1Z00B

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00B00
2FMPA 5BOLA 2FMQA 5KFSA 5IINA 4O3SA 4DQRA 4TQRA 1TK5A 9ICBA 3M9NB 1A76A 2W9BB 5J2IA 4M9LA 4O3PA 1NJYA 4F2RA 1KRPA 4F4ZA 3GDXA 4GC6A 4ELVA 4RNOA 2NRWA 7ICOA 4IR9A 3SV4A 1T7PA 1IXRA 2NRZA 1JXEA 3RJEA 3H8JA 3AU6A 4ED8A 2HVHA 2ZUBA 1S0MA 3OGUA 5J0PA 4F5NA 2AQ4A 5KFQA 1UA0A 4GC7A 4YQWA 8ICVA 4YD2A 4F5PA 1JMSA 1ZQVA 3C21A 3Q8KA 4CCHA 5KTQA 4O3NA 3PR4A 3EZ5A 1X2IA 2RDJA 5KFTA 1QSSA 3QZ7A 2MUTA 1RXVA 5DLGA 4KLUA 3SYZA 4MEYA 4YMNA 2ZUCA 2BQRA 5KFXA 1JXLA 8ICPA 4DO9A 8ICKA 2IMWP 4K4IA 4JV0A 4FBUA 5DKWA 4FS1A 1X9MA 3ZDBA 2ZUDA 5J0SA 3GIMA 4ECRA 3MR6A 1SZPA 1XU4A 4DS5A 4BXOA 4Q45A 4KLDA 4KLFA 3C23A 4I2IA 5J2HA 3T5LA 3RB4A 5J2JA 3AUOA 4DQQA 4QZIA 2PFOA 5HHHA 1NK8A 4YMOA 5DG7A 5J0TA 3RH6A 1S0VA 5CP2A 1NK9A 2MUTB 5D4BA 3GQCA 3V6HA 1H38A 2FMSA 5KFPA 4QZGA 1L3TA 8ICAA 5KT3A 3SV3A 3ZD8A 5KFDA 1D9FA 4IQVA 5J0WA 4DS4A 4RUCA 4QZ8A 3PW2A 3V72A 4RUAA 3UXNA 5J2KA 2AJQA 8ICIA 2JEIA 3ETLA 3B0XA 5HMLA 3V6KA 1NJXA 4BXOB 2HHTA 1TFRA 5KFYA 4QZCA 2Y1IA 3PW4A 1JN3A 2XC9A 5J2BA 4F4WA 4MFAA 4YN4A 4PGXA 2Q0ZX 1U4BA 5KFFA 5L9XA 5F9LA 3RH5A 2ZJAA 3T5JA 4EEYA 4NLZA 9ICRA 4G3IA 5KFMA 5DB9A 3MDCA 4O5KA 4YP3A 3SI8A 1RXWA 4YD1A 8ICNA 2UVRA 4PHAA 1TKDA 3OSNA 2R8GA 4DFJA 2PI5A 4KLTA 1BVSA 3H7IA 5HNKA 5KFLA 2XO7A 3RR7A 3TI0A 4RT3A 3TFRA 4QZAA 2KZMA 1TAUA 4ECXA 4J9SA 3RB6A 3MDAA 3MR5A 2NRXA 7ICUA 3V7KA 3BJYA 2BKEA 4GXIA 8ICLA 2JZBA 2BCQA 1A77A 2W9CA 4RQ3A 2AU0A 1D8LA 4R66A 2ASLA 4IQUA 3K75D 4LZDA 1TAQA 5IILA 2ALZA 4O5CA 1ZQLA 4Z6FA 1SKSA 2PFNA 4M9NA 1L3UA 2BDPA 2HVIA 4KMUA 3BQ2A 8ICHA 1ZQXA 2GWSA 4M9HA 4EYIB 4PHDA 4ECSA 4ECTA 8ICBA 2BHNA 2HHUA 4C8NA 5J2EA 4F92B 1MC8A 5DDYA 5KG3A 4UAZA 2JEGA 4F4XA 4J9PA 2JZBB 8ICEA 2PXIA 2W9CB 4C8OA 3TAPA 2WTFA 5J0OA 4UB4A 4ECVA 1ZETA 3JPRA 8ICMA 2R8HA 4PPXA 4B9MA 4QZBA 4KLGA 4YCXA 3EWAA 5DGBA 5CA7A 9ICMA 2BPCA 2W9MA 2R8IA 4F4YA 4KLHA 2BQ3A 4ECZA 3RJJA 4YMMA 4UBBA 3NGDA 1S0NA 4K4GA 1B22A 2ZTCA 2XCPA 2HHQA 3Q8PB 1DOQA 1ZQWA 2ZTDA 4RPXA 3ZD9A 4ECUA 1QSLA 5J0YA 1QSYA 3PO4A 5HMMA 4RQ6A 1ZYQA 4I28A 1X9SA 5KT4A 4PGYA 1SL1A 1X9WA 2FLLA 3ISDA 3SZ2A 4O3QA 3UPQA 1XSLA 1ZQIA 7ICJA 4DLEA 8ICWA 4KITB 1K1QA 4P4PA 3MABA 3OSPA 2BCRA 4IRDA 1HJPA 3RJHA 4J9KA 4R8UA 4RQ0A 5DLFA 4QZEA 4PH5A 3QEBZ 3HW8A 4ED0A 2ZJ5A 2Y1JA 3JPSA 2JEJA 3GV7B 2BQUA 4RQ1A 1ZQYA 3GFKB 4ZH4A 3C2LA 3M9MB 4DSFA 3RJGA 3Q8RB 4NM2A 2IHMA 5HHIA 2PFPA 2BGWA 1KEJA 2FPMA 3FYHA 1TV9A 4KLEA 4DSEA 5J2DA 2F1HA 4I2FA 2KN7A 4LZGA 1CEZA 3KHLA 1JX4A 5D46A 3UQ0A 2OWOA 4J9RA 5KG5A 1TK0A 4ED1A 7ICIA 3TANA 4B9TA 3BQ0A 4YXJA 4QZDA 2A1JA 3TAQA 1ZJMA 4RPZA 3ZDCA 3H4BA 1NK5A 4BWMA 3QZ8A 5DQGA 2IA6A 4DSIA 3GILA 4RPYA 9ICEA 2ZTEA 5DB6A 4DFKA 5IIOA 4J9QA 5IIKA 2C2DA 1QLNA 3LWMA 7ICGA 4F2SA 1XWLA 4RQ7A 4KLOA 4B9VA 3PMLA 4ED3A 5F9NA 3T5KA 3T3FA 3THVA 1S97A 9ICLA 4B9NA 4MF2A 3EW9A 3PO5A 2AGPA 3TARA 1U9LA 1ZQTA 4NM1A 4GXKA 1NK6A 4M9JA 8ICSA 2A1JB 5KT2A 1SL2A 2W8KA 1SKWA 5IIIA 4KLMA 2P6UA 7ICTA 4RQ5A 1IM4A 1ZQPA 3LDAA 4RZRA 9ICXA 1NKCA 3RTVA 3Q8LA 7ICFA 3FDSA 3H8WA 3NTUA 1XSPA 5KFVA 1ZQOA 2R8JA 9ICJA 3QE9Y 1KFTA 4ECYA 2VA3A 3RBDA 4IR1A 2UVUA 5KFUA 5DBCA 3UQ2A 1UA1A 3GIJA 7ICLA 7ICRA 5CWRA 3OJSA 5DQHA 5KFNA 3G6XA 4UB3A 4M04A 4KN4A 3ISBA 5KFKA 3OJUA 1Y88A 2KZZA 3RR8A 3LK9A 4DFPA 2V4QA 2BCSA 3PX0A 3H4DA 3V6JA 2BCVA 1CUKA 4F91B 1KDHA 9ICTA 1NK7A 4PHPA 3T5HA 1KSPA 2PFQA 4KLSA 3M9OB 3ISCA 5J29A 4LVSA 5KFAA 3MR3A 1HUOA 1ZQRA 7ICQA 3Q8SB 3HWTA 5EWFA 2HHVA 2KFNA 3B0YA 5DQIA 7ICPA 5HP4A 5DDMA 4J9LA 9ICPA 2FLPA 3GIIA 3GV8B 4DLGA 2VANA 3RJIA 3MR2A 2MAXA 3EPIA 1PZNA 2W8LA 1BPEA 4XUSA 4ED2A 3PX6A 3KHHA 1EXNA 4IQTA 4J9MA 3JPNA 4BGDA 4B9UA 4DEZA 4F50A 1S0OA 4ED7A 4KLIA 1TK8A 1K1SA 5J0QA 4DL7A 5KFGA 5J2AA 8ICQA 4O5EA 1U47A 4JWNA 1ZQJA 4TURA 4DL3A 1NK0A 1L3VA 1ZQBA 2FPLA 3PX4A 2C2EA 1DGSA 3QEAZ 1AROP 7ICVA 4Q8FA 3C2KA 4DL2A 4JWMA 4EBDA 4IRKA 2ASJA 4NLGA 2UVVA 3N97B 1BPXA 3BDPA 4J9NA 4DL5A 4DL6A 3G6YA 3RH4A 1U49A 3ZDDA 4F3OA 4RT2A 2R8KA 4DL4A 9ICQA 2BR0A 4QW8A 2XGQA 4Q43A 1Z3EB 5KG7A 4DF4A 1N56A 2AGQA 4NXZA 2XY5A 5KT5A 4DFMA 4HYKA 1D9DA 4UAWA 1QTMA 2DPIA 4I27A 9ICSA 4PGQA 4UBCA 5KFWA 5KG0A 4I29A 1WCNA 4UQGA 4Z6EA 4J9OA 3Q8MA 1L5UA 4UAYA 3V7LA 3TQ1A 1ZQDA 4C8LA 2ISPA 2HW3A 1ZQZA 4JV2A 4BDPA 4YFKA 2J6TA 1XO1A 4EZ6A 2KFZA 5J0RA 4DOCA 5TZVA 1KTQA 2J6SA 2P6RA 2F1JA 1NJWA 2ASDA 4RU9A 1U45A 4DWIA 1ZQGA 5CJ7A 4M6WA 4QWAA 3KHGA 1S10A 9ICHA 4DF8A 3HT3A 7ICMA 2NRTA 4TUPA 1NOMA 4O3OA 3C2MA 4MFCA 5J0XA 4DQPA 3PW5A 1T8EA 3M8SA 4MFFA 1Z00A 3RB3A 1S77D 5KFEA 1MQ3A 4DOBA 4DSKA 2I9GA 4R65A 1ZQSA 4M2YA 5J2FA 4YR3A 3PMNA 3PNCA 9ICOA 1BPBA 4ECQA 9ICGA 3C1YA 1LB2B 5KG4A 1XC9A 4F8RA 1MQ2A 3ORYA 4P4OA 5J0UA 1BGXT 3IM1A 4R8UB 5JUMA 3UXPA 4M6WB 4I2AA 4I2BA 4RQ4A 4XRHA 1TVAA 1ZQCA 8ICFA 3C5GA 4E0DA 2P66A 3HP6A 1ZQKA 4ELTA 5IIMA 1UT5A 3TFSA 1ZQMA 3EYZA 1Z00B 2F1IA 4QWCA 4DQSA 4RNMA 4M0AA 5EWEA 2HHSA 9ICVA 1S76D 4R64A 2C2RA 1ZQAA 2M9NA 9ICCA 1T4GA 2LYHA 5DB7A 2I1QA 3BQ1A 2J6UA 1NJZA 3PW7A 2UVWA 4I2JA 4QZHA 4QZFA 2H5XA 4FBTA 8ICJA 4DOAA 4XA5A 4ED6A 1V9PA 3MFIA 2NRVA 3PW0A 5L1IA 8ICTA 3RAQA 4B9LA 4M9GA 4EYHB 2V4RA 4Q8EA 4F5RA 1XS9D 3OHBA 2BPFA 4B9SA 4I2GA 8ICGA 4YXMA 2XCAA 3PV8A 4IRCA 4GLXA 4X5VA 3JPPA 1RZTA 1T3NA 2KZ3A 7ICNA 5J2CA 1D8YA 3UXOA 1JIHA 3RAXA 1ZQNA 2HHXA 2BPGA 4K4HA 9ICNA 4JUZA 4MEXA 3RJFA 4F93B 1KFSA 5DGAA 5KG1A 4ECWA 4KLLA 4DQIA 4I2EA 5KT7A 2AQ0A 3KHRA 5DB8A 5KFCA 4YR0A 4KN7A 3OHAA 5DG9A 3Q8QB 9ICKA 4YG2A 2DFLA 4QWEA 1HUZA 1ZJNA 1ZQQA 3JPQA 1ZQHA 4BWJA 3H40A 3K4GA 9ICIA 5CHGA 2C28A 4MF8A 3MGHA 3G6VA 3RRHA 2AGOA 1LV5A 2B21A 3BQTA 5CR0A 3GIKA 1ZQFA 3AU2A 2ISOA 3RJKA 3MGIA 1SL0A 5L1LA 4UB2A 4C8MA 1WCLA 4PHEA 5D49A 3C5FA 5KFHA 5L1JA 2IBKA 3RBEA 3M8RA 1KLNA 5KFBA 3IHQB 1RPLA 3EPGA 5DG8A 4QW9A 1RYRA 4XQ8A 1BPZA 3HX0A 3RRGA 4KLQA 7ICHA 5C5JA 1N48A 8ICZA 4KLJA 2XGPA 4RQ2A 2W9AA 1UT8A 1U48A 4P2HA 3E2EA 3H8SA 5KFZA 1MSWD 5KFOA 4F4KA 2FLNA 5BPCA 1ZQUA 4C8KA 2PI4A 8ICOA 5KFIA 4Z6CA 4I2CA 5KG2A 4NLKA 3KTQA 9ICUA 3PR5B 1BPYA 2C22A 4IQWA 4EBCA 4TUSA 3JPOA 7ICKA 4QZ9A 5EWGA 2JEFA 9ICFA 4NY8A 7ICEA 4DSJA 1BPDA 4F5OA 4RNNA 1SKRA 3LWLA 1NKEA 4Q44A 4YVZA 1COOA 5KFJA 1RYSA 8ICUA 3C1ZA 4UB5A 4TUQA 1NKBA 1C7YA 4FS2A 2KTQA 4ELUA 4QWDA 4F5QA 2IHNA 8ICRA 2HHWA 3HPOA 5DBBA 8ICYA 4Z6DA 2BCUA 4I2DA 1B43A 5KFRA 3ZDEA 1XSNA 1KFDA 3RB0A 4EBEA 4O9MA 3MFHA 4JV1A 2RDIA 1L3SA 4O0IA 2XY7A 7ICSA 1ZQEA 4GXJA 4DSLA 2ATLA 3N4MB 5DBAA 5BOMA 2W9BA 3V7JA 3MBYA 5IIJA 4UB1A 5J2GA 3PVXA 4KTQA 5KG6A 4EZ9A 2VA2A 4O3RA 9ICAA 3JPTA 2ZJ8A 9ICWA 4TQSA 3PY8A 8ICXA 4JK1A 3ZDAA 2XY6A 4NLNA 4QWBA 4FO6A 4YR2A 2V9WA 2FPKA 5KT6A 4RQ8A 4R63A 8ICCA 2VA8A 5EOZA 4P4MA 5L1KA 3GV5B 4I2HA 1NK4A 1S9FA 2DPJA 5CB1A 4M47A
chains in the Genus database with same CATH superfamily
3NRWA 2FMQA 2YMLA 5IINA 4Y2VA 3M9NB 5J2IA 2QKQA 4M9LA 4O3PA 4EX6A 3SV4A 1JXEA 4UB8U 2LYBA 2ZUBA 5AI0A 3Q8KA 1NNLA 2XI9A 5KFTA 2MUTA 2F3NA 2ES6A 3N7SC 4MEYA 4YMNA 8ICKA 2EAMA 5AKGA 3WKEA 2ZUDA 3QNMA 3QX7A 5HHHA 4OJPA 1N60A 5J0TA 3QUCA 2FMSA 2WF6A 4LJXA 3I76A 5KFDA 4QZ8A 3AQFA 4U7CA 1HIWA 3B0XA 3V6KA 5KFYA 5TISU 4GIBA 4EX7A 4DFDA 5KFFA 4NLZA 2F76X 5KFMA 3EUB2 5DB9A 2DWQA 3FC4A 4O5KA 2KHVA 4UAVA 2UVRA 1A6SA 3OSNA 1O03A 1BVSA 2YY6A 3RR7A 4RT3A 1SXDA 2RQ5A 1TAUA 4J9SA 2NRXA 3V7KA 3BJYA 2BKEA 2ZIXB 8ICLA 4C0ZA 4RQ3A 1D8LA 2VJ4A 4IQUA 3K75D 1KN5A 1ZQLA 4IL6U 2HVIA 2IOHA 8ICHA 2GWSA 2GO7A 8ICBA 1PK3A 3OPXA 2KE7A 3TAPA 2WTFA 5J0OA 1SIJA 1V97A 4QZBA 3EWAA 3QU7A 5CA7A 1QH9A 2R8IA 4F4YA 4UBBA 3NGDA 2HHQA 1DOQA 1ZQWA 2WHEA 2ZTDA 1QSYA 1BNOA 4Y2TA 5EE0A 1X9SA 5KT4A 2W55A 5EE9A 3SZ2A 1X9WA 4O3QA 3I28A 2WAQC 3UPQA 7ICJA 1J2MA 2W7OA 2YX8A 5J8YC 3RJHA 1PVRA 3N28A 4PZNA 2F8LA 4ED0A 2JEJA 3GV7B 2BQUA 3E58A 1HEKA 4Y2RA 3C2LA 2DL0A 2FE9A 2N1RA 1KEJA 2FPMA 5J2DA 2F1HA 4LZGA 3KHLA 5D46A 2OWOA 2YMPA 2HI0A 3BQ0A 4YXJA 2A1JA 3TAQA 3M1YA 4P0PA 2WF5A 1NK5A 2YN4A 2K4HA 2C2DA 1N5WA 7ICGA 4EELA 2M0NA 1YZ7A 4KLOA 5ALYA 3PMLA 3T5KA 3T3FA 1NZBA 3EW9A 2AGPA 3M6KA 3TARA 2H3QA 8ICSA 1SKWA 2P6UA 2WB1C 1Z1VA 1NKCA 3I1YA 2ODGA 3H8WA 3NTUA 3BQ7A 3QE9Y 2VA3A 2NO5A 2IOFK 2LI6A 3F5AA 5KFNA 5KFKA 1Y88A 5ALKA 2DGZA 1KDHA 3GU3A 4PHPA 1KSPA 4KLSA 5F3XB 5ALQA 5KFAA 3MR3A 1HUOA 3Q8SB 5L1MA 2KFNA 3BS7A 2FLPA 3GV8B 5ALTA 1PZNA 2W8LA 4C4TA 4IS7A 2WF8A 1LKYB 3RFAA 1TK8A 2HBJA 2KVSA 4DL7A 3SMVA 4OJ5A 1NK0A 5AM3A 2HOQA 2FPLA 3PX4A 3QEAZ 1AROP 7ICVA 1RYUA 4G9BA 1BPXA 3G6YA 3ZDDA 4F3OA 4RT2A 2KVCA 4Q43A 1Z3EB 4BUGA 5KG7A 3T79A 1N56A 3LVWA 4DFMA 2MA1A 3A0BU 9ICSA 4PGQA 2GLEA 1WWVA 1L5UA 2OEHA 4ACOA 3Q8MA 1ECWA 1ZQDA 3QYPA 1C20A 3ED5A 3DEEA 5KNIA 2OYYA 4EENA 2KFZA 3K1ZA 4DOCA 1KTQA 1NJWA 2ASDA 1ZQGA 3KHGA 1S10A 4MFCA 4DQPA 1T8EA 2LM1A 4DOBA 4DSKA 5J2FA 9ICOA 1VJ5A 3C1YA 1NZPA 1LB2B 1QQ6A 1MQ2A 2OXOA 2NV3A 3ORYA 5J0UA 5KL1B 1TVAA 3C5GA 3ONNA 1UT5A 3TFSA 2MRLA 3WKBA 4R64A 3TADA 5DB7A 4NL9A 2QB0B 4I2JA 2H5XA 8ICJA 4ED6A 2Z7JA 1DK3A 2NRVA 2WAQF 4US9A 8ICTA 3RAQA 4F5RA 4I2GA 2EAPA 8ICGA 4YXMA 2XCAA 3NUQA 2EANA 3JPPA 1RZTA 1D8YA 5ALRA 1CRXA 2LYAA 1ZQNA 4AP9A 4MEXA 2FDRA 5AK5A 3RJFA 2WF9A 1KFSA 4KLLA 2K4PA 3KBBA 3Q8QB 4QWEA 4DCCA 1O08A 1ZQHA 1KW4A 2KEYA 4MF8A 3G6VA 3RRHA 5CR0A 3BQTA 3GIKA 3RJKA 5ALGA 3C5FA 4C80A 3M8RA 1KLNA 3IHQB 5ALUA 1RYRA 5DG8A 4QW9A 2E8NA 7ICHA 5C5JA 4KLJA 1KL9A 3H8SA 2WB1F 2FLNA 2PKEA 1ZQUA 5AIBA 8ICOA 5KFIA 1AQ6A 4IQWA 1SV0A 2XIDA 2VIXA 3H8MA 1ZRMA 1KBUA 4DSJA 1SKRA 3IP4B 4UATA 2PMZC 1RYSA 8ICUA 4TUQA 2KTQA 2OM6A 1Q3VA 2IHNA 2LBOA 5KFRA 1XSNA 1KFDA 3RB0A 2RDIA 5AKJA 3M7DA 7ICSA 1ZQEA 2ATLA 5G5GA 3MBYA 3H0LB 5IIJA 9ICWA 2XY6A 2RHFA 2JH1A 4QWBA 4RQ8A 5L1KA 7ICEA 5BOLA 5AHXA 4CF4A 9ICBA 2W9BB 4F2RA 4ELVA 4RNOA 1T7PA 1IXRA 2NRZA 2HBMA 2W3RA 3KKAC 3H8JA 1F5SA 2ZXHA 4ED8A 5J0PA 5A0LA 5JRTA 2AQ4A 2KNJA 1UA0A 4GC7A 3VC8A 2A1AA 1JRPA 1N63A 3WK7A 1QSSA 4EEKA 1RXVA 2EAOA 3SYZA 3ICXA 4Y2UA 2ZUCA 2YB1A 4K4IA 4FBUA 5DKWA 4P0QA 5J0SA 2VJ5A 1XU4A 4BXOA 5AKKA 4KLDA 3T5LA 5J2HA 4DQQA 4QZIA 3ETRA 4YMOA 1NK9A 2MUTB 3WKDA 2JXJA 5KFPA 5AK4A 1L3TA 8ICAA 2K60A 5KT3A 3ZD8A 1B0XA 1D9FA 5C0YA 1RQNA 3PW2A 1BNPA 2HOFA 1B4FA 3UXNA 1ZD5A 8ICIA 2JEIA 3ETLA 5HMLA 4QZCA 2JV3A 2D6FC 4MFAA 4PGXA 1F44A 5L9XA 3IN5A 3RH5A 4EEYA 2DUYA 3FAHA 1JUDA 4G3IA 3AQEA 3MDCA 3F53A 2B6GA 3H7IA 5KFLA 2XO7A 2E8MA 3TI0A 2AHOB 1PVPA 1JALA 5AM2A 3MDAA 2CPRA 3MR5A 1Z1BA 2BCQA 2AU0A 3HJEA 4RQMA 4PJ0U 4Z6FA 1SKSA 4M9HA 2XVTA 4EYIB 4ECTA 2BHNA 2HHUA 3LYSA 4F92B 1MC8A 5KG3A 3SAHA 4J9PA 2E8PA 2PXIA 3CW2C 4ECVA 1ZETA 4JMUA 2BPCA 4C4SA 2BQ3A 2A19A 1UCVA 3NS1A 3KD3A 1B22A 2E5SA 4ZOHC 4F71A 2KICA 4I28A 4PGYA 1SL1A 4KITB 1K1QA 3OSPA 3MABA 3H0MB 1UHUA 4J9KA 4J03A 2EZXA 2PMZF 4QZEA 3QEBZ 3HW8A 2Y1JA 1L8LA 4RQ1A 4DSFA 3Q8RB 5HHIA 3FYHA 1K5OA 4I2FA 1CEZA 3UQ0A 3WK4A 1V85A 5KG5A 1X6IA 1TK0A 2JR5A 7ICIA 4QZDA 1ZJMA 3PSPA 1XO0A 4BWMA 4RPYA 2ZTEA 5IIOA 5IIKA 1QLNA 4F2SA 1FO4A 9ICLA 4MF2A 2KKVA 4GXKA 4M9JA 2A1JB 2W8KA 4P0PB 1IM4A 1ZQPA 9ICXA 2A3VA 1ZQOA 2R8JA 4NJ8A 5KFVA 1XSPA 2KIVA 3RBDA 3TACB 1Q8KA 4KN4A 5HR6A 3OJUA 1Q46A 3PX0A 2G5HB 3KZIU 2FJ6A 2BCVA 2AXTU 4F91B 1NK7A 5GTHU 3T5HA 3D2QA 3ISCA 3L3FX 3B0YA 5DQIA 7ICPA 2K8CB 5HP4A 9ICPA 3GIIA 2VANA 4KX5A 1BPEA 4XUSA 3PX6A 1COKA 3QUQA 1GO3F 1EXNA 4IQTA 5E79U 3JPNA 4KLIA 1SGGA 1FEZA 5J2AA 4TURA 1L3VA 2HMXA 2C2EA 1DGSA 4Q8FA 3NVZA 4DL2A 4A8EA 4EBDA 5AIAA 5AI9A 4NLGA 3N97B 3BDPA 4J9NA 1U49A 1PUZA 5AI5A 3MGVA 9ICQA 1L6NA 4DF4A 1D9DA 3WKAA 1QTMA 3KZXA 3N7RC 5KG0A 4I29A 4J9OA 4UAYA 3TQ1A 2HW3A 3R9KA 2ISPA 4YFKA 4QJFB 2G0AA 3C28A 4EZ6A 2OH2A 1N2XA 2P6RA 4QWAA 4DF8A 1NOMA 4QNLA 4OJ6A 2KIWA 4MFFA 3M8SA 4AYBC 5ALMA 3RB3A 2KSOA 2I9GA 1ZQSA 3PNCA 2ZIVA 5AI6A 2YTUA 3SD7A 5AM5A 4F8RA 4P4OA 4R8UB 5JUMA 3UXPA 4I2BA 4RQ4A 1ZQCA 8ICFA 2E3TA 2EDUA 2P66A 3HP6A 1ZQKA 5IIMA 2W03A 2LPEA 4QWCA 4M0AA 3CNHA 2C2RA 1RM6C 3ALRA 1WWUA 3AN1A 4FBTA 4XA5A 4Y2YA 1ZOLA 2HDOA 3PW0A 4EYHB 1XS9D 3OHBA 2BPFA 1M6YA 1SWVA 2BDUA 3PV8A 4IRCA 4PL1A 5AKYA 3UXOA 3CRXA 2HHXA 2KP7A 4K4HA 4C7YA 1LVHA 4JUZA 2H3IA 4ECWA 3DDHA 4DQIA 3BZKA 2W3SA 2KJ9A 5KFCA 4YR0A 4KN7A 5DG9A 2DFLA 1ZJNA 5ALXA 3MGHA 2AGOA 1SWWA 3MGIA 2GH1A 3QU9A 3O0FA 4C8MA 4PHEA 3J81j 5L1JA 3U26A 3UM9A 3EPGA 4P2HA 1U48A 4QIWC 2W04A 5AKHA 4F4KA 3M6ZA 4C8KA 9ICUA 5B5EU 4NLKA 2C22A 3AL0B 5EWGA 9ICFA 2MU2A 2AH5A 4RNNA 1COOA 5KFJA 3C1ZA 4UB5A 1C7YA 4ELUA 3D2SA 4Z6DA 2W7PA 4EBEA 4O9MA 4CGZA 4O0IA 4ICAA 4GXJA 3N4MB 5DBAA 4O3RA 4UB1A 3TADC 1QCKA 5J2GA 2VA2A 2ZJ8A 8ICXA 4NL9C 5KT6A 5EOZA 1MN8A 1NK4A 4I2HA 1X6JA 5CB1A 3PZPA 4DQRA 4TQRA 1TK5A 4C7ZA 2BZFA 5HR7A 4O3MA 1KRPA 3S6JA 2LHTA 3IV6A 7ICOA 4IR9A 3RJEA 2EH9A 1DK2A 3QXGA 1MA7A 1YZ6A 1N5XA 1SB3C 5KFQA 8ICVA 2DKZA 4F5PA 1JMSA 1ZQVA 5AICA 4CCHA 4O3NA 3EZ5A 3WK5A 3QZ7A 3D6JA 8ICPA 2BQRA 5KFXA 2QARB 4DO9A 3PSFA 2EQYA 3ZDBA 4ECRA 4DS5A 4Q45A 4KLFA 3RB4A 3AUOA 4AYBF 5DG7A 2RRDA 1S0VA 2YMMA 5D4BA 2WF7A 3V6HA 3SENA 1SV0C 5H2FU 1S8OA 4RUCA 3V72A 4RUAA 4P0QB 1FIQA 2I5HA 5B66U 4BXOB 2HHTA 1TFRA 5KL8B 1F0MA 2Y1IA 3PW4A 1JN3A 2XC9A 5J2BA 4F4WA 1SXEA 4OJLA 1PVQA 2Q0ZX 1U4BA 2G07A 5AM0A 5F9LA 2ZJAA 9ICRA 2ZXIA 4YP3A 3SI8A 1RXWA 4YD1A 8ICNA 5ALHA 2R8GA 2PI5A 4DFJA 4KLTA 2W43A 1V38A 1PK1A 4QZAA 4ECXA 3RB6A 7ICUA 2QB1A 4GXIA 1XNSA 2JZBA 3F5EA 2W9CA 4R66A 4LZDA 1T94A 3WU2U 4HAIA 3SEIA 3ZI4A 2PFNA 4M9NA 2BDPA 3BS5A 4US8A 4MHVA 4ECSA 3QUBA 5J2EA 2HSZA 5DDYA 4UAZA 2JEGA 2KJ8A 8ICEA 5CRXA 4UB4A 4PPXA 1ED1A 2G06A 4KLGA 4YCXA 2W9MA 3NASA 3HKZC 2ZIUA 4KLHA 3RJJA 4OO1J 4QIWF 4K4GA 2ZTCA 3IG8A 4NWIA 2XCPA 3PO4A 4RPXA 3ZD9A 4ECUA 5J0YA 2H3VA 4RQ6A 3IDWA 1Z4OA 3NVYA 4RQNA 1OUQA 1WG8A 1ZQIA 4JB3A 2FLLA 1XSLA 4DLEA 2P35A 2KG5A 1HJPA 4PH5A 2VKQA 2ZJ5A 3L4PA 3JPSA 2I6XA 5EE1A 3GFKB 3M9MB 2PFPA 2BGWA 1Q3UA 4BX9C 1TV9A 4DSEA 1OW5A 1JX4A 2QB0A 5KAFU 3AEVA 3TANA 4B9TA 4NV0A 3ZDCA 1ZD2P 4RPZA 4U6PA 2R18A 3H4BA 5DQGA 3UMCA 4DFKA 1RDFA 2Q4TA 3LWMA 1XWLA 4RQ7A 1KQQA 2DF4B 5F9NA 1JI7A 4NM1A 5ALWA 1ZQTA 1ZQ1C 1NK6A 5KT2A 1SL2A 7ICTA 4UASA 3LDAA 4RZRA 3Q8LA 3SQIA 3GZFA 9ICJA 2K4EA 4ECYA 2O6KA 4IR1A 2UVUA 5KFUA 1WYGA 5DBCA 3GIJA 5CWRA 3OJSA 3G6XA 3ISBA 4BJQA 2OCEA 3RR8A 3LK9A 2B0CA 4DFPA 3QU2A 2BCSA 3VCBA 3H4DA 3V6JA 1CUKA 9ICTA 2CRXA 3M9OB 7ICQA 3HWTA 5ALOA 5T14A 4J9LA 3RJIA 3MR2A 3EPIA 3KHHA 4Y2XA 2JH7A 4B9UA 4DEZA 1S0OA 5AKEA 4ED7A 5J0QA 5KFGA 3D2NA 8ICQA 4O5EA 4JWNA 4DL3A 1ZQBA 2Y0SC 2YB4A 4JWMA 4IRKA 2UVVA 3RH4A 2R8KA 2XGQA 2AGQA 4NXZA 2XY5A 5KT5A 2DPIA 2FI1A 5KFWA 1WCNA 4UQGA 2KZZA 3V7LA 1ZQZA 3CYMA 4JV2A 4BDPA 2J6TA 3CP8A 1XO1A 5J0RA 2F77X 5TZVA 4RU9A 1U45A 4DWIA 2F8KA 5CJ7A 4M6WA 2KJ5A 3HT3A 7ICMA 2H3ZA 5AKIA 4TUPA 4O3OA 3C2MA 3PW5A 1Z00A 1S77D 5KFEA 4YR3A 1BPBA 5AI4A 5KG4A 2JMGA 4Y2JA 1BGXT 4I2AA 4OJOA 2KMDA 3HKZF 3KFUF 5EWEA 2KSOB 1ZQAA 1T4GA 3BQ1A 2J6UA 2I1QA 2NO4A 2ZIVB 4FZLA 4KX3A 1NJZA 3PW7A 4FZNA 4DOAA 3E0FA 3MFIA 4CE6A 5L1IA 4B9LA 4Y2PA 4M9GA 2V4RA 4B9SA 2WFAA 1RQLA 4USAA 1T3NA 2KV2A 1DGJA 1JIHA 3AM9A 2BPGA 1OXJA 1S5LU 4F93B 5KG1A 2QLTA 1KKXA 5KT7A 5DB8A 4YG2A 4BWJA 3H40A 9ICIA 5CHGA 2HCFA 2ISOA 1ZQFA 1UQVA 3AU2A 5L1LA 1Z19A 4PZOA 1WCLA 2HOIA 3MC1A 5KFBA 1RPLA 4XQ8A 1BPZA 3HX0A 3RRGA 4KLQA 5ALLA 2XGPA 2CN1A 1UT8A 4NLBA 5KFZA 5KFOA 4I2CA 3JPOA 4QZ9A 2JEFA 2GOLA 2ZIWA 3F2CA 4F5OA 1NKEA 3HRDD 2YQEA 4YVZA 5ALVA 3HPOA 5DBBA 3F2DA 2BCUA 4I2DA 3ZDEA 3UMBA 3MFHA 1L3SA 5G5HA 3K1RB 4DSLA 3WK8A 5BOMA 3PSTA 4C4RA 3V7JA 4EZ9A 4F72A 5FP0A 3JPTA 3SAGA 4TQSA 4JK1A 1VDVA 4FO6A 4YR2A 2V9WA 2Y9UA 4R63A 2VA8A 3GV5B 1S9FA 2DPJA 4KMOB 2ESEA 2FMPA 5KFSA 4O3SA 1A76A 1NJYA 2Y0SF 3UMGA 4F4ZA 1IG6A 3GDXA 4GC6A 2NRWA 1JROA 3AU6A 5K4LA 2HVHA 1S0MA 1SV4A 3OGUA 1ZXIA 4F5NA 4CRXA 2LM4A 3PSIA 4YQWA 4YD2A 3C21A 5KTQA 2NYVA 3PR4A 1X2IA 2RDJA 3B9JA 5DLGA 4KLUA 5CEHA 1JXLA 4OD0A 2IMWP 4JV0A 2Y9TA 4FS1A 1X9MA 2D8CA 3GIMA 3MR6A 1SZPA 5J8YA 3C23A 4I2IA 2PFOA 1X40A 4CNQA 5J2JA 1NK8A 5AKLA 2RP5A 3RH6A 5CP2A 2F44A 3GQCA 1H38A 4QZGA 3WK9A 3SV3A 4CF3A 4IQVA 5J0WA 4DS4A 1DRGA 2G5IB 5EE3A 5J2KA 2AJQA 3QU4A 3WK6A 1NJXA 4PL2A 1UPHA 3L5KA 4YN4A 3T5JA 1IV8A 2ZIXA 2OHFA 4FE3A 2MSNA 3NRZA 5ALFA 4PHAA 1TKDA 5HNKA 5ALZA 3SAFA 3TFRA 4Y2QA 2KZMA 5ALPA 2L5YA 1P7DA 2DBYA 5JU5A 1A77A 2ASLA 5ALNA 5GTIU 1TAQA 3A0HU 5IILA 2ALZA 4O5CA 1PK1B 1L3UA 4KMUA 3BQ2A 1ZQXA 4PHDA 4C8NA 3IG5A 4F4XA 2JZBB 2W9CB 4C8OA 3JPRA 3F2BA 2R8HA 8ICMA 4B9MA 5DGBA 9ICMA 1J2NA 1D8BA 4UARA 2W54A 5AKXA 4ECZA 3BS5B 4YMMA 3NVWA 2YMQA 1L8OA 1S0NA 3AMZA 3Q8PB 1QSLA 4B9NA 1QQ7A 1N62A 5HMMA 1ZYQA 8ICZA 3ISDA 8ICWA 4P4PA 2BCRA 4IRDA 4R8UA 4RQ0A 1J97A 5DLFA 2ZIUB 5KAIU 1ZQYA 4ZH4A 2E8OA 3RJGA 4NM2A 2IHMA 4WJ3B 4KLEA 4CF5A 2KN7A 4J9RA 1RG6A 4ED1A 1FFVA 5AK3A 1CI4A 2IA6A 4DSIA 3QZ8A 3GILA 9ICEA 1L7NA 2F2AB 5DB6A 4J9QA 2DKXA 4B9VA 2D3DA 4ED3A 3THVA 1S97A 2KK0A 5JTIA 2EZZA 2LKYA 3PO5A 1U9LA 3C29A 5IIIA 4KLMA 3KOOA 4RQ5A 1SZHA 3RTVA 7ICFA 3FDSA 1KFTA 2K8AA 3QU5A 3UQ2A 7ICLA 1UA1A 7ICRA 1NI3A 5AK6A 5DQHA 4UB3A 4M04A 3BZCA 2V4QA 1X42A 4UB6U 1LKYA 4CDGA 1IIPA 2PFQA 4LVSA 3RF9A 5J29A 1ZQRA 5EWFA 2HHVA 5AM1A 5DDMA 4DLGA 2HBKA 4FFDA 4FZMA 2MAXA 4ED2A 4UW9A 2G09A 1FFUA 4J9MA 4BGDA 3WKCA 4F50A 1K1SA 2K4IA 1U47A 1ZQJA 3HILA 2K8BB 3C2KA 1T3QA 4Y2SA 2ASJA 3SR6A 4DL5A 4DL6A 4DL4A 2BR0A 4QW8A 2LMRA 4HYKA 4UAWA 4I27A 4UBCA 1A0PA 1WUDA 5ALJA 4Z6EA 4C8LA 5ALIA 2J6SA 2F1JA 4NLCA 1N61A 9ICHA 2HBLA 2KOBA 2NRTA 5J0XA 1TE2A 1L7OA 1MQ3A 3FM9A 2JGAA 3DV9A 4R65A 4M2YA 3PMNA 4ECQA 9ICGA 1XC9A 2JRZA 2ZG6A 3IM1A 4M6WB 1TAMA 4XRHA 2W11A 1ZD3A 4E0DA 2G08A 2QARA 4ELTA 1ZQMA 2CXYA 3EYZA 2JHDA 1Z00B 2F1IA 4DQSA 2HHSA 4RNMA 9ICVA 5ALDA 1S76D 2IOFA 2M9NA 9ICCA 2K89A 2LYHA 1QQ5A 2KHQA 2UVWA 4QZHA 4QZFA 1ZD4A 1V9PA 2E1EA 3OTQA 4IC9A 4Q8EA 4GLXA 4X5VA 2KZ3A 7ICNA 5J2CA 3RAXA 1X66A 9ICNA 2RLTA 3KKAA 5AKZA 5DGAA 4I2EA 2AQ0A 3NVVA 3KHRA 3OHAA 9ICKA 5ALEA 1HUZA 1ZQQA 4B6JA 3JPQA 3N7PD 3K4GA 2C28A 1LV5A 2B21A 2EZYA 4UAUA 1SL0A 4UB2A 3QUTA 3IRUA 2IBKA 2XICA 2KD1A 5D49A 1URJA 5KFHA 5AI8A 3RBEA 2H3FA 4OCZA 1YT3A 1N48A 4RQ2A 2W9AA 3LVVA 3E2EA 1MSWD 1ZRNA 5BPCA 2PI4A 4Z6CA 5KG2A 3KTQA 3PR5B 1BPYA 4EBCA 1X9XA 4TUSA 1L7PA 2KKPA 7ICKA 4NY8A 2DQNB 1BPDA 3LWLA 4Q44A 1NKBA 1VLBA 4FS2A 1L7MA 4QWDA 4F5QA 8ICRA 2HHWA 1Z4NA 8ICYA 3H0RB 3TKAA 5ALSA 1B43A 2E1FA 4JV1A 2ZIWB 2XY7A 2W9BA 5AM4A 3PVXA 4KTQA 5KG6A 9ICAA 3PY8A 3ZDAA 4NLNA 2FPKA 1DXSA 8ICCA 4P4MA 4GFJA 4M47A
chains in the Genus database with same CATH topology
2FMPA 5BOLA 2FMQA 5KFSA 5IINA 4O3SA 4DQRA 4TQRA 1TK5A 9ICBA 3M9NB 1A76A 2W9BB 5J2IA 4M9LA 4O3PA 1NJYA 4F2RA 1KRPA 4F4ZA 3GDXA 4GC6A 4ELVA 4RNOA 2NRWA 7ICOA 4IR9A 3SV4A 1T7PA 1IXRA 2NRZA 1JXEA 3RJEA 3H8JA 3AU6A 4ED8A 2HVHA 2ZUBA 1S0MA 3OGUA 5J0PA 4F5NA 2AQ4A 5KFQA 1UA0A 4GC7A 4YQWA 8ICVA 4YD2A 4F5PA 1JMSA 1ZQVA 3C21A 3Q8KA 4CCHA 5KTQA 4O3NA 3PR4A 3EZ5A 1X2IA 2RDJA 5KFTA 1QSSA 3QZ7A 2MUTA 1RXVA 5DLGA 4KLUA 3SYZA 4MEYA 4YMNA 2ZUCA 2BQRA 5KFXA 1JXLA 8ICPA 4DO9A 8ICKA 2IMWP 4K4IA 4JV0A 4FBUA 5DKWA 4FS1A 1X9MA 3ZDBA 2ZUDA 5J0SA 3GIMA 4ECRA 3MR6A 1SZPA 1XU4A 4DS5A 4BXOA 4Q45A 4KLDA 4KLFA 3C23A 4I2IA 5J2HA 3T5LA 3RB4A 5J2JA 3AUOA 4DQQA 4QZIA 2PFOA 5HHHA 1NK8A 4YMOA 5DG7A 5J0TA 3RH6A 1S0VA 5CP2A 1NK9A 2MUTB 5D4BA 3GQCA 3V6HA 1H38A 2FMSA 5KFPA 4QZGA 1L3TA 8ICAA 5KT3A 3SV3A 3ZD8A 5KFDA 1D9FA 4IQVA 5J0WA 4DS4A 4RUCA 4QZ8A 3PW2A 3V72A 4RUAA 3UXNA 5J2KA 2AJQA 8ICIA 2JEIA 3ETLA 3B0XA 5HMLA 3V6KA 1NJXA 4BXOB 2HHTA 1TFRA 5KFYA 4QZCA 2Y1IA 3PW4A 1JN3A 2XC9A 5J2BA 4F4WA 4MFAA 4YN4A 4PGXA 2Q0ZX 1U4BA 5KFFA 5L9XA 5F9LA 3RH5A 2ZJAA 3T5JA 4EEYA 4NLZA 9ICRA 4G3IA 5KFMA 5DB9A 3MDCA 4O5KA 4YP3A 3SI8A 1RXWA 4YD1A 8ICNA 2UVRA 4PHAA 1TKDA 3OSNA 2R8GA 4DFJA 2PI5A 4KLTA 1BVSA 3H7IA 5HNKA 5KFLA 2XO7A 3RR7A 3TI0A 4RT3A 3TFRA 4QZAA 2KZMA 1TAUA 4ECXA 4J9SA 3RB6A 3MDAA 3MR5A 2NRXA 7ICUA 3V7KA 3BJYA 2BKEA 4GXIA 8ICLA 2JZBA 2BCQA 1A77A 2W9CA 4RQ3A 2AU0A 1D8LA 4R66A 2ASLA 4IQUA 3K75D 4LZDA 1TAQA 5IILA 2ALZA 4O5CA 1ZQLA 4Z6FA 1SKSA 2PFNA 4M9NA 1L3UA 2BDPA 2HVIA 4KMUA 3BQ2A 8ICHA 1ZQXA 2GWSA 4M9HA 4EYIB 4PHDA 4ECSA 4ECTA 8ICBA 2BHNA 2HHUA 4C8NA 5J2EA 4F92B 1MC8A 5DDYA 5KG3A 4UAZA 2JEGA 4F4XA 4J9PA 2JZBB 8ICEA 2PXIA 2W9CB 4C8OA 3TAPA 2WTFA 5J0OA 4UB4A 4ECVA 1ZETA 3JPRA 8ICMA 2R8HA 4PPXA 4B9MA 4QZBA 4KLGA 4YCXA 3EWAA 5DGBA 5CA7A 9ICMA 2BPCA 2W9MA 2R8IA 4F4YA 4KLHA 2BQ3A 4ECZA 3RJJA 4YMMA 4UBBA 3NGDA 1S0NA 4K4GA 1B22A 2ZTCA 2XCPA 2HHQA 3Q8PB 1DOQA 1ZQWA 2ZTDA 4RPXA 3ZD9A 4ECUA 1QSLA 5J0YA 1QSYA 3PO4A 5HMMA 4RQ6A 1ZYQA 4I28A 1X9SA 5KT4A 4PGYA 1SL1A 1X9WA 2FLLA 3ISDA 3SZ2A 4O3QA 3UPQA 1XSLA 1ZQIA 7ICJA 4DLEA 8ICWA 4KITB 1K1QA 4P4PA 3MABA 3OSPA 2BCRA 4IRDA 1HJPA 3RJHA 4J9KA 4R8UA 4RQ0A 5DLFA 4QZEA 4PH5A 3QEBZ 3HW8A 4ED0A 2ZJ5A 2Y1JA 3JPSA 2JEJA 3GV7B 2BQUA 4RQ1A 1ZQYA 3GFKB 4ZH4A 3C2LA 3M9MB 4DSFA 3RJGA 3Q8RB 4NM2A 2IHMA 5HHIA 2PFPA 2BGWA 1KEJA 2FPMA 3FYHA 1TV9A 4KLEA 4DSEA 5J2DA 2F1HA 4I2FA 2KN7A 4LZGA 1CEZA 3KHLA 1JX4A 5D46A 3UQ0A 2OWOA 4J9RA 5KG5A 1TK0A 4ED1A 7ICIA 3TANA 4B9TA 3BQ0A 4YXJA 4QZDA 2A1JA 3TAQA 1ZJMA 4RPZA 3ZDCA 3H4BA 1NK5A 4BWMA 3QZ8A 5DQGA 2IA6A 4DSIA 3GILA 4RPYA 9ICEA 2ZTEA 5DB6A 4DFKA 5IIOA 4J9QA 5IIKA 2C2DA 1QLNA 3LWMA 7ICGA 4F2SA 1XWLA 4RQ7A 4KLOA 4B9VA 3PMLA 4ED3A 5F9NA 3T5KA 3T3FA 3THVA 1S97A 9ICLA 4B9NA 4MF2A 3EW9A 3PO5A 2AGPA 3TARA 1U9LA 1ZQTA 4NM1A 4GXKA 1NK6A 4M9JA 8ICSA 2A1JB 5KT2A 1SL2A 2W8KA 1SKWA 5IIIA 4KLMA 2P6UA 7ICTA 4RQ5A 1IM4A 1ZQPA 3LDAA 4RZRA 9ICXA 1NKCA 3RTVA 3Q8LA 7ICFA 3FDSA 3H8WA 3NTUA 1XSPA 5KFVA 1ZQOA 2R8JA 9ICJA 3QE9Y 1KFTA 4ECYA 2VA3A 3RBDA 4IR1A 2UVUA 5KFUA 5DBCA 3UQ2A 1UA1A 3GIJA 7ICLA 7ICRA 5CWRA 3OJSA 5DQHA 5KFNA 3G6XA 4UB3A 4M04A 4KN4A 3ISBA 5KFKA 3OJUA 1Y88A 2KZZA 3RR8A 3LK9A 4DFPA 2V4QA 2BCSA 3PX0A 3H4DA 3V6JA 2BCVA 1CUKA 4F91B 1KDHA 9ICTA 1NK7A 4PHPA 3T5HA 1KSPA 2PFQA 4KLSA 3M9OB 3ISCA 5J29A 4LVSA 5KFAA 3MR3A 1HUOA 1ZQRA 7ICQA 3Q8SB 3HWTA 5EWFA 2HHVA 2KFNA 3B0YA 5DQIA 7ICPA 5HP4A 5DDMA 4J9LA 9ICPA 2FLPA 3GIIA 3GV8B 4DLGA 2VANA 3RJIA 3MR2A 2MAXA 3EPIA 1PZNA 2W8LA 1BPEA 4XUSA 4ED2A 3PX6A 3KHHA 1EXNA 4IQTA 4J9MA 3JPNA 4BGDA 4B9UA 4DEZA 4F50A 1S0OA 4ED7A 4KLIA 1TK8A 1K1SA 5J0QA 4DL7A 5KFGA 5J2AA 8ICQA 4O5EA 1U47A 4JWNA 1ZQJA 4TURA 4DL3A 1NK0A 1L3VA 1ZQBA 2FPLA 3PX4A 2C2EA 1DGSA 3QEAZ 1AROP 7ICVA 4Q8FA 3C2KA 4DL2A 4JWMA 4EBDA 4IRKA 2ASJA 4NLGA 2UVVA 3N97B 1BPXA 3BDPA 4J9NA 4DL5A 4DL6A 3G6YA 3RH4A 1U49A 3ZDDA 4F3OA 4RT2A 2R8KA 4DL4A 9ICQA 2BR0A 4QW8A 2XGQA 4Q43A 1Z3EB 5KG7A 4DF4A 1N56A 2AGQA 4NXZA 2XY5A 5KT5A 4DFMA 4HYKA 1D9DA 4UAWA 1QTMA 2DPIA 4I27A 9ICSA 4PGQA 4UBCA 5KFWA 5KG0A 4I29A 1WCNA 4UQGA 4Z6EA 4J9OA 3Q8MA 1L5UA 4UAYA 3V7LA 3TQ1A 1ZQDA 4C8LA 2ISPA 2HW3A 1ZQZA 4JV2A 4BDPA 4YFKA 2J6TA 1XO1A 4EZ6A 2KFZA 5J0RA 4DOCA 5TZVA 1KTQA 2J6SA 2P6RA 2F1JA 1NJWA 2ASDA 4RU9A 1U45A 4DWIA 1ZQGA 5CJ7A 4M6WA 4QWAA 3KHGA 1S10A 9ICHA 4DF8A 3HT3A 7ICMA 2NRTA 4TUPA 1NOMA 4O3OA 3C2MA 4MFCA 5J0XA 4DQPA 3PW5A 1T8EA 3M8SA 4MFFA 1Z00A 3RB3A 1S77D 5KFEA 1MQ3A 4DOBA 4DSKA 2I9GA 4R65A 1ZQSA 4M2YA 5J2FA 4YR3A 3PMNA 3PNCA 9ICOA 1BPBA 4ECQA 9ICGA 3C1YA 1LB2B 5KG4A 1XC9A 4F8RA 1MQ2A 3ORYA 4P4OA 5J0UA 1BGXT 3IM1A 4R8UB 5JUMA 3UXPA 4M6WB 4I2AA 4I2BA 4RQ4A 4XRHA 1TVAA 1ZQCA 8ICFA 3C5GA 4E0DA 2P66A 3HP6A 1ZQKA 4ELTA 5IIMA 1UT5A 3TFSA 1ZQMA 3EYZA 1Z00B 2F1IA 4QWCA 4DQSA 4RNMA 4M0AA 5EWEA 2HHSA 9ICVA 1S76D 4R64A 2C2RA 1ZQAA 2M9NA 9ICCA 1T4GA 2LYHA 5DB7A 2I1QA 3BQ1A 2J6UA 1NJZA 3PW7A 2UVWA 4I2JA 4QZHA 4QZFA 2H5XA 4FBTA 8ICJA 4DOAA 4XA5A 4ED6A 1V9PA 3MFIA 2NRVA 3PW0A 5L1IA 8ICTA 3RAQA 4B9LA 4M9GA 4EYHB 2V4RA 4Q8EA 4F5RA 1XS9D 3OHBA 2BPFA 4B9SA 4I2GA 8ICGA 4YXMA 2XCAA 3PV8A 4IRCA 4GLXA 4X5VA 3JPPA 1RZTA 1T3NA 2KZ3A 7ICNA 5J2CA 1D8YA 3UXOA 1JIHA 3RAXA 1ZQNA 2HHXA 2BPGA 4K4HA 9ICNA 4JUZA 4MEXA 3RJFA 4F93B 1KFSA 5DGAA 5KG1A 4ECWA 4KLLA 4DQIA 4I2EA 5KT7A 2AQ0A 3KHRA 5DB8A 5KFCA 4YR0A 4KN7A 3OHAA 5DG9A 3Q8QB 9ICKA 4YG2A 2DFLA 4QWEA 1HUZA 1ZJNA 1ZQQA 3JPQA 1ZQHA 4BWJA 3H40A 3K4GA 9ICIA 5CHGA 2C28A 4MF8A 3MGHA 3G6VA 3RRHA 2AGOA 1LV5A 2B21A 3BQTA 5CR0A 3GIKA 1ZQFA 3AU2A 2ISOA 3RJKA 3MGIA 1SL0A 5L1LA 4UB2A 4C8MA 1WCLA 4PHEA 5D49A 3C5FA 5KFHA 5L1JA 2IBKA 3RBEA 3M8RA 1KLNA 5KFBA 3IHQB 1RPLA 3EPGA 5DG8A 4QW9A 1RYRA 4XQ8A 1BPZA 3HX0A 3RRGA 4KLQA 7ICHA 5C5JA 1N48A 8ICZA 4KLJA 2XGPA 4RQ2A 2W9AA 1UT8A 1U48A 4P2HA 3E2EA 3H8SA 5KFZA 1MSWD 5KFOA 4F4KA 2FLNA 5BPCA 1ZQUA 4C8KA 2PI4A 8ICOA 5KFIA 4Z6CA 4I2CA 5KG2A 4NLKA 3KTQA 9ICUA 3PR5B 1BPYA 2C22A 4IQWA 4EBCA 4TUSA 3JPOA 7ICKA 4QZ9A 5EWGA 2JEFA 9ICFA 4NY8A 7ICEA 4DSJA 1BPDA 4F5OA 4RNNA 1SKRA 3LWLA 1NKEA 4Q44A 4YVZA 1COOA 5KFJA 1RYSA 8ICUA 3C1ZA 4UB5A 4TUQA 1NKBA 1C7YA 4FS2A 2KTQA 4ELUA 4QWDA 4F5QA 2IHNA 8ICRA 2HHWA 3HPOA 5DBBA 8ICYA 4Z6DA 2BCUA 4I2DA 1B43A 5KFRA 3ZDEA 1XSNA 1KFDA 3RB0A 4EBEA 4O9MA 3MFHA 4JV1A 2RDIA 1L3SA 4O0IA 2XY7A 7ICSA 1ZQEA 4GXJA 4DSLA 2ATLA 3N4MB 5DBAA 5BOMA 2W9BA 3V7JA 3MBYA 5IIJA 4UB1A 5J2GA 3PVXA 4KTQA 5KG6A 4EZ9A 2VA2A 4O3RA 9ICAA 3JPTA 2ZJ8A 9ICWA 4TQSA 3PY8A 8ICXA 4JK1A 3ZDAA 2XY6A 4NLNA 4QWBA 4FO6A 4YR2A 2V9WA 2FPKA 5KT6A 4RQ8A 4R63A 8ICCA 2VA8A 5EOZA 4P4MA 5L1KA 3GV5B 4I2HA 1NK4A 1S9FA 2DPJA 5CB1A 4M47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMP A;  5BOL A;  2FMQ A;  5KFS A;  5IIN A;  4O3S A;  4DQR A;  4TQR A;  1TK5 A;  9ICB A;  3M9N B;  1A76 A;  2W9B B;  5J2I A;  4M9L A;  4O3P A;  1NJY A;  4F2R A;  1KRP A;  4F4Z A;  3GDX A;  4GC6 A;  4ELV A;  4RNO A;  2NRW A;  7ICO A;  4IR9 A;  3SV4 A;  1T7P A;  1IXR A;  2NRZ A;  1JXE A;  3RJE A;  3H8J A;  3AU6 A;  4ED8 A;  2HVH A;  2ZUB A;  1S0M A;  3OGU A;  5J0P A;  4F5N A;  2AQ4 A;  5KFQ A;  1UA0 A;  4GC7 A;  4YQW A;  8ICV A;  4YD2 A;  4F5P A;  1JMS A;  1ZQV A;  3C21 A;  3Q8K A;  4CCH A;  5KTQ A;  4O3N A;  3PR4 A;  3EZ5 A;  1X2I A;  2RDJ A;  5KFT A;  1QSS A;  3QZ7 A;  2MUT A;  1RXV A;  5DLG A;  4KLU A;  3SYZ A;  4MEY A;  4YMN A;  2ZUC A;  2BQR A;  5KFX A;  1JXL A;  8ICP A;  4DO9 A;  8ICK A;  2IMW P;  4K4I A;  4JV0 A;  4FBU A;  5DKW A;  4FS1 A;  1X9M A;  3ZDB A;  2ZUD A;  5J0S A;  3GIM A;  4ECR A;  3MR6 A;  1SZP A;  1XU4 A;  4DS5 A;  4BXO A;  4Q45 A;  4KLD A;  4KLF A;  3C23 A;  4I2I A;  5J2H A;  3T5L A;  3RB4 A;  5J2J A;  3AUO A;  4DQQ A;  4QZI A;  2PFO A;  5HHH A;  1NK8 A;  4YMO A;  5DG7 A;  5J0T A;  3RH6 A;  1S0V A;  5CP2 A;  1NK9 A;  2MUT B;  5D4B A;  3GQC A;  3V6H A;  1H38 A;  2FMS A;  5KFP A;  4QZG A;  1L3T A;  8ICA A;  5KT3 A;  3SV3 A;  3ZD8 A;  5KFD A;  1D9F A;  4IQV A;  5J0W A;  4DS4 A;  4RUC A;  4QZ8 A;  3PW2 A;  3V72 A;  4RUA A;  3UXN A;  5J2K A;  2AJQ A;  8ICI A;  2JEI A;  3ETL A;  3B0X A;  5HML A;  3V6K A;  1NJX A;  4BXO B;  2HHT A;  1TFR A;  5KFY A;  4QZC A;  2Y1I A;  3PW4 A;  1JN3 A;  2XC9 A;  5J2B A;  4F4W A;  4MFA A;  4YN4 A;  4PGX A;  2Q0Z X;  1U4B A;  5KFF A;  5L9X A;  5F9L A;  3RH5 A;  2ZJA A;  3T5J A;  4EEY A;  4NLZ A;  9ICR A;  4G3I A;  5KFM A;  5DB9 A;  3MDC A;  4O5K A;  4YP3 A;  3SI8 A;  1RXW A;  4YD1 A;  8ICN A;  2UVR A;  4PHA A;  1TKD A;  3OSN A;  2R8G A;  4DFJ A;  2PI5 A;  4KLT A;  1BVS A;  3H7I A;  5HNK A;  5KFL A;  2XO7 A;  3RR7 A;  3TI0 A;  4RT3 A;  3TFR A;  4QZA A;  2KZM A;  1TAU A;  4ECX A;  4J9S A;  3RB6 A;  3MDA A;  3MR5 A;  2NRX A;  7ICU A;  3V7K A;  3BJY A;  2BKE A;  4GXI A;  8ICL A;  2JZB A;  2BCQ A;  1A77 A;  2W9C A;  4RQ3 A;  2AU0 A;  1D8L A;  4R66 A;  2ASL A;  4IQU A;  3K75 D;  4LZD A;  1TAQ A;  5IIL A;  2ALZ A;  4O5C A;  1ZQL A;  4Z6F A;  1SKS A;  2PFN A;  4M9N A;  1L3U A;  2BDP A;  2HVI A;  4KMU A;  3BQ2 A;  8ICH A;  1ZQX A;  2GWS A;  4M9H A;  4EYI B;  4PHD A;  4ECS A;  4ECT A;  8ICB A;  2BHN A;  2HHU A;  4C8N A;  5J2E A;  4F92 B;  1MC8 A;  5DDY A;  5KG3 A;  4UAZ A;  2JEG A;  4F4X A;  4J9P A;  2JZB B;  8ICE A;  2PXI A;  2W9C B;  4C8O A;  3TAP A;  2WTF A;  5J0O A;  4UB4 A;  4ECV A;  1ZET A;  3JPR A;  8ICM A;  2R8H A;  4PPX A;  4B9M A;  4QZB A;  4KLG A;  4YCX A;  3EWA A;  5DGB A;  5CA7 A;  9ICM A;  2BPC A;  2W9M A;  2R8I A;  4F4Y A;  4KLH A;  2BQ3 A;  4ECZ A;  3RJJ A;  4YMM A;  4UBB A;  3NGD A;  1S0N A;  4K4G A;  1B22 A;  2ZTC A;  2XCP A;  2HHQ A;  3Q8P B;  1DOQ A;  1ZQW A;  2ZTD A;  4RPX A;  3ZD9 A;  4ECU A;  1QSL A;  5J0Y A;  1QSY A;  3PO4 A;  5HMM A;  4RQ6 A;  1ZYQ A;  4I28 A;  1X9S A;  5KT4 A;  4PGY A;  1SL1 A;  1X9W A;  2FLL A;  3ISD A;  3SZ2 A;  4O3Q A;  3UPQ A;  1XSL A;  1ZQI A;  7ICJ A;  4DLE A;  8ICW A;  4KIT B;  1K1Q A;  4P4P A;  3MAB A;  3OSP A;  2BCR A;  4IRD A;  1HJP A;  3RJH A;  4J9K A;  4R8U A;  4RQ0 A;  5DLF A;  4QZE A;  4PH5 A;  3QEB Z;  3HW8 A;  4ED0 A;  2ZJ5 A;  2Y1J A;  3JPS A;  2JEJ A;  3GV7 B;  2BQU A;  4RQ1 A;  1ZQY A;  3GFK B;  4ZH4 A;  3C2L A;  3M9M B;  4DSF A;  3RJG A;  3Q8R B;  4NM2 A;  2IHM A;  5HHI A;  2PFP A;  2BGW A;  1KEJ A;  2FPM A;  3FYH A;  1TV9 A;  4KLE A;  4DSE A;  5J2D A;  2F1H A;  4I2F A;  2KN7 A;  4LZG A;  1CEZ A;  3KHL A;  1JX4 A;  5D46 A;  3UQ0 A;  2OWO A;  4J9R A;  5KG5 A;  1TK0 A;  4ED1 A;  7ICI A;  3TAN A;  4B9T A;  3BQ0 A;  4YXJ A;  4QZD A;  2A1J A;  3TAQ A;  1ZJM A;  4RPZ A;  3ZDC A;  3H4B A;  1NK5 A;  4BWM A;  3QZ8 A;  5DQG A;  2IA6 A;  4DSI A;  3GIL A;  4RPY A;  9ICE A;  2ZTE A;  5DB6 A;  4DFK A;  5IIO A;  4J9Q A;  5IIK A;  2C2D A;  1QLN A;  3LWM A;  7ICG A;  4F2S A;  1XWL A;  4RQ7 A;  4KLO A;  4B9V A;  3PML A;  4ED3 A;  5F9N A;  3T5K A;  3T3F A;  3THV A;  1S97 A;  9ICL A;  4B9N A;  4MF2 A;  3EW9 A;  3PO5 A;  2AGP A;  3TAR A;  1U9L A;  1ZQT A;  4NM1 A;  4GXK A;  1NK6 A;  4M9J A;  8ICS A;  2A1J B;  5KT2 A;  1SL2 A;  2W8K A;  1SKW A;  5III A;  4KLM A;  2P6U A;  7ICT A;  4RQ5 A;  1IM4 A;  1ZQP A;  3LDA A;  4RZR A;  9ICX A;  1NKC A;  3RTV A;  3Q8L A;  7ICF A;  3FDS A;  3H8W A;  3NTU A;  1XSP A;  5KFV A;  1ZQO A;  2R8J A;  9ICJ A;  3QE9 Y;  1KFT A;  4ECY A;  2VA3 A;  3RBD A;  4IR1 A;  2UVU A;  5KFU A;  5DBC A;  3UQ2 A;  1UA1 A;  3GIJ A;  7ICL A;  7ICR A;  5CWR A;  3OJS A;  5DQH A;  5KFN A;  3G6X A;  4UB3 A;  4M04 A;  4KN4 A;  3ISB A;  5KFK A;  3OJU A;  1Y88 A;  2KZZ A;  3RR8 A;  3LK9 A;  4DFP A;  2V4Q A;  2BCS A;  3PX0 A;  3H4D A;  3V6J A;  2BCV A;  1CUK A;  4F91 B;  1KDH A;  9ICT A;  1NK7 A;  4PHP A;  3T5H A;  1KSP A;  2PFQ A;  4KLS A;  3M9O B;  3ISC A;  5J29 A;  4LVS A;  5KFA A;  3MR3 A;  1HUO A;  1ZQR A;  7ICQ A;  3Q8S B;  3HWT A;  5EWF A;  2HHV A;  2KFN A;  3B0Y A;  5DQI A;  7ICP A;  5HP4 A;  5DDM A;  4J9L A;  9ICP A;  2FLP A;  3GII A;  3GV8 B;  4DLG A;  2VAN A;  3RJI A;  3MR2 A;  2MAX A;  3EPI A;  1PZN A;  2W8L A;  1BPE A;  4XUS A;  4ED2 A;  3PX6 A;  3KHH A;  1EXN A;  4IQT A;  4J9M A;  3JPN A;  4BGD A;  4B9U A;  4DEZ A;  4F50 A;  1S0O A;  4ED7 A;  4KLI A;  1TK8 A;  1K1S A;  5J0Q A;  4DL7 A;  5KFG A;  5J2A A;  8ICQ A;  4O5E A;  1U47 A;  4JWN A;  1ZQJ A;  4TUR A;  4DL3 A;  1NK0 A;  1L3V A;  1ZQB A;  2FPL A;  3PX4 A;  2C2E A;  1DGS A;  3QEA Z;  1ARO P;  7ICV A;  4Q8F A;  3C2K A;  4DL2 A;  4JWM A;  4EBD A;  4IRK A;  2ASJ A;  4NLG A;  2UVV A;  3N97 B;  1BPX A;  3BDP A;  4J9N A;  4DL5 A;  4DL6 A;  3G6Y A;  3RH4 A;  1U49 A;  3ZDD A;  4F3O A;  4RT2 A;  2R8K A;  4DL4 A;  9ICQ A;  2BR0 A;  4QW8 A;  2XGQ A;  4Q43 A;  1Z3E B;  5KG7 A;  4DF4 A;  1N56 A;  2AGQ A;  4NXZ A;  2XY5 A;  5KT5 A;  4DFM A;  4HYK A;  1D9D A;  4UAW A;  1QTM A;  2DPI A;  4I27 A;  9ICS A;  4PGQ A;  4UBC A;  5KFW A;  5KG0 A;  4I29 A;  1WCN A;  4UQG A;  4Z6E A;  4J9O A;  3Q8M A;  1L5U A;  4UAY A;  3V7L A;  3TQ1 A;  1ZQD A;  4C8L A;  2ISP A;  2HW3 A;  1ZQZ A;  4JV2 A;  4BDP A;  4YFK A;  2J6T A;  1XO1 A;  4EZ6 A;  2KFZ A;  5J0R A;  4DOC A;  5TZV A;  1KTQ A;  2J6S A;  2P6R A;  2F1J A;  1NJW A;  2ASD A;  4RU9 A;  1U45 A;  4DWI A;  1ZQG A;  5CJ7 A;  4M6W A;  4QWA A;  3KHG A;  1S10 A;  9ICH A;  4DF8 A;  3HT3 A;  7ICM A;  2NRT A;  4TUP A;  1NOM A;  4O3O A;  3C2M A;  4MFC A;  5J0X A;  4DQP A;  3PW5 A;  1T8E A;  3M8S A;  4MFF A;  1Z00 A;  3RB3 A;  1S77 D;  5KFE A;  1MQ3 A;  4DOB A;  4DSK A;  2I9G A;  4R65 A;  1ZQS A;  4M2Y A;  5J2F A;  4YR3 A;  3PMN A;  3PNC A;  9ICO A;  1BPB A;  4ECQ A;  9ICG A;  3C1Y A;  1LB2 B;  5KG4 A;  1XC9 A;  4F8R A;  1MQ2 A;  3ORY A;  4P4O A;  5J0U A;  1BGX T;  3IM1 A;  4R8U B;  5JUM A;  3UXP A;  4M6W B;  4I2A A;  4I2B A;  4RQ4 A;  4XRH A;  1TVA A;  1ZQC A;  8ICF A;  3C5G A;  4E0D A;  2P66 A;  3HP6 A;  1ZQK A;  4ELT A;  5IIM A;  1UT5 A;  3TFS A;  1ZQM A;  3EYZ A;  1Z00 B;  2F1I A;  4QWC A;  4DQS A;  4RNM A;  4M0A A;  5EWE A;  2HHS A;  9ICV A;  1S76 D;  4R64 A;  2C2R A;  1ZQA A;  2M9N A;  9ICC A;  1T4G A;  2LYH A;  5DB7 A;  2I1Q A;  3BQ1 A;  2J6U A;  1NJZ A;  3PW7 A;  2UVW A;  4I2J A;  4QZH A;  4QZF A;  2H5X A;  4FBT A;  8ICJ A;  4DOA A;  4XA5 A;  4ED6 A;  1V9P A;  3MFI A;  2NRV A;  3PW0 A;  5L1I A;  8ICT A;  3RAQ A;  4B9L A;  4M9G A;  4EYH B;  2V4R A;  4Q8E A;  4F5R A;  1XS9 D;  3OHB A;  2BPF A;  4B9S A;  4I2G A;  8ICG A;  4YXM A;  2XCA A;  3PV8 A;  4IRC A;  4GLX A;  4X5V A;  3JPP A;  1RZT A;  1T3N A;  2KZ3 A;  7ICN A;  5J2C A;  1D8Y A;  3UXO A;  1JIH A;  3RAX A;  1ZQN A;  2HHX A;  2BPG A;  4K4H A;  9ICN A;  4JUZ A;  4MEX A;  3RJF A;  4F93 B;  1KFS A;  5DGA A;  5KG1 A;  4ECW A;  4KLL A;  4DQI A;  4I2E A;  5KT7 A;  2AQ0 A;  3KHR A;  5DB8 A;  5KFC A;  4YR0 A;  4KN7 A;  3OHA A;  5DG9 A;  3Q8Q B;  9ICK A;  4YG2 A;  2DFL A;  4QWE A;  1HUZ A;  1ZJN A;  1ZQQ A;  3JPQ A;  1ZQH A;  4BWJ A;  3H40 A;  3K4G A;  9ICI A;  5CHG A;  2C28 A;  4MF8 A;  3MGH A;  3G6V A;  3RRH A;  2AGO A;  1LV5 A;  2B21 A;  3BQT A;  5CR0 A;  3GIK A;  1ZQF A;  3AU2 A;  2ISO A;  3RJK A;  3MGI A;  1SL0 A;  5L1L A;  4UB2 A;  4C8M A;  1WCL A;  4PHE A;  5D49 A;  3C5F A;  5KFH A;  5L1J A;  2IBK A;  3RBE A;  3M8R A;  1KLN A;  5KFB A;  3IHQ B;  1RPL A;  3EPG A;  5DG8 A;  4QW9 A;  1RYR A;  4XQ8 A;  1BPZ A;  3HX0 A;  3RRG A;  4KLQ A;  7ICH A;  5C5J A;  1N48 A;  8ICZ A;  4KLJ A;  2XGP A;  4RQ2 A;  2W9A A;  1UT8 A;  1U48 A;  4P2H A;  3E2E A;  3H8S A;  5KFZ A;  1MSW D;  5KFO A;  4F4K A;  2FLN A;  5BPC A;  1ZQU A;  4C8K A;  2PI4 A;  8ICO A;  5KFI A;  4Z6C A;  4I2C A;  5KG2 A;  4NLK A;  3KTQ A;  9ICU A;  3PR5 B;  1BPY A;  2C22 A;  4IQW A;  4EBC A;  4TUS A;  3JPO A;  7ICK A;  4QZ9 A;  5EWG A;  2JEF A;  9ICF A;  4NY8 A;  7ICE A;  4DSJ A;  1BPD A;  4F5O A;  4RNN A;  1SKR A;  3LWL A;  1NKE A;  4Q44 A;  4YVZ A;  1COO A;  5KFJ A;  1RYS A;  8ICU A;  3C1Z A;  4UB5 A;  4TUQ A;  1NKB A;  1C7Y A;  4FS2 A;  2KTQ A;  4ELU A;  4QWD A;  4F5Q A;  2IHN A;  8ICR A;  2HHW A;  3HPO A;  5DBB A;  8ICY A;  4Z6D A;  2BCU A;  4I2D A;  1B43 A;  5KFR A;  3ZDE A;  1XSN A;  1KFD A;  3RB0 A;  4EBE A;  4O9M A;  3MFH A;  4JV1 A;  2RDI A;  1L3S A;  4O0I A;  2XY7 A;  7ICS A;  1ZQE A;  4GXJ A;  4DSL A;  2ATL A;  3N4M B;  5DBA A;  5BOM A;  2W9B A;  3V7J A;  3MBY A;  5IIJ A;  4UB1 A;  5J2G A;  3PVX A;  4KTQ A;  5KG6 A;  4EZ9 A;  2VA2 A;  4O3R A;  9ICA A;  3JPT A;  2ZJ8 A;  9ICW A;  4TQS A;  3PY8 A;  8ICX A;  4JK1 A;  3ZDA A;  2XY6 A;  4NLN A;  4QWB A;  4FO6 A;  4YR2 A;  2V9W A;  2FPK A;  5KT6 A;  4RQ8 A;  4R63 A;  8ICC A;  2VA8 A;  5EOZ A;  4P4M A;  5L1K A;  3GV5 B;  4I2H A;  1NK4 A;  1S9F A;  2DPJ A;  5CB1 A;  4M47 A; 
#chains in the Genus database with same CATH topology
 3NRW A;  2FMQ A;  2YML A;  5IIN A;  4Y2V A;  3M9N B;  5J2I A;  2QKQ A;  4M9L A;  4O3P A;  4EX6 A;  3SV4 A;  1JXE A;  4UB8 U;  2LYB A;  2ZUB A;  5AI0 A;  3Q8K A;  1NNL A;  2XI9 A;  5KFT A;  2MUT A;  2F3N A;  2ES6 A;  3N7S C;  4MEY A;  4YMN A;  8ICK A;  2EAM A;  5AKG A;  3WKE A;  2ZUD A;  3QNM A;  3QX7 A;  5HHH A;  4OJP A;  1N60 A;  5J0T A;  3QUC A;  2FMS A;  2WF6 A;  4LJX A;  3I76 A;  5KFD A;  4QZ8 A;  3AQF A;  4U7C A;  1HIW A;  3B0X A;  3V6K A;  5KFY A;  5TIS U;  4GIB A;  4EX7 A;  4DFD A;  5KFF A;  4NLZ A;  2F76 X;  5KFM A;  3EUB 2;  5DB9 A;  2DWQ A;  3FC4 A;  4O5K A;  2KHV A;  4UAV A;  2UVR A;  1A6S A;  3OSN A;  1O03 A;  1BVS A;  2YY6 A;  3RR7 A;  4RT3 A;  1SXD A;  2RQ5 A;  1TAU A;  4J9S A;  2NRX A;  3V7K A;  3BJY A;  2BKE A;  2ZIX B;  8ICL A;  4C0Z A;  4RQ3 A;  1D8L A;  2VJ4 A;  4IQU A;  3K75 D;  1KN5 A;  1ZQL A;  4IL6 U;  2HVI A;  2IOH A;  8ICH A;  2GWS A;  2GO7 A;  8ICB A;  1PK3 A;  3OPX A;  2KE7 A;  3TAP A;  2WTF A;  5J0O A;  1SIJ A;  1V97 A;  4QZB A;  3EWA A;  3QU7 A;  5CA7 A;  1QH9 A;  2R8I A;  4F4Y A;  4UBB A;  3NGD A;  2HHQ A;  1DOQ A;  1ZQW A;  2WHE A;  2ZTD A;  1QSY A;  1BNO A;  4Y2T A;  5EE0 A;  1X9S A;  5KT4 A;  2W55 A;  5EE9 A;  3SZ2 A;  1X9W A;  4O3Q A;  3I28 A;  2WAQ C;  3UPQ A;  7ICJ A;  1J2M A;  2W7O A;  2YX8 A;  5J8Y C;  3RJH A;  1PVR A;  3N28 A;  4PZN A;  2F8L A;  4ED0 A;  2JEJ A;  3GV7 B;  2BQU A;  3E58 A;  1HEK A;  4Y2R A;  3C2L A;  2DL0 A;  2FE9 A;  2N1R A;  1KEJ A;  2FPM A;  5J2D A;  2F1H A;  4LZG A;  3KHL A;  5D46 A;  2OWO A;  2YMP A;  2HI0 A;  3BQ0 A;  4YXJ A;  2A1J A;  3TAQ A;  3M1Y A;  4P0P A;  2WF5 A;  1NK5 A;  2YN4 A;  2K4H A;  2C2D A;  1N5W A;  7ICG A;  4EEL A;  2M0N A;  1YZ7 A;  4KLO A;  5ALY A;  3PML A;  3T5K A;  3T3F A;  1NZB A;  3EW9 A;  2AGP A;  3M6K A;  3TAR A;  2H3Q A;  8ICS A;  1SKW A;  2P6U A;  2WB1 C;  1Z1V A;  1NKC A;  3I1Y A;  2ODG A;  3H8W A;  3NTU A;  3BQ7 A;  3QE9 Y;  2VA3 A;  2NO5 A;  2IOF K;  2LI6 A;  3F5A A;  5KFN A;  5KFK A;  1Y88 A;  5ALK A;  2DGZ A;  1KDH A;  3GU3 A;  4PHP A;  1KSP A;  4KLS A;  5F3X B;  5ALQ A;  5KFA A;  3MR3 A;  1HUO A;  3Q8S B;  5L1M A;  2KFN A;  3BS7 A;  2FLP A;  3GV8 B;  5ALT A;  1PZN A;  2W8L A;  4C4T A;  4IS7 A;  2WF8 A;  1LKY B;  3RFA A;  1TK8 A;  2HBJ A;  2KVS A;  4DL7 A;  3SMV A;  4OJ5 A;  1NK0 A;  5AM3 A;  2HOQ A;  2FPL A;  3PX4 A;  3QEA Z;  1ARO P;  7ICV A;  1RYU A;  4G9B A;  1BPX A;  3G6Y A;  3ZDD A;  4F3O A;  4RT2 A;  2KVC A;  4Q43 A;  1Z3E B;  4BUG A;  5KG7 A;  3T79 A;  1N56 A;  3LVW A;  4DFM A;  2MA1 A;  3A0B U;  9ICS A;  4PGQ A;  2GLE A;  1WWV A;  1L5U A;  2OEH A;  4ACO A;  3Q8M A;  1ECW A;  1ZQD A;  3QYP A;  1C20 A;  3ED5 A;  3DEE A;  5KNI A;  2OYY A;  4EEN A;  2KFZ A;  3K1Z A;  4DOC A;  1KTQ A;  1NJW A;  2ASD A;  1ZQG A;  3KHG A;  1S10 A;  4MFC A;  4DQP A;  1T8E A;  2LM1 A;  4DOB A;  4DSK A;  5J2F A;  9ICO A;  1VJ5 A;  3C1Y A;  1NZP A;  1LB2 B;  1QQ6 A;  1MQ2 A;  2OXO A;  2NV3 A;  3ORY A;  5J0U A;  5KL1 B;  1TVA A;  3C5G A;  3ONN A;  1UT5 A;  3TFS A;  2MRL A;  3WKB A;  4R64 A;  3TAD A;  5DB7 A;  4NL9 A;  2QB0 B;  4I2J A;  2H5X A;  8ICJ A;  4ED6 A;  2Z7J A;  1DK3 A;  2NRV A;  2WAQ F;  4US9 A;  8ICT A;  3RAQ A;  4F5R A;  4I2G A;  2EAP A;  8ICG A;  4YXM A;  2XCA A;  3NUQ A;  2EAN A;  3JPP A;  1RZT A;  1D8Y A;  5ALR A;  1CRX A;  2LYA A;  1ZQN A;  4AP9 A;  4MEX A;  2FDR A;  5AK5 A;  3RJF A;  2WF9 A;  1KFS A;  4KLL A;  2K4P A;  3KBB A;  3Q8Q B;  4QWE A;  4DCC A;  1O08 A;  1ZQH A;  1KW4 A;  2KEY A;  4MF8 A;  3G6V A;  3RRH A;  5CR0 A;  3BQT A;  3GIK A;  3RJK A;  5ALG A;  3C5F A;  4C80 A;  3M8R A;  1KLN A;  3IHQ B;  5ALU A;  1RYR A;  5DG8 A;  4QW9 A;  2E8N A;  7ICH A;  5C5J A;  4KLJ A;  1KL9 A;  3H8S A;  2WB1 F;  2FLN A;  2PKE A;  1ZQU A;  5AIB A;  8ICO A;  5KFI A;  1AQ6 A;  4IQW A;  1SV0 A;  2XID A;  2VIX A;  3H8M A;  1ZRM A;  1KBU A;  4DSJ A;  1SKR A;  3IP4 B;  4UAT A;  2PMZ C;  1RYS A;  8ICU A;  4TUQ A;  2KTQ A;  2OM6 A;  1Q3V A;  2IHN A;  2LBO A;  5KFR A;  1XSN A;  1KFD A;  3RB0 A;  2RDI A;  5AKJ A;  3M7D A;  7ICS A;  1ZQE A;  2ATL A;  5G5G A;  3MBY A;  3H0L B;  5IIJ A;  9ICW A;  2XY6 A;  2RHF A;  2JH1 A;  4QWB A;  4RQ8 A;  5L1K A;  7ICE A;  5BOL A;  5AHX A;  4CF4 A;  9ICB A;  2W9B B;  4F2R A;  4ELV A;  4RNO A;  1T7P A;  1IXR A;  2NRZ A;  2HBM A;  2W3R A;  3KKA C;  3H8J A;  1F5S A;  2ZXH A;  4ED8 A;  5J0P A;  5A0L A;  5JRT A;  2AQ4 A;  2KNJ A;  1UA0 A;  4GC7 A;  3VC8 A;  2A1A A;  1JRP A;  1N63 A;  3WK7 A;  1QSS A;  4EEK A;  1RXV A;  2EAO A;  3SYZ A;  3ICX A;  4Y2U A;  2ZUC A;  2YB1 A;  4K4I A;  4FBU A;  5DKW A;  4P0Q A;  5J0S A;  2VJ5 A;  1XU4 A;  4BXO A;  5AKK A;  4KLD A;  3T5L A;  5J2H A;  4DQQ A;  4QZI A;  3ETR A;  4YMO A;  1NK9 A;  2MUT B;  3WKD A;  2JXJ A;  5KFP A;  5AK4 A;  1L3T A;  8ICA A;  2K60 A;  5KT3 A;  3ZD8 A;  1B0X A;  1D9F A;  5C0Y A;  1RQN A;  3PW2 A;  1BNP A;  2HOF A;  1B4F A;  3UXN A;  1ZD5 A;  8ICI A;  2JEI A;  3ETL A;  5HML A;  4QZC A;  2JV3 A;  2D6F C;  4MFA A;  4PGX A;  1F44 A;  5L9X A;  3IN5 A;  3RH5 A;  4EEY A;  2DUY A;  3FAH A;  1JUD A;  4G3I A;  3AQE A;  3MDC A;  3F53 A;  2B6G A;  3H7I A;  5KFL A;  2XO7 A;  2E8M A;  3TI0 A;  2AHO B;  1PVP A;  1JAL A;  5AM2 A;  3MDA A;  2CPR A;  3MR5 A;  1Z1B A;  2BCQ A;  2AU0 A;  3HJE A;  4RQM A;  4PJ0 U;  4Z6F A;  1SKS A;  4M9H A;  2XVT A;  4EYI B;  4ECT A;  2BHN A;  2HHU A;  3LYS A;  4F92 B;  1MC8 A;  5KG3 A;  3SAH A;  4J9P A;  2E8P A;  2PXI A;  3CW2 C;  4ECV A;  1ZET A;  4JMU A;  2BPC A;  4C4S A;  2BQ3 A;  2A19 A;  1UCV A;  3NS1 A;  3KD3 A;  1B22 A;  2E5S A;  4ZOH C;  4F71 A;  2KIC A;  4I28 A;  4PGY A;  1SL1 A;  4KIT B;  1K1Q A;  3OSP A;  3MAB A;  3H0M B;  1UHU A;  4J9K A;  4J03 A;  2EZX A;  2PMZ F;  4QZE A;  3QEB Z;  3HW8 A;  2Y1J A;  1L8L A;  4RQ1 A;  4DSF A;  3Q8R B;  5HHI A;  3FYH A;  1K5O A;  4I2F A;  1CEZ A;  3UQ0 A;  3WK4 A;  1V85 A;  5KG5 A;  1X6I A;  1TK0 A;  2JR5 A;  7ICI A;  4QZD A;  1ZJM A;  3PSP A;  1XO0 A;  4BWM A;  4RPY A;  2ZTE A;  5IIO A;  5IIK A;  1QLN A;  4F2S A;  1FO4 A;  9ICL A;  4MF2 A;  2KKV A;  4GXK A;  4M9J A;  2A1J B;  2W8K A;  4P0P B;  1IM4 A;  1ZQP A;  9ICX A;  2A3V A;  1ZQO A;  2R8J A;  4NJ8 A;  5KFV A;  1XSP A;  2KIV A;  3RBD A;  3TAC B;  1Q8K A;  4KN4 A;  5HR6 A;  3OJU A;  1Q46 A;  3PX0 A;  2G5H B;  3KZI U;  2FJ6 A;  2BCV A;  2AXT U;  4F91 B;  1NK7 A;  5GTH U;  3T5H A;  3D2Q A;  3ISC A;  3L3F X;  3B0Y A;  5DQI A;  7ICP A;  2K8C B;  5HP4 A;  9ICP A;  3GII A;  2VAN A;  4KX5 A;  1BPE A;  4XUS A;  3PX6 A;  1COK A;  3QUQ A;  1GO3 F;  1EXN A;  4IQT A;  5E79 U;  3JPN A;  4KLI A;  1SGG A;  1FEZ A;  5J2A A;  4TUR A;  1L3V A;  2HMX A;  2C2E A;  1DGS A;  4Q8F A;  3NVZ A;  4DL2 A;  4A8E A;  4EBD A;  5AIA A;  5AI9 A;  4NLG A;  3N97 B;  3BDP A;  4J9N A;  1U49 A;  1PUZ A;  5AI5 A;  3MGV A;  9ICQ A;  1L6N A;  4DF4 A;  1D9D A;  3WKA A;  1QTM A;  3KZX A;  3N7R C;  5KG0 A;  4I29 A;  4J9O A;  4UAY A;  3TQ1 A;  2HW3 A;  3R9K A;  2ISP A;  4YFK A;  4QJF B;  2G0A A;  3C28 A;  4EZ6 A;  2OH2 A;  1N2X A;  2P6R A;  4QWA A;  4DF8 A;  1NOM A;  4QNL A;  4OJ6 A;  2KIW A;  4MFF A;  3M8S A;  4AYB C;  5ALM A;  3RB3 A;  2KSO A;  2I9G A;  1ZQS A;  3PNC A;  2ZIV A;  5AI6 A;  2YTU A;  3SD7 A;  5AM5 A;  4F8R A;  4P4O A;  4R8U B;  5JUM A;  3UXP A;  4I2B A;  4RQ4 A;  1ZQC A;  8ICF A;  2E3T A;  2EDU A;  2P66 A;  3HP6 A;  1ZQK A;  5IIM A;  2W03 A;  2LPE A;  4QWC A;  4M0A A;  3CNH A;  2C2R A;  1RM6 C;  3ALR A;  1WWU A;  3AN1 A;  4FBT A;  4XA5 A;  4Y2Y A;  1ZOL A;  2HDO A;  3PW0 A;  4EYH B;  1XS9 D;  3OHB A;  2BPF A;  1M6Y A;  1SWV A;  2BDU A;  3PV8 A;  4IRC A;  4PL1 A;  5AKY A;  3UXO A;  3CRX A;  2HHX A;  2KP7 A;  4K4H A;  4C7Y A;  1LVH A;  4JUZ A;  2H3I A;  4ECW A;  3DDH A;  4DQI A;  3BZK A;  2W3S A;  2KJ9 A;  5KFC A;  4YR0 A;  4KN7 A;  5DG9 A;  2DFL A;  1ZJN A;  5ALX A;  3MGH A;  2AGO A;  1SWW A;  3MGI A;  2GH1 A;  3QU9 A;  3O0F A;  4C8M A;  4PHE A;  3J81 j;  5L1J A;  3U26 A;  3UM9 A;  3EPG A;  4P2H A;  1U48 A;  4QIW C;  2W04 A;  5AKH A;  4F4K A;  3M6Z A;  4C8K A;  9ICU A;  5B5E U;  4NLK A;  2C22 A;  3AL0 B;  5EWG A;  9ICF A;  2MU2 A;  2AH5 A;  4RNN A;  1COO A;  5KFJ A;  3C1Z A;  4UB5 A;  1C7Y A;  4ELU A;  3D2S A;  4Z6D A;  2W7P A;  4EBE A;  4O9M A;  4CGZ A;  4O0I A;  4ICA A;  4GXJ A;  3N4M B;  5DBA A;  4O3R A;  4UB1 A;  3TAD C;  1QCK A;  5J2G A;  2VA2 A;  2ZJ8 A;  8ICX A;  4NL9 C;  5KT6 A;  5EOZ A;  1MN8 A;  1NK4 A;  4I2H A;  1X6J A;  5CB1 A;  3PZP A;  4DQR A;  4TQR A;  1TK5 A;  4C7Z A;  2BZF A;  5HR7 A;  4O3M A;  1KRP A;  3S6J A;  2LHT A;  3IV6 A;  7ICO A;  4IR9 A;  3RJE A;  2EH9 A;  1DK2 A;  3QXG A;  1MA7 A;  1YZ6 A;  1N5X A;  1SB3 C;  5KFQ A;  8ICV A;  2DKZ A;  4F5P A;  1JMS A;  1ZQV A;  5AIC A;  4CCH A;  4O3N A;  3EZ5 A;  3WK5 A;  3QZ7 A;  3D6J A;  8ICP A;  2BQR A;  5KFX A;  2QAR B;  4DO9 A;  3PSF A;  2EQY A;  3ZDB A;  4ECR A;  4DS5 A;  4Q45 A;  4KLF A;  3RB4 A;  3AUO A;  4AYB F;  5DG7 A;  2RRD A;  1S0V A;  2YMM A;  5D4B A;  2WF7 A;  3V6H A;  3SEN A;  1SV0 C;  5H2F U;  1S8O A;  4RUC A;  3V72 A;  4RUA A;  4P0Q B;  1FIQ A;  2I5H A;  5B66 U;  4BXO B;  2HHT A;  1TFR A;  5KL8 B;  1F0M A;  2Y1I A;  3PW4 A;  1JN3 A;  2XC9 A;  5J2B A;  4F4W A;  1SXE A;  4OJL A;  1PVQ A;  2Q0Z X;  1U4B A;  2G07 A;  5AM0 A;  5F9L A;  2ZJA A;  9ICR A;  2ZXI A;  4YP3 A;  3SI8 A;  1RXW A;  4YD1 A;  8ICN A;  5ALH A;  2R8G A;  2PI5 A;  4DFJ A;  4KLT A;  2W43 A;  1V38 A;  1PK1 A;  4QZA A;  4ECX A;  3RB6 A;  7ICU A;  2QB1 A;  4GXI A;  1XNS A;  2JZB A;  3F5E A;  2W9C A;  4R66 A;  4LZD A;  1T94 A;  3WU2 U;  4HAI A;  3SEI A;  3ZI4 A;  2PFN A;  4M9N A;  2BDP A;  3BS5 A;  4US8 A;  4MHV A;  4ECS A;  3QUB A;  5J2E A;  2HSZ A;  5DDY A;  4UAZ A;  2JEG A;  2KJ8 A;  8ICE A;  5CRX A;  4UB4 A;  4PPX A;  1ED1 A;  2G06 A;  4KLG A;  4YCX A;  2W9M A;  3NAS A;  3HKZ C;  2ZIU A;  4KLH A;  3RJJ A;  4OO1 J;  4QIW F;  4K4G A;  2ZTC A;  3IG8 A;  4NWI A;  2XCP A;  3PO4 A;  4RPX A;  3ZD9 A;  4ECU A;  5J0Y A;  2H3V A;  4RQ6 A;  3IDW A;  1Z4O A;  3NVY A;  4RQN A;  1OUQ A;  1WG8 A;  1ZQI A;  4JB3 A;  2FLL A;  1XSL A;  4DLE A;  2P35 A;  2KG5 A;  1HJP A;  4PH5 A;  2VKQ A;  2ZJ5 A;  3L4P A;  3JPS A;  2I6X A;  5EE1 A;  3GFK B;  3M9M B;  2PFP A;  2BGW A;  1Q3U A;  4BX9 C;  1TV9 A;  4DSE A;  1OW5 A;  1JX4 A;  2QB0 A;  5KAF U;  3AEV A;  3TAN A;  4B9T A;  4NV0 A;  3ZDC A;  1ZD2 P;  4RPZ A;  4U6P A;  2R18 A;  3H4B A;  5DQG A;  3UMC A;  4DFK A;  1RDF A;  2Q4T A;  3LWM A;  1XWL A;  4RQ7 A;  1KQQ A;  2DF4 B;  5F9N A;  1JI7 A;  4NM1 A;  5ALW A;  1ZQT A;  1ZQ1 C;  1NK6 A;  5KT2 A;  1SL2 A;  7ICT A;  4UAS A;  3LDA A;  4RZR A;  3Q8L A;  3SQI A;  3GZF A;  9ICJ A;  2K4E A;  4ECY A;  2O6K A;  4IR1 A;  2UVU A;  5KFU A;  1WYG A;  5DBC A;  3GIJ A;  5CWR A;  3OJS A;  3G6X A;  3ISB A;  4BJQ A;  2OCE A;  3RR8 A;  3LK9 A;  2B0C A;  4DFP A;  3QU2 A;  2BCS A;  3VCB A;  3H4D A;  3V6J A;  1CUK A;  9ICT A;  2CRX A;  3M9O B;  7ICQ A;  3HWT A;  5ALO A;  5T14 A;  4J9L A;  3RJI A;  3MR2 A;  3EPI A;  3KHH A;  4Y2X A;  2JH7 A;  4B9U A;  4DEZ A;  1S0O A;  5AKE A;  4ED7 A;  5J0Q A;  5KFG A;  3D2N A;  8ICQ A;  4O5E A;  4JWN A;  4DL3 A;  1ZQB A;  2Y0S C;  2YB4 A;  4JWM A;  4IRK A;  2UVV A;  3RH4 A;  2R8K A;  2XGQ A;  2AGQ A;  4NXZ A;  2XY5 A;  5KT5 A;  2DPI A;  2FI1 A;  5KFW A;  1WCN A;  4UQG A;  2KZZ A;  3V7L A;  1ZQZ A;  3CYM A;  4JV2 A;  4BDP A;  2J6T A;  3CP8 A;  1XO1 A;  5J0R A;  2F77 X;  5TZV A;  4RU9 A;  1U45 A;  4DWI A;  2F8K A;  5CJ7 A;  4M6W A;  2KJ5 A;  3HT3 A;  7ICM A;  2H3Z A;  5AKI A;  4TUP A;  4O3O A;  3C2M A;  3PW5 A;  1Z00 A;  1S77 D;  5KFE A;  4YR3 A;  1BPB A;  5AI4 A;  5KG4 A;  2JMG A;  4Y2J A;  1BGX T;  4I2A A;  4OJO A;  2KMD A;  3HKZ F;  3KFU F;  5EWE A;  2KSO B;  1ZQA A;  1T4G A;  3BQ1 A;  2J6U A;  2I1Q A;  2NO4 A;  2ZIV B;  4FZL A;  4KX3 A;  1NJZ A;  3PW7 A;  4FZN A;  4DOA A;  3E0F A;  3MFI A;  4CE6 A;  5L1I A;  4B9L A;  4Y2P A;  4M9G A;  2V4R A;  4B9S A;  2WFA A;  1RQL A;  4USA A;  1T3N A;  2KV2 A;  1DGJ A;  1JIH A;  3AM9 A;  2BPG A;  1OXJ A;  1S5L U;  4F93 B;  5KG1 A;  2QLT A;  1KKX A;  5KT7 A;  5DB8 A;  4YG2 A;  4BWJ A;  3H40 A;  9ICI A;  5CHG A;  2HCF A;  2ISO A;  1ZQF A;  1UQV A;  3AU2 A;  5L1L A;  1Z19 A;  4PZO A;  1WCL A;  2HOI A;  3MC1 A;  5KFB A;  1RPL A;  4XQ8 A;  1BPZ A;  3HX0 A;  3RRG A;  4KLQ A;  5ALL A;  2XGP A;  2CN1 A;  1UT8 A;  4NLB A;  5KFZ A;  5KFO A;  4I2C A;  3JPO A;  4QZ9 A;  2JEF A;  2GOL A;  2ZIW A;  3F2C A;  4F5O A;  1NKE A;  3HRD D;  2YQE A;  4YVZ A;  5ALV A;  3HPO A;  5DBB A;  3F2D A;  2BCU A;  4I2D A;  3ZDE A;  3UMB A;  3MFH A;  1L3S A;  5G5H A;  3K1R B;  4DSL A;  3WK8 A;  5BOM A;  3PST A;  4C4R A;  3V7J A;  4EZ9 A;  4F72 A;  5FP0 A;  3JPT A;  3SAG A;  4TQS A;  4JK1 A;  1VDV A;  4FO6 A;  4YR2 A;  2V9W A;  2Y9U A;  4R63 A;  2VA8 A;  3GV5 B;  1S9F A;  2DPJ A;  4KMO B;  2ESE A;  2FMP A;  5KFS A;  4O3S A;  1A76 A;  1NJY A;  2Y0S F;  3UMG A;  4F4Z A;  1IG6 A;  3GDX A;  4GC6 A;  2NRW A;  1JRO A;  3AU6 A;  5K4L A;  2HVH A;  1S0M A;  1SV4 A;  3OGU A;  1ZXI A;  4F5N A;  4CRX A;  2LM4 A;  3PSI A;  4YQW A;  4YD2 A;  3C21 A;  5KTQ A;  2NYV A;  3PR4 A;  1X2I A;  2RDJ A;  3B9J A;  5DLG A;  4KLU A;  5CEH A;  1JXL A;  4OD0 A;  2IMW P;  4JV0 A;  2Y9T A;  4FS1 A;  1X9M A;  2D8C A;  3GIM A;  3MR6 A;  1SZP A;  5J8Y A;  3C23 A;  4I2I A;  2PFO A;  1X40 A;  4CNQ A;  5J2J A;  1NK8 A;  5AKL A;  2RP5 A;  3RH6 A;  5CP2 A;  2F44 A;  3GQC A;  1H38 A;  4QZG A;  3WK9 A;  3SV3 A;  4CF3 A;  4IQV A;  5J0W A;  4DS4 A;  1DRG A;  2G5I B;  5EE3 A;  5J2K A;  2AJQ A;  3QU4 A;  3WK6 A;  1NJX A;  4PL2 A;  1UPH A;  3L5K A;  4YN4 A;  3T5J A;  1IV8 A;  2ZIX A;  2OHF A;  4FE3 A;  2MSN A;  3NRZ A;  5ALF A;  4PHA A;  1TKD A;  5HNK A;  5ALZ A;  3SAF A;  3TFR A;  4Y2Q A;  2KZM A;  5ALP A;  2L5Y A;  1P7D A;  2DBY A;  5JU5 A;  1A77 A;  2ASL A;  5ALN A;  5GTI U;  1TAQ A;  3A0H U;  5IIL A;  2ALZ A;  4O5C A;  1PK1 B;  1L3U A;  4KMU A;  3BQ2 A;  1ZQX A;  4PHD A;  4C8N A;  3IG5 A;  4F4X A;  2JZB B;  2W9C B;  4C8O A;  3JPR A;  3F2B A;  2R8H A;  8ICM A;  4B9M A;  5DGB A;  9ICM A;  1J2N A;  1D8B A;  4UAR A;  2W54 A;  5AKX A;  4ECZ A;  3BS5 B;  4YMM A;  3NVW A;  2YMQ A;  1L8O A;  1S0N A;  3AMZ A;  3Q8P B;  1QSL A;  4B9N A;  1QQ7 A;  1N62 A;  5HMM A;  1ZYQ A;  8ICZ A;  3ISD A;  8ICW A;  4P4P A;  2BCR A;  4IRD A;  4R8U A;  4RQ0 A;  1J97 A;  5DLF A;  2ZIU B;  5KAI U;  1ZQY A;  4ZH4 A;  2E8O A;  3RJG A;  4NM2 A;  2IHM A;  4WJ3 B;  4KLE A;  4CF5 A;  2KN7 A;  4J9R A;  1RG6 A;  4ED1 A;  1FFV A;  5AK3 A;  1CI4 A;  2IA6 A;  4DSI A;  3QZ8 A;  3GIL A;  9ICE A;  1L7N A;  2F2A B;  5DB6 A;  4J9Q A;  2DKX A;  4B9V A;  2D3D A;  4ED3 A;  3THV A;  1S97 A;  2KK0 A;  5JTI A;  2EZZ A;  2LKY A;  3PO5 A;  1U9L A;  3C29 A;  5III A;  4KLM A;  3KOO A;  4RQ5 A;  1SZH A;  3RTV A;  7ICF A;  3FDS A;  1KFT A;  2K8A A;  3QU5 A;  3UQ2 A;  7ICL A;  1UA1 A;  7ICR A;  1NI3 A;  5AK6 A;  5DQH A;  4UB3 A;  4M04 A;  3BZC A;  2V4Q A;  1X42 A;  4UB6 U;  1LKY A;  4CDG A;  1IIP A;  2PFQ A;  4LVS A;  3RF9 A;  5J29 A;  1ZQR A;  5EWF A;  2HHV A;  5AM1 A;  5DDM A;  4DLG A;  2HBK A;  4FFD A;  4FZM A;  2MAX A;  4ED2 A;  4UW9 A;  2G09 A;  1FFU A;  4J9M A;  4BGD A;  3WKC A;  4F50 A;  1K1S A;  2K4I A;  1U47 A;  1ZQJ A;  3HIL A;  2K8B B;  3C2K A;  1T3Q A;  4Y2S A;  2ASJ A;  3SR6 A;  4DL5 A;  4DL6 A;  4DL4 A;  2BR0 A;  4QW8 A;  2LMR A;  4HYK A;  4UAW A;  4I27 A;  4UBC A;  1A0P A;  1WUD A;  5ALJ A;  4Z6E A;  4C8L A;  5ALI A;  2J6S A;  2F1J A;  4NLC A;  1N61 A;  9ICH A;  2HBL A;  2KOB A;  2NRT A;  5J0X A;  1TE2 A;  1L7O A;  1MQ3 A;  3FM9 A;  2JGA A;  3DV9 A;  4R65 A;  4M2Y A;  3PMN A;  4ECQ A;  9ICG A;  1XC9 A;  2JRZ A;  2ZG6 A;  3IM1 A;  4M6W B;  1TAM A;  4XRH A;  2W11 A;  1ZD3 A;  4E0D A;  2G08 A;  2QAR A;  4ELT A;  1ZQM A;  2CXY A;  3EYZ A;  2JHD A;  1Z00 B;  2F1I A;  4DQS A;  2HHS A;  4RNM A;  9ICV A;  5ALD A;  1S76 D;  2IOF A;  2M9N A;  9ICC A;  2K89 A;  2LYH A;  1QQ5 A;  2KHQ A;  2UVW A;  4QZH A;  4QZF A;  1ZD4 A;  1V9P A;  2E1E A;  3OTQ A;  4IC9 A;  4Q8E A;  4GLX A;  4X5V A;  2KZ3 A;  7ICN A;  5J2C A;  3RAX A;  1X66 A;  9ICN A;  2RLT A;  3KKA A;  5AKZ A;  5DGA A;  4I2E A;  2AQ0 A;  3NVV A;  3KHR A;  3OHA A;  9ICK A;  5ALE A;  1HUZ A;  1ZQQ A;  4B6J A;  3JPQ A;  3N7P D;  3K4G A;  2C28 A;  1LV5 A;  2B21 A;  2EZY A;  4UAU A;  1SL0 A;  4UB2 A;  3QUT A;  3IRU A;  2IBK A;  2XIC A;  2KD1 A;  5D49 A;  1URJ A;  5KFH A;  5AI8 A;  3RBE A;  2H3F A;  4OCZ A;  1YT3 A;  1N48 A;  4RQ2 A;  2W9A A;  3LVV A;  3E2E A;  1MSW D;  1ZRN A;  5BPC A;  2PI4 A;  4Z6C A;  5KG2 A;  3KTQ A;  3PR5 B;  1BPY A;  4EBC A;  1X9X A;  4TUS A;  1L7P A;  2KKP A;  7ICK A;  4NY8 A;  2DQN B;  1BPD A;  3LWL A;  4Q44 A;  1NKB A;  1VLB A;  4FS2 A;  1L7M A;  4QWD A;  4F5Q A;  8ICR A;  2HHW A;  1Z4N A;  8ICY A;  3H0R B;  3TKA A;  5ALS A;  1B43 A;  2E1F A;  4JV1 A;  2ZIW B;  2XY7 A;  2W9B A;  5AM4 A;  3PVX A;  4KTQ A;  5KG6 A;  9ICA A;  3PY8 A;  3ZDA A;  4NLN A;  2FPK A;  1DXS A;  8ICC A;  4P4M A;  4GFJ A;  4M47 A; 
#chains in the Genus database with same CATH homology
 2FMP A;  5BOL A;  2FMQ A;  5KFS A;  5IIN A;  4O3S A;  4DQR A;  4TQR A;  1TK5 A;  9ICB A;  3M9N B;  1A76 A;  2W9B B;  5J2I A;  4M9L A;  4O3P A;  1NJY A;  4F2R A;  1KRP A;  4F4Z A;  3GDX A;  4GC6 A;  4ELV A;  4RNO A;  2NRW A;  7ICO A;  4IR9 A;  3SV4 A;  1T7P A;  1IXR A;  2NRZ A;  1JXE A;  3RJE A;  3H8J A;  3AU6 A;  4ED8 A;  2HVH A;  2ZUB A;  1S0M A;  3OGU A;  5J0P A;  4F5N A;  2AQ4 A;  5KFQ A;  1UA0 A;  4GC7 A;  4YQW A;  8ICV A;  4YD2 A;  4F5P A;  1JMS A;  1ZQV A;  3C21 A;  3Q8K A;  4CCH A;  5KTQ A;  4O3N A;  3PR4 A;  3EZ5 A;  1X2I A;  2RDJ A;  5KFT A;  1QSS A;  3QZ7 A;  2MUT A;  1RXV A;  5DLG A;  4KLU A;  3SYZ A;  4MEY A;  4YMN A;  2ZUC A;  2BQR A;  5KFX A;  1JXL A;  8ICP A;  4DO9 A;  8ICK A;  2IMW P;  4K4I A;  4JV0 A;  4FBU A;  5DKW A;  4FS1 A;  1X9M A;  3ZDB A;  2ZUD A;  5J0S A;  3GIM A;  4ECR A;  3MR6 A;  1SZP A;  1XU4 A;  4DS5 A;  4BXO A;  4Q45 A;  4KLD A;  4KLF A;  3C23 A;  4I2I A;  5J2H A;  3T5L A;  3RB4 A;  5J2J A;  3AUO A;  4DQQ A;  4QZI A;  2PFO A;  5HHH A;  1NK8 A;  4YMO A;  5DG7 A;  5J0T A;  3RH6 A;  1S0V A;  5CP2 A;  1NK9 A;  2MUT B;  5D4B A;  3GQC A;  3V6H A;  1H38 A;  2FMS A;  5KFP A;  4QZG A;  1L3T A;  8ICA A;  5KT3 A;  3SV3 A;  3ZD8 A;  5KFD A;  1D9F A;  4IQV A;  5J0W A;  4DS4 A;  4RUC A;  4QZ8 A;  3PW2 A;  3V72 A;  4RUA A;  3UXN A;  5J2K A;  2AJQ A;  8ICI A;  2JEI A;  3ETL A;  3B0X A;  5HML A;  3V6K A;  1NJX A;  4BXO B;  2HHT A;  1TFR A;  5KFY A;  4QZC A;  2Y1I A;  3PW4 A;  1JN3 A;  2XC9 A;  5J2B A;  4F4W A;  4MFA A;  4YN4 A;  4PGX A;  2Q0Z X;  1U4B A;  5KFF A;  5L9X A;  5F9L A;  3RH5 A;  2ZJA A;  3T5J A;  4EEY A;  4NLZ A;  9ICR A;  4G3I A;  5KFM A;  5DB9 A;  3MDC A;  4O5K A;  4YP3 A;  3SI8 A;  1RXW A;  4YD1 A;  8ICN A;  2UVR A;  4PHA A;  1TKD A;  3OSN A;  2R8G A;  4DFJ A;  2PI5 A;  4KLT A;  1BVS A;  3H7I A;  5HNK A;  5KFL A;  2XO7 A;  3RR7 A;  3TI0 A;  4RT3 A;  3TFR A;  4QZA A;  2KZM A;  1TAU A;  4ECX A;  4J9S A;  3RB6 A;  3MDA A;  3MR5 A;  2NRX A;  7ICU A;  3V7K A;  3BJY A;  2BKE A;  4GXI A;  8ICL A;  2JZB A;  2BCQ A;  1A77 A;  2W9C A;  4RQ3 A;  2AU0 A;  1D8L A;  4R66 A;  2ASL A;  4IQU A;  3K75 D;  4LZD A;  1TAQ A;  5IIL A;  2ALZ A;  4O5C A;  1ZQL A;  4Z6F A;  1SKS A;  2PFN A;  4M9N A;  1L3U A;  2BDP A;  2HVI A;  4KMU A;  3BQ2 A;  8ICH A;  1ZQX A;  2GWS A;  4M9H A;  4EYI B;  4PHD A;  4ECS A;  4ECT A;  8ICB A;  2BHN A;  2HHU A;  4C8N A;  5J2E A;  4F92 B;  1MC8 A;  5DDY A;  5KG3 A;  4UAZ A;  2JEG A;  4F4X A;  4J9P A;  2JZB B;  8ICE A;  2PXI A;  2W9C B;  4C8O A;  3TAP A;  2WTF A;  5J0O A;  4UB4 A;  4ECV A;  1ZET A;  3JPR A;  8ICM A;  2R8H A;  4PPX A;  4B9M A;  4QZB A;  4KLG A;  4YCX A;  3EWA A;  5DGB A;  5CA7 A;  9ICM A;  2BPC A;  2W9M A;  2R8I A;  4F4Y A;  4KLH A;  2BQ3 A;  4ECZ A;  3RJJ A;  4YMM A;  4UBB A;  3NGD A;  1S0N A;  4K4G A;  1B22 A;  2ZTC A;  2XCP A;  2HHQ A;  3Q8P B;  1DOQ A;  1ZQW A;  2ZTD A;  4RPX A;  3ZD9 A;  4ECU A;  1QSL A;  5J0Y A;  1QSY A;  3PO4 A;  5HMM A;  4RQ6 A;  1ZYQ A;  4I28 A;  1X9S A;  5KT4 A;  4PGY A;  1SL1 A;  1X9W A;  2FLL A;  3ISD A;  3SZ2 A;  4O3Q A;  3UPQ A;  1XSL A;  1ZQI A;  7ICJ A;  4DLE A;  8ICW A;  4KIT B;  1K1Q A;  4P4P A;  3MAB A;  3OSP A;  2BCR A;  4IRD A;  1HJP A;  3RJH A;  4J9K A;  4R8U A;  4RQ0 A;  5DLF A;  4QZE A;  4PH5 A;  3QEB Z;  3HW8 A;  4ED0 A;  2ZJ5 A;  2Y1J A;  3JPS A;  2JEJ A;  3GV7 B;  2BQU A;  4RQ1 A;  1ZQY A;  3GFK B;  4ZH4 A;  3C2L A;  3M9M B;  4DSF A;  3RJG A;  3Q8R B;  4NM2 A;  2IHM A;  5HHI A;  2PFP A;  2BGW A;  1KEJ A;  2FPM A;  3FYH A;  1TV9 A;  4KLE A;  4DSE A;  5J2D A;  2F1H A;  4I2F A;  2KN7 A;  4LZG A;  1CEZ A;  3KHL A;  1JX4 A;  5D46 A;  3UQ0 A;  2OWO A;  4J9R A;  5KG5 A;  1TK0 A;  4ED1 A;  7ICI A;  3TAN A;  4B9T A;  3BQ0 A;  4YXJ A;  4QZD A;  2A1J A;  3TAQ A;  1ZJM A;  4RPZ A;  3ZDC A;  3H4B A;  1NK5 A;  4BWM A;  3QZ8 A;  5DQG A;  2IA6 A;  4DSI A;  3GIL A;  4RPY A;  9ICE A;  2ZTE A;  5DB6 A;  4DFK A;  5IIO A;  4J9Q A;  5IIK A;  2C2D A;  1QLN A;  3LWM A;  7ICG A;  4F2S A;  1XWL A;  4RQ7 A;  4KLO A;  4B9V A;  3PML A;  4ED3 A;  5F9N A;  3T5K A;  3T3F A;  3THV A;  1S97 A;  9ICL A;  4B9N A;  4MF2 A;  3EW9 A;  3PO5 A;  2AGP A;  3TAR A;  1U9L A;  1ZQT A;  4NM1 A;  4GXK A;  1NK6 A;  4M9J A;  8ICS A;  2A1J B;  5KT2 A;  1SL2 A;  2W8K A;  1SKW A;  5III A;  4KLM A;  2P6U A;  7ICT A;  4RQ5 A;  1IM4 A;  1ZQP A;  3LDA A;  4RZR A;  9ICX A;  1NKC A;  3RTV A;  3Q8L A;  7ICF A;  3FDS A;  3H8W A;  3NTU A;  1XSP A;  5KFV A;  1ZQO A;  2R8J A;  9ICJ A;  3QE9 Y;  1KFT A;  4ECY A;  2VA3 A;  3RBD A;  4IR1 A;  2UVU A;  5KFU A;  5DBC A;  3UQ2 A;  1UA1 A;  3GIJ A;  7ICL A;  7ICR A;  5CWR A;  3OJS A;  5DQH A;  5KFN A;  3G6X A;  4UB3 A;  4M04 A;  4KN4 A;  3ISB A;  5KFK A;  3OJU A;  1Y88 A;  2KZZ A;  3RR8 A;  3LK9 A;  4DFP A;  2V4Q A;  2BCS A;  3PX0 A;  3H4D A;  3V6J A;  2BCV A;  1CUK A;  4F91 B;  1KDH A;  9ICT A;  1NK7 A;  4PHP A;  3T5H A;  1KSP A;  2PFQ A;  4KLS A;  3M9O B;  3ISC A;  5J29 A;  4LVS A;  5KFA A;  3MR3 A;  1HUO A;  1ZQR A;  7ICQ A;  3Q8S B;  3HWT A;  5EWF A;  2HHV A;  2KFN A;  3B0Y A;  5DQI A;  7ICP A;  5HP4 A;  5DDM A;  4J9L A;  9ICP A;  2FLP A;  3GII A;  3GV8 B;  4DLG A;  2VAN A;  3RJI A;  3MR2 A;  2MAX A;  3EPI A;  1PZN A;  2W8L A;  1BPE A;  4XUS A;  4ED2 A;  3PX6 A;  3KHH A;  1EXN A;  4IQT A;  4J9M A;  3JPN A;  4BGD A;  4B9U A;  4DEZ A;  4F50 A;  1S0O A;  4ED7 A;  4KLI A;  1TK8 A;  1K1S A;  5J0Q A;  4DL7 A;  5KFG A;  5J2A A;  8ICQ A;  4O5E A;  1U47 A;  4JWN A;  1ZQJ A;  4TUR A;  4DL3 A;  1NK0 A;  1L3V A;  1ZQB A;  2FPL A;  3PX4 A;  2C2E A;  1DGS A;  3QEA Z;  1ARO P;  7ICV A;  4Q8F A;  3C2K A;  4DL2 A;  4JWM A;  4EBD A;  4IRK A;  2ASJ A;  4NLG A;  2UVV A;  3N97 B;  1BPX A;  3BDP A;  4J9N A;  4DL5 A;  4DL6 A;  3G6Y A;  3RH4 A;  1U49 A;  3ZDD A;  4F3O A;  4RT2 A;  2R8K A;  4DL4 A;  9ICQ A;  2BR0 A;  4QW8 A;  2XGQ A;  4Q43 A;  1Z3E B;  5KG7 A;  4DF4 A;  1N56 A;  2AGQ A;  4NXZ A;  2XY5 A;  5KT5 A;  4DFM A;  4HYK A;  1D9D A;  4UAW A;  1QTM A;  2DPI A;  4I27 A;  9ICS A;  4PGQ A;  4UBC A;  5KFW A;  5KG0 A;  4I29 A;  1WCN A;  4UQG A;  4Z6E A;  4J9O A;  3Q8M A;  1L5U A;  4UAY A;  3V7L A;  3TQ1 A;  1ZQD A;  4C8L A;  2ISP A;  2HW3 A;  1ZQZ A;  4JV2 A;  4BDP A;  4YFK A;  2J6T A;  1XO1 A;  4EZ6 A;  2KFZ A;  5J0R A;  4DOC A;  5TZV A;  1KTQ A;  2J6S A;  2P6R A;  2F1J A;  1NJW A;  2ASD A;  4RU9 A;  1U45 A;  4DWI A;  1ZQG A;  5CJ7 A;  4M6W A;  4QWA A;  3KHG A;  1S10 A;  9ICH A;  4DF8 A;  3HT3 A;  7ICM A;  2NRT A;  4TUP A;  1NOM A;  4O3O A;  3C2M A;  4MFC A;  5J0X A;  4DQP A;  3PW5 A;  1T8E A;  3M8S A;  4MFF A;  1Z00 A;  3RB3 A;  1S77 D;  5KFE A;  1MQ3 A;  4DOB A;  4DSK A;  2I9G A;  4R65 A;  1ZQS A;  4M2Y A;  5J2F A;  4YR3 A;  3PMN A;  3PNC A;  9ICO A;  1BPB A;  4ECQ A;  9ICG A;  3C1Y A;  1LB2 B;  5KG4 A;  1XC9 A;  4F8R A;  1MQ2 A;  3ORY A;  4P4O A;  5J0U A;  1BGX T;  3IM1 A;  4R8U B;  5JUM A;  3UXP A;  4M6W B;  4I2A A;  4I2B A;  4RQ4 A;  4XRH A;  1TVA A;  1ZQC A;  8ICF A;  3C5G A;  4E0D A;  2P66 A;  3HP6 A;  1ZQK A;  4ELT A;  5IIM A;  1UT5 A;  3TFS A;  1ZQM A;  3EYZ A;  1Z00 B;  2F1I A;  4QWC A;  4DQS A;  4RNM A;  4M0A A;  5EWE A;  2HHS A;  9ICV A;  1S76 D;  4R64 A;  2C2R A;  1ZQA A;  2M9N A;  9ICC A;  1T4G A;  2LYH A;  5DB7 A;  2I1Q A;  3BQ1 A;  2J6U A;  1NJZ A;  3PW7 A;  2UVW A;  4I2J A;  4QZH A;  4QZF A;  2H5X A;  4FBT A;  8ICJ A;  4DOA A;  4XA5 A;  4ED6 A;  1V9P A;  3MFI A;  2NRV A;  3PW0 A;  5L1I A;  8ICT A;  3RAQ A;  4B9L A;  4M9G A;  4EYH B;  2V4R A;  4Q8E A;  4F5R A;  1XS9 D;  3OHB A;  2BPF A;  4B9S A;  4I2G A;  8ICG A;  4YXM A;  2XCA A;  3PV8 A;  4IRC A;  4GLX A;  4X5V A;  3JPP A;  1RZT A;  1T3N A;  2KZ3 A;  7ICN A;  5J2C A;  1D8Y A;  3UXO A;  1JIH A;  3RAX A;  1ZQN A;  2HHX A;  2BPG A;  4K4H A;  9ICN A;  4JUZ A;  4MEX A;  3RJF A;  4F93 B;  1KFS A;  5DGA A;  5KG1 A;  4ECW A;  4KLL A;  4DQI A;  4I2E A;  5KT7 A;  2AQ0 A;  3KHR A;  5DB8 A;  5KFC A;  4YR0 A;  4KN7 A;  3OHA A;  5DG9 A;  3Q8Q B;  9ICK A;  4YG2 A;  2DFL A;  4QWE A;  1HUZ A;  1ZJN A;  1ZQQ A;  3JPQ A;  1ZQH A;  4BWJ A;  3H40 A;  3K4G A;  9ICI A;  5CHG A;  2C28 A;  4MF8 A;  3MGH A;  3G6V A;  3RRH A;  2AGO A;  1LV5 A;  2B21 A;  3BQT A;  5CR0 A;  3GIK A;  1ZQF A;  3AU2 A;  2ISO A;  3RJK A;  3MGI A;  1SL0 A;  5L1L A;  4UB2 A;  4C8M A;  1WCL A;  4PHE A;  5D49 A;  3C5F A;  5KFH A;  5L1J A;  2IBK A;  3RBE A;  3M8R A;  1KLN A;  5KFB A;  3IHQ B;  1RPL A;  3EPG A;  5DG8 A;  4QW9 A;  1RYR A;  4XQ8 A;  1BPZ A;  3HX0 A;  3RRG A;  4KLQ A;  7ICH A;  5C5J A;  1N48 A;  8ICZ A;  4KLJ A;  2XGP A;  4RQ2 A;  2W9A A;  1UT8 A;  1U48 A;  4P2H A;  3E2E A;  3H8S A;  5KFZ A;  1MSW D;  5KFO A;  4F4K A;  2FLN A;  5BPC A;  1ZQU A;  4C8K A;  2PI4 A;  8ICO A;  5KFI A;  4Z6C A;  4I2C A;  5KG2 A;  4NLK A;  3KTQ A;  9ICU A;  3PR5 B;  1BPY A;  2C22 A;  4IQW A;  4EBC A;  4TUS A;  3JPO A;  7ICK A;  4QZ9 A;  5EWG A;  2JEF A;  9ICF A;  4NY8 A;  7ICE A;  4DSJ A;  1BPD A;  4F5O A;  4RNN A;  1SKR A;  3LWL A;  1NKE A;  4Q44 A;  4YVZ A;  1COO A;  5KFJ A;  1RYS A;  8ICU A;  3C1Z A;  4UB5 A;  4TUQ A;  1NKB A;  1C7Y A;  4FS2 A;  2KTQ A;  4ELU A;  4QWD A;  4F5Q A;  2IHN A;  8ICR A;  2HHW A;  3HPO A;  5DBB A;  8ICY A;  4Z6D A;  2BCU A;  4I2D A;  1B43 A;  5KFR A;  3ZDE A;  1XSN A;  1KFD A;  3RB0 A;  4EBE A;  4O9M A;  3MFH A;  4JV1 A;  2RDI A;  1L3S A;  4O0I A;  2XY7 A;  7ICS A;  1ZQE A;  4GXJ A;  4DSL A;  2ATL A;  3N4M B;  5DBA A;  5BOM A;  2W9B A;  3V7J A;  3MBY A;  5IIJ A;  4UB1 A;  5J2G A;  3PVX A;  4KTQ A;  5KG6 A;  4EZ9 A;  2VA2 A;  4O3R A;  9ICA A;  3JPT A;  2ZJ8 A;  9ICW A;  4TQS A;  3PY8 A;  8ICX A;  4JK1 A;  3ZDA A;  2XY6 A;  4NLN A;  4QWB A;  4FO6 A;  4YR2 A;  2V9W A;  2FPK A;  5KT6 A;  4RQ8 A;  4R63 A;  8ICC A;  2VA8 A;  5EOZ A;  4P4M A;  5L1K A;  3GV5 B;  4I2H A;  1NK4 A;  1S9F A;  2DPJ A;  5CB1 A;  4M47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...