUA 2ECKA 2PMKA 1MT0A 3QPWA 4XOIA 2GXSA 1OH8A 1SGWA 5FPTA 2AKAB 3TMKA 5G3YA 1AIPA 3ZVMA 2O8CB 2H57A 1U98A 2CL7X 4RD6A 4QOSA 4MGYR 3TSZA 1P6XA 3CH5A 5K8TA 1GNQA 1AZTA 4K46A 1UAAA 3LXRA 1SVKA 3ONWA 2GCOB 1OF1A 2F1RA 4KV9A 4M1MA 4Z54A 2GCPA 2W00A 3JZMA 5GJBA 4KU4A 3THYA 1BKDR 1NVXQ 4MUBA 2F1JA 1ELOA 3AM1A 1ZJ6A 5AK0A 1AK2A 2DCUA 3DZ8A 5TXGA 1HA3A 3A4LA 4X8OA 2CE7A 5L3QB 1EWQA 4Q5IA 3CNOA 1COWA 1KSJA 3C16C 3Q72A 2QP3A 1ZAKA 2Z0MA 1VIAA 4XVQA 1T3SA 3TR0A 1NN5A 2WSSD 4Q4AA 3U2QA 2AK3A 1I2DA 1FMLA 3SZRA 4Q1EA 1E2KA 4BFTA 4E09A 3UK6A 3GLIB 2CHVA 4ZCMA 5GVSA 1E69A 1IN7A 3O8BA 3QVVA 5SZHB 3IBGA 4OBEA 5JI2E 1LV7A 1Q1BA 3QG1A 4XIGS 4RZXA 3ZGXA 2BBTA 3DDCA 3IIMA 4BZQA 2QP9X 4HLQB 3U3JA 3C15C 5J4LA 1MOZA 1HUQA 2DWOA 1BIFA 3ZZTA 1KHTA 1M34E 1M6NA 1OHHA 2A5YB 1II9A 2KE5A 4XTRA 2AX4A 2ZI3A 2A3RA 1Q1QA 4A6XA 1G21E 1GOTA 4KVGA 4DLZA 4AURA 2G1KA 1E9FA 2HJVA 4A0GA 4AKEA 4TL9A 1E32A 2F7SA 4M21A 4TLAA 4UJ3A 3WYGA 1JB1A 1YRAA 3EWAA 4OI0A 1J70A 2JDIA 5G3ZA 1S0UA 5FUWA 1YQTA 1G3IA 4PANA 4NHOA 5CYOA 3W8NA 4JYBA 1KY2A 1X6VA 2ZSFA 4BEJA 3PJRA 4UNQA 5CYPA 3LFUA 1L4YA 2YYZA 5KNBA 4OHYA 4Q47A 4URUR 1R5NA 4MRVA 4NCIA 5P21A 1UEJA 3NH9A 4A92A 3KKOA 2VEDA 3PUZA 5JWHA 1YVDA 1E4VA 2A5GA 3QXXA 2RKOA 4G01B 1XX6A 4AYXA 4DLSA 2YNMA 1S9DA 4DXAA 1H65A 4TWZA 2I3BA 2W6IA 1YE8A 5TMPA 5J4HA 1N5LA 1NVVQ 2GHIA 2Q0HA 1ZCAA 2XAUA 2Z4RA 3SHWA 2FV8A 4PO9A 3RDPA 4CEIA 4C0QC 1JALA 4YXWA 3I3SR 2W2XA 3EZ6A 1BS1A 3QXJA 4YMWA 1LNZA 3MD0A 5B30A 5K8IA 1JNYA 1G7RA 2CL6X 4C3ZA 2C9CA 3TSOA 4HAZA 1G19A 5AJZA 4HLUC 1XZPA 1M74A 1EFUA 1YR8A 2GTPA 1ZYUA 2ZYWX 3I8XA 3PV0A 2IXFA 8OHMA 3KFVA 5LBIA 2ZM5A 3GFTA 4M0LA 2X8AA 4B48A 1Z29A 4Z51A 1E2JA 2BJVA 4KFTA 2NO6A 5KU1A 1HEIA 3UMSA 4EPYA 1ZINA 1P9NA 1YR7A 3GQBA 4LHWA 2FX3A 4GOJA 4P4UA 5FOWA 3RSLA 2WWHA 4IDOA 3QXHA 1P73A 4TQ9A 4TT3A 1X1RA 4RD0A 3U4QA 1VDZA 1VKJA 3W6PA 1NIJA 3HR7A 2K5UA 1F60A 5AUPB 4JSYA 1U0LA 2A30A 4BPBA 2V55B 5JCPA 3X1ZA 3ASYA 4WAUA 4WBSA 1IY0A 1XTIA 3UPUA 3X1DA 3FKSD 2J7PA 2WJHA 2J0UB 1D9XA 2FSHA 1NBMA 1OJLA 1MKYA 4M1OA 1ZP6A 1GKYA 2ZSAA 4DEXA 4QM6A 3V9PA 1IBRA 2OG2A 4A6PA 2H8KA 2ZXUA 1X86B 4XWKA 3M4YA 1HE8B 5AJWA 3T12A 3WXMA 3L0PA 2Z5FA 4K81B 1NKSA 4OHWA 3LAWA 4D26A 5ELXA 3HPRA 1Z6XA 2XNDD 3U7FB 5TY0A 1DAGA 2YVUA 4IW3B 1GM5A 1KDTA 2MSCB 2VBCA 4TN1A 5FFMA 4N3NA 3LA6A 1P4SA 4DIEA 2ZJ8A 1ANKA 4PAQA 2GJ9A 3N2EA 4KI0A 2P67A 4BECA 1P62B 4KSBA 1KJZA 2NMVA 1OYWA 2F1IA 4ZV4A 3SYNA 3D7MA 3CPHA 2NO7A 4P4SA 4BASA 2H1LA 2IEZA 3VR1A 1OYYA 4B6FA 2QSYA 3RLFA 2OLJA 3GJ0A 1P72A 2AXNA 5E7JA 4C0HA 3BH0A 3HDTA 3LD9A 4PO1A 2B8TA 2RB4A 1KKLA 3R7WA 1W44A 5KDDA 2MMCA 1BYUA 1JXMA 4MYHA 3AVUA 1XRJA 3C4JA 4Q19A 3AKYA 2XTNA 2YHSA 3FWYA 1XXHE 4DSNA 2CMKA 3OF5A 1P9RA 4PTLA 4HB0A 1TUIA 1M2OB 4OHVA 3V4FA 3LY5A 4OJKA 4W5HA 3ASZA 1M8PA 1RJ9B 1SXJD 4KFRA 4Q1DA 4UNSA 1OFUX 2XSZA 1K6MA 3P4YA 3IBYA 3DM9B 2BV3A 1YZKA 3B82A 2ZS8A 5EE1A 4B6EA 2ZVPX 1L2TA 1NN3A 2ZRFA 1OSNA 3NTUA 3BERA 5EZ5A 1ZIPA 1MO4A 2W2VA 1LVGA 1FP6A 2ANBA 2OFOA 4D25A 3CR7A 2DPXA 3CR8A 1QHSA 2QG6A 4GFDA 4ITRC 4KSCA 1C9KA 5JMTA 2IX3A 4QGHA 3SU8A 1TEVA 3T34A 5JFGA 4L9WA 5JI3E 1S4QA 3TLXA 1NMYA 1E2EA 3G0HA 2LWIA 5FUXA 4KVAA 3IO3A 1DTSA 5DISB 3U44B 1KDOA 5AR1A 1II8B 3TIFA 1ZC4A 4QNRA 2WTUA 4M1YA 4GMDA 3LO5A 3B6EA 1M1YE 3E5HA 3SBDA 4E22A 1XPRA 3K0CA 3THWB 3EZ2A 2WKQA 4KLNA 4NYJR 5BYJA 1XTJA 2G83A 2ZE7A 1Z0IA 5FTMA 1NN1A 4K8OA 4BLTA 4UJ5A 1JPNA 3DKVA 1CBUA 2C78A 3D8BA 4UXHA 3UXMA 4Q1BA 4DLRA 3SBEA 1COWD 3WMGA 4ZPXA 1P61B 2OCBA 3CNNA 1IXRC 2F3RA 4LV5B 2IYVA 1T4GA 4U00A 4PSAA 2O8EA 1N6KA 2PL3A 4JBXA 3HYTA 4D6PA 5KSPA 2RGNA 1TU4A 2JLSA 1Q20A 1SXJC 3MUFA 5AJVB 4JVMA 3SQWA 2EFEB 3GFPA 3BE4A 2HCBA 3FMOB 3QKSB 2XOKA 1FZQA 3L43A 4IOKA 2BKUA 3N5CA 3U7GA 1KMQA 1LS6A 2LCFA 4YLGA 1UF9A 4R71A 1LS1A 3H84A 1OHHD 4B73A 3SR0A 4B3GA 1AM4D 1G3QA 4JKYA 1W46A 4LJ5A 4M1WA 821PA 2ODWA 5DYIA 1YJ5A 1Z2AA 1KI2A 2R6DA 1XMJA 4IOJA 3R9XA 2ONJA 5EUMA 4OHXA 1WRBA 4CDGA 1XEXA 2NPIA 1ONBA 2PZGA 1IJEA 4Q1FA 5H70A 3GLGE 2BBWA 2ODNA 1R0XA 2FN4A 3ZDQA 4W5JA 2O8CA 4IDQA 4TL8A 2VP6A 5IDVA 2IUUA 2QQEA 4Q4AB 5JEEA 3AVVA 4D4MA 4XVRA 5CITA 2ZJYA 3A1UA 1OB2A 1CS4C 4Q7LA 4JMPA 3T1OA 2GCOA 3X2SA 3ADCA 4M1TA 4FCWA 4G5OA 4URWR 2YC4C 4Q7KA 5IF9A 5L3SB 3Q7QA 1DVRA 5EJEA 3THOA
chains in the Genus database with same CATH superfamily
1N9GA 2P35A 2QZJA 3ND8A 3SKVA 1USIA 5G4LA 1E62A 4I5EA 5CDGA 5L3QA 3KQLA 2Q3DA 4L85A 2YL2A 1WLYA 1VLJA 2ATXA 4PQYA 1H2WA 1ZH0A 2OBMA 3HC7A 3C3YA 3OUUA 2X2FA 3HDYA 4IMPA 4QQRA 5SY9A 4A5SA 1E7QA 1XVTA 2V4UA 3RVNA 2XNSA 4UM7A 2V8BA 1ZGAA 4OQQA 2PSSA 3FROA 1X1CA 3GV0A 2E9SA 4IIXA 4IMIB 4MV3A 3P2OA 1Y34E 2VTKA 3QEJA 1X80B 3TTWA 3ZHZA 4FYJA 3I0ZA 1M8GA 1G20A 2O2YA 4R8SA 3H9UA 4YAGA 4NBTA 5KOJB 1QFSA 2VH5R 4UASA 2HM7A 2EJCA 1A50B 3TECE 3ZV3A 4BV2A 3C6KA 4R41A 3KVOA 4LFCB 4EOGA 1ETUA 1JVNA 2VPYA 1PJ2A 2XT0A 4DQDA 4KHZA 4R3WA 1GDDA 2BMDA 2Q4BA 4ZVKA 2VHZA 3MWLA 3MTBA 2ZTVA 4TYPA 4Q3DA 2C58A 1KRHA 1T6YA 2H85A 1GLVA 4YQZA 5EJ8A 1IOWA 3BCRA 2PBFA 3U17A 1WW3A 2CKDA 2CXSA 2XTAA 4Q7MB 4K6GA 4KYIB 5DP1A 3VVLA 4G0XA 2PWAA 5F7JA 1RM3A 3O91A 3GA7A 4MYSA 3X0DA 4HCJA 4FNAA 4QOJA 1DXQA 3RWOA 4PPQA 2HCFA 4BGVA 1KP2A 3PX7A 1OCEA 1TKCA 2YZGA 1X1EA 3IDOA 1N34B 5DLQC 2PZ8A 3G82C 4WCVA 3UHAA 2XMQA 3DEZA 3GJ8A 4MV4A 4YXFA 2EWVA 3G2PA 2ZRBA 4INZA 3ROFA 1N2BA 3UT5A 3ZR4B 4LF4B 3ZQ4A 4G0WA 3F90A 1L5RA 2PUWA 1GD1O 5K3BA 5DCYA 4ZYVA 1Z88A 3I30X 3GARA 2HQBA 2IQ5A 4M1QA 1NAIA 2WUGA 4HBGA 4PLYA 5NLLA 1W36D 2DSNA 3KYCB 1FVOA 3BH7A 5T4EA 4UE2A 3PQDA 4ZVSA 1DKOA 4Z3OA 2CLEB 3P0JA 4W9NC 2FEXA 1QPBA 1U8UA 1E1RA 3HY4A 4X8LA 1VJ5A 1GRCA 1XJQA 4KCGA 4R2HA 3BKXA 2J9ZB 3QWAA 5CJJA 2RGEA 2WTAA 1XAIA 4N82A 4OQEA 5GGXA 1JNXX 3T0IA 1HOTA 4IRMA 3KZNA 4YHBA 2I2FA 1TADA 3Q0TA 4HVLA 4D0LB 4Q7QA 2WA2A 1AN0A 4KBFA 4BX8A 3VYUB 1JIXA 4YMUA 2RI6A 4M9XA 4R98A 2R2GA 2O0MA 3I72A 5T5QA 5JDIA 1AUOA 3L6EA 3X1XA 1T1JA 2ZANA 1PAUA 1RHUA 2PUEA 4CKXA 1RMTA 5HCUA 1UDCA 3EVBA 3U5TA 5ALNA 3V7NA 2GMWA 5CPBA 3AXSA 3CLKA 1KDYA 4FI3F 3IIIA 2YASA 4MV7A 3WLAA 4GR5A 2FN8A 2E48A 1EGAA 2FUCA 4KVZA 4LDRA 4R69A 4YJ3A 5IM5A 2PX6A 3UKOA 4JI5B 3JVIA 2ZUUA 3MXOA 2VF8A 3JYQA 1JJ7A 4PINA 4FE7A 4XD2A 3VDMA 4B71A 3PHJA 1QG2A 3A4YA 3K5HA 3AESB 1JU4A 1IB0A 3T4PA 3C3KA 1WKVA 3LW8A 4RJKA 5I5GA 4B31A 5K09A 4WASA 1MX9A 3K70D 3OZ7A 4KGZA 3HKDB 2RB5A 4F5WA 1AQ6A 2OM2A 2C61A 3E8MA 3ZWAA 4YUAA 2OM6A 1SBTA 2HA4A 3K6JA 4WVFA 2P2LA 3JQAB 2VTDA 2CCGA 4MW2A 4UUAA 1TM3E 2E3JA 4IRUB 2Y2UA 1HYEA 1OTXA 1MB3A 2J0UA 4UEKA 3GO4A 2G04A 5DM1A 4S24A 1H2FA 3QP9A 1Y6JA 3TR5A 3UJPA 3U4DA 4RKQA 2GM5A 1Z34A 5BOSA 4DC0A 3K20A 5C5IA 2H2IA 4QQNA 1IONA 1JYEA 1MOQA 2BUAA 3L0YA 4HNAB 3JQRA 4DV0B 1E2BA 2PU5A 2VUTA 3L93A 5AW6A 5G0UA 4C9BA 3BGIA 1TJ5A 4Q6BA 3U39A 3VR4H 2OZEA 1RFGE 2O8BB 3OZEA 1U94A 3V97A 1WHSA 5FADA 1VZ2A 4O4JA 4RS4A 2WILA 1TUGA 3GGDA 1PKEA 3FW1A 3COSA 3W8RA 1SK8A 4QDKA 5AKEA 4BMDA 2CXUA 1M6VA 3D6NB 1ZIOA 3PXCX 4A16A 4BO7A 2GAIA 2WB4A 1NYQA 3ETDA 3JY6A 3R5XA 3V32A 1X8LA 3DE6X 4IIYA 4GPZA 1YRHA 1M2NA 4U7JA 5AM1A 5SY6A 1WE2A 3ONNA 2CZGA 3FCXA 1P7CA 3PNBA 1ZGJA 4FOSA 3I2HA 1HE3A 1J6UA 5HPYB 4L8GA 3DKRA 3RNOA 2ZG6A 1WOMA 4JV5B 1NQOA 3GLHB 3KXIA 2VI5A 1G4HA 1J23A 1PZNA 4I50A 4RTLA 2VUUA 4OHOA 4XGNA 2AN9A 2FDCA 3OQIA 4Q82A 3HLTA 1PWHA 2R8PA 2IZ0A 2R62A 4OFBA 1I3LA 1V37A 4YBRA 1OBHA 3LVFO 3BXGA 4I5IA 1POWA 2F9FA 2LIPA 2V45A 4P7JA 4ABYA 4F4FA 1HNXB 2I7XA 3K70C 2WD8A 2GEVA 2XNCA 4MV0A 5DYNA 3U3KA 2P9YA 3M6LA 3FVWA 3LNCA 2CSUA 4ER7A 3HB7A 1KK0A 2ZXEA 3AIKA 5DGXA 3LYUA 4GE3A 2FMIA 5EINA 3Q11A 2JEYA 4N5MA 2CB9A 3C7TA 1P8AA 3AI1A 1X39A 2YHBA 4MIYA 3OIGA 5AI4A 4W5OA 2NO0A 3P27A 3U7HB 4HI0E 3U9TA 3IALA 4J0GA 2NZ2A 1E3WB 1W73A 3W9BA 4BQNA 1PUJA 3NXKA 1FQWA 5BSTA 1KSFX 1RBMA 2Q8NA 5KYUB 5EIBD 2GEFA 1IULA 4PYNA 2DR3A 3MSXA 4BUJA 5EHNA 3HCBA 3HDQA 4U7PB 3NBAA 4X91A 3BM5A 3MGAA 4DDKA 5KNDA 2AOTB 2JW5A 1EFVB 3UMMA 3HV0A 3M8KA 1GHTA 4DARA 4UHCA 2P62A 3BQ9A 4G25A 2P6MA 2WD7B 4DLWA 1QC5A 1XR3A 2MT9A 5EQDA 3V4PB 2CNKA 1XAHA 3OMWA 4YT5A 2BHTA 2DWPA 2YVQA 2VNKA 3RV3A 3AEUA 3GUUA 4A3SA 3K05A 1RYEA 1Z83A 3KZ1E 5TSDA 3QU7A 3QVOA 2R751 2OGZA 2A35A 4OM7A 3PD7A 3U81A 3OQNA 2P90A 1ZMXA 1TJ3A 1O77A 1UJCA 2V74B 3U44A 1II8A 4HDRA 4JC0A 1TAGA 5JCOC 1DI0A 1O9HA 2OYSA 4EA7A 5CB6A 3ZGNA 1GNSA 4BMZA 2G9VA 2Q9CA 2OAP1 4ZDWA 5HHTA 4BMPB 4KDRA 3WMFA 1HBJA 2P2CA 4UW9A 5EHGA 3LDGA 1JQLB 2UVPB 1T2FA 4U0KA 5G0TA 4FFBB 1SVUA 2REBA 2ZAOA 3AT1A 2CHGA 5B55A 2CNDA 4X66B 1V0JA 4BNLA 4Q4HA 1XZMA 2EFHB 1KZ6A 2L2QA 3H2HA 3B1JA 3ZDFA 1O3YA 5A5GA 5AW4A 4WW0A 4G2TA 1QHHB 3MD9A 1UDBA 4GZ6A 4BQQA 5IJXA 3I5XA 1P1JA 1JDSA 2ABWA 3T5MA 4V0LA 3WK8A 4HPXB 1WZIA 4Q4JB 5EJ9A 2CXHA 2H6EA 5ITZA 4L74A 1MA0A 3M2PA 4BC1A 1B8UA 1T2DA 4Y6OA 2BONA 1OKKD 4K9QA 4MQ4A 2YHIA 4HDCA 5ICMA 1JEYA 3P9XA 5AUOB 4B4UA 3DTVA 1YASA 3RUAA 2B7LA 3DEAA 2OPBA 3GFVA 3QPAA 4XM1A 3RSGA 4CKCA 1FLAA 3L6UA 4IGAA 2EKPA 2XQJA 1QDLB 1ZR4A 3SC3A 4NXMB 1D5WA 4OEHA 5AHXA 3UMRA 1V8FA 2YOFA 3H6GA 2EJUA 1QYRA 3BFVA 4HX2A 4KH0A 2GBIA 1DQYA 1NSFA 2BEWA 5DBEX 3E9DA 1VE9A 2OXEA 3ND5A 3S1AB 4KR0A 2R44A 3IHTA 4G0PA 1YWGO 7AT1A 1SUSA 2QRVB 5LCXA 3RQIA 3KYIB 1OB2A 1T1IA 3LX6A 1RRMA 3HUTA 1W4AA 2J3JA 3AEYA 3MJEA 4EUKA 1RQ2A 2Q2QA 5TPZD 5IXSA 5DYWA 1EHYA 1P6UA 2AD5A 3AO0B 3PENA 4ZO4A 2X14A 4L07A 3EY4A 4MUIA 5TQJA 2UZ1B 3M1IA 4ZEMA 4XVHA 4UUOA 4RCYA 4C3UA 3BDAA 3R0JA 2FPIA 3NHFA 4KPUB 2DUUA 4PFJA 2Z3VA 3STVA 3CNEA 2VDWB 3UANA 2W6PA 1EAMA 1CNEA 1YI0A 4O2RA 1LI7A 3DVLA 2HUPA 1YHZA 3DKPA 5I7UA 2CLOB 3BD9A 3LPLA 4JLSA 3NT2A 4KPYA 2VYND 4UBMA 1WQ1R 1EUZA 2BF4A 2FMHA 2FPOA 3PSAA 1Q3TA 3PGMA 4I5DA 2A3NA 1JQKA 5H83A 3IH5A 2CVFA 1G8SA 3PC4A 2VF2A 3R3VA 4PG8A 2E5LB 3EIHA 2HJGA 5T7BA 1TIBA 2GHTA 3AEKB 2KSQA 4YHHB 5BORA 4FW9A 3TXYA 1A2QA 2MSDB 3IUJA 1YUBA 3K1JA 4DE5A 1A04A 1RHMA 1RTTA 1VJRA 2RHRA 2R8RA 4LCEA 4PC1A 2J9FB 4PLGA 1P45A 4FTWA 4DV7B 2DLDA 1JAZA 3E9QA 1YQUA 2QROA 4QICA 4TKUA 3U5ZB 1FFYA 1H05A 4BU0A 2QVGA 4AJ9A 4TYNA 2J3DA 3GJ7A 1JDVA 1RPJA 3AQ4A 3QJYA 4QAQA 4WT7A 5HWSA 2WTEA 2H1RA 2PSHA 1R0ZA 4WJKB 4YPOA 5AJUA 1UBMS 4TV8B 4DNPA 1NG9A 3K1ZA 2ZJ4A 1TO2E 3T3DA 1WXHA 1XCJA 3DEYX 4DNQA 4HRYA 1A76A 3B2NA 4D4JA 1Z6AA 3JASA 4FIDA 4LOAA 3L0CA 5M3BA 3TIGA 2QJOA 4V03A 3V7WA 5ICFA 2ZRKA 2P5SA 3H5RA 3N07A 2G9QA 4WN9A 2JCBA 3A7DA 5EE3A 3A6JA 3HB0A 1KI6B 1OT5A 1DLIA 1K0FA 5FXMA 2XCRB 3OHMA 1NZDA 1NY5A 1H2EA 1NVEA 1GYRA 3W0LB 5B7GA 2ODAA 2AN1A 1E8MA 5FI1B 1KDZA 3O2NA 5K6AC 1DC7A 4O2LA 5EOVA 2Y0BA 3G23A 2RSLA 1Y98A 2V7QA 4NU5A 3G9XA 1ISRA 1ORRA 3HCNA 3OEEA 1RNLA 3T7CA 1VMDA 1BDHA 4QHSA 2CEKA 4X00A 4XWOA 1R9JA 4V0MA 4F45A 1K63A 2C84A 2W6MA 2RHTA 4FZ5A 1LRKA 2IZOA 2Z8ZA 3J7AC 2XZDA 3BAZA 3KT6A 3AIIA 3NBZC 4NH0A 1BH2A 1ZVKA 1Y5IA 2V5VA 1X2EA 1XFDA 3PTZA 4RJJA 5LQNA 2EZ4A 1NVWQ 3WICA 7ADHA 1XMQB 1SQSA 2OK7A 2R6R1 1D1PA 1Z08A 3AINA 3EJWA 1TO1E 3Q9SA 4FFPA 4YI5A 3ZKWA 1UDWA 1SVSA 3A4IA 3VAYA 3C3MA 4GZ3A 2EZUA 1AX9A 4XYMA 1T5SA 4QIHA 4DBVO 1K8XB 1Q1GA 1SIUA 1PCXA 1YZYA 2FPGB 2FY8A 2V7VA 3JW8A 1L7QA 2X8BA 4G24A 4MW6A 4X20A 4G23A 3UBTA 3GRPA 1EFTA 1KMMA 3ZY2A 2X3FA 2RGRA 4W8GA 5JSKA 4RPCA 1P8JA 1D9ZA 4BAGA 1ZIYA 5HG0A 1Q77A 3RFXA 1IE3A 2DU8A 3KL4A 1CZNA 3W8EA 5K8LA 4QTYA 1MU0A 4MRNA 4XR4A 5I9LA 5JVDF 2ZT8A 4P0QB 4B2PA 2FPUA 2N46A 1PT7A 1L4UA 2IPXA 2GZRA 3DV2A 3KOMA 3UAOA 4UHKA 1L9XA 1YL6A 3IB6A 4Y6LA 2OXIA 3SSOA 2V3CC 1FTWA 3A4NA 3L8ZA 4QGFA 1EPUA 5COQA 3UTDA 5ALXA 1GAXA 4WX2B 5J2TF 4QU5A 2VFAA 3HCCA 2AH5A 4FGUA 4JQYA 4L6CA 1DDGA 4LWPA 2XPCA 2XMBA 3ITKA 4S0XA 2FCAA 3OFSA 4LSGA 2BAGA 2CFSA 2ZBDA 4IIJB 2M2IA 3V8EA 1F9AA 3ZBQA 3ZWQA 2GYWA 3KLBA 5K3DA 4M1SA 3THSA 1EK6A 2E55A 1OFTA 2G80A 2A1TS 2HT6A 3CGWA 3LDHA 3EXFA 3LX8A 2QS9A 3MQ4A 3CONA 3V4RA 1NI4A 3TK1A 4ASUD 2X1HA 4S2UA 3VSDA 3VHLB 1QRTA 3FZQA 5TT1A 3UXYA 4QD3A 4FYMA 5KOYA 2E4ZA 2WG1A 4S35A 3T1NA 1TMOA 1JKMA 4MCIA 4GOLD 2SCUA 3OCZA 5K7SA 1ZWLA 3HR4A 3M7IA 2FPSA 3MUNA 1WW8A 4EYEA 4CLRA 4YVFA 3RVDA 4GM0A 4DJTA 5K8VA 3WXBA 4PGFA 4UHBA 5CFOA 1FSGA 1R4AA 1WM1A 3GB9A 3ZCTA 4GKKB 1N2EA 4JI8B 1PX0A 4ON9A 3TF5A 2Y4OA 1CIPA 2ZTLA 4BO2A 2QBYA 4Q3AA 4QG3A 2IOFA 3QPCA 4Y2UA 1N5KA 2QUIA 4MVJP 4O4HF 1I9CA 1NUSA 1YQQA 2P4EA 1E0KA 5FD8A 2WJWA 5GTDA 1A0OA 2RCNA 3IPAA 3H3JA 3NWEA 1Y5MA 3H6KA 1DX6A 3CUUA 1NJSA 2AUTA 4Y2XA 1KKUA 4YV1A 5A1JA 3ZW9A 2R4QA 4QPDA 3FIUA 3FGPA 4NCXA 1OU0A 2EFCB 4ALLA 5F3WB 2C7VA 2FSUA 2C8KA 4BB5A 3BC1A 2Z2XA 3UWSA 1CUSA 3AKEA 3FBGA 1BHO1 1Z35A 5HFNA 3E61A 5FHRA 1VMEA 4JB8A 2ZDGA 1RLUA 3BIWA 3E35A 1NWHA 3K9GA 4BE7B 4CV3A 3AVQA 4O08A 4R2IA 1C9DB 3A6DA 4PZEA 1PO7A 3EAFA 1ZUWA 2F90A 4QECA 1JFFA 1G7CA 3DBLB 3F6PA 3Q3HA 4QBGB 4WACA 3VNQA 2XBUA 4TQUS 4UATA 3EZXA 4EGCB 1K8ZB 3HBFA 2OAQ1 1B0UA 1MEEA 1YBAA 2HF7A 3T38A 1I3MA 3GJSA 1O0SA 2VJAA 3GZJA 3I4FA 5AKXA 1Y81A 2NUAA 4GXRA 3WR5A 3D6TB 2Q4RA 3ZU5A 3TTYA 1XCGB 1DIHA 2YWFA 3NCTA 5ANRB 1IDN1 1SCUA 1T9KA 3FKJA 2C4NA 2VWHA 2HGZA 3I6MA 4L0QA 5D3QA 4KPFC 4ZREA 5HFAA 4Y67A 2IY8A 1PZMA 1KI3A 1NC3A 3F71A 2XIQA 1T5LA 2J6CA 3WNZA 4BLRA 1I4EB 2WUFA 1OLSA 5CVCA 3QJ5A 3VZCA 1V1RA 5IEBA 5CP8A 5CDYA 1RS0A 2V6JA 4IIEA 2BN4A 2X41A 3FWZA 3PUVA 4Z0NA 4DANA 1X8KA 1ZOSA 2M9MA 2X6RA 4U7FA 3TSYA 1XXHB 1YZHA 3VDRA 5A3RA 2FQWA 4LQDA 4KG7A 4N6GA 3GRAA 1O8CA 1FMCA 5ECDA 5GONB 1U7ZA 4WESA 4D44A 1RAEA 4PZ0A 1GXSB 2EFJA 1ISIA 4MGHA 2BFFB 3MTQA 2VRBA 3BMCB 5AXCA 3PWKA 4EF5A 4U6QA 4F7WA 1SB8A 2EFYA 2FR0A 4XJSA 1P0PA 3TQTA 1U9IA 3INTA 2VT3A 1YQWA 1YQ9A 2YJTD 3K5IA 1ULAA 2QORA 4XUDA 1CUIA 3KR0A 4DLXA 2NPOA 4XW2A 5B53A 3KCQA 1Z3CA 4NC9A 2ZUSA 4Y1FA 5A3JA 3T7IA 1KI8A 4LV8B 1T0PA 4U9UA 4A36A 1V47A 5ALTA 4QTUB 4HJRA 5EA2A 1UKEA 3T0GA 1X77A 2QR3A 3GUCA 4W6ZA 1ZAYA 2NXCA 2IYTA 3UKDA 2P91A 2PNFA 2ZJ1A 4ZQBA 3PJFA 2ATIA 5IRCD 4IJKA 2X4DA 5GIPE 1YIOA 2GCGA 4J07A 2BFMA 4YRKA 4DV5B 3THRA 3ONEA 5CA0B 2HA0A 4KO4S 4P08A 3B6MA 4NENB 3X43A 4I55F 4ZDJA 2D1QA 3P9KA 1EX1A 1Z6PA 1KO8A 1PW7A 1YE5A 1EB9A 4P4GA 3W8FA 3K1AA 5LIPA 2IW3A 5BN4A 4L0DA 1JKJA 3E15A 3LPAA 2R8BA 3CH7A 3T0FA 3O8QB 4I2VA 4IKPA 2BZGA 4FONA 4FQ8A 2IOFK 1KETA 4FT2A 3UCFA 3CKMA 2R8YA 4I1YA 2EJVA 3TKLA 3CE9A 1M7BA 4MVCA 4XE5A 4YP1A 3LT2A 4MR8B 2QTZA 2F9LA 4HFNA 4IH1A 2PWYA 4UXJA 1TZJA 3RRNA 1GR0A 7ABPA 2RHHA 4E3WA 1SVIA 5K3CA 4K1LA 2QNRA 2X0NA 2RBKA 4LECA 1GPUA 4WL0A 3LOPA 5JZBA 1W49A 2ZSDA 1A27A 1FTSA 3LUPA 4BP3A 4GP7A 3M6MD 2ISCA 1IY1A 4RQAA 2FLWA 2PH7A 4M4SA 5JQGF 4AY3A 1AC5A 2CK3A 2MSNA 4YLYA 2IYNA 1JVBA 2BC9A 1Z7GA 5J63A 1YCDA 3ESYA 4ZVLA 4PC3A 3ZNNA 1HDOA 4CKEB 1KEEA 1MUUA 5CU7A 3N2KB 3HP7A 1FU8A 3CPJB 4Y9RA 5BUZA 4V1CB 2Z6QA 4RTNA 3D8HA 4UVIA 4ONEA 3UWKA 4C6RA 3F4LA 4NMLA 5E4JA 4YRIA 1JB9A 1QVWA 2WI8A 5JT1A 3LFTA 4MMXB 2GYVA 2HA3A 3DEIA 1F17A 3UV3A 4A26A 1BX3A 1DP4A 4ZT4A 2W48A 3ORRA 3A25A 4MUEA 1IPHA 1AZSC 1QLJA 2REOA 2XQVA 3COVA 3OZVA 1RW4A 3LSTA 4PPGA 4GQBA 2YYAA 3QRWA 3O1JC 1P2UA 4HSGA 3ZEAA 3ZWKA 2BKAA 3DE3X 3IAHA 5JR3A 3QV1A 4OM8A 1ONOA 1UJ2A 2FOLA 3GRCA 1G4AE 1LSOA 3A8TA 4IF4A 3IKVA 4MVXA 4Q3NA 2OORC 4MI6A 3UEOA 3H1FA 2BWJA 3FPSA 3UENA 1JZSA 5EIWA 3GJ4A 2IEYA 3A6LA 3ILVA 5EWMA 3GIDA 2IZ1A 1V5WA 3F4BA 3G7SA 2GBLA 5HKAA 1X7DA 4Z6KA 1KO7A 4RV4A 3H17A 4TXHA 4UPDA 3SXUB 2QVBA 2V6FA 2VT7A 2CSXA 2QN9A 1XHFA 1G98A 2BL4A 3GZ4A 4EI8A 4WK6A 4GX2A 1DQZA 2J1LA 2OQRA 5L9AA 1I32A 4I1SA 4PYLA 4B5KA 1ONNA 2H4YA 2OV6A 3MERA 5C32A 2FUNB 2Z6VA 1L5MA 1IBCA 3L41A 1LF5A 1L5OA 4KQCA 4R6XA 4RTKA 1CR6A 4HO1X 1RBQA 2DYKA 4MRRA 1ZI9A 3OZBA 5IBRA 2P4UA 2POQX 1OH5A 2OILA 2FN7A 1V3TA 5ALWA 4UHFA 3MCUA 1H5UA 5BXYA 3PFFA 2V9ZA 3TPFA 3Q6IA 4I36A 1EE2A 4AT1A 4DJEC 3WISA 4CQMB 5LWHA 5SYNA 1XCOA 5DTJA 2NO1A 4F7DA 4BZPA 4UDXX 4IQFA 1GUBA 2O05A 1Q44A 4B2YA 4YRMA 1E3MA 2FFAA 2Q27A 1U5BA 4HNGA 5TVGA 4G0ZA 9ATCA 3K2EA 1DZ3A 3PDHA 5T4FA 3W2HA 1E2GA 4CTJA 3EDOA 1TTQB 1KVSA 1H23A 2ZIVB 1TTTA 2ZTHA 3CZCA 4LSZA 4UAJA 3DZJA 2HXYA 1E9CA 1M33A 2V3VA 3I92A 3ZCQA 1JR6A 3DR3A 1T4CB 2KWIA 1RLMA 3D5TA 2PLNA 2NXEA 3FA2A 3GJQA 3T1YB 1IY2A 2OYCA 3OOSA 3L7LA 3L4BC 2JI6A 4DR4B 3KDSE 4BVFA 4TYYA 2HADA 3MHTA 3DT8A 3B51X 1D6NA 3OICA 2QT9A 1A9ZA 2V97A 3MRTA 3TYXA 1W4ZA 1FRZA 3H2YA 1KS9A 3K1TA 4NNOA 4OQDA 3T9FA 5C46F 1ULHA 1JDNA 3T7DA 2C5LA 3NHWA 3QMVA 1G8YA 2VZLA 3DMTA 1XZBA 3DJYA 5AP9A 5LU9A 3T7KA 4HEA6 3KPYA 1QV7A 1A9RA 1EMDA 1TGVA 1YK1A 1YULA 1Z25A 2P6UA 4MQBA 3W2GA 4JQOA 4W5NA 1Z0ZA 4OJNA 2P0AA 2QAGB 3LM8A 3K6SB 4FLMA 1T2VA 1UPCA 3TIIA 5A4MS 3IYLW 4FHDA 4LNUA 1KERA 2OAGA 4DCPA 5ICGA 1VBFA 2FSIA 3L1IA 3FLAA 4X1KB 5FB3A 1Q7RA 4MJ3A 1VGRA 3HV2A 2ZJOA 1J8YF 1G3MA 1FY2A 1R6XA 2HIAA 4FYYA 4WZBE 4AMVA 4AUEA 3TOZA 3VPXA 2ZUBA 3W5BA 1FFDA 4JR0A 4PBTA 4V0RA 3D7SA 4G4SO 1NGSA 4LW8A 3UJ9A 1L5YA 4JEUA 1JXOA 2AJ8A 3INYA 1E7YA 1UMDA 3C6MA 3RNLA 1BMQA 4AJPA 4BZWA 5BSGA 2V1UA 1RAAA 3H9GA 4QJBA 1IUNA 2ZSIA 2Y71A 3P0HA 1GCAA 3IBSA 5A3SA 4L6AA 1OFHA 3H9EO 5FA5A 4ZHQB 2R6GA 5INTA 1G5TA 4DEVA 1K5HA 2Q46A 2EFDB 3IT2A 3LLCA 4JT9A 1GTL1 1I7DA 4N0DA 4OL9A 2YVKA 3IA2A 4XB1A 3OJ0A 4X95A 1N2HA 5FOUA 3RT9A 5AW8A 2IP1A 1E3SA 2NIPA 4HQNA 3QYAA 3PGKA 5SZIA 5BV0A 1EX7A 5CTJA 5HQ3A 3PC2A 3KUKA 4OHPA 1ZRSA 3D5QA 1GZUA 1FYVA 1U3VA 4IVQA 3ZXYA 1US8B 2JCGA 4EELA 2EYUA 4WNAA 3GELA 3ZCSA 1TL7C 4RHUA 1ULBA 1YBHA 3D8NA 3ESAA 3VVBA 3BXEA 3CSUA 2CJWA 2CYAA 2ZROA 3F1LA 2XB6A 4JBNA 3SIRA 2FPWA 1F5SA 4B3DA 5HIAA 4M6WB 4WIAA 3FUWA 3WFZA 4BGEA 1YAJA 4RF3A 4LZZA 1H4SA 1DS6A 2DE0X 2JCVA 1E6WA 4G8DA 5J5CA 1JQ3A 3B2QA 3EH1A 2RC6A 1FRQA 1Y7IA 1XTBA 3R41A 1W0KD 1IZ9A 4HDNB 1NNLA 1WCV1 1X7XA 3UYLA 1VQ1A 3O92A 3UJBA 1NVGA 4UBOA 5JVDA 2ZXFA 4XWAA 3RAPR 3IURA 4LQCA 3KB1A 3W3AA 3HI6A 3SIXA 1K3UB 4KGVA 2B1IA 1XZEA 3JAWA 3TDKA 3VOTA 1VFNA 3GJ5A 3FHOA 3QUQA 2OHVA 2CXOA 2GJ8A 3TQIA 3IVMA 5J2TA 1U2SA 2XNDA 4DT1B 5K2OA 5DTEA 1PNOA 2RKBA 4Q9JA 3LS2A 2DULA 1CRLA 1FPMA 2CUKA 2UZ0A 4JL8A 5C8YB 3MCZA 2RC5A 5FWYA 1PZXA 3EXG1 4N5IX 5K8JB 4S2EA 2VXCA 3CS3A 5TQ0B 2IPNA 1NI5A 2BFAA 2JGEA 4ZDIA 1GO2A 1MIOB 2I66A 4G0OA 1T5DX 4LUCA 5CEJA 1UXJA 1OWPA 2PGXA 1D3AA 2QUHA 4QU0A 5ARDA 1PGOA 5A4AA 1KDPA 4PYQA 1AMNA 2VOEA 2R84A 4JP2A 4Q01A 1OUMA 1QJCA 2PT9A 4AO6A 4Q00A 3QE2A 5LB4A 3WYDA 2GN4A 1DXHA 1ZS9A 2IHZA 3AF2A 4JUBA 1UQTA 1QANA 1T36A 3R0IA 4KIFA 2H2WA 1C9YA 1VE3A 2HQSA 5EMKA 1QH8A 1TK3A 4ZAZA 2D6FA 5IT4A 1DT5A 4HH1A 1GRRA 4I81A 2R4TA 3ZWVA 4M7OA 2YOHA 5ERYA 4CF4A 8LDHA 5JFOA 3PGXA 1JA1A 1LDBA 3WVNA 3A1DA 1W4CA 2GPYA 2VJDA 2ZSHA 4ZYLA 5GINE 4IJWA 4ILKA 1TUBA 1OC4A 1RAFA 2C2MA 2RGUA 1H2YA 5CK4A 4ZKDA 4KQ2A 1ONPA 3RTGA 1TX4B 4KVFA 4PZYA 2JFHA 4TV9B 5FHQA 1QF6A 4O4HA 2Z9CA 4MYCA 3LV8A 1K89A 4NL4H 4NCJA 4P84A 4YRZA 3T4UA 3PNKA 2V7EA 3BUSA 1Z7EA 2JBWA 2ZCUA 3KWJA 1ID1A 1PSZA 2QRLA 1CY7A 3MJRA 4PZCA 2DKFA 2I3GA 1AGPA 1LNSA 4TM8A 5TRTA 3QQ5A 4CI0B 4E03A 4L78A 5HBRA 5KSYA 4AVYA 1A7AA 3FDIA 4DDTA 3WP1B 1J20A 1EHIA 2HZ7A 3CN7A 4MVYA 3VKUA 5TS3A 3NVKI 1ZRNA 1WZUA 5HVNA 2DETA 5KX5B 4QA9A 4BUCA 1HEUA 3RAJA 1EKXA 3GJTA 4MP6A 4RENA 1EBFA 3K9CA 1Y3CE 4E7PA 5JMWA 3EK2A 4YJFA 5I4BA 3L4JA 2LPMA 4BP8A 4G0UA 2RMKA 1N7IA 3AIOA 4P3PA 4RHYA 4EG5A 1EFKA 3MJFA 4GPIB 3USES 1X1DA 3NANA 4XWGA 4HDSA 2ZE6A 3TN7A 3WB2A 1OIWA 4D4LA 2ZRQA 1I2ZA 2O1WA 3GL9A 1YFKA 4ZOLB 3ZXXA 3ZDDA 1N3BA 1KAQA 2ZUEA 5EC8A 5KSOA 5TMEA 1M1YA 1NIPA 1DO0A 3SDZA 4NE9A 4DSUA 1XXLA 4GX1A 3I0NA 1JTVA 3AK4A 3EMDA 4RVDA 2C1EA 1KNXA 2PG3A 1F7UA 2MINB 4ID9A 2I34A 3ZWNA 4EKEA 4PRLA 1Y5RA 4PYIA 1J33A 5A7GA 3Q40A 3N2YA 1J99A 3P96A 4G9GA 2WVGA 3RC7A 1CQIB 1A1VA 3IL2A 3F7MA 2VZ0A 3NHYA 4RKRA 1JWBB 2P0EA 3W9YA 2AEMA 1S8OA 4RLQA 1PK8A 3L3BA 3PUXA 1M83A 1WPRA 4DJJA 4JLOA 3QBTA 3DL4A 4F9GA 3RC9A 1WB5A 4WDRA 4A8JA 4GM4A 8ATCA 2WYOA 3EDYA 3OPMA 1BE1A 3V8MA 2XB2A 2H9YA 3LQ2A 3DFUA 4YYZA 3GMIA 3IHKA 2R6FA 5LMZA 3TSCA 3P9NA 4XM2A 4J2OA 5BN3A 4BIIA 1QIEA 4AY6A 3LPCA 3CKYA 1E1RD 2P2DA 2OECA 2R8EA 3BWXA 1SCBA 1Z0JA 4NG5A 4RD3A 4BBZA 3HKCA 1CHDA 1SMKA 2IUSA 1XG5A 1TLTA 3JQ7B 3UAGA 2WR8A 3TMAA 1TM1E 4OU4A 2X13A 1PFGA 4DSTA 4BBJA 4QT4A 2D4HA 3N87A 4US0R 3PKJA 1M8FA 5EN4A 2EGHA 3HJTA 3LY9A 2C3UA 1HGXA 1P1IA 4LOLA 4O0LA 3X1WA 1DBVO 3PFGA 1ZH8A 5CG1A 1DIGA 1HYHA 4IYJA 4Z2YA 2XWBF 4DLPA 5CAEB 2IC5A 3A37A 2G28A 3LP6A 2BJWA 3NHMA 3QEOA 5F21A 1FNSA 3T6KA 4BO8A 2V0GA 3FRHA 4MHTA 3RYFB 5FOQA 2OPHA 2QM3A 2AOUA 1UJMA 4I55A 5EHXA 3DWFA 2P6NA 4F5ZA 3WAGA 3SFZA 2W6JD 2BFDB 4UMFA 4BN5A 2L0XA 4EKYA 1QGOA 5K3FB 1V7QA 2VQ6A 4YFYA 3FIJA 1E2IA 3ZWPA 3CY6A 3WGQA 4K05A 3QPBA 4CM5A 3OJOA 4OJYA 4L3VA 1KZ7B 3VJRA 3EVNA 1TCBA 4F38A 3FTNA 1E1NA 1YACA 3ZH9B 4U7HA 2EGUA 4HJXA 3CJTA 2ZB3A 1UC5B 2KLHA 3DH0A 4OG2A 1U31A 5JATA 1TK9A 5KDLA 1O6CA 4EG8A 3HZRA 4R1OA 1U8CB 1KOFA 4NCAA 1DKMA 2V7XA 5FPSA 4R1LA 1SBQA 2D0DA 2FHSA 3C3XA 4WXMA 3L8DA 1CD5A 3IDFA 1DO2A 3FPHA 4RX1A 5BQFA 1SHJA 2AFHE 3MBKA 4GECA 4TRRA 4Q3OA 1QSGA 1G8AA 3GDFA 2UZIR 2G1UA 3OZXA 4L15A 3AFHA 2B98A 3BWCA 1VIVA 1YU6A 4LI3X 4R9VA 4F21A 1WL8A 2ILVA 4UFOA 2CLCX 2HJRA 3ONVA 1P7VA 4HDOB 3F7NA 1UBLS 4ZQFA 4NPHA 1OB5A 1GNPA 1Q3KA 2IE0A 3ZW8A 5L45A 5KJCA 1S2GA 1WOYA 1A77A 5JISA 3H4MA 3OPVA 2C00A 2XCUA 4C0JA 3F6SA 4RUKA 1GRQA 4JLJA 3ICWA 1TA0A 3E3OA 3R8XA 3K0SA 5HF8A 3IGFA 3B52X 4JB0A 4DR6B 2CCKA 3CZ5A 2QB5A 2HCRA 3AHJA 1JTEA 4HUQA 4WK0B 4OD0A 2P3LA 5DI9A 5LA6F 1JR3A 1CJKC 5K8CA 2C2WA 1CF9A 4BVKA 1XTQA 4A03A 4FDUA 4XPIA 1ILEA 1LWNA 2DR0A 3BBPA 1P0IA 1L7RA 3ETNA 1TCCA 1WW2A 1ISHA 1E2HA 2ZJ7A 3BE8A 1DV2A 1JHZA 3KUDA 4HRXA 1L5LA 1JR4A 4MS4A 5JMOA 1CP2A 1LWOA 1XEWX 1TRKA 1N6HA 3EZNA 3DAPA 2A6PA 3ZHCA 2E7ZA 1GILA 3NAZA 4CMCA 3TZQA 4HXFB 4CW7A 4C7OA 3BAFA 1NUQA 4KKVA 2IYFA 2O7SA 3CLVA 1EWRA 3KZKA 4GOXA 5E7IA 4D8TA 4EF4A 1KTVA 2BYTA 1JPUA 1DQRA 1FTNA 1HQDA 2PTHA 4U7WA 1O54A 2HMWA 3QX8A 5UKDA 1G2OA 3NXSA 2IQIA 1W0JA 4MROA 3SEZA 5BT9A 5KSZA 4V1CI 3E9ZA 3VH4A 3DE7X 3OM0A 1YDEA 4BTEA 3E9CA 3JWHA 1GZ4A 1P2GA 5JW6A 1UAGA 1PJAA 1IJBA 3G59A 3G8DA 3L8EA 5LXTA 2ZB4A 3WKEA 2M6KA 3WSWA 2AE1A 2WQZA 3PHBE 5KNDD 1N32B 3PQ7A 2D5CA 1BEEA 2HREA 3UUEA 4RLSA 2AQIA 1B3BA 5D3MB 1MVOA 1NP7A 1QR2A 3ENWA 2HF8A 3PPYA 4P36A 4YK7A 2QW0X 2FRDA 3ZIDA 1VSQA 2ORIA 1H5QA 1N9ZA 1X7WA 2X2EA 4FN5A 1RT9A 4EQ6B 4KFCA 3SDSA 2Q1YA 3H9QA 1MJGA 1QAOA 4IFBA 4DV3B 3EXIA 3PF8A 2OHXA 5U1PA 4YRDA 4ZGBA 5DSTA 3UBMA 2CDCA 2ZSBA 1HQCA 2D62A 5BYBA 2AMYA 1OC2A 4MUHA 3S28A 1GGKA 3FTPA 3ZU6A 4BFZA 4IDHA 1J8MF 4KIGA 3BMOB 2EP7A 3ON5A 2V6MA 4IHAA 2J5QA 3OOJA 4JJ4A 2EZ8A 1G8PA 2GPWA 3DV9A 2X5KO 2VJYA 2WDPA 3EGXA 1JS1X 5HUJA 3OFKA 4ZXPA 1K7EB<