1YZQA

Gppnhp-bound rab6 gtpase
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
164
structure length
164
Chain Sequence
FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords small GTP binding protein RAB6 isoform
total genus 57
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1yzqA00
5L3SA 1S4QA 5CDFA 3PV0A 5EP3A 2ATVA 2QMEA 4B6FA 3EZ9A 2QENA 2JJ1D 5CDFE 2OE2A 1Z06A 2BBTA 3GLIB 1YRAA 4PTLA 2XNDA 4PSKA 1VCNA 2VP4A 5DSZA 2QL6A 2G88A 3SC3A 5E3HA 1JPNA 1G3MA 3ADKA 3VQTA 3C4JA 1NIJA 5KNDA 3MSXA 1ZAKA 1E1QD 4Z1MD 2H5EA 3R20A 5JWRA 1ZMXA 4F93B 3GEIA 5SZHB 4EAQA 1XD2A 4CIDA 1ZU5A 4HYYA 4BFSA 1XPUA 4AG6A 1KI7A 1AS2A 5LD2C 1LF0A 4OI4A 1NSFA 2CVHA 3FVQA 4FMDB 4JLDA 1N25A 3QVVA 3KKPA 3GEHA 3THWA 4TYPA 1RRGA 4XVUA 2WKPA 2JA1A 3MMPA 1XXHA 2DFTA 1MH1A 2W58A 3LW7A 4Q7JB 2BM0A 5G3ZA 2EVWX 4Z54A 1SKYB 2F1RA 1EFHA 1VKJA 2CL7X 1R0WA 1XTRA 2WPDA 4JVMA 1VCMA 4EPYA 4L5BA 2C9OA 2FSFA 2RAPA 3JZMA 5F9HA 4NU0A 1XD9A 1GL7A 3GJXC 2V8OA 1M7HA 3RABA 1AS3A 3NVAA 4YMVA 2R6FA 1GG2A 1KMHA 3QVUA 1A1VA 2F1IA 4KI0A 3G82C 2RGAA 1E4YA 2BMFA 5CK5A 1YR7A 2ZRCA 1EESA 4KJZA 4KFSA 3I73A 1Z28A 5SZJA 2HDNB 3TKLA 2JJ8A 2A7QA 1QVRA 2Z43A 3A58B 1ONBA 1P73A 3LXXA 3PR1A 421PA 4C0AC 3IEVA 4IEIA 2HEIA 4XTCS 2O8FB 4J0QA 4AC9A 2O8DB 4WZAE 2XTMA 3CZQA 2F1JA 1N5IA 1RYHA 3AF1A 4P4SB 3FMFA 4MKIA 1X3SA 3P4YA 1JR3D 2P2LA 2YYZA 1R4AA 4F4CA 3K0SA 5EE3A 1AZTA 1NMXA 2AR7A 3GLIE 221PA 2WJVA 3A4LA 1T8UA 3CUEF 4HAYA 2EU8A 3GLGE 1UKZA 2AD1A 4RCZA 2IUTA 1JAIA 4Q1AA 1HURA 2QP4A 2V4ZA 1PLKA 3LQQA 2Z4RA 3QPVA 1G8GA 3N2EA 1KJZA 2G6BA 1FNNA 4KFUA 4N3NA 1FP6A 2R65A 4HAVA 1SXJA 5EUMA 4RD3A 2C2HA 2WWHA 2BBWA 2V7QA 2J3EA 3EIEA 3PEUA 4RY2A 3C5HA 4PC3A 1IY2A 1GNPA 1WP9A 3I62A 5B57C 4NCKA 2G0TA 2QORA 1QHHA 1PZNA 1OIVA 3DO6A 5KNCA 4MRPA 3UIEA 3ASZA 3SBDA 5KPJA 5FL3A 2YWHA 1OF1A 2O8BB 2VHJA 1XB2A 2F43B 5CIWA 1TQ4A 1UPTA 3QPUA 3L0PA 1GNRA 1NF3A 2QTVB 2PH1A 1M7BA 5F3WB 2DPXA 1W4AA 1GZSA 4Q5IA 1D9ZA 4HLQB 3I5XA 2GVZC 4G01B 4B43A 2C96A 3SI7A 3M4YA 1PLLA 1W4RA 3U7FB 1QF9A 1A5TA 4AYXA 4PZYA 1US8A 4AY2A 3EC1A 4MYCA 1KI9A 3C41J 3U60B 2GAAA 1TQDA 1IJFA 1RRPA 2PLRA 3NEJA 5J47A 4JLOA 1JB1A 2FFBA 3T61A 3L0SA 4V03A 1OXUA 2AK3A 2J46A 3OIUA 1T3HA 4LK2A 3B78A 1P2TA 3SU8A 3H2YA 1DAFA 4OQLA 2W6ID 5GADl 3SNHA 3AGQA 3CONA 5LB4A 5BN5A 3QXCA 5FUWA 2QE7D 1D9XA 4LHZA 4IOJA 4OHZA 1RFLA 3LAWA 3KKOA 4I99A 1E1QA 2WIAA 4PO9A 4JVLA 3L2OB 4WIAA 4M0LA 4Q9JA 4AI6A 1JJVA 4D4JA 4M9ZA 3SHWA 1ZM7A 2ZJOA 3GPLA 3NWJA 1TUEA 2ZREA 3OE7D 1R7RA 2OFWA 2NTYC 3RRMA 2J0VA 1ZNZA 5AUQA 3W90A 1E2HA 2ZSDA 3EASA 3GCGA 2QBYB 2C03A 2ZI6A 3WY9A 4MGZR 1WMSA 1P7CA 2V1XA 5FPKA 1BIFA 1AZSC 3IIMA 3D3QA 5EXTA 5G41A 1E9EA 3AKDA 5E7MA 3W5IA 4CGZA 1LB1B 1UDXA 2QRNA 4A8JA 1Z0JA 3WMFA 1PUJA 2ODBA 4IFBA 4IFEA 2GXSA 4CW7A 2FEMA 1DAMA 4MITA 4BEBA 2GBLA 2RGNA 1COWD 4DCUA 3PUWA 3EPJA 1OH8A 1G41A 2ZANA 4DB2A 4FW9A 1HEIA 1TQ6A 3AKCA 5AJYA 5J5CA 3VR2A 5FOXA 3T1TA 4UKDA 2PCLA 1IN6A 5FBQB 4LJAA 4ZIRB 2ZUCA 2WMNB 1ZIOA 2ORIA 2ZS8A 4PPQA 1Q12A 1YQTA 2EFDB 4D4KA 4DZZA 1XMSA 2YC2C 3L82B 4MQBA 3RLFA 1U8YA 1E6CA 3DM9B 2RHDA 5D3MB 4Q4AA 1NN3A 4QKQA 1LNZA 2H1LA 1G9XA 2CL0X 3W5JA 1G8YA 3I4LA 1UEIA 4PC2A 4TMTA 1XTJA 2G3YA 4CEIB 1P75A 1W36B 1PUIA 3Q3JB 4HUQB 4OK3A 2C98A 2P0EA 1NJFA 1KTVA 1LFDB 1JBKA 4WAUA 1MRSA 3RRYA 4JVNA 4I1UA 1W36C 2BMJA 3DKVA 4M1SA 4RCYA 5EE0A 1M74A 4A0RA 5B58C 1RPZA 2QI9C 2CJWA 2V7QD 1VPLA 3GP8A 1OFUX 3EW9A 2VSXA 3KUDA 4BLPA 2OCAA 1SXJD 1BYUA 2OHFA 821PA 4NMMA 5DO9A 3X1WA 1NIPA 5C46F 4OQNA 4WZBE 4C0QC 2REBA 1FTSA 1N0WA 4KBFA 1II0A 3U7GA 4RKFA 4OYHA 3TGPA 1KI2A 1SKYE 2C8VA 3CRMA 1W5TA 4DSUA 1X86B 3LQRA 2J7PA 2ERXA 3B5JA 4QC2A 1Y63A 4YDHB 3A8TA 5DYGA 3O8CA 3UATA 3SDZA 1V5WA 1J7KA 3TQFA 1HE8B 4HAUA 2JIZA 4OL0A 3U3KA 3QOFA 1XCGB 1E2FA 4RFSB 3TUIC 4JLBA 3ZD6A 4JJZA 1SULA 4KXFB 1XEXA 4NZYA 2NOAA 1C9KA 3DDCA 3DZDA 2IYXA 4HB0A 4BASA 3CR8A 1WBDA 1IN4A 2ZJYA 2ANCA 2FGKA 3QUSA 4R9UC 5KSPA 1XNJA 3WNCA 1TADA 1U9IC 1YKSA 1NLYA 2GF0A 2GNOA 4I1VA 4TLAA 1S2MA 2A5GA 4X8MA 4GL2A 2O8EA 1U0HC 2LKDA 5GVSA 4A6XA 1CJMA 1XMVA 2BHRA 2H8KA 2XOKA 4IDOA 4B74A 2O5VA 3FDIA 3A6PC 5EP1A 4EKDA 4US2R 3EZFA 3I61A 2OXRA 4QOSA 4PHTA 2GJ9A 2RCNA 1JALA 4G5GA 4TTPA 2GBLC 3E5HA 4HAXA 3TSOA 4HI0E 4AYWA 1TF2A 5DI9A 4NYMQ 2ZAMA 4MUAA 3KKMA 5ELXA 4AURA 4ACBA 3B9QA 4TZ6A 4BPBA 4L9SA 1K6MA 3PITA 3C7KA 2D7CA 2I4IA 3AVPA 5E7IA 3QPWA 1Z6AA 3DHWC 2WICA 4JSYA 2YKGA 3AVXA 2MMCA 3EARA 2NO1A 4TYWA 4CT5A 1G3RA 3MJHA 2GWHA 5FUXA 5JWHA 2P5TB 2VQSA 3KQLA 1AM4D 1NJGA 2B7CA 4DSNA 1NKTA 3IQWA 3BK7A 1LTQA 4OI0A 1S9HA 3RRZA 4H1UA 3RSOA 3VHXA 2J0UA 4E5UA 3QKSA 3K1JA 4PSVA 8OHMA 3NG1A 2IEYA 2ZI4A 5LD2B 2OT3B 4DCSA 1XXHB 4AKIA 2OCYC 3SFVA 3KX2A 3K9GA 2QU8A 4FCWA 3NBXX 4PXAA 1UADA 3GFOA 1E79D 4E03A 2CDNA 2NZ8A 4QRHA 4A2WA 3FMOB 4NHOA 4JL5A 2GEVA 5JBQA 1WB9A 2ZR9A 2WWXA 3D8BA 2JEOA 2ZS9A 2WJHA 4PC7A 3UK6A 2NGRA 3BXZA 3MG9A 2UVQA 3GLGA 3LA6A 1SHZA 4WZ6A 4YXWD 2ZPTX 3CNOA 5L3QA 2ZVPX 4BLRA 3GJ0A 3N2IA 5CITA 3I72A 1N6IA 4UQOA 1FPMA 1KGDA 4DHEA 1PJRA 5C4MA 5DYIA 2OV2A 3Q85A 1KAOA 1ZC3A 2BMEA 4IEEA 4JLMA 3QXJA 3RS5A 2XNSA 5AK0A 5H68A 2IYZA 2IBMA 1I4DD 1OSNA 1S8FA 1KZ7B 2HJGA 3OHMA 3EZ7A 4KLNA 4KO8A 4EDHA 3LLMA 2QTFA 3FMIA 4Y0AA 5CIQA 3KKNA 1KK1A 1QRAA 2J59A 4CEIA 2GZHA 1RVDA 1XJ0A 3L8ZA 1R0XA 2D7DA 5TMPA 4QGAA 3OEHD 2JDIA 1N5JA 4KODA 3LV8A 4MGKR 2W2VA 2WV9A 4M22A 4NPHA 2DCUA 4A9AA 1HT2E 2PT7A 5TVKA 1E9DA 1Q22A 1KNQA 1T5IA 4Q1CA 4IOKA 1DS6A 3AVQA 4LJ7A 4B2PA 2JLUA 1OB2A 3C15C 4TT3A 2A3RA 5EQTA 2DWPA 1OPXA 1XTQA 5JI3E 2JATA 2MMGA 2CHGA 2VSFA 3FOZA 3ZS8A 2PX3A 2IXEA 4A15A 3MWYW 2R6DA 1Z6YA 5F9FA 1VHLA 5KDOA 3SZRA 5L8VA 4IW3B 4P4TA 1KI6A 1EFRD 3HYTA 5SZKB 3VNUA 1HUQA 3TH5A 2QEQA 1ZINA 5FL7A 4A92A 2C04A 3TW4A 1W0JA 2XB4A 1H8ED 4JSTA 3UPUA 2PMDA 3T1QA 1YRBA 3GJ7A 5FL7D 4KITB 2G1KA 3D31A 4EPTA 2AXNA 1KHTA 3WBKA 1OB5A 1ZP6A 4TN1A 3CBQA 1GRQA 4OJQA 1NRJB 3L43A 3FHOA 1YHNA 2ZQ5A 4DKXA 3KQHA 5JJIA 4NE2A 1BH2A 3R7WB 3R8FA 1XMJA 1U8ZA 3CPEA 3BBPA 4OHXA 5TARA 5KSYA 4Q02A 3X1DA 1G7SA 1LW7A 1W2HA 2WAXA 3SYKA 3EPHA 2GILA 1ESNA 5CLLA 1OHHD 1UJ2A 2ZRIA 2HT6A 1SVLA 2GRJA 3CWQA 5DI3A 1GWNA 3LH5A 1N0UA 2V54A 4UJ5A 2C9YA 2JAQA 4GI7A 1TX4B 4NCJA 3GEEA 3EG5A 2VHQA 5KHOC 1AKYA 3U3MA 1KI6B 2FA9A 3B9PA 4DUGD 4OQMA 4ZIRA 1IXZA 4W5WA 2ZE8A 5KYKA 1W0KA 4PZZA 2GCPA 1C4OA 2YC4C 5J4HA 2OBLA 1AJEA 1ZUIA 3WYFA 4M8NE 3K9LA 3RS4A 4IXNA 1KI3A 4LI0A 2XITA 1P9WA 4M1KA 4E09A 3SQWA 2QMUA 4M1MA 2RGCA 1G16A 2CJWB 3EAQA 1VCIA 2GKSA 4A8JB 2CK3D 2F7SA 4HSEA 1UKVY 1VDZA 2W83A 3CPJB 4RFVA 4Q48A 1DAHA 2A9KA 3GJ8A 4FINA 1ZYUA 3LW8A 2AFHE 2MSDB 1BOFA 1LS6A 2GJKA 3AF3A 2RGBA 1XTSA 5IHPA 3GJ3A 2FDCA 1UAAA 4HUTA 5JEEA 1EFUA 2BM1A 4KSCA 4NKRA 2GESA 5AUPB 1DTSA 1VTKA 3KUCA 3A1TA 2JLZA 2CE7A 4YMWA 4DC9A 3NBFA 5BW8A 3BJIC 4MKHA 4B34A 3ZIAA 2QT0A 3CF0A 2JJ1A 2W6JA 3LBIA 2MSEB 4TMWA 2R6GA 2ZRNA 5AJXA 2WZQA 3HU2A 5FUVA 1D2EA 3TVTA 1B0UA 3T5GA 3GLGB 4P3YA 3AKYA 4JS0A 3WHKA 3SN6A 3TR5A 1E1RD 2ASEA 2FF7A 2D62A 3CNNA 3NIBA 1G3QA 1KO5A 2ZM5A 2O0JA 4FWTA 4TYYA 4XWOA 1D2NA 4V0OA 2ZSEA 4ABYA 4CF7A 3GLHA 4LBVA 4V0ME 1VIYA 4DLWA 1R0ZA 2AD5A 5FPSA 2DWOA 4LBYA 1H8HA 2R2AA 2Q3FA 3UXMA 3PUVA 4DLTA 4G0NA 4XOIA 2FMXA 2R6CA 4DLYA 2EW1A 3MD0A 4MGIR 2KWIA 4S35A 2WWIA 4RKEA 1GFIA 1N6KA 1SVOA 3T35A 4B35A 4ZI2A 3H4MA 1KAGA 3JVVA 4QL3A 2NO0A 3ZZUA 1N6RA 4DLSA 3OIVA 1KI4A 2CK3A 3BWDD 2IS2A 4QNRA 1Z83A 4G3XA 4Q1EA 4URYR 4Z8YA 2Z4SA 2DFLA 2PJRA 2BBSA 4DSTA 2C95A 4TTQA 1N6HA 1A2KC 1MOZA 2ZRLA 4O3MA 2XZOA 5HKKA 1MT0A 1XEWY 3RC8A 3IQXA 4YMSA 3AV0B 4QGGA 2D2EA 2BCJQ 4YMTA 1G17A 1SHKA 1D5CA 1SXJB 3FE2A 1TEXA 2P5SA 1DEKA 2FFHA 1DAIA 1JNYA 2ZE6A 3W6OA 4MUBA 1AS0A 1JEEA 4LRWA 1XMIA 2BC9A 5K8UA 5DNYB 4HZUA 3C5CA 5LPNA 2JLXA 1DADA 4IVPA 3ZVNA 3V9PA 4NTZA 3PCRB 2JJ2D 4M4SA 1YR8A 3IKJA 5K8IA 3CRRA 4BLQA 5EE5B 2YOFA 2HYIC 5TV2A 3ASYA 4UXHA 4PC6A 2RGEA 1E2QA 1W2GA 2ZI3A 5LB2A 5B64A 3I1FA 4YDSA 4WA7A 3NTUA 1MRNA 1CR2A 1Q3TA 3TK1A 2G0NA 2J9RA 3PEVA 3EX7C 1J90A 1DOAA 2WBLC 2JDID 1DG1G 3GLIA 1CEEA 4KU4A 4XVRA 5CM8B 1P61B 1Z0FA 1NVVQ 3QF7A 3VU9B 5JHHB 2I1QA 1P3JA 2ZRKA 4TL9A 2GJAA 5GVRA 1Y3AA 3HPQA 4BFXA 1U94A 3QSYA 4PHHA 4BWYA 2G9NA 1CULC 1G5TA 1U0LA 2R8RA 3BAFA 2WWGA 2IYTA 2ODNA 3QI2A 4CEJA 4Q19A 1MABB 1S0UA 1AKEA 3WMEA 3BFVA 1NLFA 4BFTA 4OQXA 2AX4A 2QN6A 2HYDA 1S1CA 1SVSA 3AH8A 2X77A 1K5DA 1KY2A 1KK3A 3VNVA 1EK0A 1ZU4A 4FMBB 5FPYA 4TSFD 3RC3A 1HYQA 4MRRA 4CZ2A 2VHUA 3CF2A 2ONJA 2H17A 2AWOA 3PEWA 2WAYA 2IW3A 4Z1MA 4D82A 3TLXA 2QSYA 2O0KA 3ZJYA 1GM5A 1VG9B 1GNQA 1MO6A 3MGCA 4EPXA 4G1UC 4TMVA 2YWEA 1I2DA 1P60A 1Z2AA 3FWYA 5EXXA 1E0SA 2Q9CA 4M1TA 2VF8A 1OIWA 1Z3IX 3IBGA 4X8HA 1G64A 2C78A 2ZJ2A 1CR0A 1JR6A 3CH4B 1T4GA 4Q4JB 2XZLA 3VR6A 4QXAA 2WKQA 2ZEJA 5JJKA 3QEJA 5EZ6B 3VFDA 4C3ZA 3GLFB 3BH0A 5JHGB 3Q5DA 4Q21A 3SJZA 1NVWQ 4HDOB 2QPOA 4UNRA 4PQRA 2Z0MA 2IYSA 3CWZA 3K9HA 4LJ5A 2E1RA 4R98A 3E70C 2PT5A 4RZUA 1A7JA 1QHGA 2FE4A 3NDPA 2VRWA 4GZLA 1OKKD 1H8HD 3ECCA 5HZHA 1COWA 4KFTA 2OCPA 3LVQE 3U3RA 1P2SA 1Q1BA 2Q3MA 1WRBA 4C0LA 1OXSC 1P9RA 1Q1ZA 4ZDJA 5KDLA 3OE7A 1JXMA 4DSOA 1IN8A 2OBMA 4QBIA 1P5ZB 4H9GA 4M21A 3A1SA 3U6KA 3ONWA 2KJQA 3PQCA 5FR1A 1NSTA 1F60A 2ZAOA 3O8BA 2WJGA 3LWNA 3CB4A 3T06B 3RWMB 3TBKA 4ESHA 2IWRA 3BIFA 4A82A 4B6EA 4PO1A 5KO2A 1FNMA 1T91A 521PA 2YZ2A 3AVWA 1ELOA 3Q7PA 2RB4A 1E2NA 3KJHA 4FCVA 4DEXA 2QBYA 3CO5A 2BVNA 2FSGA 2FSIA 3C14C 4L4UA 4LYAA 1YZLA 4UXJA 2O8EB 1KDPA 2ZRHA 3CM0A 1Z2CA 2IL1A 4MKGA 1T0HB 3BFKA 4BFYA 1U81A 2YV5A 3CZPA 4TYQA 1MR3F 2VBCA 1G18A 1P2VA 2XSZD 1R5OA 1YZNA 3FHCB 4LV5B 1J70A 1I2MA 1OT3A 3K0EA 1KSHA 4PSAA 2F3TA 5JS7A 2HV8A 3MWLA 3P1JA 1II8A 4Q4AB 1RJ9B 2EFGA 2A5YB 4EIWA 5L3SB 4HLUC 4LDJA 4FCTA 1W4BA 4BEJA 5C2JB 1OV4A 4TYNA 3X1XA 1WA5A 2FEOA 3B1YA 3QF4A 3QJYA 4GP6A 4XTRA 3HDTA 4TQ9A 2A78A 2WMOB 1YR9A 1MKYA 1P6XA 3BB4A 4RZ2A 1LF5A 4Q7KA 4FI3C 1RE0A 2J87A 1FOEB 3N5CA 3ZZ0A 1P72A 1FMLA 1SGWA 1VCOA 5G53C 1RC8A 2SHKA 5EE1A 2BIFA 1F2UA 2FWRA 3T1OA 4YQFA 3D7MA 1GVNB 4CRWB 1II8B 1Z63A 2VP6A 1OW3B 3R8CA 3HR7A 2AFIE 4V0MA 1OHHA 3RYTC 4B3BA 5JZVA 4W5JA 1HQYE 3VU9A 6Q21A 3U7HB 2QGZA 4PO8A 2UKDA 1NN5A 3W3ZB 4D26A 4N0DA 4M9SA 2AK2A 3ADDA 3LNCA 2QUZA 2ZJAA 4ARZA 3DKPA 5DIFA 3P20A 3B2EA 3THXA 2RKOA 2X8AA 1S3GA 3VKGA 2VLIA 4TLDA 4URXR 3K9NA 1OYYA 1QVAA 2A5JA 4K46A 4D25A 1NVUQ 2V9PA 4LOAA 4AKHA 2X19A 2WWYA 2YINC 4B44A 4M2LA 3UG7A 5G3YA 3B6EA 2FPMA 3NBZC 4B2IA 4RVCA 2VL7A 1Q3HA 3K0FA 3AVTA 4PHGA 4MRSA 1TMKA 1NVXQ 1FQKA 5DH9A 1OFHA 4BLTA 2W2XA 4PHFA 4GFDA 4Y0VA 4ASUD 1AIPA 2FV8A 4A2QA 4Q47A 5B30A 1KJYA 1EWRA 4XD7A 1J2JA 1G20E 2QRZA 5FBVB 5IK2D 2FH5B 2H18A 4LV8B 3WP0A 3OF5A 1G8HA 4CEHB 2Z83A 3W6PA 5AR1A 3QQ5A 1E2KA 1F6BA 5CJPA 1JPJA 4LY6A 1CJTC 4A1FA 4LC0A 4M53A 1WF3A 1YJ5A 3SYNA 4D2IA 5DE3A 2IHYA 2D2FA 1OXVA 1E94E 3KXKA 1A82A 4FMCB 4XSHA 2ZJZA 4DDVA 1FUKA 1N5LA 2VO1A 3L0IB 2PZGA 1NY6A 3KXLA 5A4JA 1E0AA 4QNMA 2J0QA 1F3OA 1W47A 1HH4A 3L8YA 4MGYR 4Q9HA 1Z5ZA 4KV9A 2HXSA 4LCBA 4DLRA 1FFHA 1M2OB 1QHHB 2W2TA 4YC7A 4ILEA 4ZDKA 3K0AA 3QXHA 5CB6A 5H70A 2ANBA 2BKEA 1Z0IA 3CKLA 1JJ7A 4GOJA 4MRNA 5K8LA 4IJMA 1Q44A 3JZAA 2HXYA 2ZU6A 3P26A 3TIFA 1G291 3VR1A 4D80A 2QQ0A 1O87A 2QTHA 1G3IA 1N0VC 3THWB 5F98A 3TRFA 4NYJR 2AXPA 3MJRA 3T5DA 2ZYVX 4LJ9A 3QENA 3THYB 2CVFA 4AWXA 3BH7A 4BLSA 4R71A 4ZV4A 1ZNYA 3CR7A 1UBGA 3U5ZB 4LHXA 2IK8A 4C30A 1G5PA 2YJTD 2DFNA 1RRCA 4FXPA 4HEJA 4QJ5A 2W6JD 3DZ8A 5G40A 5CM9C 1T5LA 1TUIA 1KI8A 1X8KA 2D74A 1AQUA 2NZJA 2RGXA 4A8JC 1XPOA 2FNAA 1F5NA 2J0SA 3BGWA 2VA8A 2JLYA 2FG5A 4Q00A 3PG5A 4PAMA 3DMNA 4DCTA 1QBKC 2FGJA 3O47A 1J8YF 3GJ6A 4IDHA 4B3FX 2RGDA 1G7RA 3EPKA 2F43A 1DO0A 1S1MA 2D4HA 2O8BA 3CRW1 2C5LA 3RNLA 3CLVA 3G0HA 1H65A 2XZPA 3KTAA 4D81A 5K8TA 3GLHB 5AUOB 2EYUA 2GK6A 4RZ3A 5DN6A 4DIEA 2GA8A 2ZUDA 1GKYA 4JBYA 4TLEA 4C7OB 2CNWD 4JKIA 5FI0B 2VP0A 1XJCA 1ZBDA 1Z29A 4M1YA 2ZI7A 1KK2A 2BWJA 1Z0AA 1M6NA 1IHUA 3MUFA 4S2EA 2IXFA 3BD9A 4C2TA 1G7CA 5GJVC 4Q9KA 4HDCA 1Z6TA 2IX3A 5FTJA 1TEVA 1FMJA 2ZYUX 4PAQA 1OH6A 4AK9A 3B1WA 4F92B 2ZYWX 2ZROA 3BB1A 3LBHA 4OI1A 1JR3E 2Z6VA 3CX8A 5HE8A 1IY0A 2GAOA 1E0KA 3ZQ6A 3BRWD 5IT5A 2IYQA 3ETLA 4BFVA 3H86A 3FTQA 3EZ6A 3KQNA 3U2QA 4U00A 4ESVA 4LWZA 4MYUA 4V0KA 2R44A 3M1IA 2ZR7A 4NDZA 3GFTA 4MDEA 3CIOA 4HLUA 4PPFA 3I5YA 3EPLA 4KLZA 5FOUA 3SHFA 3THXB 3F5FA 2IHBA 1RKBA 1KMHB 3OEHA 2AL7A 3REFA 4OJKA 4DLUA 2WPDD 5IRCD 4C2UA 5KPDA 4B73A 3LLUA 3DVLA 3BORA 2IYWA 3JVUA 1X1SA 3HWSA 4PZLA 1G21E 1FTNA 2JCSA 3SJCA 3ZQJA 3A36A 2OLJA 2NMVA 2ZITA 3TJZA 4QM6A 2XXAA 5GJWC 2QNRA 4H1VA 1G1MA 3EZ2A 3DPUA 2H7VA 3RS7A 1X6VA 3U6BA 2DWQA 2NO9A 3AB3A 5D3QA 4Q7LA 1G8PA 3QG1A 3R9IA 2VP9A 1NBMD 1ZC4A 1NI3A 3K0CA 5EXSA 3OIYA 2P3SA 2YHSA 4LBWA 4URWR 2P65A 4I81A 1EXMA 2ZRPA 4ZDWA 1EGAA 1M34E 1ZM2A 2VH5R 1RJ9A 1EFTA 2VP5A 4BLOA 4NYMR 1UM8A 1XP8A 5JRZA 1ZCAA 4ZKDA 3CRVA 3R7WA 4KHZA 3UKDA 3HYRA 2K5UA 1E2LA 1IM2A 3AP2A 3RVBA 3TQCA 4Q01A 3ZVLA 4ON9A 1T9HA 1TPZA 4YXWA 2C77A 1CR1A 1NMZA 5FR2A 1P2UA 4IOMA 1HA3A 1AGPA 2YOHA 1NKSA 1XU4A 5EP2A 1L7VC 1R5BA 3BERA 3OAAA 1Q1QA 3RS3A 3VX4A 3AF2A 4BFWA 3BH6A 5J4KA 1K5GA 3GLHE 3EWSA 1E79A 1CJVC 4FN5A 4YONB 2VPPA 4XD7D 5FI1B 4DVGA 5L3QB 4TL6A 2MSCB 5KSZA 1NBMA 2Q6TA 1G4UR 5LDDC 2OEPA 1N2CE 4TL8A 2CLDX 4I4LA 1UFQA 4R7ZA 2OO7A 4FMCF 3A1VA 4CT4B 2P67A 3H0KA 2EQBA 3R9WA 2R9VA 2YNMA 1I4LD 3E1SA 3WYGA 1YZQA 1JI0A 3KKQA 2XJ4A 3OEEA 2HF8A 1AN0A 2F9MA 1RIFA 4G5SA 4MYTA 1NG9A 1LVGA 2WJJA 1NNEA 1IN5A 1T6NA 1WXQA 4TWZA 4DDUA 3Q7QA 4JKYA 2XEXA 2IEZA 1DG3A 4DWJA 3GLFA 3U7EB 4ACAA 5JS8A 3Q5EA 2QAGC 3FYHA 1ZNWA 2V3CC 1Z0DA 4MA4A 5SZIA 5JRJA 1HY3A 3V4RA 1EX7A 2FX3A 4KAXA 1E9RA 1G3UA 3B8HA 4WBSA 1KSJA 5BYKA 2HCJB 1JEDA 2VYFA 4JLJA 2Q0HA 3SJAA 4Q1BA 4GBMA 2F9LA 5FOSA 5HZKA 1W48A 4LC1A 1KJWA 1N3BA 3VX3A 1ANKA 1E98A 1NBME 1BYIA 5FTMA 5DHFA 3I92A 2XOKD 4DLZA 4WW0A 3LDAA 4JBXA 4EPRA 3RDPA 3UWOA 4O0MA 2X2EA 3F8TA 2LWIA 3CNLA 2HUPA 4XVQA 2ZUBA 2IYLD 2F1HA 2NO6A 1LY1A 2BEKA 4JL6A 5M04A 5CYPA 4HLCA 2JLRA 2ZSAA 2PBRA 2ZETA 1EFRA 3ADCA 2QAGA 4B3CA 2HLDA 3GD7A 4R2IA 1MABA 4KVAA 1KKLA 4CEJB 4KCGA 1B23P 2DBYA 4EJSA 3ZLJA 4N0EA 1OFIA 1E2PA 2OSBA 4A0HA 5A5GA 1MO5A 2GEDA 4US1R 5J4LA 3EA0A 3KTAB 1QG2A 4JLNA 4EJSB 2QZ4A 1G19A 3QNUA 3K53A 1WQ1R 3W3AA 4N1AA 2CHQA 1XF9A 2EWVA 1E2JA 3PUXA 1CBUA 2QAGB 3DOFA 2ZRMA 1CJKC 1LS1A 3B1VA 2JJ2A 3DMDA 4LYHA 2E87A 4RZXA 1QHXA 3NXSA 4IKEA 3VR5A 1U99A 2FFAA 2IYRA 5JI2E 4IDNA 4PFSA 5EUQB 4MDFA 1W49A 4PPGA 3ZS9A 4ZCIA 1KO7A 1WDTA 1ZD9A 2ZRDA 5FBRB 3ZZTA 4GP7A 1SVKA 2PJZA 3TNFA 1N6PA 4HLDA 3OEED 4EPVA 3P4XA 4MYHA 3U4QA 1NG1A 3ZDQA 1KNXA 3RWOA 1MO4A 1XCMA 4DT1A 1UF9A 4HZUB 5DN6D 4E22A 2OILA 1S9DA 4PR0A 4QBGB 3AEZA 1NY5A 4JLKA 4C0KA 5EJEA 1VYTA 1C1YA 1N5KA 3HP1A 2H57A 2G83A 4QGHA 4QBFA 4LYJA 2EFCB 3T12A 1L4UA 3RHFA 3ZH9B 1GKIA 4RSGA 4JLVA 4V02A 3WXMA 3K0AB 1FZQA 2OAP1 3ADBA 3B13B 2BOVA 1JQLB 3WP1B 4B33A 2QT1A 4F7WA 3I8XA 2GXQA 4CYMA 4Q66C 3GJ5A 1QDEA 1OJLA 2YWFA 2ZTSA 2REOA 3LX8A 3LFUA 1OXXK 1YVDA 3AP1A 3MLEA 4P4UA 1TNDA 5C1BA 2X2FA 4LYFA 5JLJA 3ZD7A 3GQBA 1GL9B 3KFXA 4GMXA 1W0KD 4WXPA 3U44B 3AVOA 2XJ9A 3QXSA 1VMAA 4OQFA 1JXOA 3KQUA 4A4DA 4LZZA 4PAOA 3PVSA 1GILA 2OG2A 1M1YE 4C0JA 4CEHA 2QP3A 2F6RA 2FOLA 3NHBA 1R2QA 2YOGA 2BMDA 4JLAA 4Q9LA 3TSWA 1VIAA 3B1XA 5E7JA 3NC0C 1G6HA 4K8OA 1SXJE 2ZR0A 3VMFA 4JT4A 3EIQA 1XPRA 3UMRA 2JLVA 1CF4A 1MV5A 4Q1DA 1MO3A 1T3LA 1G6OA 2IUSA 3RANA 3W8RA 1ZVQA 4GNKA 2ECKA 1IY1A 1GSIA 2R6AA 2W0MA 3MCAA 5IDVA 4EJSC 2LKCA 4U5XA 5AUNB 1R10A 2QM8A 3SJBA 2DR3A 4K81B 5H1YA 3ZVMA 1G5RA 5JWOA 4NYJQ 1BKDR 3ZIAD 1QHSA 3LX5A 5FOVA 5D3MA 1D6JA 3RAPR 2WSMA 4Q4HA 2GZDA 1XXHE 4AYTA 1KY3A 1T8TA 1L4YA 4QFMA 3VHLB 1GDDA 2R62A 2WIBA 3IUYA 4KVGA 3QY0A 1XDBA 3PUZA 3CRQA 1OLOA 1TL7C 5KOYA 4KFRA 1IONA 3HU1A 3OIWA 1KIMA 2J45A 2NPIA 1YE8A 3DEFA 3UMSA 2HF9A 2QG6A 3FGNA 5TDHA 1Q20A 2W6IA 2AWNA 4QHTA 3GJ4A 4GSYA 1US8B 4JLPA 5B2ZA 2N1BA 1CTQA 1IN7A 1OE0A 1XEFA 1IXRC 5FTKA 4R2HA 1RW4A 1GOTA 4BECA 5KDDA 4XIGS 3A4NA 2EFEB 3NC1C 2IC5A 4EFNA 1YR6A 1VYUA 3MWJA 2DYKA 1FX0A 4RD6A 3T34A 3FB4A 1GKUB 1YZKA 4A36A 4EFLA 3Q8XB 2VEDA 2ZU0C 2XSZA 4DLVA 4MH0R 1E9SA 1X1RA 4XSGA 2OZEA 2Q3HA 3PIRA 4KYIB 4NL4H 4QBHA 2ATXA 1JQJC 2EFHB 4D4LA 2IF0A 3VTKA 1SVMA 1DAKA 3CH5A 3IO3A 4UNNA 2NO7A 2IYYA 2ZJ5A 3AQ4A 4NCNA 4EUNA 3UWKA 1UKEA 4XJXA 2ZI5A 2WOOA 3M6AA 2JGNA 1II9A 2FPKA 4BQSA 3MWKA 2JLWA 1NL3A 2CCGA 3QKRB 2CHVA 3SFZA 1HQCA 2VHCA 4JL8A 3H84A 2W0SA 2ORWA 3IPYA 2E9SA 3U3OA 4P4SA 2FN4A 1ZM3A 1D8TA 3K70C 2GXAA 4QJ4A 1EFCA 1Z0KA 4QHYA 2CLCX 3O8DA 4B48A 3D6TB 2KI5A 2O8DA 2CXXA 1R8QA 4Z8XA 1KO1A 1JR3A 5HKKD 4PQFA 3ICQB 4P33A 2HCBA 1X8JA 4NH0A 3KXIA 1Q0UA 1WCV1 3FPAA 3NH9A 3AM1A 3AVUA 3KZ1E 3KB2A 1DAGA 2GF9A 4JBWA 3EXAA 2A5DA 4WXRA 4B71A 1KK0A 4XWKA 3U44A 1EWQA 4ZPXA 2QM7A 4O25A 4G5RA 3WHLA 1P62B 3BFXA 3CW2A 3PENA 3LD9A 4BE7B 2RGNC 4ITRC 1XZQA 3SR0A 4CDGA 2GDJA 1KI1A 3PXGA 4G5QA 1FW6A 1R6BX 4BRWA 2UZIR 1XWIA 3Q9LA 4ZCLA 2GHIA 3WNDA 3K70B 2L0XA 3IIKA 3IIJA 4UNSA 3KJIA 4NBSA 2WWWA 5JMTA 3IGFA 4JVSB 3MRSA 4GOKA 3RS2A 5E4FA 2QMOA 1CJUC 1CRPA 2ZRGA 1F2TA 3TMKA 5EXPA 4BRUA 4DT1B 4EFMA 1IQPA 1YU9A 2QROA 5FBWB 4D0LB 3FHTA 3VR4A 1KZGB 2N42A 3KB1A 3GMTA 4HATA 4HAZA 1XBTA 1DVRA 3PUYA 4QG7A 3OAAD 1GL6A 5FTNA 3SOPA 2DFKB 2BCGY 2BDTA 1IXSB 3BC1A 2PZEA 1TU4A 4IDPA 3KJGA 4US0R 3BE4A 5KTYA 2IT1A 4PX9A 2VP2A 2QMHA 1CIPA 5CLQA 4B75A 4L8GA 3I32A 4C0SA 1K8RA 5CK4A 1SQ5A 3NH6A 4URVR 5HCNA 5A0FA 5J40A 5CYOA 5CB8A 4WVFA 1HV8A 2WM9B 3IHWA 4E07A 2CE2X 3QKTA 2FZ4A 3PFIA 3B1ZA 4ZKEA 4RD1A 3MFYA 4JZKA 2B21A 3QG5A 1VG8A 2FPLA 4B2LA 2WWFA 2XGJA 2OLKA 3BOSA 5H8WA 4TQAA 4DUGA 1YZUA 2GCNA 2Q21A 1XD8A 2O52A 2OAQ1 3LRPA 2HJVA 1XEXB 4AKEA 4TZ0A 1UBFA 2JIZD 4DB4A 1R5NA 3W9YA 2JLSA 4KSBA 2GXUA 1YZGA 1CXZA 1GAJA 3X1ZA 2QQEA 4WOPA 1KDOA 2Y8EA 1HTWA 5AWFC 3VR3A 4M9XA 2CL6X 3A1WA 4W9MC 4RD2A 5L3RA 4OK5A 3IILA 3HPRA 4HAWA 1D2MA 1VECA 3LXRA 5C4GB 1L2TA 2UZ3A 4NONA 1E96A 3RRNA 1NN1A 1S96A 3K0FB 3B60A 4HDQB 3WRXC 4BGDA 1E32A 1FUUA 1HE1C 2FU5C 4X8LA 4F91B 1U90A 1TU3A 5BYJA 4A0FA 4AD8A 3ZVRA 2ODEA 3U4QB 1CR4A 1XX6A 1Q57A 3V4FA 1SZPA 3QBTA 4LV6A 2I3BA 1OXTA 2GVDC 5JFGA 4ZO4A 2YWGA 4TT3D 2FSHA 5KNBA 4FMDF 3ICEA 4UXIA 3ZYCA 4C0HA 2ERYA 2ZJ8A 2EYQA 2QSZA 2XX3A 3KDSE 2ZRBA 1Z8FA 4DCVA 5KUTA 1R8SA 2ZI9A 2D06A 1E2GA 2CNWA 2WOJA 3U3JA 2ZE5A 4NCHA 1Z6GA 2CEAA 1GIAA 3TE6A 5L3VA 1G7TA 4HUQA 2ODWA 4D6PA 2G77B 1F2TB 2ZYTX 4II7A 4PQYA 5CJ2A 4FWIB 3KQKA 1E9BA 4M1WA 4L15A 4TLBA 4GRAA 2B6HA 5JCZA 4IVQA 5JJLA 1GUAA 4MRVA 3QKSB 1V43A 1Z07A 2W00A 3VKHA 4PANA 3DL0A 2JLQA 1H8EA 5E95A 4PPNA 2ZSFA 3IBYA 4B47A 3KFVA 5P21A 1U0JA 1O3YA 4DDTA 2CBZA 3QXXA 1BO6A 1A2BA 1N6OA 3TW8B 1YZTA 3ZGXA 4Q18A 4Q7MB 2I1VB 4DRZA 2LCFA 3LBNA 4JT2A 1GITA 4HB4A 3A4MA 1E2IA 3WRYC 5HPYB 2O8CB 4IRUB 2ONKA 4O2LA 5JSZB 2OCBA 3NHAA 3IHLA 3IO5A 4TLCA 121PA 2GZAA 4O2RA 4LPKA 4URUR 3N70A 4NCIA 1SXJC 1AA9A 2QP9X 4JMPA 1XCPA 5BN3A 2WJYA 2Q9BA 1XEWX 3AP3A 2NIPA 4B3DA 4UJ3A 1ZIPA 3RS0A 4DXAA 1KDRA 2PEYA 4QM7A 1T3SA 3FFBA 3VAAA 4L9WA 3FFAA 5AJWA 2DB3A 2FJUA 3LY5A 1RZ3A 5ANRB 1ZCBA 2ZS7A 3ND9A 5EP4A 1JECA 2IF2A 2J5XA 1SKQA 2NG1A 3S1AB 721PA 1EX6A 5EZ5A 4XWAA 4IOLA 1Z6XA 3CPHA 4FIDA 4TMKA 4OI2A 1ZM4A 3OFNA 2GK7A 3HU3A 5AJZA 2RGGA 1E2EA 2BJWA 2J41A 1XJQA 2IXGA 2V6JA 4UNPA 5JEDA 5FUYA 4LHYA 5F2EA 2P6RA 4LBZA 3HR8A 1E1RA 4GMDA 3FKQA 4V0LA 1XTKA 2IYUA 3IEUA 2DY1A 1ZW6A 2WHXA 1OIXA 5AJVB 4AG5A 4BZQA 3W8NA 1PV4A 3A37A 1NN0A 4OBEA 3TAHA 3EA5A 3NEYA 4F4IA 2V6IA 1WE2A 2QE7A 4JJKA 1UEJA 1Z08A 4NYIR 1NVVR 2IS1A 2JASA 4HB2A 4I1OA 2DHRA 2GETA 2PCJA 2XTNA 4DLXA 5C18A 1CLUA 1E0JA 1E4VA 1VYVA 4QHSA 3OFND 3W6NA 4Q4JA 3QKRA 1QHIA 2B92A 1QG4A 4G5OA 2F55A 4KBGA 3V00A 2FFQA 2AKAB 4L16A 3T1VA 4EPWA 3TVDA 1ZUHA 5DI3B 1BMFA 2BJVA 2A30A 2VIIA 3AF4A 4LJYA 1A4RA 3NBYC 4HZIA 2A5FA 1NLZA 3LO5A 3RSLA 4I1SA 3O8RA 1UBEA 5TB5A 5FH9A 1GRNA 2VTKA 5BQ5A 4F38A 1JAHA 1F48A 4FD2A 2WKRA 4EQ6A 4URZR 5KSOA 1IAQA 1N6LA 2QA5A 3K09C 4ZCMA 5GJCA 3SS8A 4LJ4A 4Q9IA 1Q1EA 1FX0B 1E9AA 2AN9A 2PZFA 1IJEA 2ZJBA 2GTPA 4MKFA 5FBLB 2VSOA 4C7OA 2PX0A 2BBOA 4ASUA 3NKVA 2PEZA 2YVUA 1TQ2A 5J4VA 5BXQC 2QY9A 2V1UA 2C99A 4JYBA 4YMUA 2HT1A 3P27A 5KU1A 1CU1A 2TMKA 3WNBA 3L0OA 1E69A 3TUZC 4ZI3A 1S3SA 1ESMA 4NYIQ 2VHTA 2ZSBA 2OUKA 1TTTA 1J8MF 2J1LA 1XFAA 1ODFA 2GCOB 2OXCA 1AQYA 3DOEA 3SYLA 4C0BA 4F4JA 3SBEA 1SVWA 2QPAA 1OFTA 1W44A 4PC1A 1W4CA 3HJNA 1W5SA 4HB3A 2IUUA 4BFZA 2QGNA 1TAGA 4Q4HB 1G8FA 3ND8A 4BUJA 2ZVQX 2IYVA 4CVNA 1BMFD 2ZIAA 5EE9A 3LVRE 3QEOA 4P31A 3G5UA 2J7PD 3WBJA 1P9NA 1KMQA 1Z47A 3TAUA 1ETUA 2OESA 2ORVA 3TSZA 3UMFA 3AUXA 1Q21A 4W5HA 2FZLA 1UKYA 4LSGA 4V0NA 3FKSD 3QE0A 4BFUA 4IVRA 4OK6A 2PLFA 4GOXA 3X2SA 5BN4A 4BZXA 1CS4C 4D4MA 1KSFX 1FL9A 4ZDIA 4GPTA 5FFMA 5JECA 2BV3A 1Z22A 1G4AE 1L8QA 3I3SR 1R0YA 3PEYA 1VG1A 3T15A 1XD2B 3WYAA 5IF9A 2IS4A 3J81k 1KOFA 2N46A 5FPHA 4YLGA 3EIHA 1QHYA 4QGFA 5DLQC 5FTLA 2GJ8A 4B32A 2WJIA 1U2RA 2XB2A 4P32A 3E2IA 2GEUA 5J4YA 1XZPA 4QJ3A 4UNQA 4LX0A 3R9XA 1J99A 1KDTA 1TF7A 5FPTA 4POAA 4DDWA 4DIDA 5HE9A 1RRFA 2IWHA 4NP6A 3K70D 3Q72A 3AVYA 2ZRAA 4Q03A 3CF6R 1DARA 4C9BA 4GDFA 4DEYA 2J0UB 4GT1A 1P4SA 3K8YA 1X8LA 2IS6A 4W7SA 4LJ8A 1WBBA 1M7GA 3B85A 4TMXA 2V55B 3M0EA 2CMKA 2A2ZA 1AGRA 3F3YA 1ZJ6A 1CP2A 1DAEA 1PLJA 4TTRA 4P0TA 1PVOA 3QKUA 3OZXA 5HR5A 2XNDD 3UG6A 1QZXA 4U02A 1OH5A 1E9FA 1HT1E 1XRJA 3SEAA 1E9CA 1KYIA 1DPFA 2H16A 2KB0A 2CCJA 2GJSA 5TXGA 4EQ6B 4DCNA 4M1OA 4RD0A 3THYA 3C16C 3EWAA 4RD4A 1W46A 4AIIA 1U9IA 4XH9B 1W36D 5LBIA 1UBCA 2BKUA 2D3WA 1EG7A 3THOA 1OH7A 1ZNXA 2RHMA 1U98A 2RMKA 4Q1FA 2P6NA 2O8FA 5HCIA 1E2MA 3K0CC 3PJRA 1I4TD 5DGXA 1NP6A 1CKEA 2XTZA 4B3GA 2Q9AA 5DISB 3GFPA 2ZXUA 3KL4A 5FOTA 3REGA 4LGMA 3NDBB 3AF0A 5BWMA 4OKSA 2XAUA 5IK2A 4LHWA 3P32A 2IA5A 2RH5A 3C8UA 1N6NA 2QPTA 4AKGA 2GCOA 4TSFA 1ZD1A 3TR0A 1DBSA 2B8TA 2BEJA 1GP2A 5UKDA 4DBLC 1GTVA 1W1WA 4A2PA 4OHYA 2F3RA 1KKMA 3AKEA 2WSSD 1ZM9A 4GZMA 3IDQA 1ZD8A 2P6UA 3FMPB 5JSZA 5HTKA 621PA 2PMKA 4A0GA 4BZPA 2Z5FA 1F2UB 4RFSA 3QF4B 3DM5A 4B76A 2X1VA 4Z51A 4A6PA 2NQ2C 3AGPA 3BS4A 2OM2A 1KSGA 1RYFA 4ERNA 2XXAB 1AK2A 2OFOA 4LPSA 4LHVA 4D0NA 2C9CA 1ZUNB 1KO8A 2J7KA 3QBVA 2WVJA 1SVIA 2CCKA 2G1JA 2ZRFA 1CRQA 4X8OA 2KSQA 3SE0A 5DHAA 3VKWA 2PL3A 3I8SA 3SQXA 2KE5A 1IBRA 4M9QA 2OBNA 2HLDD 3CX6A 3FKSA 2ZRJA 3A1UA 4JYCA 3S1AA 5GJBA 1GRRA 2B8WA 3X1YA 4C4PA 1E3MA 1FQJA 1BS1A 1NMYA 1QHNA 1VHTA 2AHOA 3MAAC 3B7GA 2AKYA 4IHQA 3WMGA 5JCPA 3K09A 1M8PA 4ARZB 4TMZA 3IPXA 1KO4A 2KBFA 4OHVA 3W34A 2OFXA 3QIAA 2B7BA 1E2DA 1FP7A 1W7AA 2EWWA 4IXMA 1E99A 4JIMA 1VG0B 2NPFA 3KJEA 1LV7A 1UDWA 4D0GA 5FOWA 1W0JD 3OESA 2O8CA 3UANA 3EC2A 4OHWA 4KYUA 2KBEA 1DO2A 3B82A 1OYWA 2WSSA 2ZE7A 1ZRHA 1OKKA 2REXB 2VF7A 3BB3A 3TUJC 4U7DA 4IDQA 4B3XA 4LJ6A 2WTUA 1DE0A 4TL7A 4LUCA 2CLSA 2QAJA 1U8AA 1DELA 3F0TA 1IOZA 1T0JB 4RJLA 3CX7A 4Q4LA 1TF5A 4DJTA 3H1TA 2O0HA 1XTIA 3AUYA 5TY0A 4TQUS 3U61B 2H92A 3AVVA 3GLFE
chains in the Genus database with same CATH superfamily
1L6RA 1ORIA 3FLEA 5AM1A 2BI4A 2PH5A 3DNPA 4XYBA 3V7FA 2PTHA 4RKWA 2Z4TA 2YN0A 3OFKA 5H82A 3PV0A 5C8DA 5CB4F 5IN4A 2QMEA 2GKGA 4RNDB 5ALDA 4F11A 5BSWA 1R0SA 2ILTA 2JJ1D 2GN2A 2WV7A 5FWYA 3R6LA 5F3DA 3EJ6A 13PKA 1WXHA 1ODSA 4S1PA 5DM0A 4KIFA 2Y1XA 4TS1A 2O57A 3R7LA 4DLPA 2FDRA 1U1DA 3BMNA 2VP4A 3F8SA 4FFVA 3ZCSA 2I62A 5I7SA 1VJGA 2QLJA 3I9LA 5JFTA 1QKJA 2VYCA 3SC3A 5E3HA 4DCGA 2JAWA 1EUDB 1DC8A 3CN7A 3K9WA 5BV8A 1MZPA 4K0KB 3VO2A 3DVQX 4YIHA 4PG5A 2F59A 1NIJA 4KQCA 3MSXA 2KHZA 2VDPB 3HRKA 4UFOA 2XB6A 4K3UA 1TZ2A 3ROPA 1F1JA 3UOWA 1H5NA 3N2KB 2R00C 2R11A 1ZMXA 4RV9A 2OSVA 1GGVA 1MC4A 3GEIA 3W6UA 3ZYZA 1WCXA 1XD2A 1Z25A 2NYUA 3OX3A 3KEQA 3DL4A 3S5UA 1XPUA 1V95A 1NQWA 5C31A 3WDLA 3FYSA 4AUMA 3URKA 4C1BA 4BQPA 4Y98A 3KELA 4DILA 1LF0A 3WB1A 4DWWA 3ORHA 4FU0A 4L1KA 4OI4A 4OQYA 2CVHA 2NTVA 2XQKA 3C1AA 3FVWA 3QVVA 4FW8A 3VV2A 2PUCA 2B4QA 3A26A 4TYPA 1KRHA 3PF8A 1TAUA 2G63A 3DC2A 3MMPA 4UHJA 2DFTA 1WMBA 3G0OA 1XMXA 2DUMA 2EZ9A 4BBJA 3KSDO 5TGZA 1MQ8B 5AVKA 4ZA2A 2BM0A 5C80A 5HOQA 5HKBA 1SKYB 4RA9A 3D3WA 1R0WA 2YN4A 1VKNA 3UNXA 3UC9A 1XRSB 4JVMA 3HO8A 2FSFA 3DWFA 3BBLA 4WOCA 4C87A 4Y2RA 4NU0A 1PQPA 2CJXA 4O59O 5LBUA 1HDOA 3GJXC 2V8OA 3H2ZA 4KVZA 2GNAA 4ALMA 1KJJA 3FNEA 5J5AA 3NVAA 2OCIA 5EMNA 3WIVA 1OX4B 4ZU3A 1GG2A 3AX6A 3ED5A 5KNLA 3T7KA 3QVUA 3G82C 1EEHA 2PX4A 3G1TA 1UWVA 1XLTA 4YTEA 2MDTA 1EESA 1A9RA 5SZJA 1AKMA 4WUTA 2HDNB 3U3ZA 1CHNA 1HZZC 1M5TA 1YJAA 3BGIA 3IP6A 4HDNA 4WNAA 3W2FA 4C0AC 1GYQA 1G2IA 2OOSA 2ZIFA 1S2LA 2BYTA 3EWIA 4IEIA 3IEVA 1T6YA 4XTCS 5JSKA 3TEMA 2DPLA 2XTMA 1JHPA 1JL3A 2E6UX 1Y89A 1MORA 4E94A 2A88A 1X3SA 3P4YA 3PPVA 4JA2A 4CMIA 1R4AA 5DTJA 3WWPA 3K0SA 1ZJZA 2NUPA 1Z5WA 1GT91 2ATCA 1UKZA 4YYEA 4J1TA 1GGFA 4RCZA 2IUTA 1JAIA 3O3OB 4F06A 4U6QA 4BFLA 2V98A 1ZI8A 4EI9A 1HNZB 1U63A 5DRTA 5EUCA 1X94A 3LP8A 2YCBA 2G6BA 1HDXA 3ADOA 3N2EA 5KTRA 4HAOA 3MEQA 1BWQA 1FP6A 2R65A 3JS5A 2BFBB 4ZARA 3RR2A 2Z56A 4TTIA 1QH8A 4NAUA 4AG3A 2WWHA 3PEUA 2HR1A 4FYPA 1T13A 3EGOA 1QV7A 1QX3A 2BGNA 3Q1KA 1MIHA 3L9XA 4PC3A 4TSKA 1KU6A 1BC5A 1I5RA 3BT7A 4F8EA 1WP9A 4TRMA 3IVCA 3UF0A 3HZHA 5B57C 1R6UA 2OD7A 3D3KA 1EP3B 1VMEA 2ZOSA 3E9DA 3O0TA 1L5OA 1NW9B 1OIVA 3DO6A 4QUAA 4ZZ0A 1E1DA 1GCOA 1RT9A 3ASZA 4UUNA 2YWHA 5FL3A 2WJAA 5CIWA 1LNSA 2F43B 3HB7A 1RAEA 4K86A 4R1OA 3QPUA 1PEYA 3AC0A 2FRDA 3L0PA 2QYTA 4ZRNA 5E9QA 1NF3A 2HFKA 2NU6A 5HFAA 5F3WB 5BYBA 1C1HA 4DTCA 4JFRA 1NM5C 2I7DA 2QN3A 1BXRB 4P0QB 1BGVA 2FFRA 3FHJA 1FSGA 2W8BA 2XXJA 2BUAA 3OBIA 1TO6A 3RPEA 1L5MA 3U7FB 2GN0A 1RZRD 1PWZA 5I7FA 4P4GA 5IAJA 2HW8A 4PZYA 4I4IA 1A9YA 3WRVA 4BP8A 3U60B 5FWXB 1QOPB 1RYNA 1TQDA 2PLRA 2V7TA 3LUHA 4RVNA 4U8GA 4JLOA 4EYOA 3O74A 3T61A 1PJ4A 4V03A 3OIUA 2AK3A 4JA0A 2DPGA 4E0BA 2VR1A 3B78A 1P2TA 2X1HA 4OQLA 4OH7A 2E7ZA 2IX9A 5FORA 1HE4A 1TPYA 1U2PA 3AGQA 5LB4A 4BAGA 4DPKA 5BN5A 5EQJB 3UJBA 2RGYA 2ETXA 1Q7CA 3UBTA 3NVKI 1JWBB 4GLOA 5JPDA 3P0FA 4U9UA 4CLOA 4IOJA 2WIAA 3N8NA 4RJKA 4J03A 2UXBB 3L2OB 3PWSA 4QGBA 4FFBB 4Q9JA 5ENZA 4D4JA 5EJ6A 3A4IA 4JP5A 1NG9A 1ZM7A 2ZJOA 3LGSA 4PGFA 4JI5B 4YDQA 2BSQA 3TJRA 4TUYF 5ERGB 2FSSA 1CUEA 1ABEA 3OE7D 3EEBA 2ONZA 4DNPA 2OFWA 4ZJUA 1Z2OX 1E2HA 2ZSDA 1P44A 1TZBA 3EASA 5AVRA 4L78A 2H59A 2Z2XA 5JPCA 4RMGA 1P7CA 1PTKA 4QDTA 2F2TA 2FPRA 5F21A 1AZSC 2UU9B 3STYA 2PL1A 4DJDC 5G41A 1KEKA 4FDLA 3EIWA 3K2QA 1GSHA 3LLCA 1OA0A 2GOYA 3P9XA 4TPKA 3ZWDA 4DG8A 3OCUA 4BB0A 1QRTA 4K40A 2CXOA 1Z0JA 3ZHQA 5A3QA 2BCEA 1PUJA 4YRSA 2C5HA 1RABA 2G1UA 4IGKA 4OCZA 3RVOA 1ISSA 1KH2A 1BRTA 1VLZA 3VYSB 1F4LA 3LHSA 3PE6A 3IL2A 4BEBA 4Z7QB 2RGNA 1ZIDA 4CU2A 5DP2A 2DRIA 4RL6A 1P5RA 4ZTUB 1FNCA 2JKYA 1QZZA 1ULTA 2X23A 2ZANA 1DTWA 4FW9A 4Z9AA 1OH8A 1RTTA 1Y9JA 2G17A 1J1IA 4JNKA 3AKCA 1QH0A 2RH8A 1AXRA 2ZGVA 1CWUA 1K7CA 2PKCA 5BSRA 4JKOA 3FR7A 4D9FA 5EIBC 2D2XA 2ORIA 3DZJA 3FNHA 2VA9A 1Q12A 1TUBB 1WD5A 1YQTA 1AOXA 2ADFA 2EFDB 2HA2A 1PNOA 2RAUA 2RH4A 2YC2C 3E1KA 3FX2A 3L82B 3PQ7A 3IQIX 4Q3OA 2ZQYA 4Q4AA 1NN3A 1Z35A 4I4TB 4Y6LA 2JPDA 4MVJP 2CL0X 3UBMA 1H69A 5TMDA 1PWYE 1SM4A 3KVVA 4GYKA 3VTFA 3UB3A 1C1DB 1BAPA 2XUFA 2QYSA 3WISA 1T4CB 2QVBA 2R5FA 4XIIA 3IEMA 3DPIA 4OK3A 4G37A 2I6QA 3NUZA 3HDYA 3TTWA 3C3MA 1KA9H 5AQ1A 2J4DA 3B51X 1NVBA 4QVGA 4HGZA 3PR2B 2BN4A 2HM7A 4JVNA 3QHPA 4I1UA 3DKVA 2ZYIA 1W36C 4RCYA 1M74A 5JS2A 3IMFA 2CJWA 3VHRA 3RBXA 4DV2B 1OFUX 3EW9A 2VSXA 3G2HA 1TJ4A 2OCAA 1BX3A 3SF8A 4JMLA 4Y9DA 5BNZA 4P08A 4OGGA 1XRLA 4OA8A 4JI0B 4F1KA 1RWPA 1O6FA 2UZ4A 1NIPA 2C7QA 1PBTA 3L8DA 1PD1A 4KBFA 1II0A 5JZBA 3Q3HA 3S2IA 2P3OA 5FWDA 3STXA 4OPMA 4OFZA 3QMPA 2BFEB 3IJ5A 1Y9EA 2LD4A 5ADHA 3T3NA 3E4DA 3F4KA 2HNAA 3B5JA 5CLIA 4YDHB 3A8TA 5DYGA 4BNDB 3UATA 1HC7A 3P45A 4JI7B 1TGYA 4KPGA 3CEHA 3ILXA 3WLPA 1IHXA 3ZHRA 4FS8A 3T7DA 3UHJA 1UJBA 2PA3A 4YT4A 2OVFA 3RYFB 3TUIC 1E2FA 1U3VA 4BNHA 1SPBS 3V33A 5L45A 3VC7A 3FPBA 4X7BA 4PFQA 4COKA 3L40A 2Q1WA 3KAPA 3QH4A 2WILA 3L6DA 3D6UA 3WIEA 1HMPA 2AZDA 2JAUA 1ZH4A 3DDCA 4MV6A 1XNGA 4BASA 3CR8A 2C2GA 4UM8B 4DMFA 3VC3A 2FWIA 4I9UA 3K5WA 4J7UA 4NG5A 4MICA 2JHCA 3VH1A 5JXGA 5LOVF 4HTFB 1A2OA 1IK4A 2OO3A 3BGVA 5H0IA 2J30A 2NUBA 1FJGB 4PLCA 2O8BB 2GF0A 3JD1A 5D3ZA 1I5OA 4CLXA 4B1FA 2DTEA 4D96A 2R86A 3HUFA 4IS2A 4OEHA 1BQ4A 2C1XA 2I54A 2R60A 1CJMA 1CY7A 2J3DA 4QQRA 4HBZA 3CEAA 4YO8A 2GERA 5AT1A 4CWAA 5BSHA 2JFQA 2LVBA 2CV1A 1W85B 1XLWA 5JAOA 2X5JO 2ZT5A 4U7HA 3UQYS 3OTHA 3M7IA 2CLHB 1E6KA 2QX7A 3FWNA 2PRKA 1YKFA 4IMPA 4NCXA 4RIFA 5EP1A 3B3FA 3OH8A 5C8VA 3I61A 3COWA 1XVAA 4PF1A 1NPYA 4HDRB 2F8SA 1H23A 3HNPA 5B2FA 2M6SA 1KYZA 2GBLC 2YH2A 4HAXA 1U7HA 2PWYA 4CCSA 1Y8QB 5HDBB 4HI0E 3DXXA 4XE5A 1IG0A 2QIPA 4F71A 3NUGA 3OCYA 4Q1VA 1KFJB 4MUAA 3KKMA 4Q7QA 4AURA 1XRNA 2EJCA 4HS4A 5DT9A 4L9SA 4B3RB 1K6MA 5BWCA 3PITA 4FGJA 3KHTA 5EINA 1NX9A 4M54A 3L41A 1TT7A 2A0YA 1SQ6A 4A0SA 3QKIA 4C7JA 1QO0A 3KFLA 3W06A 2NO1A 4MVJH 3MJHA 3K6KA 1WCIB 1A9QA 2ID8A 2A9RA 4A6EA 2P5TB 3IOMA 1ZPDA 3IQWA 4G1EB 3OLQA 3BK7A 3E35A 5BVGB 1QP0A 5KWSA 1S9HA 1Y6ZA 1Z37A 3EVTA 5JCJA 2H1FA 2WYHA 3DBVO 3L92A 2ASVA 1I14A 3C87A 2ENWA 2R4UA 3DFZA 3N53A 3QWBA 1B43A 1A76A 4H4CA 4UBNA 3VHXA 4E5UA 1G55A 2C0CA 4E7PA 2M9MA 2PBLA 3K32A 3VTZA 3VNSA 4FFRA 4F3NA 3RROA 2OT3B 2HMUA 2I4TA 3PQ3A 4R7TA 5TGTA 3R7FA 5IZ4A 2OCYC 1XVIA 1ZW1A 3OT1A 5EPUA 1ZGCA 2QU8A 4ZAVA 4HMPA 1UADA 2B25A 3ZX5A 5JH7B 3ASUA 1E79D 4U7JA 1R12A 1V26A 3KDPA 2G82A 4A2WA 4E03A 3FMOB 1O08A 3MGAA 4FGWA 4NAVA 3V8EA 4FZRA 4KJXA 5IASA 4LK3A 3V3KA 5JBQA 1WB9A 2ZR9A 1EXVA 1XAGA 3QVXA 3W4KA 1RHKA 3D8BA 3LOQA 3OECA 3QWHA 1Y4DE 1Z74A 2WJHA 3E18A 4IZHA 1T8PA 1K8YB 1NYRA 2NGRA 3BXZA 4KQEA 1Q5PA 4L3OA 4OJYA 4DCOA 1SHZA 5FAKA 2FW8A 4EHIA 4ZYUA 5L3QA 3OTOB 1WUYA 1ZCFA 4UQOA 5AHRA 2NVBA 1PJRA 1M2FA 2J6CA 5DYIA 1OLSB 4JOCA 4MTLA 1U9JA 1QKIA 3Q85A 3A32A 5FLYA 3RS5A 1X2EA 4JLMA 1D09A 4TXNA 2VAXA 5G1OA 3TFWA 2IYZA 3CUVA 1OSNA 2HJGA 1QRDA 1KZ7B 3OHMA 3NRJA 2X0DA 3EZ7A 3CE9A 4EDHA 3ABOB 4XGKA 2ISSD 2GHTA 2WUEA 3EGIA 3I12A 5A4AA 5BQFA 2Q2WA 3IJPA 2I4MA 5B6IA 1XJ0A 2PQ2A 1DINA 2LUOA 2FXIA 5DF1A 1LLCA 1R0XA 3WAGA 2D7DA 4JWTA 1T2DA 2D5LA 4OTZA 5CVCA 4C4XA 3EMKA 4FEAA 3W5CA 4PXYA 3TQSA 4DMGA 4MGKR 3AL0C 2D59A 2PE5A 2XHEA 4TTJA 2PMBA 1RLUA 3IBTA 3LKZA 4L4YA 1DBWA 3TLZA 4RIEA 3BHIA 3EVAA 1EB9A 3B8EA 2RHCA 2JZNA 2JANA 3AVQA 4JUDX 1K8ZB 1Q17A 3PEFA 1Z2EA 4EHNA 2JLUA 1UC4B 3ROXA 1JKXA 2OQ2A 3S81A 3CH7A 4RYLA 3M8KA 2P78A 4CI9A 4F45A 4PLVA 4R69A 1G8SA 2CHGA 3E9CA 3FOZA 5LQSA 1UJCA 2PX3A 5FBKA 1PJBA 3U49A 2R6DA 5F9FA 1QUFA 4ZQGA 1I6KA 3SZRA 1LVHA 4P4TA 1CDOA 1EFRD 1LX6A 2CNBA 3I8OA 1BA3A 1OLUB 1VFPA 3VNUA 1GXSB 1JIIA 3ITKA 1RMQA 3TH5A 2QEQA 5CD1A 4I1PA 3WSVA 2C04A 5AXCA 1W0JA 3PJEA 4B45A 3C4VA 1ISJA 5AW7A 2Q6LA 3GJ7A 1M6EX 2G1KA 4N7JA 2AGVA 5HK9A 1KHTA 4RTRA 1MGOA 5F3RA 1I4EB 2WU4A 1AKRA 1XSEA 1PJ2A 3FUTA 1SD1A 2B36A 1VXOA 2FWAA 3V4PB 1X0VA 1KE2A 3FHOA 1CZLA 1FB5A 1DHTA 1PT9A 3HKDA 5TC4A 3PR3A 1P31A 1W5FA 3PXUA 4QRIA 1GTMA 3CPEA 3IEPA 3KJXA 3VR4H 5TARA 3V7NA 3WGGA 1RXVA 3O3NB 2XY4A 5JSQA 3KJFA 2X6QA 4E5DA 4Q02A 5KWEA 4G1VA 1G7SA 3ETJA 4Q93A 1QOZA 5F4BA 5HQJA 1LDMA 3BK2A 3EPHA 1ESNA 2JF0A 1HLGA 2VPWA 3CVJA 4L9AA 1OZFA 2Z08A 4CFYA 3AHCA 4F9EA 1Z4IA 1KTIA 2IH5A 2ARKA 3LH5A 1N0UA 1G6Q1 1ZWLA 1OAKA 3IBFA 3V4SA 1JG6A 4GI7A 3NB0A 3TSAA 1TX4B 2NUAB 1WD7A 3EG5A 2VHQA 2B1JA 2V7EA 1ZOSA 3JQ8B 2J6IA 4MVJE 2FA9A 4BZWA 2Z3VA 1IXZA 3B5IA 3L8MA 1E64A 4YAWA 5JCOA 3T9EA 3D8UA 3KB6A 2HMVA 1JIXA 2GSDA 3V8VA 1R9GA 1P2BA 4QWWA 5K09A 2ONCA 3VPBA 5BURA 2IDKA 3RRXA 1FU8A 3WZMA 4EG7A 2IEBA 4RA6B 4NOMA 4D56A 3KR1A 3IXMA 3P9NA 2RK6A 1E8NA 2AJLI 4E09A 1GPKA 4YN3A 4OUDB 2RGCA 4HH4A 3OSUA 3PP8A 4M1ZA 2RIPA 1VCIA 2GKSA 2YIVX 3K1AA 3TLKA 1M6WA 4D41A 3CPJB 2JIRA 1DAHA 3FUUA 3E3LA 1ZYUA 1U65A 2FK8A 1ITZA 2VOJA 4KZPA 1GG8A 1BOFA 1UXGA 5CX1A 2IP1A 1LS6A 2R79A 5IHPA 1XTSA 2FEKA 2R4TA 1M75A 4OQZA 1BHSA 4KE9A 4HUTA 2BM1A 3K6RA 5AUPB 3OPNA 5JD5A 1Q91A 4C22A 1ZITA 1VTKA 2BFBA 2DP4E 3KOWA 4M99A 3A1TA 3JQAB 3LT4A 2CE7A 4PCVA 2B3TA 4YMWA 2P6MA 4A8HA 4MWSA 4ARVA 4G1MB 1UMDA 3BJIC 4MKHA 3BD6A 4P84A 3ZPXA 3OPYA 3CF0A 3OZIA 5JNUA 4NQZA 2FZKA 5D8DA 3G2JA 3INRA 3D2AA 1OFGA 5THQA 1JE1A 1PKEA 2RJ3A 3CNBA 3F7OA 4OF4A 1IBMB 2WF7A 2N9UA 3MMNA 2QD3A 2R6GA 4NZZA 5ALMA 1NF9A 3TVTA 4B0OA 1NC3A 1JEOA 3C6KA 3T5GA 3P9KA 3S2UA 4MVJD 4C78A 1PQWA 4HC4A 1ODIA 2TRSB 5E2AA 3SN6A 3LGAA 1NZDA 3MYYA 2LW7A 3NIBA 1PL7A 3D64A 4JEHA 3S70A 2C0QA 5EYPA 4HMOA 1D2NA 2DBRA 2FMFA 2HGZA 3L7BA 2WZBA 1CQJA 4TN5A 4XWOA 1VIYA 2FB9A 2BTQB 4X7RA 2AD5A 3F9RA 3O1HB 4KDEA 4J3FA 1E3TA 1SPXA 2QRUA 3UXMA 3R6DA 4IF6A 4DLTA 1QGOA 3OT1B 4KWTA 1EMDA 2R6CA 1YBMA 2XQJA 4XOIA 1YGPA 1JHYA 1U2EA 2EW1A 2IZ6A 2KWIA 3JQRA 4GSKA 3VXKA 4ZZIA 1NI5A 2X2PA 3S68A 5BWBA 2PM8A 1I30A 1SVOA 2BGMA 2DE0X 4WKGA 1Q74A 3KOMA 1N2GA 4HYQA 1RWVA 3T35A 5CTJA 4B35A 4ZI2A 3IS3A 4QL3A 3JVVA 4CMKA 2NU6B 4EA7A 4FT4A 3IOBA 3ZZUA 1USIA 3HRHA 3RV4A 3L1JA 5EJ8A 2CK3A 1IBLB 3J80A 4LF7B 4QNRA 4QFCA 3DV0A 4BKUA 3EXG2 4G3XA 4Q1EA 3DHVA 1ZMRA 2NQTA 2O3SA 2Q9UA 3R09A 4YCCA 2Z4SA 2DJIA 3IOEA 2BBSA 1EUCB 2C95A 3G2IA 4GX1A 4N0PA 1N6HA 4TTQA 3DJFA 5WRFA 4CV3A 1A2KC 4DMMA 1OTYA 1DIGA 2YY6A 5HKKA 4FNOA 5GZ6A 3TQOA 2BDEA 5JG7A 1J33A 3IQXA 4F56A 4QGGA 3AI3A 2OZKA 5I9BA 2Y1KA 4S2UA 4PG8A 3FE2A 1TEXA 3HA7A 2P5SA 4LHEA 2IY7A 1MCZA 1DAIA 2Z30A 3DFUA 3IC5A 4MUBA 4P5EA 4V3CA 3RREA 3TQIA 4FFSA 4C6SA 4LRWA 4Z9YA 2BC9A 3M81A 3PS9A 5DX0A 2X0JA 2D1TA 5LPNA 1PNQA 3C3PA 3M6FA 4YRJA 2K7ZA 1BMDA 4NFLA 1KH1A 3WQRA 1U3DA 1E66A 1DO8A 3EY9A 4QOEA 4JHXA 5EWJB 4D3FA 4KZKA 1YR8A 3IKJA 5K8IA 1CCWA 2HYIC 4ETWA 3F90A 4XQ9A 4GMHA 2DUUA 1OOEA 1PYOA 2RGEA 4MQ5A 3UT6A 2I5PO 1KYQA 3MWFA 3OLYA 4IIGA 1M8GA 4JC0A 4BP1A 4EO4A 2C8LA 2JH9A 5KHAA 1CR2A 3DF9A 4ZQEA 4Z0PA 2J9RA 4YRDA 3TK1A 3EX7C 3JQEA 3HA3A 4HDNB 4S24A 1VPTA 2RAFA 2H0AA 3USES 5J2TB 4A2QA 3GLIA 4I6JA 3S7ZA 2PGXA 5CM8B 1Z2PX 1ZG3A 3ITEA 2Y93A 4DADA 4O4JA 1U94A 2JAXA 4G0OA 4RV4A 2EIXA 3OZGA 1CULC 2A57A 2DPMA 2YFKA 4JENA 3BAFA 3FTEA 1ZGHA 1VJTA 5T6BA 2P40A 4UHKA 1MABB 3I6ZA 4NG4A 1GKKA 1W88B 1L1FA 3GDFA 2F17A 2BE7A 3AWIA 2AX4A 4FLEA 5BMOA 4EGJA 5JZ9A 3VZBA 2WG1A 3D7NA 5D5QA 3KSAC 1KY2A 1J9ZA 3VNVA 1EK0A 3FFXA 1XG5A 1N5OX 4TUYA 1X92A 4U7WA 5JCOC 3A6JA 4UU0A 2IYAA 2H17A 2AWOA 3PEWA 4XJTA 3X44A 3D3JA 5CXXA 4X1IA 4D82A 3G8DA 1T26A 2GBFA 4O4LF 4U63A 5GP1A 1VG9B 2HAEA 5LZ8A 1MO6A 2RHJA 4G1UC 4EAAA 1JIQA 1I2DA 1P60A 4LZOA 2MYNA 4I7EA 3RAGA 2WJPA 3LZ6A 2C2OA 3NTRA 3VPFA 3FWYA 2A1IA 4PLFA 2JJQA 1U1CA 3A4VA 4BMPB 4DMUB 3KV3O 2VF8A 3DXFA 3MC1A 4QT4A 5I7WA 3IBGA 1AT1A 3A27A 2D6FA 1W85A 3JRNA 3S29A 1IMJA 1L4FA 2NXWA 2PR7A 3LYHA 3HO6A 3VM6A 1CR0A 4KOEC 2W9XA 3GI1A 2A33A 1M6VA 3GLRA 1YD7A 2A8YA 3HKEB 4MRMB 2WKQA 4UUPA 2OK7A 3SKVA 2QGFA 3QEJA 3HB5X 5EZ6B 4C3ZA 3CBGA 5JHGB 1ODTC 1ONOA 1UOOA 1IUNA 3MUEA 3SK0A 2GTIA 3V1MA 1JIVA 1EDDA 1YVRA 2QPOA 5K0ZA 2Z0MA 4GZ6A 3DKRA 1CX9B 4AXBA 1I94B 3K9HA 4MV8A 3RRJA 2E1RA 4XVCA 1DCTA 1CZRA 2PT5A 4RZUA 1X80A 2DCMA 5KOHB 4GZLA 1OKKD 3DYVA 1JAZA 1RJWA 3FUCA 5HZHA 2OCPA 5JC8A 5HA5A 5DEIA 4J0IA 1IQUA 2MR5A 2BKVA 2Z1NA 1P9RA 1QPZA 1GPLA 3OE7A 2YV4A 4BNJA 5KX5F 2W2QA 1ZGAA 4JSRA 4RS4A 4URHA 3TQRA 4M21A 4O4LB 2EKZA 2LCQA 3TLAA 2Z8ZA 4BNDA 1EZ4A 3ONWA 4QBTA 3U6KA 2WWTA 1JU3A 1ZUD1 3IXLA 3LWNA 4LVUA 4ESHA 2JD0A 2IWRA 2EXXA 1RWNA 3W5DA 2P5YA 3CSDA 3TAXA 5I7VA 3FXAA 2HU8A 5J23A 1JLLB 1UK7A 2QI9F 2JJMA 1FNMA 2JCYA 3GH1A 3IVRA 4K6HA 3WGNA 2GASA 5L7TA 1ELOA 1E7WA 2ZWIA 3G5TA 3Q7PA 4PQGA 4OAOA 1R0BA 4DV7B 2P2YA 2UYYA 5CDSA 2JGRA 1JG7A 2WRZA 4EZEA 1NT2A 1YZLA 5GOZA 4GVXA 1KDPA 3IUJA 1Z2CA 3N7UA 2WD8A 1GZHB 3D4NA 3G1UA 3MBKA 3PXXA 4ZVMA 4JB2A 3VBEA 3ZNPA 5JNRA 1S8OA 3SVZA 4LJLA 4TYQA 4UPDA 4BNIA 3HACA 3OICA 5EIAA 4LV5B 3HJBA 3I1JA 4MWTA 5CVUA 3MCUA 2ZJ3A 3GARA 5A2QA 2GM4A 4MWDA 1PKXA 1OZAA 4E6EA 4JEIA 2C88A 1F8XA 4KN8A 5CFQA 3ZD8A 2F3TA 4IM7A 2HV8A 3MWLA 5JS7A 4C89A 2A5YB 3DUFB 4P2GA 5L3SB 4MQ4A 1GTRA 3K8ZA 4F84A 3PHGA 3ANTA 4FFPA 3V8NA 1TUBA 2VTDA 4EY7A 1OV4A 1RCUA 3B1YA 3G6WA 4JZYA 1JHDA 3L7MA 4YP0A 2QLMA 4XTRA 1N1DA 1ULZA 2A78A 1YR9A 5ICGA 1JKMA 5A04A 2Q41A 2JK0A 1MX1A 2WDPA 2G71A 2I3ZA 4I9GA 2INGX 3WL4A 3MJVA 2J09A 1P72A 2GX6A 3ETEA 3KJNA 4ZALA 3TD2A 4YJ2A 3ER9A 4B4OA 4H15A 3IAFA 1RC8A 3RO7A 3UC5A 2EKQA 2XH8A 4AY3A 2OM6A 1W1UA 4LXGA 2WEKA 3U7QA 1GVNB 4CRWB 1OVGA 4AULA 3O8NA 5M3BA 3ZWVA 2DPYA 1SNYA 1QIFA 4O08A 3RYTC 1RSZA 4XFKA 4B3BA 4BQNA 1H4QA 1PJQA 4YRZA 2EW2A 4W5JA 1FU4A 2Q4EA 3RVPA 6Q21A 3BREA 4PO8A 1NONA 2UKDA 3W3ZB 3TIXB 4BRZA 3DCJA 5IAEA 4YUYA 3JARB 4UEJA 3BSYA 1KPGA 2H07A 3OO1A 2OXIA 3ADDA 1AU9A 2ZJAA 4YPVA 1WY7A 2A59A 4L0MA 4RELA 3SZOA 2XCOA 3B2EA 2R6ZA 1S3GA 2X8AA 3QUCA 4YRBA 5ALTA 3L4EA 1YRWA 3NP7A 2H9AA 4K46A 1NVUQ 1AUXA 1KXJA 1VHQA 2I3AA 3KCQA 4D8XA 3LC0A 4CQNA 2X19A 4IMIB 2WWYA 2EL7A 4OG2A 2OGZA 4EGAA 1P6QA 1UFRA 4INAA 3T6KA 2FPMA 1RKUA 4RY0A 3MTIA 4NARA 4MVJF 2L19A 1M3SA 2JBAB 3Q0TA 5JSUA 1V4VA 3UHOA 1NVXQ 2HWYA 5DH9A 4DAEA 1OFHA 4BO5A 3ICOA 2VBGA 2CVPA 5LU9A 3GVHA 3EJWA 2FV8A 3LBYA 1YR1A 4WKCA 5A3VA 1SBQA 3FWPA 4MS3A 1B2RA 4XD7A 3PGXA 4IR7A 2QRZA 3SYTA 5FBVB 5ALHA 4CL2A 5IK2D 3UGJA 4OLFA 3EYWA 4RIGA 1BD4A 4ZC1A 3A9VA 5TPZA 3W6PA 3MS4A 1E2KA 4AJHA 1JR6A 1DX4A 2WUDA 1CJTC 5BV1A 2QNIA 1O5TA 1RXYA 3IV9A 3L02A 4LC0A 4M53A 5DE3A 4QLAA 2VHYA 3WAJA 1LW6E 1OQAA 2J0EA 3IAXA 4EELA 3LA8A 5LA6B 5EKSA 1OX6A 1VLVA 1ODCA 3LY8A 5AI5A 4ECAA 4QRDA 2IBTA 2ZJZA 4AZ0B 5JTTA 3L0IB 2VO1A 5E0OA 3RJ9A 2PZGA 1EDOA 1MD9A 1PNTA 2H1VA 3I30X 5G4LA 1H1LA 4D6YA 5LIPA 3ZHBA 5LQKA 4DGSA 4FBLA 3OJCA 3EXHA 2JZCA 2P0YA 4QNMA 3NHPA 1MBZA 1W47A 4MGYR 3GC6A 3QEMA 4KV9A 3E9NA 4LCBA 1BXGA 4Y6QA 2W2TA 1UDAA 4ILEA 1GT6A 2BKEA 2EEPA 3C3WA 3CKLA 4GOJA 4W1PA 3CG4A 4JUIA 1FJXA 2XDQA 2FLKA 2G36A 3JZAA 3LRXA 3TLEA 5JNLA 2XKKA 1I6LA 3P26A 5K3CA 3U81A 1G291 3EQ7A 3VR1A 3ZTWA 2Z98A 2QQ0A 5K6TA 1G3IA 5DB4A 3T3DA 4JLUA 5KVCA 3V2IA 4G1BA 2ZCJA 1DXOA 3MJRA 4HX9A 3INYA 3T5DA 3KQSA 3T9AA 4LJ9A 3QENA 4BCBA 4FEYA 2CVFA 4AWXA 3BH7A 2AF3C 5TS3A 3C5VA 3IP8A 3EDYA 4LXUA 4RXTA 5JMOA 4OBXA 1G5FA 1I80A 1D0SA 2W6PA 3N5KA 4MUYA 3CVXA 4CMHA 4AXXA 4LHXA 3HCFA 2Z2JA 1N2BA 2YV1A 3E58A 4DSZA 3SLKA 3HK2A 2X0KA 3PF9A 2OO5A 3AETB 2MYUA 3KZMA 5G40A 1AV6A 1CUGA 1T5LA 4X41A 4Q9AA 2HCTA 2YRFA 3IAUA 4A8JC 1AGNA 1EM8A 4WK6A 3YASA 2AFHA 4Y18A 4MW9A 3BGWA 3Q0EA 4KN9S 5HSGA 2PLWA 1RADA 4Q00A 3FSGA 1LGYA 1UQUA 4DCTA 3H4TA 5HIAA 1YJ8A 2FGJA 3GGDA 4B3FX 4IDHA 4CKCB 1CP3A 1QFXA 1VMIA 2Q2NA 5IXSA 2RGDA 4ARUA 1G7RA 2QUHA 4J0JA 3WLSA 1H9CA 2F43A 3AI2A 1DO0A 4I4TF 1WZNA 2IHZA 2UUPA 2XNJA 1WMAA 3AR7A 3BZUA 3LY9A 3TD9A 4DHWA 4F1JA 4N7BA 3I2GA 1E6EA 2AF4C 3JQGA 4P93A 4TWBA 5CUQA 3M1LA 5K8TA 5CAEA 5AUOB 3COPA 4IIUA 5JXHA 4DIEA 2GA8A 4YJ2B 4TLEA 2CXHA 5KVAA 2NU9A 3DGEC 1V7PC 1S8AA 2QTMA 5HK8A 5CXUA 3C0KA 3KUUA 1XCJA 5ALKA 4EDFA 1XJCA 4GVPA 2OWEA 3KKLA 3CE6A 1RYZA 3HV0A 2K2WA 3K5IA 4XDYA 3PGMA 4X3CA 3FNFA 1P18A 2X9VA 2EG5A 4RENA 5A62A 2IXFA 1JQ3A 3ZCQA 1GGJA 1NXSA 4UCXA 4BRSA 2UZ0A 4KXNA 4LE0A 2IX3A 2HIGA 1K7XB 1OXBB 3KP1A 2POQX 2W8ZA 3LF2A 4FHZA 4KRYA 1WJGA 2EFJA 3B1WA 2ZYWX 2BAGA 2ZROA 3BB1A 1RJDA 1PG2A 4IUBS 5E3IA 3UOAB 1W581 2FETA 3ORYA 3CX8A 1RPTA 5HE8A 3M5WA 2GAOA 1CUSA 3FLAA 1E0KA 2QTTA 1EP1B 5IT5A 1C30B 4EYKA 5ULLA 2I6XA 4HRYA 5CVJA 3T8YA 1F0KA 1U9CA 1YO6A 4GM0A 2OENG 4ESVA 4MYUA 2PWPA 2A0UA 1K3UB 4NDZA 3CH6A 2GQ0A 5IAKA 3CIOA 1V47A 4MR7A 2ALJA 3RTDA 3P9SA 4PPFA 3I5YA 3THXB 1XXLA 1QRSA 3ZDCA 2IHBA 1BMQA 1U7PA 1KGSA 2JRLA 2VQ6A 2WHEA 3UKJA 4OB6A 2ZT7A 1RPAA 2OMKA 1AY0A 2MHCA 3ICWA 5A1TA 2WLSA 4OJKA 1JZQA 1TM1E 3ME5A 3N0WA 1Z8NA 1UPUA 3NBUA 4RTPA 4B73A 4G0XA 3LLUA 4MJLA 1E2UA 3WWCA 1JWLA 4FS3A 2E5WA 2YWRA 4KWCA 1X1SA 5TMEA 3HWSA 4D5EA 3UY4A 1C3OA 1G5HA 2JCSA 1UZNA 3ESZA 4YB8A 3CVUA 1A04A 1TA9A 1UBJS 1A72A 3A36A 3IURA 2QL5A 3R6GA 1P8AA 4EVIA 4YRFA 2NMVA 4H1VA 1D04A 3RS7A 2PY6A 1X6VA 2FSVA 3IVXA 4IIFA 4PYNA 4ERXA 2DWQA 3DE6X 1KP3A 1DRKA 4Y1GA 2IODA 1G8PA 3PFGA 3H1FA 5LQMA 5CDYA 1QBGA 1U5BA 4K9OA 2QZJA 3PZRA 1TM7E 3M3PA 5BR1A 4G2TA 2VJQA 2H11A 3DWGA 4MMYB 1QFSA 1RQNA 4N0MA 4IX1A 2COUA 3STTA 1ZGGA 2O6LA 1EGAA 1M34E 4ZDWA 1E9VA 2MYPA 1XZLA 1RJ9A 1EFTA 1YS7A 2JFBA 2VHXA 3OSZA 4WN3A 1BEUB 4ZT7A 2E0IA 3CRVA 1V1RB 1V9SA 3FSGD 3GRCA 4NQRA 4RVUA 1ILWA 1QNLA 4X3OA 4EF5A 2VT7A 2XKAA 4RETA 2CBXA 3KLMX 2EF1A 5MHTA 2UAGA 4JR1A 2NXEA 2C77A 1CR1A 3HS3A 2HPHA 1J2UA 2O06A 3AILA 1EKXA 2QN1A 4K9DA 1QE5A 2TMGA 2YOHA 1NKSA 3M4NA 3UMMA 1L7VC 2FAXA 4IILA 4RPLA 2AW3A 1MTOA 3EYAA 1KVRA 3DAFA 2VJPA 2QR5A 3BH6A 5JNSA 4RLFA 4BEVA 2XYVA 4P4LA 4DCMA 1FVOA 3EWSA 4FN5A 4YONB 1NRXA 2VPPA 4XD7D 2VWGA 3CLTD 2GRUA 1EK6A 2Y0BA 4N7MA 2Q6TA 3QOXA 1VLHA 1F8YA 2H4ZA 2BR3A 2WNIA 4C2BA 4CMEC 4TL8A 4YLYA 2CLDX 4CIWA 4R7ZA 1X7XB 4RHTA 4REMA 2NSHA 1TLLA 4F2GA 1DHRA 3E1SA 3SS9X 3NWEA 5IC4A 4BOYA 3KKQA 1BN7A 5COBA 2F9MA 3FB1A 1C0EA 4MYTA 2HJHA 3NC4A 5E2BA 2OGSA 4BQRA 4BP3A 3FF1A 2N75A 1N7JA 1N2XA 3OO0A 1IN5A 3A6HA 3FW1A 3T7CA 1WXQA 1BEZA 3UJPA 4DDUA 1X7WA 2K2QB 5LYJB 3QBJA 4LF4B 2X9LA 1DBIA 2O2XA 4BAUA 4JKYA 2EX0A 2XEXA