1Z00B

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
total genus 22
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00B00
4UBCA 4EZ9A 3ZDCA 7ICOA 1TAUA 1U45A 1KDHA 1H38A 4C8NA 4YXJA 2ATLA 5L9XA 3PR5B 5KFTA 4GXKA 5KTQA 3OSPA 2HVHA 3TQ1A 3H8JA 4YG2A 3RTVA 2KFNA 3M9MB 3SV3A 5DBCA 3V7KA 4JWNA 4RQ7A 4DSFA 3RJHA 1NKBA 3LWMA 1QSYA 2NRXA 1RZTA 3OJUA 4RPZA 3JPSA 4DL7A 2IA6A 1L3SA 2HVIA 3G6YA 3V6HA 5J2JA 2WTFA 3PVXA 3QEAZ 4F4XA 2IBKA 2JEIA 5IIIA 1S0MA 3T5KA 3TAQA 1ZQCA 2PFQA 8ICRA 1JN3A 5HHHA 5KFZA 8ICBA 4KN7A 3AU6A 3Q8KA 4PHEA 5KFQA 4P4OA 4QWAA 9ICTA 2GWSA 4QZBA 1SL1A 1KSPA 5DB9A 4BGDA 4Z6DA 4UB3A 3V6KA 4B9UA 4ELVA 4KLHA 5L1LA 5J2EA 5L1JA 5IIMA 2ASDA 1X9SA 2NRWA 3ZDEA 4IRCA 5C5JA 4I2EA 2BCUA 4R66A 5DQHA 4DQSA 1D9FA 1DGSA 3ETLA 3MDAA 4PGYA 1JMSA 4F93B 5KFWA 3UXNA 4KTQA 4PGQA 4I28A 5CB1A 4MFCA 3PW4A 1AROP 4F4ZA 4YP3A 4Q45A 1BPZA 5HMLA 5DB6A 3LWLA 4GC6A 5J0XA 1UA1A 2MUTA 1IM4A 2BCRA 3UXOA 4ECYA 5DBAA 3T3FA 4DSLA 4I2AA 2C2EA 3UPQA 3C23A 2R8HA 9ICHA 5EOZA 4NM1A 1LV5A 4GXJA 4QZGA 2F1JA 3SI8A 4MF2A 1D8LA 3RH4A 4B9VA 4TQSA 4IRKA 3OHAA 4QWCA 3C1YA 3BQ0A 1KLNA 1KFSA 3JPOA 1NK4A 8ICGA 3TFSA 1NK5A 2J6TA 3B0YA 3TANA 3V72A 5J2GA 4P4PA 4QWDA 2BPGA 4M47A 4M9JA 8ICYA 1HJPA 4F4KA 4UAZA 9ICKA 3EZ5A 3PX6A 3OGUA 4QZAA 3MDCA 1S0NA 7ICMA 4DOAA 4F5NA 2RDJA 5DKWA 2ASJA 4C8MA 5KFDA 5J0SA 9ICOA 4B9MA 3EPIA 4GXIA 3RBEA 4ECQA 4YQWA 3PY8A 8ICNA 9ICCA 1XS9D 2ZTCA 4YR3A 1T8EA 8ICMA 3BDPA 4RT3A 4QW9A 2W9CA 2R8JA 4F5PA 1ZQXA 3C2MA 4ED8A 8ICTA 3RRGA 1B22A 3H40A 4ED2A 1T7PA 3PX0A 3TAPA 5EWEA 3EYZA 1Z00A 5KT2A 1XO1A 3M8SA 3RH5A 3RJJA 2FLPA 3JPQA 5DQGA 5J2DA 2ZJ5A 4RQ3A 4TQRA 2Y1JA 1PZNA 4Z6CA 4F5OA 5CJ7A 4KLLA 3EW9A 4F2SA 9ICJA 4DSEA 4KLDA 3G6XA 4J9OA 4C8KA 1N56A 2VANA 4RQ8A 3HX0A 4BDPA 1ZQLA 3RJEA 1SKWA 9ICIA 4J9SA 5KFPA 2BHNA 4IRDA 7ICVA 3JPTA 4JK1A 2BQUA 3THVA 9ICAA 3Q8RB 4ED3A 3MGIA 4F8RA 7ICJA 1KFDA 4YMMA 4MEYA 4FS2A 3Q8MA 5IIJA 1D8YA 2HHQA 4BXOB 2I1QA 1XSLA 2JEFA 4O5CA 5DGAA 1XWLA 3MR3A 4NLGA 4LVSA 1TV9A 3PMNA 2ZJAA 3K4GA 4NXZA 3BJYA 9ICVA 3ISBA 5DDYA 4O3NA 1JXEA 3OJSA 2AJQA 4UAWA 4RNNA 3PMLA 5BOLA 3HWTA 2FPLA 4I2JA 3PR4A 2BR0A 1S0OA 1NK6A 4LZGA 8ICQA 4XUSA 3N4MB 1A77A 4LZDA 2PFPA 4X5VA 4I29A 1COOA 2B21A 2V4RA 2ZTDA 2FPMA 4UB1A 1X9WA 9ICPA 3V7JA 4ELTA 2HHUA 1U9LA 5KFLA 4JV0A 4EBEA 4FO6A 3PW2A 8ICEA 4UAYA 2XY6A 3LDAA 4BWJA 5J2AA 2XO7A 4O3QA 7ICRA 4IR1A 5KFJA 1NJXA 9ICXA 3GFKB 4EYHB 3TFRA 1UT5A 4PHAA 2NRVA 3RAXA 2C2RA 3V7LA 3NGDA 2AU0A 5CP2A 1TK5A 3KHLA 4M9HA 5IIOA 3QE9Y 2ISPA 4Z6FA 1QLNA 8ICWA 1K1SA 1CUKA 4QZEA 5J0PA 2UVRA 3C1ZA 3M9NB 2ASLA 4DFPA 4RPXA 5KFXA 1S10A 7ICHA 2BCVA 1A76A 4QWEA 3TI0A 3PW7A 5CA7A 1B43A 5DLFA 5KT7A 5J0UA 4I2CA 1XC9A 3GQCA 4F4YA 7ICNA 4R8UA 3RJFA 4IQUA 5J2CA 4UQGA 1NK9A 7ICGA 2W9CB 3MFHA 3H4DA 5JUMA 4K4IA 3GIKA 1SZPA 3GV7B 2MUTB 1UT8A 4DF4A 3RAQA 1MC8A 4YXMA 1KTQA 1ZQWA 1WCLA 3QEBZ 5DB8A 7ICFA 8ICOA 3MR5A 4YD1A 4MFFA 2UVVA 3SV4A 2C2DA 5KT5A 4I27A 5KG3A 4PGXA 4JV2A 4RQ5A 2XGPA 5J2FA 3JPRA 1SKSA 1S97A 4YCXA 5DDMA 2PXIA 2PFNA 5KFOA 8ICAA 1ZQRA 3UQ0A 2ISOA 3HT3A 4RT2A 2V4QA 5KG7A 3C21A 3H8WA 3HW8A 1ZQFA 3MGHA 1ZQEA 7ICSA 4ED7A 9ICSA 4DSJA 5KFSA 2KZ3A 3NTUA 4I2HA 2XC9A 1TK0A 1ZQUA 1MQ3A 2J6UA 4ED1A 2XGQA 2NRZA 4F91B 4QWBA 1T3NA 4BXOA 3GILA 3ZDAA 4NLNA 3MABA 1NJYA 4QZHA 4DOBA 2ALZA 1C7YA 4GLXA 5KT3A 1RXWA 4ECRA 2HHSA 4ECXA 1ZQYA 2ZTEA 4DSKA 4KLSA 2Q0ZX 4TURA 4KLTA 4TUPA 2KN7A 1RXVA 3RJGA 4B9NA 5DG7A 4K4GA 4DSIA 1Z3EB 4TUSA 3C2LA 5L1IA 1ZQOA 4F2RA 2XY7A 3N97B 1BPEA 3PO4A 4M9LA 4O3PA 5EWFA 4K4HA 2DPJA 2VA8A 4QW8A 4DL5A 2UVWA 2ZUDA 2R8GA 3QZ7A 3JPPA 4UB5A 2UVUA 3RR8A 2W9BB 3MFIA 8ICCA 3RB6A 1XSNA 4IQWA 5KFIA 5J0WA 4J9NA 2FMPA 4DQPA 2KZZA 7ICIA 5KFRA 4I2IA 4YMNA 2HHXA 5KG2A 3PNCA 4RQ1A 1ZQHA 1JIHA 1TAQA 2ZUBA 5D46A 5KFMA 5KFKA 3ZDDA 4QZFA 8ICXA 3RB4A 1QSSA 4UB4A 4DS4A 2W9BA 3BQ1A 1ZQQA 5KFFA 2PI5A 4BWMA 7ICEA 1S77D 4JV1A 2DFLA 4F5QA 4J9PA 2MAXA 9ICUA 4JUZA 2FMSA 5F9LA 5DG8A 4R8UB 2BGWA 4DF8A 3RR7A 3M9OB 3EPGA 7ICLA 8ICJA 2W9AA 4PHDA 4YN4A 5J2HA 4Q8EA 3GDXA 3C2KA 4UBBA 3FDSA 5DG9A 5KFAA 5HNKA 1KRPA 4B9TA 4KLFA 3M8RA 8ICZA 4M6WB 4EEYA 2BPCA 2ZUCA 5KG0A 3K75D 4RUCA 3GIJA 1D9DA 2J6SA 3GIMA 2HHVA 2HHWA 5BOMA 3T5HA 1MQ2A 1NKCA 4O3SA 4DL4A 1L3VA 2HHTA 3BQTA 8ICPA 1KFTA 3QZ8A 3RB0A 1U48A 3IM1A 1ZETA 3HP6A 3RRHA 4QZDA 4PPXA 2H5XA 4KN4A 4R63A 1ZQJA 3H4BA 3RBDA 4O0IA 1XSPA 4YD2A 3MBYA 1ZQPA 3E2EA 4F92B 1Z00B 5KFVA 1NOMA 2LYHA 2RDIA 3PO5A 1TKDA 2P6RA 2M9NA 4CCHA 4O3RA 1S0VA 4ECUA 1RYSA 1U4BA 4I2BA 2DPIA 3ISCA 4RQ0A 3Q8PB 5IILA 3V6JA 4PHPA 3UQ2A 5J0TA 4J9RA 3C5GA 4DFJA 1NKEA 4M9GA 9ICGA 2F1IA 4RQ2A 2V9WA 4XQ8A 5KFGA 4KLJA 4UB2A 4C8OA 1ZQKA 8ICUA 4YFKA 5KT4A 4J9MA 4R64A 3LK9A 3MR6A 4TUQA 1NK8A 9ICQA 1ZYQA 1SKRA 3PW0A 2OWOA 4QZ9A 5HHIA 4QZIA 2AGPA 3OSNA 4ED6A 1X2IA 4IR9A 3RJKA 4RZRA 4ECZA 1JX4A 2BDPA 4DEZA 4DQQA 1ZQSA 1ZQTA 4KLEA 1BPYA 4ECVA 4G3IA 4DLGA 5KG6A 1SL0A 4O9MA 5CWRA 4GC7A 5KT6A 4YR0A 1N48A 4DOCA 3KTQA 4JWMA 4R65A 5J0YA 1RPLA 1XU4A 3EWAA 3Q8LA 3ORYA 4KLUA 4KITB 4YMOA 4O5EA 4YVZA 2ZJ8A 2XCAA 7ICQA 4J9KA 3T5JA 2I9GA 7ICTA 4RQ6A 2F1HA 3PX4A 2IHMA 4DWIA 4QZCA 4I2FA 5DGBA 9ICNA 4NY8A 1WCNA 2JZBA 5D4BA 1HUZA 1HUOA 5IINA 9ICLA 2VA2A 1ZJMA 1ZQAA 4DO9A 1ZQGA 2KZMA 1Y88A 2AQ0A 4O3OA 2XCPA 9ICBA 2W9MA 4RPYA 4FBUA 3IHQB 2PFOA 9ICFA 4RUAA 4YR2A 4DFMA 4KMUA 8ICSA 5KFEA 3AUOA 4RQ4A 1ZQIA 4XA5A 2P6UA 1ZJNA 5KFBA 3JPNA 4DFKA 4M04A 1NK0A 8ICVA 3SZ2A 1ZQMA 4EBDA 3PV8A 4DL6A 5HMMA 4ELUA 5J0OA 1ZQVA 1BPDA 4I2DA 4I2GA 2W8KA 2AGQA 2W8LA 2VA3A 4PH5A 5DB7A 4M6WA 5J2BA 1T4GA 1L5UA 4EBCA 1EXNA 3ISDA 2KFZA 1TK8A 1U47A 2Y1IA 2XY5A 2FLLA 8ICLA 9ICMA 1JXLA 2A1JB 3Q8SB 4M2YA 1TVAA 2JEJA 4NM2A 4HYKA 5J2KA 2IHNA 3GV5B 1L3UA 5KG5A 1ZQZA 8ICFA 2R8IA 2FPKA 5J0RA 4RU9A 5KG1A 3RH6A 2C22A 4F3OA 4Q44A 5D49A 3GIIA 4B9LA 5DBBA 3Q8QB 1ZQDA 5DLGA 2IMWP 1NJZA 3KHRA 5J0QA 3HPOA 4KLOA 1V9PA 3T5LA 1UA0A 1ZQBA 1S76D 1RYRA 2HW3A 4O5KA 4DQRA 3H8SA 5KFYA 1SL2A 2FMQA 9ICEA 5CHGA 4E0DA 7ICUA 3ZDBA 3B0XA 4M9NA 3G6VA 5DQIA 2AQ4A 4C8LA 4FS1A 3KHHA 3FYHA 2AGOA 8ICKA 4Z6EA 3OHBA 3SYZA 4B9SA 4KLQA 2BPFA 5KFUA 5CR0A 1IXRA 9ICWA 5KFNA 2PI4A 4DQIA 2NRTA 5IIKA 4IQTA 5F9NA 1TFRA 4F50A 7ICKA 2JEGA 5BPCA 8ICIA 4DL3A 4F5RA 1LB2B 4MFAA 1X9MA 4P4MA 4EYIB 4IQVA 3GV8B 3UXPA 2A1JA 3RJIA 8ICHA 3KHGA 3ZD9A 3AU2A 3H7IA 3MR2A 4ECSA 4J9QA 7ICPA 1MSWD 1QTMA 4ZH4A 1DOQA 2R8KA 4DLEA 1ZQNA 1K1QA 4QZ8A 2BCSA 2BKEA 2P66A 1U49A 1NJWA 2JZBB 1CEZA 1QSLA 9ICRA 1S9FA 4XRHA 4J9LA 5TZVA 4RNOA 1L3TA 4NLKA 4ED0A 5J2IA 5HP4A 2KTQA 2BCQA 4NLZA 4DS5A 4ECWA 5KG4A 3ZD8A 1BVSA 4MEXA 5EWGA 1BGXT 3TARA 4KLMA 1KEJA 5L1KA 2BQ3A 4Q43A 4EZ6A 4FBTA 4KLGA 3RB3A 2BQRA 3C5FA 1NK7A 4DL2A 5KFCA 1BPBA 3PW5A 5KFHA 4F4WA 2C28A 4P2HA 4Q8FA 1BPXA 4RNMA 4ECTA 4MF8A 4M0AA 4KLIA 2FLNA 5J29A 3BQ2A
chains in the Genus database with same CATH superfamily
4EZ9A 1TAUA 5AIBA 3E58A 2ATLA 5L9XA 3WK4A 2OXOA 4GXKA 5EE0A 3SENA 1ZRNA 3RTVA 2K4IA 2YN4A 3M9MB 4DSFA 2NRXA 1FEZA 3OJUA 3JPSA 2HVIA 3V6HA 5J2JA 3QEAZ 1GO3F 4F4XA 4IS7A 3T5KA 8ICRA 2PFQA 1JN3A 2G5HB 1JALA 2D3DA 4PHEA 4QWAA 2GWSA 1KSPA 4ELVA 4Z6DA 5ALNA 5IIMA 1YZ6A 1D9FA 5AI0A 1L7NA 5B5EU 3ETRA 5AI4A 5HMLA 5DB6A 4GC6A 5ALHA 2HHTA 3UPQA 3C23A 2E5SA 4USAA 1WUDA 5ALZA 2ZIXB 4B9VA 4QWCA 5AI6A 3JPOA 1B4FA 2HSZA 3TANA 3V72A 4P4PA 4M9JA 1SIJA 1HJPA 4UAZA 2WF8A 1WWVA 2FJ6A 3PX6A 4QZAA 7ICMA 4F5NA 5DKWA 1SB3C 4B9MA 5EE1A 2GH1A 1T8EA 8ICMA 3BDPA 4CGZA 2R8JA 1ZQXA 4ED8A 3RRGA 4FZMA 5EWEA 2MRLA 1SV0A 3NVVA 1Z00A 5KT2A 3RJJA 2Y1JA 1Q8KA 1PZNA 1SWWA 1N56A 4RQ8A 3HX0A 1ECWA 5AICA 1ZD5A 2WB1F 2BHNA 1V85A 2ZIVB 2PMZF 4FS2A 5IIJA 2OHFA 3DEEA 4O3MA 2WAQF 3QUBA 5AI9A 3ISBA 2FPLA 4LZGA 4LZDA 5ALRA 1COOA 2FPMA 4UB1A 3V7JA 2HHUA 2RP5A 5ALGA 8ICEA 2XY6A 1KW4A 2K4HA 3TFRA 2HBKA 2AU0A 1SGGA 2LYAA 1QLNA 1CUKA 4QZEA 1VDVA 3M9NB 1S10A 7ICHA 2BCVA 1A76A 2IOHA 4Y2TA 1B43A 4Y2XA 2I6XA 5ALSA 5J0UA 3GQCA 1XC9A 3R9KA 3M7DA 7ICNA 4R8UA 3RJFA 4CE6A 2OCEA 2RHFA 2XI9A 3GIKA 4DF4A 3SAGA 2E1FA 5KT5A 1SKSA 1S97A 4YCXA 3QX7A 2E8OA 2PFNA 5ALEA 8ICAA 2WB1C 2V4QA 7ICSA 4ED7A 4KX5A 4DSJA 1ZD2P 1ZQUA 1MQ3A 4PZOA 2XGQA 2FI1A 4BXOA 4CNQA 3UM9A 4QZHA 1C7YA 1ZQ1C 1RXWA 3SR6A 2HMXA 4ECXA 2ZTEA 2LM4A 1L7PA 4TURA 2KN7A 3HKZF 4DSIA 1ZQOA 2XIDA 1ED1A 5ALKA 1N62A 4M9LA 4K4HA 3E0FA 2UVWA 1XSNA 4IQWA 5KFIA 5J0WA 4DQPA 3NS1A 7ICIA 2FE9A 3PNCA 4RQ1A 1JIHA 8ICXA 5FP0A 2WF7A 3RB4A 4DS4A 3BQ1A 2PI5A 2QB0B 3C29A 7ICEA 4J9PA 2MAXA 9ICUA 2BGWA 5ALXA 8ICJA 4UBBA 5HNKA 8ICZA 3GIJA 3LYSA 4RUCA 2F76X 1D9DA 5J8YA 2E1EA 4O3SA 3J81j 1U48A 3N7PD 1ZETA 1QCKA 4CRXA 4OO1J 4YD2A 1BNOA 1Z00B 5KFVA 1NOMA 2RDIA 5JRTA 3PO5A 1K5OA 4RQNA 5ALUA 3KKAC 1RYSA 4AP9A 3V6JA 4C4TA 5KAIU 1NKEA 5AI5A 1PK3A 5KFGA 4KLJA 1YT3A 4C8OA 4YFKA 3ICXA 5KT4A 4J9MA 5K4LA 3LK9A 2QB0A 1ZYQA 4ZOHC 2DQNB 4QZIA 2QARB 4RZRA 4ECZA 2BDPA 4DQQA 1ZQSA 4ECVA 1SL0A 3KZXA 1XU4A 2H3VA 2QARA 2ZJ8A 5ALIA 7ICQA 3T5JA 1RG6A 5TISU 2PMZC 4I2FA 1X40A 1HUOA 2VA2A 4DO9A 5AK4A 1ZQGA 2KZMA 4O3OA 4P0QB 2NV3A 4EELA 3IHQB 2IOFK 1HIWA 2P6UA 5KFBA 2ZIUB 5JU5A 4ELUA 2WAQC 4EX6A 2W8KA 5AIAA 1L5UA 1TK8A 4BUGA 3BS7A 2A1JB 4FZNA 1TVAA 8ICFA 3N28A 3FM9A 2H3IA 3I76A 5D49A 2F8KA 2EQYA 2IMWP 1NJZA 5J0QA 3HPOA 3OTQA 4GIBA 1V9PA 3IN5A 2P35A 1B0XA 1OW5A 5KFYA 3B0XA 5DQIA 4C8LA 3H0LB 2Y0SC 1IXRA 4ICAA 5KFNA 5AM5A 2K8AA 5IIKA 3M1YA 3C28A 5F9NA 1Z1BA 2JEGA 8ICIA 1LB2B 4MFAA 4P4MA 4EYIB 3KHGA 1PK1A 4ECSA 3MR2A 1S8OA 2GLEA 2E8PA 1QQ7A 2R8KA 1DOQA 1K1QA 1T94A 4CF5A 1S9FA 1PVPA 5AKGA 5AKYA 4ED0A 1NI3A 5KNIA 2KTQA 2YMPA 1RQLA 4MEXA 4Q43A 4KLGA 1FFUA 2JH7A 3RB3A 4FE3A 2BQRA 4RNMA 4KLIA 5AM2A 5ALMA 2KJ5A 7ICOA 1KDHA 1H38A 4C8NA 1MA7A 5AKIA 5KTQA 2HVHA 3TQ1A 4YG2A 3SV3A 5DBCA 4JWNA 4C4RA 5ALQA 4DL7A 1L3SA 4IL6U 3PVXA 1DK2A 1SV4A 4C7ZA 4NLBA 5IIIA 3TKAA 4ACOA 1ZQCA 1X6IA 4PL2A 3L5KA 3AU6A 2KKPA 3SMVA 2EZZA 4J03A 1N63A 4BGDA 1P7DA 4DFDA 5L1LA 2ASDA 3WU2U 5J8YC 2NRWA 4IRCA 5DQHA 5ALLA 1JMSA 3IG5A 3QNMA 5AK5A 4KTQA 5CB1A 4MFCA 4YP3A 2RLTA 1SZHA 1IM4A 2MUTA 3UXOA 3T3FA 1LKYB 2C2EA 5ALYA 1D8LA 3RH4A 3ALRA 2ZIWB 1OXJA 2JXJA 4UAVA 3AL0B 3F2BA 3MDCA 3PSFA 2ASJA 5KFDA 9ICOA 4GXIA 3RBEA 8ICNA 2RRDA 2ZTCA 2KG5A 3QXGA 2G06A 5ALJA 2A3VA 2K4PA 4F5PA 2QKQA 8ICTA 1N2XA 3PSTA 2F8LA 3KOOA 4OJ5A 2MSNA 3TAPA 1XO1A 3JPQA 3GU3A 1J2MA 2ZJ5A 4RQ3A 3N7RC 2DKXA 4F5OA 4F2SA 4C8KA 2VANA 1SKWA 2LI6A 3L3FX 4CF3A 4F8RA 1KFDA 4MEYA 3QU2A 3Q8MA 2HHQA 4OCZA 1L8OA 5EE9A 1XSLA 4O5CA 1TV9A 2ZJAA 3K4GA 4UW9A 4O3NA 3EUB2 5BOLA 4I2JA 2BR0A 4XUSA 4X5VA 4I29A 4LJXA 2E3TA 2KMDA 4EBEA 2Y9UA 4UAYA 4BWJA 2XO7A 1NJXA 3L4PA 4PHAA 2NRVA 3RAXA 1TK5A 5CP2A 5IIOA 3QE9Y 2ISPA 4Z6FA 4GFJA 3C1ZA 1DGJA 2KIVA 4QWEA 5DLFA 3SQIA 2Y0SF 5KT7A 4I2CA 2EANA 4IQUA 1NK9A 7ICGA 2FDRA 3H4DA 3F5EA 3D2QA 3H0MB 2VKQA 8ICOA 4MFFA 2UVVA 1Z19A 5KG3A 4PGXA 1JRPA 2W43A 4RQ5A 2H3QA 2PXIA 2KHQA 2LPEA 3HT3A 3MGHA 3UMCA 5A0LA 3NTUA 4I2HA 1TK0A 2J6UA 4ED1A 3KD3A 2NRZA 3PSIA 4QWBA 4F91B 5KL1B 3GILA 3ZDAA 2ALZA 4DOBA 3AM9A 5ALOA 2HHSA 1ZQYA 4DSKA 5ALWA 3WK8A 3RJGA 4K4GA 1L7OA 5DG7A 1Z3EB 4TUSA 4F2RA 3PO4A 5G5GA 4O3PA 1WWUA 2ESEA 3BQ7A 2DPJA 3FAHA 1IG6A 4UB8U 2XVTA 2R8GA 3QZ7A 2W9BB 1MN8A 2EDUA 3MFIA 2B6GA 1CRXA 4YMNA 1ZQHA 5KFMA 2DBYA 1Z1VA 2I5HA 4CF4A 3UMBA 4BWMA 2VIXA 3H0RB 4F5QA 5F9LA 4FFDA 1URJA 3RR7A 2W9AA 2KJ9A 5J2HA 4Q8EA 3GDXA 3FDSA 5DG9A 5KFAA 4EEYA 2ZUCA 2LMRA 2WF6A 3GIMA 1NKCA 3BQTA 2F3NA 2W3SA 3IDWA 1QQ5A 3WK7A 3F2CA 4PPXA 4R63A 3RBDA 1XSPA 3TADC 3TACB 3MBYA 2LYHA 2P6RA 4CCHA 4ECUA 2ZIWA 3ISCA 3Q8PB 5IILA 4DFJA 3NUQA 2V9WA 5C0YA 5HR6A 3MR6A 4TUQA 1SKRA 4OD0A 5HHIA 1PUZA 3OSNA 3QUTA 1N61A 1X2IA 1JX4A 1A6SA 4KLEA 4DLGA 5KG6A 5KT6A 4DOCA 3KTQA 5J0YA 1RPLA 2HOQA 7ICTA 3WK5A 2F1HA 3I28A 2HI0A 2IHMA 5GTIU 9ICNA 4NY8A 1HUZA 5IINA 1ZQAA 1Y88A 2XCPA 2KSOA 2W9MA 4UASA 4FBUA 3WKEA 2PFOA 2EZXA 5KFEA 1ZQIA 1ZJNA 1LVHA 3HILA 8ICVA 1ZQMA 5AI8A 4DL6A 5HMMA 2F44A 5J0OA 1ZQVA 4I2GA 5AM4A 2W8LA 1WG8A 1SXDA 5GTHU 1U47A 2Y1IA 4M2YA 4UARA 4NM2A 4HYKA 3KKAA 1L3UA 1ZQZA 2FPKA 4RU9A 3QYPA 4PZNA 4Q44A 1X9XA 1DRGA 5DLGA 2HBLA 4F72A 1JI7A 3BZKA 2YB1A 2BDUA 1UA0A 1ZQBA 1RYRA 4O5KA 3IRUA 2FMQA 2YX8A 2ZXHA 3I1YA 3G6VA 5CRXA 3FYHA 2AGOA 8ICKA 4Z6EA 3SYZA 4B9SA 2BPFA 1ZD4A 5CR0A 3BZCA 9ICWA 2G0AA 2PI4A 4DQIA 4IQTA 4Y2YA 3WKCA 1BNPA 4BJQA 4F5RA 4IQVA 3RJIA 2A1JA 4U6PA 2LHTA 2W3RA 4J9QA 3WKAA 1ZXIA 4ZH4A 1UPHA 1ZQNA 3MGVA 2WFAA 1T3QA 3B9JA 1QSLA 5TZVA 4NLKA 4P0PB 4NLZA 5KG4A 3NRZA 3ZD8A 1N5WA 1BGXT 1KEJA 2JHDA 1V38A 4EZ6A 2HCFA 4DL2A 4P2HA 2A19A 5KFHA 4F4WA 5JTIA 4M0AA 2EAPA 2FLNA 3BQ2A 3NVYA 1LKYA 3QUCA 3ZDCA 4Y2SA 1FIQA 3T79A 2HBJA 1JUDA 2DF4B 5KFTA 4QJFB 3PR5B 4NL9C 1SXEA 4KX3A 3H8JA 2KFNA 1NKBA 2A1AA 1RZTA 1S5LU 2IA6A 3G6YA 2WTFA 4OJOA 2IBKA 1S0MA 3TAQA 5HHHA 2KEYA 2LKYA 4KN7A 3Q8KA 4P4OA 9ICTA 1SL1A 4KLHA 5L1JA 1X9SA 2LM1A 3NVWA 3ZDEA 2BCUA 1DGSA 4PGYA 2YY6A 3UXNA 1L8LA 4PGQA 4I28A 1AROP 3AQFA 2KVSA 2W55A 4F4ZA 3LWLA 2BCRA 5J0XA 4DSLA 1M6YA 4G9BA 4ECYA 5DBAA 1L7MA 3DDHA 2R8HA 2HOFA 2BZFA 4GXJA 2KICA 2QB1A 3BQ0A 3C1YA 1DK3A 1KFSA 2CXYA 1NK4A 2JH1A 3TFSA 1NK5A 2EAOA 3B0YA 2F77X 3KFUF 4QWDA 2BPGA 2MA1A 8ICYA 4F4KA 9ICKA 2VJ5A 5T14A 4OJ6A 2YMMA 2RDJA 4C8MA 4NWIA 1X42A 3EPIA 3PY8A 9ICCA 1XS9D 2K89A 4RT3A 3IV6A 3C2MA 3RF9A 4CDGA 3EYZA 2WF5A 3M8SA 3RH5A 3AN1A 2FLPA 5DQGA 2HOIA 2CRXA 4AYBC 9ICJA 4DSEA 4KLDA 3M6KA 1ZQLA 3WKDA 4J9SA 1O03A 5KFPA 4IRDA 7ICVA 4JK1A 2NO4A 3THVA 3Q8RB 4ED3A 7ICJA 5AKKA 4YMMA 2VJ4A 2H3FA 1D8YA 4BXOB 2I1QA 2JEFA 4BX9C 3LVVA 3MR3A 4NLGA 4LVSA 3PMNA 4NXZA 3BJYA 4Y2JA 1JXEA 3OJSA 4RNNA 2DUYA 4QNLA 5E79U 8ICQA 3N4MB 1A77A 3A0BU 3SEIA 1HEKA 2ZTDA 5AKXA 5KFLA 4US9A 4FO6A 3PW2A 1KKXA 3FC4A 3LDAA 5KFJA 2YTUA 1F0MA 3GFKB 2KVCA 1AQ6A 2C2RA 8ICWA 5J0PA 2UVRA 4DFPA 5KFXA 4UB6U 2YB4A 3PW7A 1KBUA 4F4YA 4AYBF 2W9CB 5JUMA 2W7OA 2AHOB 3GV7B 2MUTB 1UT8A 4IC9A 1KTQA 1ZQWA 5DB8A 3MR5A 4YD1A 3F53A 2C2DA 1NZPA 2ZIXA 4I27A 4JV2A 2EH9A 2XGPA 3JPRA 5DDMA 2JMGA 1ZQRA 3UQ0A 2ISOA 5KG7A 3C21A 3H8WA 2KOBA 3HW8A 2W03A 4DCCA 2WF9A 9ICSA 5KFSA 2ZG6A 1V97A 2XC9A 2Q4TA 2CPRA 4NLNA 5AM1A 1NJYA 5KT3A 4ECRA 2YMLA 3QU7A 4B9NA 4Y2VA 5L1IA 2XY7A 3N97B 3PSPA 3TADA 2W11A 2ZUDA 4UB5A 1CI4A 2KZZA 3KBBA 2FMPA 4I2IA 2ZUBA 5D46A 5KFKA 4QZFA 1QSSA 4UB4A 2W9BA 5KFFA 1TE2A 1S77D 2HDOA 2FMSA 4R8UB 1WYGA 3M9OB 7ICLA 1RM6C 4PHDA 4YN4A 3LVWA 4B9TA 4M6WB 1JROA 2BPCA 2J6SA 3K75D 2HHVA 2HHWA 5BOMA 1N5XA 1MQ2A 4DL4A 1KFTA 8ICPA 3QZ8A 4QZDA 2H5XA 4KN4A 1ZQJA 1RYUA 1ZQPA 3E2EA 4F92B 2KSOB 3VCBA 2M9NA 4O3RA 4I2BA 4PHPA 3UQ2A 5J0TA 3C5GA 4M9GA 9ICGA 3BS5A 4XQ8A 1ZQKA 8ICUA 4R64A 1FO4A 9ICQA 3PW0A 2NO5A 4IR9A 2JGAA 2OM6A 4O9MA 5CWRA 4GC7A 4OJPA 1N48A 4JWMA 1O08A 3EWAA 3ORYA 4KITB 4YMOA 4O5EA 3K1RB 4YVZA 2I9GA 3ZI4A 5H2FU 2RQ5A 4DWIA 1D8BA 1WCNA 2H3ZA 2JZBA 9ICLA 1RDFA 4C80A 1Q3VA 2AQ0A 3CP8A 2YQEA 4KMUA 3AUOA 4RQ4A 4XA5A 3JPNA 4DFKA 1NK0A 3D2NA 1Q3UA 1XO0A 2ZXIA 3WKBA 4I2DA 1BPDA 3SAHA 3AMZA 2ES6A 4RQMA 4PH5A 5DB7A 1T4GA 5J2BA 1EXNA 4C0ZA 2XY5A 2FLLA 1PVRA 2KE7A 3Q8SB 2JEJA 2K60A 5J2KA 2IHNA 3GV5B 2D8CA 2R8IA 1UQVA 2KIWA 1ZQDA 3M6ZA 3T5LA 1S76D 2HW3A 2GO7A 1UHUA 4DQRA 3H8SA 5CHGA 4E0DA 3ZDBA 2Y9TA 4M9NA 2AQ4A 4FS1A 2KKVA 5KFUA 2K4EA 2KHVA 4F50A 7ICKA 5BPCA 5KL8B 4DL3A 1X9MA 3H7IA 1MSWD 1QTMA 2JV3A 4DLEA 3QU9A 2G09A 4QIWF 3F2DA 4QZ8A 2B0CA 2P66A 4PL1A 1U49A 1NJWA 2JZBB 9ICRA 1L3TA 5J2IA 2PKEA 2BCQA 4DS5A 4ECWA 1BVSA 3TARA 1UCVA 2BQ3A 1XNSA 4FBTA 1NK7A 5KFCA 1BPBA 3PW5A 4Q8FA 1BPXA 4MF8A 5J29A 5KFQA 4UBCA 1U45A 4YXJA 5AKJA 1VLBA 3OSPA 2JR5A 4EENA 2HBMA 3V7KA 4RQ7A 3RJHA 3LWMA 1QSYA 2GOLA 5ALTA 4RPZA 5AM3A 3D6JA 4WJ3B 2OEHA 1NNLA 2JEIA 1QQ6A 3K1ZA 3CNHA 3CYMA 5KFZA 8ICBA 2KJ8A 4QZBA 5DB9A 1IIPA 4UB3A 3V6KA 4B9UA 5J2EA 1SWVA 1A0PA 4B6JA 5C5JA 4I2EA 5G5HA 4R66A 4DQSA 5AKLA 3ETLA 3MDAA 4F93B 1PK1B 5KFWA 3PW4A 1BPZA 4Q45A 1UA1A 3O0FA 4I2AA 2G08A 9ICHA 5EOZA 4NM1A 1LV5A 3H8MA 4QZGA 2F1JA 3SI8A 1NZBA 4MF2A 5AKZA 2IOFA 3QUQA 4TQSA 1F44A 3OHAA 4IRKA 2K8CB 1KLNA 2M0NA 8ICGA 2J6TA 2OYYA 4P0PA 2DWQA 2ZIVA 5J2GA 4Y2RA 4M47A 1Z4OA 3EZ5A 3OGUA 1S0NA 4DOAA 5J0SA 3D2SA 4ECQA 4YQWA 4YR3A 2AXTU 4QW9A 2W9CA 1COKA 1QH9A 2E8MA 1KL9A 3NASA 1B22A 3H40A 4ED2A 1T7PA 3PX0A 3QU4A 3ED5A 2CN1A 5J2DA 4TQRA 4Z6CA 5F3XB 5CJ7A 4KLLA 3EW9A 3G6XA 4J9OA 4BDPA 9ICIA 3RJEA 3JPTA 2BQUA 3HJEA 2D6FC 9ICAA 3VC8A 3RFAA 3MGIA 3UMGA 2EZYA 5DGAA 1XWLA 9ICVA 5DDYA 2QLTA 4NV0A 2NYVA 4UAWA 2AJQA 3PMLA 3HWTA 1S0OA 3NRWA 1NK6A 3PR4A 2PFPA 2B21A 1J97A 2V4RA 2W7PA 1X9WA 9ICPA 4ELTA 1U9LA 4JV0A 1C20A 5J2AA 4O3QA 7ICRA 4IR1A 5AKHA 3MC1A 4EEKA 4EYHB 9ICXA 1SV0C 1UT5A 5HR7A 3V7LA 3NGDA 2E8NA 3KHLA 4M9HA 5AKEA 1K1SA 2ASLA 4RPXA 3TI0A 2EAMA 4JB3A 2N1RA 5CA7A 2W54A 2O6KA 5J2CA 4UQGA 4QIWC 3MFHA 4K4IA 1SZPA 1X6JA 3RAQA 1MC8A 4YXMA 3QEBZ 1WCLA 2Z7JA 7ICFA 3SV4A 1Z4NA 5J2FA 5AHXA 2G07A 3QU5A 5CEHA 5B66U 5KFOA 2OH2A 3F5AA 4NL9A 4RT2A 1ZQFA 1ZQEA 3HKZC 2KZ3A 3AEVA 1T3NA 3MABA 4GLXA 1KN5A 4MHVA 3WK9A 1F5SA 4KLSA 5EE3A 2Q0ZX 4KLTA 4TUPA 1RXVA 2R18A 3C2LA 3CW2C 1BPEA 5EWFA 1OUQA 2VA8A 4QW8A 4DL5A 2UVUA 3S6JA 3JPPA 3RR8A 1FFVA 8ICCA 3RB6A 4J9NA 5KFRA 1KQQA 2HHXA 5KG2A 5AK6A 1TAQA 3ZDDA 1ZQQA 4JV1A 2DFLA 4UAUA 2KP7A 4JUZA 5DG8A 2W04A 1VJ5A 4DF8A 2KNJA 3EPGA 3C2KA 3SAFA 3PZPA 1KRPA 3DV9A 4KLFA 2JRZA 3M8RA 5KG0A 3T5HA 1L3VA 4KMOB 3RB0A 3IM1A 3HP6A 3RRHA 3HRDD 3H4BA 4NJ8A 4O0IA 1TKDA 1S0VA 1U4BA 2DPIA 1DXSA 5ALPA 4RQ0A 2DKZA 4J9RA 2F1IA 4RQ2A 2WHEA 4UB2A 3AQEA 4C4SA 2L5YA 1NK8A 2OWOA 4QZ9A 2AGPA 4ED6A 5ALFA 2KV2A 3RJKA 2K8BB 4HAIA 4DEZA 1ZQTA 1RQNA 1BPYA 4G3IA 2LBOA 4YR0A 3IP4B 4R65A 3ONNA 3Q8LA 4KLUA 2XCAA 5AM0A 1ZD3A 4J9KA 4P0QA 3PX4A 4RQ6A 1YZ7A 4QZCA 3OPXA 4C7YA 5DGBA 2DL0A 5L1MA 5D4BA 1ZJMA 9ICBA 4Y2QA 4RPYA 9ICFA 4RUAA 4YR2A 4DFMA 8ICSA 3WK6A 4JMUA 4Y2PA 2AH5A 2F2AB 3N7SC 1IV8A 4M04A 3SZ2A 2MU2A 4EBDA 3PV8A 2LYBA 2AGQA 2VA3A 2KFZA 4M6WA 4EBCA 3ISDA 2KK0A 2KD1A 8ICLA 9ICMA 1JXLA 4NLCA 5KG5A 1TAMA 5J0RA 4EX7A 5KG1A 3RH6A 2C22A 4F3OA 5AK3A 3GZFA 3GIIA 4B9LA 5DBBA 2DGZA 3Q8QB 4FZLA 3KHRA 3A0HU 3U26A 5ALVA 2YMQA 4KLOA 4US8A 1SL2A 9ICEA 7ICUA 1ZOLA 3KHHA 4OJLA 1Q46A 4UATA 3SD7A 3OHBA 1L6NA 2G5IB 4KLQA 3NVZA 4U7CA 1X66A 2NRTA 1TFRA 3CRXA 3GV8B 3UXPA 8ICHA 5ALDA 3ZD9A 3AU2A 2XICA 7ICPA 4A8EA 1ZRMA 4Y2UA 2BCSA 2BKEA 2ODGA 1CEZA 3BS5B 1PVQA 4XRHA 1J2NA 3IG8A 4J9LA 4RNOA 5HP4A 1N60A 5EWGA 2ZIUA 4KLMA 3KZIU 5L1KA 4PJ0U 5KAFU 3C5FA 2C28A 4ECTA 4F71A
chains in the Genus database with same CATH topology
4UBCA 4EZ9A 3ZDCA 7ICOA 1TAUA 1U45A 1KDHA 1H38A 4C8NA 4YXJA 2ATLA 5L9XA 3PR5B 5KFTA 4GXKA 5KTQA 3OSPA 2HVHA 3TQ1A 3H8JA 4YG2A 3RTVA 2KFNA 3M9MB 3SV3A 5DBCA 3V7KA 4JWNA 4RQ7A 4DSFA 3RJHA 1NKBA 3LWMA 1QSYA 2NRXA 1RZTA 3OJUA 4RPZA 3JPSA 4DL7A 2IA6A 1L3SA 2HVIA 3G6YA 3V6HA 5J2JA 2WTFA 3PVXA 3QEAZ 4F4XA 2IBKA 2JEIA 5IIIA 1S0MA 3T5KA 3TAQA 1ZQCA 2PFQA 8ICRA 1JN3A 5HHHA 5KFZA 8ICBA 4KN7A 3AU6A 3Q8KA 4PHEA 5KFQA 4P4OA 4QWAA 9ICTA 2GWSA 4QZBA 1SL1A 1KSPA 5DB9A 4BGDA 4Z6DA 4UB3A 3V6KA 4B9UA 4ELVA 4KLHA 5L1LA 5J2EA 5L1JA 5IIMA 2ASDA 1X9SA 2NRWA 3ZDEA 4IRCA 5C5JA 4I2EA 2BCUA 4R66A 5DQHA 4DQSA 1D9FA 1DGSA 3ETLA 3MDAA 4PGYA 1JMSA 4F93B 5KFWA 3UXNA 4KTQA 4PGQA 4I28A 5CB1A 4MFCA 3PW4A 1AROP 4F4ZA 4YP3A 4Q45A 1BPZA 5HMLA 5DB6A 3LWLA 4GC6A 5J0XA 1UA1A 2MUTA 1IM4A 2BCRA 3UXOA 4ECYA 5DBAA 3T3FA 4DSLA 4I2AA 2C2EA 3UPQA 3C23A 2R8HA 9ICHA 5EOZA 4NM1A 1LV5A 4GXJA 4QZGA 2F1JA 3SI8A 4MF2A 1D8LA 3RH4A 4B9VA 4TQSA 4IRKA 3OHAA 4QWCA 3C1YA 3BQ0A 1KLNA 1KFSA 3JPOA 1NK4A 8ICGA 3TFSA 1NK5A 2J6TA 3B0YA 3TANA 3V72A 5J2GA 4P4PA 4QWDA 2BPGA 4M47A 4M9JA 8ICYA 1HJPA 4F4KA 4UAZA 9ICKA 3EZ5A 3PX6A 3OGUA 4QZAA 3MDCA 1S0NA 7ICMA 4DOAA 4F5NA 2RDJA 5DKWA 2ASJA 4C8MA 5KFDA 5J0SA 9ICOA 4B9MA 3EPIA 4GXIA 3RBEA 4ECQA 4YQWA 3PY8A 8ICNA 9ICCA 1XS9D 2ZTCA 4YR3A 1T8EA 8ICMA 3BDPA 4RT3A 4QW9A 2W9CA 2R8JA 4F5PA 1ZQXA 3C2MA 4ED8A 8ICTA 3RRGA 1B22A 3H40A 4ED2A 1T7PA 3PX0A 3TAPA 5EWEA 3EYZA 1Z00A 5KT2A 1XO1A 3M8SA 3RH5A 3RJJA 2FLPA 3JPQA 5DQGA 5J2DA 2ZJ5A 4RQ3A 4TQRA 2Y1JA 1PZNA 4Z6CA 4F5OA 5CJ7A 4KLLA 3EW9A 4F2SA 9ICJA 4DSEA 4KLDA 3G6XA 4J9OA 4C8KA 1N56A 2VANA 4RQ8A 3HX0A 4BDPA 1ZQLA 3RJEA 1SKWA 9ICIA 4J9SA 5KFPA 2BHNA 4IRDA 7ICVA 3JPTA 4JK1A 2BQUA 3THVA 9ICAA 3Q8RB 4ED3A 3MGIA 4F8RA 7ICJA 1KFDA 4YMMA 4MEYA 4FS2A 3Q8MA 5IIJA 1D8YA 2HHQA 4BXOB 2I1QA 1XSLA 2JEFA 4O5CA 5DGAA 1XWLA 3MR3A 4NLGA 4LVSA 1TV9A 3PMNA 2ZJAA 3K4GA 4NXZA 3BJYA 9ICVA 3ISBA 5DDYA 4O3NA 1JXEA 3OJSA 2AJQA 4UAWA 4RNNA 3PMLA 5BOLA 3HWTA 2FPLA 4I2JA 3PR4A 2BR0A 1S0OA 1NK6A 4LZGA 8ICQA 4XUSA 3N4MB 1A77A 4LZDA 2PFPA 4X5VA 4I29A 1COOA 2B21A 2V4RA 2ZTDA 2FPMA 4UB1A 1X9WA 9ICPA 3V7JA 4ELTA 2HHUA 1U9LA 5KFLA 4JV0A 4EBEA 4FO6A 3PW2A 8ICEA 4UAYA 2XY6A 3LDAA 4BWJA 5J2AA 2XO7A 4O3QA 7ICRA 4IR1A 5KFJA 1NJXA 9ICXA 3GFKB 4EYHB 3TFRA 1UT5A 4PHAA 2NRVA 3RAXA 2C2RA 3V7LA 3NGDA 2AU0A 5CP2A 1TK5A 3KHLA 4M9HA 5IIOA 3QE9Y 2ISPA 4Z6FA 1QLNA 8ICWA 1K1SA 1CUKA 4QZEA 5J0PA 2UVRA 3C1ZA 3M9NB 2ASLA 4DFPA 4RPXA 5KFXA 1S10A 7ICHA 2BCVA 1A76A 4QWEA 3TI0A 3PW7A 5CA7A 1B43A 5DLFA 5KT7A 5J0UA 4I2CA 1XC9A 3GQCA 4F4YA 7ICNA 4R8UA 3RJFA 4IQUA 5J2CA 4UQGA 1NK9A 7ICGA 2W9CB 3MFHA 3H4DA 5JUMA 4K4IA 3GIKA 1SZPA 3GV7B 2MUTB 1UT8A 4DF4A 3RAQA 1MC8A 4YXMA 1KTQA 1ZQWA 1WCLA 3QEBZ 5DB8A 7ICFA 8ICOA 3MR5A 4YD1A 4MFFA 2UVVA 3SV4A 2C2DA 5KT5A 4I27A 5KG3A 4PGXA 4JV2A 4RQ5A 2XGPA 5J2FA 3JPRA 1SKSA 1S97A 4YCXA 5DDMA 2PXIA 2PFNA 5KFOA 8ICAA 1ZQRA 3UQ0A 2ISOA 3HT3A 4RT2A 2V4QA 5KG7A 3C21A 3H8WA 3HW8A 1ZQFA 3MGHA 1ZQEA 7ICSA 4ED7A 9ICSA 4DSJA 5KFSA 2KZ3A 3NTUA 4I2HA 2XC9A 1TK0A 1ZQUA 1MQ3A 2J6UA 4ED1A 2XGQA 2NRZA 4F91B 4QWBA 1T3NA 4BXOA 3GILA 3ZDAA 4NLNA 3MABA 1NJYA 4QZHA 4DOBA 2ALZA 1C7YA 4GLXA 5KT3A 1RXWA 4ECRA 2HHSA 4ECXA 1ZQYA 2ZTEA 4DSKA 4KLSA 2Q0ZX 4TURA 4KLTA 4TUPA 2KN7A 1RXVA 3RJGA 4B9NA 5DG7A 4K4GA 4DSIA 1Z3EB 4TUSA 3C2LA 5L1IA 1ZQOA 4F2RA 2XY7A 3N97B 1BPEA 3PO4A 4M9LA 4O3PA 5EWFA 4K4HA 2DPJA 2VA8A 4QW8A 4DL5A 2UVWA 2ZUDA 2R8GA 3QZ7A 3JPPA 4UB5A 2UVUA 3RR8A 2W9BB 3MFIA 8ICCA 3RB6A 1XSNA 4IQWA 5KFIA 5J0WA 4J9NA 2FMPA 4DQPA 2KZZA 7ICIA 5KFRA 4I2IA 4YMNA 2HHXA 5KG2A 3PNCA 4RQ1A 1ZQHA 1JIHA 1TAQA 2ZUBA 5D46A 5KFMA 5KFKA 3ZDDA 4QZFA 8ICXA 3RB4A 1QSSA 4UB4A 4DS4A 2W9BA 3BQ1A 1ZQQA 5KFFA 2PI5A 4BWMA 7ICEA 1S77D 4JV1A 2DFLA 4F5QA 4J9PA 2MAXA 9ICUA 4JUZA 2FMSA 5F9LA 5DG8A 4R8UB 2BGWA 4DF8A 3RR7A 3M9OB 3EPGA 7ICLA 8ICJA 2W9AA 4PHDA 4YN4A 5J2HA 4Q8EA 3GDXA 3C2KA 4UBBA 3FDSA 5DG9A 5KFAA 5HNKA 1KRPA 4B9TA 4KLFA 3M8RA 8ICZA 4M6WB 4EEYA 2BPCA 2ZUCA 5KG0A 3K75D 4RUCA 3GIJA 1D9DA 2J6SA 3GIMA 2HHVA 2HHWA 5BOMA 3T5HA 1MQ2A 1NKCA 4O3SA 4DL4A 1L3VA 2HHTA 3BQTA 8ICPA 1KFTA 3QZ8A 3RB0A 1U48A 3IM1A 1ZETA 3HP6A 3RRHA 4QZDA 4PPXA 2H5XA 4KN4A 4R63A 1ZQJA 3H4BA 3RBDA 4O0IA 1XSPA 4YD2A 3MBYA 1ZQPA 3E2EA 4F92B 1Z00B 5KFVA 1NOMA 2LYHA 2RDIA 3PO5A 1TKDA 2P6RA 2M9NA 4CCHA 4O3RA 1S0VA 4ECUA 1RYSA 1U4BA 4I2BA 2DPIA 3ISCA 4RQ0A 3Q8PB 5IILA 3V6JA 4PHPA 3UQ2A 5J0TA 4J9RA 3C5GA 4DFJA 1NKEA 4M9GA 9ICGA 2F1IA 4RQ2A 2V9WA 4XQ8A 5KFGA 4KLJA 4UB2A 4C8OA 1ZQKA 8ICUA 4YFKA 5KT4A 4J9MA 4R64A 3LK9A 3MR6A 4TUQA 1NK8A 9ICQA 1ZYQA 1SKRA 3PW0A 2OWOA 4QZ9A 5HHIA 4QZIA 2AGPA 3OSNA 4ED6A 1X2IA 4IR9A 3RJKA 4RZRA 4ECZA 1JX4A 2BDPA 4DEZA 4DQQA 1ZQSA 1ZQTA 4KLEA 1BPYA 4ECVA 4G3IA 4DLGA 5KG6A 1SL0A 4O9MA 5CWRA 4GC7A 5KT6A 4YR0A 1N48A 4DOCA 3KTQA 4JWMA 4R65A 5J0YA 1RPLA 1XU4A 3EWAA 3Q8LA 3ORYA 4KLUA 4KITB 4YMOA 4O5EA 4YVZA 2ZJ8A 2XCAA 7ICQA 4J9KA 3T5JA 2I9GA 7ICTA 4RQ6A 2F1HA 3PX4A 2IHMA 4DWIA 4QZCA 4I2FA 5DGBA 9ICNA 4NY8A 1WCNA 2JZBA 5D4BA 1HUZA 1HUOA 5IINA 9ICLA 2VA2A 1ZJMA 1ZQAA 4DO9A 1ZQGA 2KZMA 1Y88A 2AQ0A 4O3OA 2XCPA 9ICBA 2W9MA 4RPYA 4FBUA 3IHQB 2PFOA 9ICFA 4RUAA 4YR2A 4DFMA 4KMUA 8ICSA 5KFEA 3AUOA 4RQ4A 1ZQIA 4XA5A 2P6UA 1ZJNA 5KFBA 3JPNA 4DFKA 4M04A 1NK0A 8ICVA 3SZ2A 1ZQMA 4EBDA 3PV8A 4DL6A 5HMMA 4ELUA 5J0OA 1ZQVA 1BPDA 4I2DA 4I2GA 2W8KA 2AGQA 2W8LA 2VA3A 4PH5A 5DB7A 4M6WA 5J2BA 1T4GA 1L5UA 4EBCA 1EXNA 3ISDA 2KFZA 1TK8A 1U47A 2Y1IA 2XY5A 2FLLA 8ICLA 9ICMA 1JXLA 2A1JB 3Q8SB 4M2YA 1TVAA 2JEJA 4NM2A 4HYKA 5J2KA 2IHNA 3GV5B 1L3UA 5KG5A 1ZQZA 8ICFA 2R8IA 2FPKA 5J0RA 4RU9A 5KG1A 3RH6A 2C22A 4F3OA 4Q44A 5D49A 3GIIA 4B9LA 5DBBA 3Q8QB 1ZQDA 5DLGA 2IMWP 1NJZA 3KHRA 5J0QA 3HPOA 4KLOA 1V9PA 3T5LA 1UA0A 1ZQBA 1S76D 1RYRA 2HW3A 4O5KA 4DQRA 3H8SA 5KFYA 1SL2A 2FMQA 9ICEA 5CHGA 4E0DA 7ICUA 3ZDBA 3B0XA 4M9NA 3G6VA 5DQIA 2AQ4A 4C8LA 4FS1A 3KHHA 3FYHA 2AGOA 8ICKA 4Z6EA 3OHBA 3SYZA 4B9SA 4KLQA 2BPFA 5KFUA 5CR0A 1IXRA 9ICWA 5KFNA 2PI4A 4DQIA 2NRTA 5IIKA 4IQTA 5F9NA 1TFRA 4F50A 7ICKA 2JEGA 5BPCA 8ICIA 4DL3A 4F5RA 1LB2B 4MFAA 1X9MA 4P4MA 4EYIB 4IQVA 3GV8B 3UXPA 2A1JA 3RJIA 8ICHA 3KHGA 3ZD9A 3AU2A 3H7IA 3MR2A 4ECSA 4J9QA 7ICPA 1MSWD 1QTMA 4ZH4A 1DOQA 2R8KA 4DLEA 1ZQNA 1K1QA 4QZ8A 2BCSA 2BKEA 2P66A 1U49A 1NJWA 2JZBB 1CEZA 1QSLA 9ICRA 1S9FA 4XRHA 4J9LA 5TZVA 4RNOA 1L3TA 4NLKA 4ED0A 5J2IA 5HP4A 2KTQA 2BCQA 4NLZA 4DS5A 4ECWA 5KG4A 3ZD8A 1BVSA 4MEXA 5EWGA 1BGXT 3TARA 4KLMA 1KEJA 5L1KA 2BQ3A 4Q43A 4EZ6A 4FBTA 4KLGA 3RB3A 2BQRA 3C5FA 1NK7A 4DL2A 5KFCA 1BPBA 3PW5A 5KFHA 4F4WA 2C28A 4P2HA 4Q8FA 1BPXA 4RNMA 4ECTA 4MF8A 4M0AA 4KLIA 2FLNA 5J29A 3BQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UBC A;  4EZ9 A;  3ZDC A;  7ICO A;  1TAU A;  1U45 A;  1KDH A;  1H38 A;  4C8N A;  4YXJ A;  2ATL A;  5L9X A;  3PR5 B;  5KFT A;  4GXK A;  5KTQ A;  3OSP A;  2HVH A;  3TQ1 A;  3H8J A;  4YG2 A;  3RTV A;  2KFN A;  3M9M B;  3SV3 A;  5DBC A;  3V7K A;  4JWN A;  4RQ7 A;  4DSF A;  3RJH A;  1NKB A;  3LWM A;  1QSY A;  2NRX A;  1RZT A;  3OJU A;  4RPZ A;  3JPS A;  4DL7 A;  2IA6 A;  1L3S A;  2HVI A;  3G6Y A;  3V6H A;  5J2J A;  2WTF A;  3PVX A;  3QEA Z;  4F4X A;  2IBK A;  2JEI A;  5III A;  1S0M A;  3T5K A;  3TAQ A;  1ZQC A;  2PFQ A;  8ICR A;  1JN3 A;  5HHH A;  5KFZ A;  8ICB A;  4KN7 A;  3AU6 A;  3Q8K A;  4PHE A;  5KFQ A;  4P4O A;  4QWA A;  9ICT A;  2GWS A;  4QZB A;  1SL1 A;  1KSP A;  5DB9 A;  4BGD A;  4Z6D A;  4UB3 A;  3V6K A;  4B9U A;  4ELV A;  4KLH A;  5L1L A;  5J2E A;  5L1J A;  5IIM A;  2ASD A;  1X9S A;  2NRW A;  3ZDE A;  4IRC A;  5C5J A;  4I2E A;  2BCU A;  4R66 A;  5DQH A;  4DQS A;  1D9F A;  1DGS A;  3ETL A;  3MDA A;  4PGY A;  1JMS A;  4F93 B;  5KFW A;  3UXN A;  4KTQ A;  4PGQ A;  4I28 A;  5CB1 A;  4MFC A;  3PW4 A;  1ARO P;  4F4Z A;  4YP3 A;  4Q45 A;  1BPZ A;  5HML A;  5DB6 A;  3LWL A;  4GC6 A;  5J0X A;  1UA1 A;  2MUT A;  1IM4 A;  2BCR A;  3UXO A;  4ECY A;  5DBA A;  3T3F A;  4DSL A;  4I2A A;  2C2E A;  3UPQ A;  3C23 A;  2R8H A;  9ICH A;  5EOZ A;  4NM1 A;  1LV5 A;  4GXJ A;  4QZG A;  2F1J A;  3SI8 A;  4MF2 A;  1D8L A;  3RH4 A;  4B9V A;  4TQS A;  4IRK A;  3OHA A;  4QWC A;  3C1Y A;  3BQ0 A;  1KLN A;  1KFS A;  3JPO A;  1NK4 A;  8ICG A;  3TFS A;  1NK5 A;  2J6T A;  3B0Y A;  3TAN A;  3V72 A;  5J2G A;  4P4P A;  4QWD A;  2BPG A;  4M47 A;  4M9J A;  8ICY A;  1HJP A;  4F4K A;  4UAZ A;  9ICK A;  3EZ5 A;  3PX6 A;  3OGU A;  4QZA A;  3MDC A;  1S0N A;  7ICM A;  4DOA A;  4F5N A;  2RDJ A;  5DKW A;  2ASJ A;  4C8M A;  5KFD A;  5J0S A;  9ICO A;  4B9M A;  3EPI A;  4GXI A;  3RBE A;  4ECQ A;  4YQW A;  3PY8 A;  8ICN A;  9ICC A;  1XS9 D;  2ZTC A;  4YR3 A;  1T8E A;  8ICM A;  3BDP A;  4RT3 A;  4QW9 A;  2W9C A;  2R8J A;  4F5P A;  1ZQX A;  3C2M A;  4ED8 A;  8ICT A;  3RRG A;  1B22 A;  3H40 A;  4ED2 A;  1T7P A;  3PX0 A;  3TAP A;  5EWE A;  3EYZ A;  1Z00 A;  5KT2 A;  1XO1 A;  3M8S A;  3RH5 A;  3RJJ A;  2FLP A;  3JPQ A;  5DQG A;  5J2D A;  2ZJ5 A;  4RQ3 A;  4TQR A;  2Y1J A;  1PZN A;  4Z6C A;  4F5O A;  5CJ7 A;  4KLL A;  3EW9 A;  4F2S A;  9ICJ A;  4DSE A;  4KLD A;  3G6X A;  4J9O A;  4C8K A;  1N56 A;  2VAN A;  4RQ8 A;  3HX0 A;  4BDP A;  1ZQL A;  3RJE A;  1SKW A;  9ICI A;  4J9S A;  5KFP A;  2BHN A;  4IRD A;  7ICV A;  3JPT A;  4JK1 A;  2BQU A;  3THV A;  9ICA A;  3Q8R B;  4ED3 A;  3MGI A;  4F8R A;  7ICJ A;  1KFD A;  4YMM A;  4MEY A;  4FS2 A;  3Q8M A;  5IIJ A;  1D8Y A;  2HHQ A;  4BXO B;  2I1Q A;  1XSL A;  2JEF A;  4O5C A;  5DGA A;  1XWL A;  3MR3 A;  4NLG A;  4LVS A;  1TV9 A;  3PMN A;  2ZJA A;  3K4G A;  4NXZ A;  3BJY A;  9ICV A;  3ISB A;  5DDY A;  4O3N A;  1JXE A;  3OJS A;  2AJQ A;  4UAW A;  4RNN A;  3PML A;  5BOL A;  3HWT A;  2FPL A;  4I2J A;  3PR4 A;  2BR0 A;  1S0O A;  1NK6 A;  4LZG A;  8ICQ A;  4XUS A;  3N4M B;  1A77 A;  4LZD A;  2PFP A;  4X5V A;  4I29 A;  1COO A;  2B21 A;  2V4R A;  2ZTD A;  2FPM A;  4UB1 A;  1X9W A;  9ICP A;  3V7J A;  4ELT A;  2HHU A;  1U9L A;  5KFL A;  4JV0 A;  4EBE A;  4FO6 A;  3PW2 A;  8ICE A;  4UAY A;  2XY6 A;  3LDA A;  4BWJ A;  5J2A A;  2XO7 A;  4O3Q A;  7ICR A;  4IR1 A;  5KFJ A;  1NJX A;  9ICX A;  3GFK B;  4EYH B;  3TFR A;  1UT5 A;  4PHA A;  2NRV A;  3RAX A;  2C2R A;  3V7L A;  3NGD A;  2AU0 A;  5CP2 A;  1TK5 A;  3KHL A;  4M9H A;  5IIO A;  3QE9 Y;  2ISP A;  4Z6F A;  1QLN A;  8ICW A;  1K1S A;  1CUK A;  4QZE A;  5J0P A;  2UVR A;  3C1Z A;  3M9N B;  2ASL A;  4DFP A;  4RPX A;  5KFX A;  1S10 A;  7ICH A;  2BCV A;  1A76 A;  4QWE A;  3TI0 A;  3PW7 A;  5CA7 A;  1B43 A;  5DLF A;  5KT7 A;  5J0U A;  4I2C A;  1XC9 A;  3GQC A;  4F4Y A;  7ICN A;  4R8U A;  3RJF A;  4IQU A;  5J2C A;  4UQG A;  1NK9 A;  7ICG A;  2W9C B;  3MFH A;  3H4D A;  5JUM A;  4K4I A;  3GIK A;  1SZP A;  3GV7 B;  2MUT B;  1UT8 A;  4DF4 A;  3RAQ A;  1MC8 A;  4YXM A;  1KTQ A;  1ZQW A;  1WCL A;  3QEB Z;  5DB8 A;  7ICF A;  8ICO A;  3MR5 A;  4YD1 A;  4MFF A;  2UVV A;  3SV4 A;  2C2D A;  5KT5 A;  4I27 A;  5KG3 A;  4PGX A;  4JV2 A;  4RQ5 A;  2XGP A;  5J2F A;  3JPR A;  1SKS A;  1S97 A;  4YCX A;  5DDM A;  2PXI A;  2PFN A;  5KFO A;  8ICA A;  1ZQR A;  3UQ0 A;  2ISO A;  3HT3 A;  4RT2 A;  2V4Q A;  5KG7 A;  3C21 A;  3H8W A;  3HW8 A;  1ZQF A;  3MGH A;  1ZQE A;  7ICS A;  4ED7 A;  9ICS A;  4DSJ A;  5KFS A;  2KZ3 A;  3NTU A;  4I2H A;  2XC9 A;  1TK0 A;  1ZQU A;  1MQ3 A;  2J6U A;  4ED1 A;  2XGQ A;  2NRZ A;  4F91 B;  4QWB A;  1T3N A;  4BXO A;  3GIL A;  3ZDA A;  4NLN A;  3MAB A;  1NJY A;  4QZH A;  4DOB A;  2ALZ A;  1C7Y A;  4GLX A;  5KT3 A;  1RXW A;  4ECR A;  2HHS A;  4ECX A;  1ZQY A;  2ZTE A;  4DSK A;  4KLS A;  2Q0Z X;  4TUR A;  4KLT A;  4TUP A;  2KN7 A;  1RXV A;  3RJG A;  4B9N A;  5DG7 A;  4K4G A;  4DSI A;  1Z3E B;  4TUS A;  3C2L A;  5L1I A;  1ZQO A;  4F2R A;  2XY7 A;  3N97 B;  1BPE A;  3PO4 A;  4M9L A;  4O3P A;  5EWF A;  4K4H A;  2DPJ A;  2VA8 A;  4QW8 A;  4DL5 A;  2UVW A;  2ZUD A;  2R8G A;  3QZ7 A;  3JPP A;  4UB5 A;  2UVU A;  3RR8 A;  2W9B B;  3MFI A;  8ICC A;  3RB6 A;  1XSN A;  4IQW A;  5KFI A;  5J0W A;  4J9N A;  2FMP A;  4DQP A;  2KZZ A;  7ICI A;  5KFR A;  4I2I A;  4YMN A;  2HHX A;  5KG2 A;  3PNC A;  4RQ1 A;  1ZQH A;  1JIH A;  1TAQ A;  2ZUB A;  5D46 A;  5KFM A;  5KFK A;  3ZDD A;  4QZF A;  8ICX A;  3RB4 A;  1QSS A;  4UB4 A;  4DS4 A;  2W9B A;  3BQ1 A;  1ZQQ A;  5KFF A;  2PI5 A;  4BWM A;  7ICE A;  1S77 D;  4JV1 A;  2DFL A;  4F5Q A;  4J9P A;  2MAX A;  9ICU A;  4JUZ A;  2FMS A;  5F9L A;  5DG8 A;  4R8U B;  2BGW A;  4DF8 A;  3RR7 A;  3M9O B;  3EPG A;  7ICL A;  8ICJ A;  2W9A A;  4PHD A;  4YN4 A;  5J2H A;  4Q8E A;  3GDX A;  3C2K A;  4UBB A;  3FDS A;  5DG9 A;  5KFA A;  5HNK A;  1KRP A;  4B9T A;  4KLF A;  3M8R A;  8ICZ A;  4M6W B;  4EEY A;  2BPC A;  2ZUC A;  5KG0 A;  3K75 D;  4RUC A;  3GIJ A;  1D9D A;  2J6S A;  3GIM A;  2HHV A;  2HHW A;  5BOM A;  3T5H A;  1MQ2 A;  1NKC A;  4O3S A;  4DL4 A;  1L3V A;  2HHT A;  3BQT A;  8ICP A;  1KFT A;  3QZ8 A;  3RB0 A;  1U48 A;  3IM1 A;  1ZET A;  3HP6 A;  3RRH A;  4QZD A;  4PPX A;  2H5X A;  4KN4 A;  4R63 A;  1ZQJ A;  3H4B A;  3RBD A;  4O0I A;  1XSP A;  4YD2 A;  3MBY A;  1ZQP A;  3E2E A;  4F92 B;  1Z00 B;  5KFV A;  1NOM A;  2LYH A;  2RDI A;  3PO5 A;  1TKD A;  2P6R A;  2M9N A;  4CCH A;  4O3R A;  1S0V A;  4ECU A;  1RYS A;  1U4B A;  4I2B A;  2DPI A;  3ISC A;  4RQ0 A;  3Q8P B;  5IIL A;  3V6J A;  4PHP A;  3UQ2 A;  5J0T A;  4J9R A;  3C5G A;  4DFJ A;  1NKE A;  4M9G A;  9ICG A;  2F1I A;  4RQ2 A;  2V9W A;  4XQ8 A;  5KFG A;  4KLJ A;  4UB2 A;  4C8O A;  1ZQK A;  8ICU A;  4YFK A;  5KT4 A;  4J9M A;  4R64 A;  3LK9 A;  3MR6 A;  4TUQ A;  1NK8 A;  9ICQ A;  1ZYQ A;  1SKR A;  3PW0 A;  2OWO A;  4QZ9 A;  5HHI A;  4QZI A;  2AGP A;  3OSN A;  4ED6 A;  1X2I A;  4IR9 A;  3RJK A;  4RZR A;  4ECZ A;  1JX4 A;  2BDP A;  4DEZ A;  4DQQ A;  1ZQS A;  1ZQT A;  4KLE A;  1BPY A;  4ECV A;  4G3I A;  4DLG A;  5KG6 A;  1SL0 A;  4O9M A;  5CWR A;  4GC7 A;  5KT6 A;  4YR0 A;  1N48 A;  4DOC A;  3KTQ A;  4JWM A;  4R65 A;  5J0Y A;  1RPL A;  1XU4 A;  3EWA A;  3Q8L A;  3ORY A;  4KLU A;  4KIT B;  4YMO A;  4O5E A;  4YVZ A;  2ZJ8 A;  2XCA A;  7ICQ A;  4J9K A;  3T5J A;  2I9G A;  7ICT A;  4RQ6 A;  2F1H A;  3PX4 A;  2IHM A;  4DWI A;  4QZC A;  4I2F A;  5DGB A;  9ICN A;  4NY8 A;  1WCN A;  2JZB A;  5D4B A;  1HUZ A;  1HUO A;  5IIN A;  9ICL A;  2VA2 A;  1ZJM A;  1ZQA A;  4DO9 A;  1ZQG A;  2KZM A;  1Y88 A;  2AQ0 A;  4O3O A;  2XCP A;  9ICB A;  2W9M A;  4RPY A;  4FBU A;  3IHQ B;  2PFO A;  9ICF A;  4RUA A;  4YR2 A;  4DFM A;  4KMU A;  8ICS A;  5KFE A;  3AUO A;  4RQ4 A;  1ZQI A;  4XA5 A;  2P6U A;  1ZJN A;  5KFB A;  3JPN A;  4DFK A;  4M04 A;  1NK0 A;  8ICV A;  3SZ2 A;  1ZQM A;  4EBD A;  3PV8 A;  4DL6 A;  5HMM A;  4ELU A;  5J0O A;  1ZQV A;  1BPD A;  4I2D A;  4I2G A;  2W8K A;  2AGQ A;  2W8L A;  2VA3 A;  4PH5 A;  5DB7 A;  4M6W A;  5J2B A;  1T4G A;  1L5U A;  4EBC A;  1EXN A;  3ISD A;  2KFZ A;  1TK8 A;  1U47 A;  2Y1I A;  2XY5 A;  2FLL A;  8ICL A;  9ICM A;  1JXL A;  2A1J B;  3Q8S B;  4M2Y A;  1TVA A;  2JEJ A;  4NM2 A;  4HYK A;  5J2K A;  2IHN A;  3GV5 B;  1L3U A;  5KG5 A;  1ZQZ A;  8ICF A;  2R8I A;  2FPK A;  5J0R A;  4RU9 A;  5KG1 A;  3RH6 A;  2C22 A;  4F3O A;  4Q44 A;  5D49 A;  3GII A;  4B9L A;  5DBB A;  3Q8Q B;  1ZQD A;  5DLG A;  2IMW P;  1NJZ A;  3KHR A;  5J0Q A;  3HPO A;  4KLO A;  1V9P A;  3T5L A;  1UA0 A;  1ZQB A;  1S76 D;  1RYR A;  2HW3 A;  4O5K A;  4DQR A;  3H8S A;  5KFY A;  1SL2 A;  2FMQ A;  9ICE A;  5CHG A;  4E0D A;  7ICU A;  3ZDB A;  3B0X A;  4M9N A;  3G6V A;  5DQI A;  2AQ4 A;  4C8L A;  4FS1 A;  3KHH A;  3FYH A;  2AGO A;  8ICK A;  4Z6E A;  3OHB A;  3SYZ A;  4B9S A;  4KLQ A;  2BPF A;  5KFU A;  5CR0 A;  1IXR A;  9ICW A;  5KFN A;  2PI4 A;  4DQI A;  2NRT A;  5IIK A;  4IQT A;  5F9N A;  1TFR A;  4F50 A;  7ICK A;  2JEG A;  5BPC A;  8ICI A;  4DL3 A;  4F5R A;  1LB2 B;  4MFA A;  1X9M A;  4P4M A;  4EYI B;  4IQV A;  3GV8 B;  3UXP A;  2A1J A;  3RJI A;  8ICH A;  3KHG A;  3ZD9 A;  3AU2 A;  3H7I A;  3MR2 A;  4ECS A;  4J9Q A;  7ICP A;  1MSW D;  1QTM A;  4ZH4 A;  1DOQ A;  2R8K A;  4DLE A;  1ZQN A;  1K1Q A;  4QZ8 A;  2BCS A;  2BKE A;  2P66 A;  1U49 A;  1NJW A;  2JZB B;  1CEZ A;  1QSL A;  9ICR A;  1S9F A;  4XRH A;  4J9L A;  5TZV A;  4RNO A;  1L3T A;  4NLK A;  4ED0 A;  5J2I A;  5HP4 A;  2KTQ A;  2BCQ A;  4NLZ A;  4DS5 A;  4ECW A;  5KG4 A;  3ZD8 A;  1BVS A;  4MEX A;  5EWG A;  1BGX T;  3TAR A;  4KLM A;  1KEJ A;  5L1K A;  2BQ3 A;  4Q43 A;  4EZ6 A;  4FBT A;  4KLG A;  3RB3 A;  2BQR A;  3C5F A;  1NK7 A;  4DL2 A;  5KFC A;  1BPB A;  3PW5 A;  5KFH A;  4F4W A;  2C28 A;  4P2H A;  4Q8F A;  1BPX A;  4RNM A;  4ECT A;  4MF8 A;  4M0A A;  4KLI A;  2FLN A;  5J29 A;  3BQ2 A; 
#chains in the Genus database with same CATH topology
 4EZ9 A;  1TAU A;  5AIB A;  3E58 A;  2ATL A;  5L9X A;  3WK4 A;  2OXO A;  4GXK A;  5EE0 A;  3SEN A;  1ZRN A;  3RTV A;  2K4I A;  2YN4 A;  3M9M B;  4DSF A;  2NRX A;  1FEZ A;  3OJU A;  3JPS A;  2HVI A;  3V6H A;  5J2J A;  3QEA Z;  1GO3 F;  4F4X A;  4IS7 A;  3T5K A;  8ICR A;  2PFQ A;  1JN3 A;  2G5H B;  1JAL A;  2D3D A;  4PHE A;  4QWA A;  2GWS A;  1KSP A;  4ELV A;  4Z6D A;  5ALN A;  5IIM A;  1YZ6 A;  1D9F A;  5AI0 A;  1L7N A;  5B5E U;  3ETR A;  5AI4 A;  5HML A;  5DB6 A;  4GC6 A;  5ALH A;  2HHT A;  3UPQ A;  3C23 A;  2E5S A;  4USA A;  1WUD A;  5ALZ A;  2ZIX B;  4B9V A;  4QWC A;  5AI6 A;  3JPO A;  1B4F A;  2HSZ A;  3TAN A;  3V72 A;  4P4P A;  4M9J A;  1SIJ A;  1HJP A;  4UAZ A;  2WF8 A;  1WWV A;  2FJ6 A;  3PX6 A;  4QZA A;  7ICM A;  4F5N A;  5DKW A;  1SB3 C;  4B9M A;  5EE1 A;  2GH1 A;  1T8E A;  8ICM A;  3BDP A;  4CGZ A;  2R8J A;  1ZQX A;  4ED8 A;  3RRG A;  4FZM A;  5EWE A;  2MRL A;  1SV0 A;  3NVV A;  1Z00 A;  5KT2 A;  3RJJ A;  2Y1J A;  1Q8K A;  1PZN A;  1SWW A;  1N56 A;  4RQ8 A;  3HX0 A;  1ECW A;  5AIC A;  1ZD5 A;  2WB1 F;  2BHN A;  1V85 A;  2ZIV B;  2PMZ F;  4FS2 A;  5IIJ A;  2OHF A;  3DEE A;  4O3M A;  2WAQ F;  3QUB A;  5AI9 A;  3ISB A;  2FPL A;  4LZG A;  4LZD A;  5ALR A;  1COO A;  2FPM A;  4UB1 A;  3V7J A;  2HHU A;  2RP5 A;  5ALG A;  8ICE A;  2XY6 A;  1KW4 A;  2K4H A;  3TFR A;  2HBK A;  2AU0 A;  1SGG A;  2LYA A;  1QLN A;  1CUK A;  4QZE A;  1VDV A;  3M9N B;  1S10 A;  7ICH A;  2BCV A;  1A76 A;  2IOH A;  4Y2T A;  1B43 A;  4Y2X A;  2I6X A;  5ALS A;  5J0U A;  3GQC A;  1XC9 A;  3R9K A;  3M7D A;  7ICN A;  4R8U A;  3RJF A;  4CE6 A;  2OCE A;  2RHF A;  2XI9 A;  3GIK A;  4DF4 A;  3SAG A;  2E1F A;  5KT5 A;  1SKS A;  1S97 A;  4YCX A;  3QX7 A;  2E8O A;  2PFN A;  5ALE A;  8ICA A;  2WB1 C;  2V4Q A;  7ICS A;  4ED7 A;  4KX5 A;  4DSJ A;  1ZD2 P;  1ZQU A;  1MQ3 A;  4PZO A;  2XGQ A;  2FI1 A;  4BXO A;  4CNQ A;  3UM9 A;  4QZH A;  1C7Y A;  1ZQ1 C;  1RXW A;  3SR6 A;  2HMX A;  4ECX A;  2ZTE A;  2LM4 A;  1L7P A;  4TUR A;  2KN7 A;  3HKZ F;  4DSI A;  1ZQO A;  2XID A;  1ED1 A;  5ALK A;  1N62 A;  4M9L A;  4K4H A;  3E0F A;  2UVW A;  1XSN A;  4IQW A;  5KFI A;  5J0W A;  4DQP A;  3NS1 A;  7ICI A;  2FE9 A;  3PNC A;  4RQ1 A;  1JIH A;  8ICX A;  5FP0 A;  2WF7 A;  3RB4 A;  4DS4 A;  3BQ1 A;  2PI5 A;  2QB0 B;  3C29 A;  7ICE A;  4J9P A;  2MAX A;  9ICU A;  2BGW A;  5ALX A;  8ICJ A;  4UBB A;  5HNK A;  8ICZ A;  3GIJ A;  3LYS A;  4RUC A;  2F76 X;  1D9D A;  5J8Y A;  2E1E A;  4O3S A;  3J81 j;  1U48 A;  3N7P D;  1ZET A;  1QCK A;  4CRX A;  4OO1 J;  4YD2 A;  1BNO A;  1Z00 B;  5KFV A;  1NOM A;  2RDI A;  5JRT A;  3PO5 A;  1K5O A;  4RQN A;  5ALU A;  3KKA C;  1RYS A;  4AP9 A;  3V6J A;  4C4T A;  5KAI U;  1NKE A;  5AI5 A;  1PK3 A;  5KFG A;  4KLJ A;  1YT3 A;  4C8O A;  4YFK A;  3ICX A;  5KT4 A;  4J9M A;  5K4L A;  3LK9 A;  2QB0 A;  1ZYQ A;  4ZOH C;  2DQN B;  4QZI A;  2QAR B;  4RZR A;  4ECZ A;  2BDP A;  4DQQ A;  1ZQS A;  4ECV A;  1SL0 A;  3KZX A;  1XU4 A;  2H3V A;  2QAR A;  2ZJ8 A;  5ALI A;  7ICQ A;  3T5J A;  1RG6 A;  5TIS U;  2PMZ C;  4I2F A;  1X40 A;  1HUO A;  2VA2 A;  4DO9 A;  5AK4 A;  1ZQG A;  2KZM A;  4O3O A;  4P0Q B;  2NV3 A;  4EEL A;  3IHQ B;  2IOF K;  1HIW A;  2P6U A;  5KFB A;  2ZIU B;  5JU5 A;  4ELU A;  2WAQ C;  4EX6 A;  2W8K A;  5AIA A;  1L5U A;  1TK8 A;  4BUG A;  3BS7 A;  2A1J B;  4FZN A;  1TVA A;  8ICF A;  3N28 A;  3FM9 A;  2H3I A;  3I76 A;  5D49 A;  2F8K A;  2EQY A;  2IMW P;  1NJZ A;  5J0Q A;  3HPO A;  3OTQ A;  4GIB A;  1V9P A;  3IN5 A;  2P35 A;  1B0X A;  1OW5 A;  5KFY A;  3B0X A;  5DQI A;  4C8L A;  3H0L B;  2Y0S C;  1IXR A;  4ICA A;  5KFN A;  5AM5 A;  2K8A A;  5IIK A;  3M1Y A;  3C28 A;  5F9N A;  1Z1B A;  2JEG A;  8ICI A;  1LB2 B;  4MFA A;  4P4M A;  4EYI B;  3KHG A;  1PK1 A;  4ECS A;  3MR2 A;  1S8O A;  2GLE A;  2E8P A;  1QQ7 A;  2R8K A;  1DOQ A;  1K1Q A;  1T94 A;  4CF5 A;  1S9F A;  1PVP A;  5AKG A;  5AKY A;  4ED0 A;  1NI3 A;  5KNI A;  2KTQ A;  2YMP A;  1RQL A;  4MEX A;  4Q43 A;  4KLG A;  1FFU A;  2JH7 A;  3RB3 A;  4FE3 A;  2BQR A;  4RNM A;  4KLI A;  5AM2 A;  5ALM A;  2KJ5 A;  7ICO A;  1KDH A;  1H38 A;  4C8N A;  1MA7 A;  5AKI A;  5KTQ A;  2HVH A;  3TQ1 A;  4YG2 A;  3SV3 A;  5DBC A;  4JWN A;  4C4R A;  5ALQ A;  4DL7 A;  1L3S A;  4IL6 U;  3PVX A;  1DK2 A;  1SV4 A;  4C7Z A;  4NLB A;  5III A;  3TKA A;  4ACO A;  1ZQC A;  1X6I A;  4PL2 A;  3L5K A;  3AU6 A;  2KKP A;  3SMV A;  2EZZ A;  4J03 A;  1N63 A;  4BGD A;  1P7D A;  4DFD A;  5L1L A;  2ASD A;  3WU2 U;  5J8Y C;  2NRW A;  4IRC A;  5DQH A;  5ALL A;  1JMS A;  3IG5 A;  3QNM A;  5AK5 A;  4KTQ A;  5CB1 A;  4MFC A;  4YP3 A;  2RLT A;  1SZH A;  1IM4 A;  2MUT A;  3UXO A;  3T3F A;  1LKY B;  2C2E A;  5ALY A;  1D8L A;  3RH4 A;  3ALR A;  2ZIW B;  1OXJ A;  2JXJ A;  4UAV A;  3AL0 B;  3F2B A;  3MDC A;  3PSF A;  2ASJ A;  5KFD A;  9ICO A;  4GXI A;  3RBE A;  8ICN A;  2RRD A;  2ZTC A;  2KG5 A;  3QXG A;  2G06 A;  5ALJ A;  2A3V A;  2K4P A;  4F5P A;  2QKQ A;  8ICT A;  1N2X A;  3PST A;  2F8L A;  3KOO A;  4OJ5 A;  2MSN A;  3TAP A;  1XO1 A;  3JPQ A;  3GU3 A;  1J2M A;  2ZJ5 A;  4RQ3 A;  3N7R C;  2DKX A;  4F5O A;  4F2S A;  4C8K A;  2VAN A;  1SKW A;  2LI6 A;  3L3F X;  4CF3 A;  4F8R A;  1KFD A;  4MEY A;  3QU2 A;  3Q8M A;  2HHQ A;  4OCZ A;  1L8O A;  5EE9 A;  1XSL A;  4O5C A;  1TV9 A;  2ZJA A;  3K4G A;  4UW9 A;  4O3N A;  3EUB 2;  5BOL A;  4I2J A;  2BR0 A;  4XUS A;  4X5V A;  4I29 A;  4LJX A;  2E3T A;  2KMD A;  4EBE A;  2Y9U A;  4UAY A;  4BWJ A;  2XO7 A;  1NJX A;  3L4P A;  4PHA A;  2NRV A;  3RAX A;  1TK5 A;  5CP2 A;  5IIO A;  3QE9 Y;  2ISP A;  4Z6F A;  4GFJ A;  3C1Z A;  1DGJ A;  2KIV A;  4QWE A;  5DLF A;  3SQI A;  2Y0S F;  5KT7 A;  4I2C A;  2EAN A;  4IQU A;  1NK9 A;  7ICG A;  2FDR A;  3H4D A;  3F5E A;  3D2Q A;  3H0M B;  2VKQ A;  8ICO A;  4MFF A;  2UVV A;  1Z19 A;  5KG3 A;  4PGX A;  1JRP A;  2W43 A;  4RQ5 A;  2H3Q A;  2PXI A;  2KHQ A;  2LPE A;  3HT3 A;  3MGH A;  3UMC A;  5A0L A;  3NTU A;  4I2H A;  1TK0 A;  2J6U A;  4ED1 A;  3KD3 A;  2NRZ A;  3PSI A;  4QWB A;  4F91 B;  5KL1 B;  3GIL A;  3ZDA A;  2ALZ A;  4DOB A;  3AM9 A;  5ALO A;  2HHS A;  1ZQY A;  4DSK A;  5ALW A;  3WK8 A;  3RJG A;  4K4G A;  1L7O A;  5DG7 A;  1Z3E B;  4TUS A;  4F2R A;  3PO4 A;  5G5G A;  4O3P A;  1WWU A;  2ESE A;  3BQ7 A;  2DPJ A;  3FAH A;  1IG6 A;  4UB8 U;  2XVT A;  2R8G A;  3QZ7 A;  2W9B B;  1MN8 A;  2EDU A;  3MFI A;  2B6G A;  1CRX A;  4YMN A;  1ZQH A;  5KFM A;  2DBY A;  1Z1V A;  2I5H A;  4CF4 A;  3UMB A;  4BWM A;  2VIX A;  3H0R B;  4F5Q A;  5F9L A;  4FFD A;  1URJ A;  3RR7 A;  2W9A A;  2KJ9 A;  5J2H A;  4Q8E A;  3GDX A;  3FDS A;  5DG9 A;  5KFA A;  4EEY A;  2ZUC A;  2LMR A;  2WF6 A;  3GIM A;  1NKC A;  3BQT A;  2F3N A;  2W3S A;  3IDW A;  1QQ5 A;  3WK7 A;  3F2C A;  4PPX A;  4R63 A;  3RBD A;  1XSP A;  3TAD C;  3TAC B;  3MBY A;  2LYH A;  2P6R A;  4CCH A;  4ECU A;  2ZIW A;  3ISC A;  3Q8P B;  5IIL A;  4DFJ A;  3NUQ A;  2V9W A;  5C0Y A;  5HR6 A;  3MR6 A;  4TUQ A;  1SKR A;  4OD0 A;  5HHI A;  1PUZ A;  3OSN A;  3QUT A;  1N61 A;  1X2I A;  1JX4 A;  1A6S A;  4KLE A;  4DLG A;  5KG6 A;  5KT6 A;  4DOC A;  3KTQ A;  5J0Y A;  1RPL A;  2HOQ A;  7ICT A;  3WK5 A;  2F1H A;  3I28 A;  2HI0 A;  2IHM A;  5GTI U;  9ICN A;  4NY8 A;  1HUZ A;  5IIN A;  1ZQA A;  1Y88 A;  2XCP A;  2KSO A;  2W9M A;  4UAS A;  4FBU A;  3WKE A;  2PFO A;  2EZX A;  5KFE A;  1ZQI A;  1ZJN A;  1LVH A;  3HIL A;  8ICV A;  1ZQM A;  5AI8 A;  4DL6 A;  5HMM A;  2F44 A;  5J0O A;  1ZQV A;  4I2G A;  5AM4 A;  2W8L A;  1WG8 A;  1SXD A;  5GTH U;  1U47 A;  2Y1I A;  4M2Y A;  4UAR A;  4NM2 A;  4HYK A;  3KKA A;  1L3U A;  1ZQZ A;  2FPK A;  4RU9 A;  3QYP A;  4PZN A;  4Q44 A;  1X9X A;  1DRG A;  5DLG A;  2HBL A;  4F72 A;  1JI7 A;  3BZK A;  2YB1 A;  2BDU A;  1UA0 A;  1ZQB A;  1RYR A;  4O5K A;  3IRU A;  2FMQ A;  2YX8 A;  2ZXH A;  3I1Y A;  3G6V A;  5CRX A;  3FYH A;  2AGO A;  8ICK A;  4Z6E A;  3SYZ A;  4B9S A;  2BPF A;  1ZD4 A;  5CR0 A;  3BZC A;  9ICW A;  2G0A A;  2PI4 A;  4DQI A;  4IQT A;  4Y2Y A;  3WKC A;  1BNP A;  4BJQ A;  4F5R A;  4IQV A;  3RJI A;  2A1J A;  4U6P A;  2LHT A;  2W3R A;  4J9Q A;  3WKA A;  1ZXI A;  4ZH4 A;  1UPH A;  1ZQN A;  3MGV A;  2WFA A;  1T3Q A;  3B9J A;  1QSL A;  5TZV A;  4NLK A;  4P0P B;  4NLZ A;  5KG4 A;  3NRZ A;  3ZD8 A;  1N5W A;  1BGX T;  1KEJ A;  2JHD A;  1V38 A;  4EZ6 A;  2HCF A;  4DL2 A;  4P2H A;  2A19 A;  5KFH A;  4F4W A;  5JTI A;  4M0A A;  2EAP A;  2FLN A;  3BQ2 A;  3NVY A;  1LKY A;  3QUC A;  3ZDC A;  4Y2S A;  1FIQ A;  3T79 A;  2HBJ A;  1JUD A;  2DF4 B;  5KFT A;  4QJF B;  3PR5 B;  4NL9 C;  1SXE A;  4KX3 A;  3H8J A;  2KFN A;  1NKB A;  2A1A A;  1RZT A;  1S5L U;  2IA6 A;  3G6Y A;  2WTF A;  4OJO A;  2IBK A;  1S0M A;  3TAQ A;  5HHH A;  2KEY A;  2LKY A;  4KN7 A;  3Q8K A;  4P4O A;  9ICT A;  1SL1 A;  4KLH A;  5L1J A;  1X9S A;  2LM1 A;  3NVW A;  3ZDE A;  2BCU A;  1DGS A;  4PGY A;  2YY6 A;  3UXN A;  1L8L A;  4PGQ A;  4I28 A;  1ARO P;  3AQF A;  2KVS A;  2W55 A;  4F4Z A;  3LWL A;  2BCR A;  5J0X A;  4DSL A;  1M6Y A;  4G9B A;  4ECY A;  5DBA A;  1L7M A;  3DDH A;  2R8H A;  2HOF A;  2BZF A;  4GXJ A;  2KIC A;  2QB1 A;  3BQ0 A;  3C1Y A;  1DK3 A;  1KFS A;  2CXY A;  1NK4 A;  2JH1 A;  3TFS A;  1NK5 A;  2EAO A;  3B0Y A;  2F77 X;  3KFU F;  4QWD A;  2BPG A;  2MA1 A;  8ICY A;  4F4K A;  9ICK A;  2VJ5 A;  5T14 A;  4OJ6 A;  2YMM A;  2RDJ A;  4C8M A;  4NWI A;  1X42 A;  3EPI A;  3PY8 A;  9ICC A;  1XS9 D;  2K89 A;  4RT3 A;  3IV6 A;  3C2M A;  3RF9 A;  4CDG A;  3EYZ A;  2WF5 A;  3M8S A;  3RH5 A;  3AN1 A;  2FLP A;  5DQG A;  2HOI A;  2CRX A;  4AYB C;  9ICJ A;  4DSE A;  4KLD A;  3M6K A;  1ZQL A;  3WKD A;  4J9S A;  1O03 A;  5KFP A;  4IRD A;  7ICV A;  4JK1 A;  2NO4 A;  3THV A;  3Q8R B;  4ED3 A;  7ICJ A;  5AKK A;  4YMM A;  2VJ4 A;  2H3F A;  1D8Y A;  4BXO B;  2I1Q A;  2JEF A;  4BX9 C;  3LVV A;  3MR3 A;  4NLG A;  4LVS A;  3PMN A;  4NXZ A;  3BJY A;  4Y2J A;  1JXE A;  3OJS A;  4RNN A;  2DUY A;  4QNL A;  5E79 U;  8ICQ A;  3N4M B;  1A77 A;  3A0B U;  3SEI A;  1HEK A;  2ZTD A;  5AKX A;  5KFL A;  4US9 A;  4FO6 A;  3PW2 A;  1KKX A;  3FC4 A;  3LDA A;  5KFJ A;  2YTU A;  1F0M A;  3GFK B;  2KVC A;  1AQ6 A;  2C2R A;  8ICW A;  5J0P A;  2UVR A;  4DFP A;  5KFX A;  4UB6 U;  2YB4 A;  3PW7 A;  1KBU A;  4F4Y A;  4AYB F;  2W9C B;  5JUM A;  2W7O A;  2AHO B;  3GV7 B;  2MUT B;  1UT8 A;  4IC9 A;  1KTQ A;  1ZQW A;  5DB8 A;  3MR5 A;  4YD1 A;  3F53 A;  2C2D A;  1NZP A;  2ZIX A;  4I27 A;  4JV2 A;  2EH9 A;  2XGP A;  3JPR A;  5DDM A;  2JMG A;  1ZQR A;  3UQ0 A;  2ISO A;  5KG7 A;  3C21 A;  3H8W A;  2KOB A;  3HW8 A;  2W03 A;  4DCC A;  2WF9 A;  9ICS A;  5KFS A;  2ZG6 A;  1V97 A;  2XC9 A;  2Q4T A;  2CPR A;  4NLN A;  5AM1 A;  1NJY A;  5KT3 A;  4ECR A;  2YML A;  3QU7 A;  4B9N A;  4Y2V A;  5L1I A;  2XY7 A;  3N97 B;  3PSP A;  3TAD A;  2W11 A;  2ZUD A;  4UB5 A;  1CI4 A;  2KZZ A;  3KBB A;  2FMP A;  4I2I A;  2ZUB A;  5D46 A;  5KFK A;  4QZF A;  1QSS A;  4UB4 A;  2W9B A;  5KFF A;  1TE2 A;  1S77 D;  2HDO A;  2FMS A;  4R8U B;  1WYG A;  3M9O B;  7ICL A;  1RM6 C;  4PHD A;  4YN4 A;  3LVW A;  4B9T A;  4M6W B;  1JRO A;  2BPC A;  2J6S A;  3K75 D;  2HHV A;  2HHW A;  5BOM A;  1N5X A;  1MQ2 A;  4DL4 A;  1KFT A;  8ICP A;  3QZ8 A;  4QZD A;  2H5X A;  4KN4 A;  1ZQJ A;  1RYU A;  1ZQP A;  3E2E A;  4F92 B;  2KSO B;  3VCB A;  2M9N A;  4O3R A;  4I2B A;  4PHP A;  3UQ2 A;  5J0T A;  3C5G A;  4M9G A;  9ICG A;  3BS5 A;  4XQ8 A;  1ZQK A;  8ICU A;  4R64 A;  1FO4 A;  9ICQ A;  3PW0 A;  2NO5 A;  4IR9 A;  2JGA A;  2OM6 A;  4O9M A;  5CWR A;  4GC7 A;  4OJP A;  1N48 A;  4JWM A;  1O08 A;  3EWA A;  3ORY A;  4KIT B;  4YMO A;  4O5E A;  3K1R B;  4YVZ A;  2I9G A;  3ZI4 A;  5H2F U;  2RQ5 A;  4DWI A;  1D8B A;  1WCN A;  2H3Z A;  2JZB A;  9ICL A;  1RDF A;  4C80 A;  1Q3V A;  2AQ0 A;  3CP8 A;  2YQE A;  4KMU A;  3AUO A;  4RQ4 A;  4XA5 A;  3JPN A;  4DFK A;  1NK0 A;  3D2N A;  1Q3U A;  1XO0 A;  2ZXI A;  3WKB A;  4I2D A;  1BPD A;  3SAH A;  3AMZ A;  2ES6 A;  4RQM A;  4PH5 A;  5DB7 A;  1T4G A;  5J2B A;  1EXN A;  4C0Z A;  2XY5 A;  2FLL A;  1PVR A;  2KE7 A;  3Q8S B;  2JEJ A;  2K60 A;  5J2K A;  2IHN A;  3GV5 B;  2D8C A;  2R8I A;  1UQV A;  2KIW A;  1ZQD A;  3M6Z A;  3T5L A;  1S76 D;  2HW3 A;  2GO7 A;  1UHU A;  4DQR A;  3H8S A;  5CHG A;  4E0D A;  3ZDB A;  2Y9T A;  4M9N A;  2AQ4 A;  4FS1 A;  2KKV A;  5KFU A;  2K4E A;  2KHV A;  4F50 A;  7ICK A;  5BPC A;  5KL8 B;  4DL3 A;  1X9M A;  3H7I A;  1MSW D;  1QTM A;  2JV3 A;  4DLE A;  3QU9 A;  2G09 A;  4QIW F;  3F2D A;  4QZ8 A;  2B0C A;  2P66 A;  4PL1 A;  1U49 A;  1NJW A;  2JZB B;  9ICR A;  1L3T A;  5J2I A;  2PKE A;  2BCQ A;  4DS5 A;  4ECW A;  1BVS A;  3TAR A;  1UCV A;  2BQ3 A;  1XNS A;  4FBT A;  1NK7 A;  5KFC A;  1BPB A;  3PW5 A;  4Q8F A;  1BPX A;  4MF8 A;  5J29 A;  5KFQ A;  4UBC A;  1U45 A;  4YXJ A;  5AKJ A;  1VLB A;  3OSP A;  2JR5 A;  4EEN A;  2HBM A;  3V7K A;  4RQ7 A;  3RJH A;  3LWM A;  1QSY A;  2GOL A;  5ALT A;  4RPZ A;  5AM3 A;  3D6J A;  4WJ3 B;  2OEH A;  1NNL A;  2JEI A;  1QQ6 A;  3K1Z A;  3CNH A;  3CYM A;  5KFZ A;  8ICB A;  2KJ8 A;  4QZB A;  5DB9 A;  1IIP A;  4UB3 A;  3V6K A;  4B9U A;  5J2E A;  1SWV A;  1A0P A;  4B6J A;  5C5J A;  4I2E A;  5G5H A;  4R66 A;  4DQS A;  5AKL A;  3ETL A;  3MDA A;  4F93 B;  1PK1 B;  5KFW A;  3PW4 A;  1BPZ A;  4Q45 A;  1UA1 A;  3O0F A;  4I2A A;  2G08 A;  9ICH A;  5EOZ A;  4NM1 A;  1LV5 A;  3H8M A;  4QZG A;  2F1J A;  3SI8 A;  1NZB A;  4MF2 A;  5AKZ A;  2IOF A;  3QUQ A;  4TQS A;  1F44 A;  3OHA A;  4IRK A;  2K8C B;  1KLN A;  2M0N A;  8ICG A;  2J6T A;  2OYY A;  4P0P A;  2DWQ A;  2ZIV A;  5J2G A;  4Y2R A;  4M47 A;  1Z4O A;  3EZ5 A;  3OGU A;  1S0N A;  4DOA A;  5J0S A;  3D2S A;  4ECQ A;  4YQW A;  4YR3 A;  2AXT U;  4QW9 A;  2W9C A;  1COK A;  1QH9 A;  2E8M A;  1KL9 A;  3NAS A;  1B22 A;  3H40 A;  4ED2 A;  1T7P A;  3PX0 A;  3QU4 A;  3ED5 A;  2CN1 A;  5J2D A;  4TQR A;  4Z6C A;  5F3X B;  5CJ7 A;  4KLL A;  3EW9 A;  3G6X A;  4J9O A;  4BDP A;  9ICI A;  3RJE A;  3JPT A;  2BQU A;  3HJE A;  2D6F C;  9ICA A;  3VC8 A;  3RFA A;  3MGI A;  3UMG A;  2EZY A;  5DGA A;  1XWL A;  9ICV A;  5DDY A;  2QLT A;  4NV0 A;  2NYV A;  4UAW A;  2AJQ A;  3PML A;  3HWT A;  1S0O A;  3NRW A;  1NK6 A;  3PR4 A;  2PFP A;  2B21 A;  1J97 A;  2V4R A;  2W7P A;  1X9W A;  9ICP A;  4ELT A;  1U9L A;  4JV0 A;  1C20 A;  5J2A A;  4O3Q A;  7ICR A;  4IR1 A;  5AKH A;  3MC1 A;  4EEK A;  4EYH B;  9ICX A;  1SV0 C;  1UT5 A;  5HR7 A;  3V7L A;  3NGD A;  2E8N A;  3KHL A;  4M9H A;  5AKE A;  1K1S A;  2ASL A;  4RPX A;  3TI0 A;  2EAM A;  4JB3 A;  2N1R A;  5CA7 A;  2W54 A;  2O6K A;  5J2C A;  4UQG A;  4QIW C;  3MFH A;  4K4I A;  1SZP A;  1X6J A;  3RAQ A;  1MC8 A;  4YXM A;  3QEB Z;  1WCL A;  2Z7J A;  7ICF A;  3SV4 A;  1Z4N A;  5J2F A;  5AHX A;  2G07 A;  3QU5 A;  5CEH A;  5B66 U;  5KFO A;  2OH2 A;  3F5A A;  4NL9 A;  4RT2 A;  1ZQF A;  1ZQE A;  3HKZ C;  2KZ3 A;  3AEV A;  1T3N A;  3MAB A;  4GLX A;  1KN5 A;  4MHV A;  3WK9 A;  1F5S A;  4KLS A;  5EE3 A;  2Q0Z X;  4KLT A;  4TUP A;  1RXV A;  2R18 A;  3C2L A;  3CW2 C;  1BPE A;  5EWF A;  1OUQ A;  2VA8 A;  4QW8 A;  4DL5 A;  2UVU A;  3S6J A;  3JPP A;  3RR8 A;  1FFV A;  8ICC A;  3RB6 A;  4J9N A;  5KFR A;  1KQQ A;  2HHX A;  5KG2 A;  5AK6 A;  1TAQ A;  3ZDD A;  1ZQQ A;  4JV1 A;  2DFL A;  4UAU A;  2KP7 A;  4JUZ A;  5DG8 A;  2W04 A;  1VJ5 A;  4DF8 A;  2KNJ A;  3EPG A;  3C2K A;  3SAF A;  3PZP A;  1KRP A;  3DV9 A;  4KLF A;  2JRZ A;  3M8R A;  5KG0 A;  3T5H A;  1L3V A;  4KMO B;  3RB0 A;  3IM1 A;  3HP6 A;  3RRH A;  3HRD D;  3H4B A;  4NJ8 A;  4O0I A;  1TKD A;  1S0V A;  1U4B A;  2DPI A;  1DXS A;  5ALP A;  4RQ0 A;  2DKZ A;  4J9R A;  2F1I A;  4RQ2 A;  2WHE A;  4UB2 A;  3AQE A;  4C4S A;  2L5Y A;  1NK8 A;  2OWO A;  4QZ9 A;  2AGP A;  4ED6 A;  5ALF A;  2KV2 A;  3RJK A;  2K8B B;  4HAI A;  4DEZ A;  1ZQT A;  1RQN A;  1BPY A;  4G3I A;  2LBO A;  4YR0 A;  3IP4 B;  4R65 A;  3ONN A;  3Q8L A;  4KLU A;  2XCA A;  5AM0 A;  1ZD3 A;  4J9K A;  4P0Q A;  3PX4 A;  4RQ6 A;  1YZ7 A;  4QZC A;  3OPX A;  4C7Y A;  5DGB A;  2DL0 A;  5L1M A;  5D4B A;  1ZJM A;  9ICB A;  4Y2Q A;  4RPY A;  9ICF A;  4RUA A;  4YR2 A;  4DFM A;  8ICS A;  3WK6 A;  4JMU A;  4Y2P A;  2AH5 A;  2F2A B;  3N7S C;  1IV8 A;  4M04 A;  3SZ2 A;  2MU2 A;  4EBD A;  3PV8 A;  2LYB A;  2AGQ A;  2VA3 A;  2KFZ A;  4M6W A;  4EBC A;  3ISD A;  2KK0 A;  2KD1 A;  8ICL A;  9ICM A;  1JXL A;  4NLC A;  5KG5 A;  1TAM A;  5J0R A;  4EX7 A;  5KG1 A;  3RH6 A;  2C22 A;  4F3O A;  5AK3 A;  3GZF A;  3GII A;  4B9L A;  5DBB A;  2DGZ A;  3Q8Q B;  4FZL A;  3KHR A;  3A0H U;  3U26 A;  5ALV A;  2YMQ A;  4KLO A;  4US8 A;  1SL2 A;  9ICE A;  7ICU A;  1ZOL A;  3KHH A;  4OJL A;  1Q46 A;  4UAT A;  3SD7 A;  3OHB A;  1L6N A;  2G5I B;  4KLQ A;  3NVZ A;  4U7C A;  1X66 A;  2NRT A;  1TFR A;  3CRX A;  3GV8 B;  3UXP A;  8ICH A;  5ALD A;  3ZD9 A;  3AU2 A;  2XIC A;  7ICP A;  4A8E A;  1ZRM A;  4Y2U A;  2BCS A;  2BKE A;  2ODG A;  1CEZ A;  3BS5 B;  1PVQ A;  4XRH A;  1J2N A;  3IG8 A;  4J9L A;  4RNO A;  5HP4 A;  1N60 A;  5EWG A;  2ZIU A;  4KLM A;  3KZI U;  5L1K A;  4PJ0 U;  5KAF U;  3C5F A;  2C28 A;  4ECT A;  4F71 A; 
#chains in the Genus database with same CATH homology
 4UBC A;  4EZ9 A;  3ZDC A;  7ICO A;  1TAU A;  1U45 A;  1KDH A;  1H38 A;  4C8N A;  4YXJ A;  2ATL A;  5L9X A;  3PR5 B;  5KFT A;  4GXK A;  5KTQ A;  3OSP A;  2HVH A;  3TQ1 A;  3H8J A;  4YG2 A;  3RTV A;  2KFN A;  3M9M B;  3SV3 A;  5DBC A;  3V7K A;  4JWN A;  4RQ7 A;  4DSF A;  3RJH A;  1NKB A;  3LWM A;  1QSY A;  2NRX A;  1RZT A;  3OJU A;  4RPZ A;  3JPS A;  4DL7 A;  2IA6 A;  1L3S A;  2HVI A;  3G6Y A;  3V6H A;  5J2J A;  2WTF A;  3PVX A;  3QEA Z;  4F4X A;  2IBK A;  2JEI A;  5III A;  1S0M A;  3T5K A;  3TAQ A;  1ZQC A;  2PFQ A;  8ICR A;  1JN3 A;  5HHH A;  5KFZ A;  8ICB A;  4KN7 A;  3AU6 A;  3Q8K A;  4PHE A;  5KFQ A;  4P4O A;  4QWA A;  9ICT A;  2GWS A;  4QZB A;  1SL1 A;  1KSP A;  5DB9 A;  4BGD A;  4Z6D A;  4UB3 A;  3V6K A;  4B9U A;  4ELV A;  4KLH A;  5L1L A;  5J2E A;  5L1J A;  5IIM A;  2ASD A;  1X9S A;  2NRW A;  3ZDE A;  4IRC A;  5C5J A;  4I2E A;  2BCU A;  4R66 A;  5DQH A;  4DQS A;  1D9F A;  1DGS A;  3ETL A;  3MDA A;  4PGY A;  1JMS A;  4F93 B;  5KFW A;  3UXN A;  4KTQ A;  4PGQ A;  4I28 A;  5CB1 A;  4MFC A;  3PW4 A;  1ARO P;  4F4Z A;  4YP3 A;  4Q45 A;  1BPZ A;  5HML A;  5DB6 A;  3LWL A;  4GC6 A;  5J0X A;  1UA1 A;  2MUT A;  1IM4 A;  2BCR A;  3UXO A;  4ECY A;  5DBA A;  3T3F A;  4DSL A;  4I2A A;  2C2E A;  3UPQ A;  3C23 A;  2R8H A;  9ICH A;  5EOZ A;  4NM1 A;  1LV5 A;  4GXJ A;  4QZG A;  2F1J A;  3SI8 A;  4MF2 A;  1D8L A;  3RH4 A;  4B9V A;  4TQS A;  4IRK A;  3OHA A;  4QWC A;  3C1Y A;  3BQ0 A;  1KLN A;  1KFS A;  3JPO A;  1NK4 A;  8ICG A;  3TFS A;  1NK5 A;  2J6T A;  3B0Y A;  3TAN A;  3V72 A;  5J2G A;  4P4P A;  4QWD A;  2BPG A;  4M47 A;  4M9J A;  8ICY A;  1HJP A;  4F4K A;  4UAZ A;  9ICK A;  3EZ5 A;  3PX6 A;  3OGU A;  4QZA A;  3MDC A;  1S0N A;  7ICM A;  4DOA A;  4F5N A;  2RDJ A;  5DKW A;  2ASJ A;  4C8M A;  5KFD A;  5J0S A;  9ICO A;  4B9M A;  3EPI A;  4GXI A;  3RBE A;  4ECQ A;  4YQW A;  3PY8 A;  8ICN A;  9ICC A;  1XS9 D;  2ZTC A;  4YR3 A;  1T8E A;  8ICM A;  3BDP A;  4RT3 A;  4QW9 A;  2W9C A;  2R8J A;  4F5P A;  1ZQX A;  3C2M A;  4ED8 A;  8ICT A;  3RRG A;  1B22 A;  3H40 A;  4ED2 A;  1T7P A;  3PX0 A;  3TAP A;  5EWE A;  3EYZ A;  1Z00 A;  5KT2 A;  1XO1 A;  3M8S A;  3RH5 A;  3RJJ A;  2FLP A;  3JPQ A;  5DQG A;  5J2D A;  2ZJ5 A;  4RQ3 A;  4TQR A;  2Y1J A;  1PZN A;  4Z6C A;  4F5O A;  5CJ7 A;  4KLL A;  3EW9 A;  4F2S A;  9ICJ A;  4DSE A;  4KLD A;  3G6X A;  4J9O A;  4C8K A;  1N56 A;  2VAN A;  4RQ8 A;  3HX0 A;  4BDP A;  1ZQL A;  3RJE A;  1SKW A;  9ICI A;  4J9S A;  5KFP A;  2BHN A;  4IRD A;  7ICV A;  3JPT A;  4JK1 A;  2BQU A;  3THV A;  9ICA A;  3Q8R B;  4ED3 A;  3MGI A;  4F8R A;  7ICJ A;  1KFD A;  4YMM A;  4MEY A;  4FS2 A;  3Q8M A;  5IIJ A;  1D8Y A;  2HHQ A;  4BXO B;  2I1Q A;  1XSL A;  2JEF A;  4O5C A;  5DGA A;  1XWL A;  3MR3 A;  4NLG A;  4LVS A;  1TV9 A;  3PMN A;  2ZJA A;  3K4G A;  4NXZ A;  3BJY A;  9ICV A;  3ISB A;  5DDY A;  4O3N A;  1JXE A;  3OJS A;  2AJQ A;  4UAW A;  4RNN A;  3PML A;  5BOL A;  3HWT A;  2FPL A;  4I2J A;  3PR4 A;  2BR0 A;  1S0O A;  1NK6 A;  4LZG A;  8ICQ A;  4XUS A;  3N4M B;  1A77 A;  4LZD A;  2PFP A;  4X5V A;  4I29 A;  1COO A;  2B21 A;  2V4R A;  2ZTD A;  2FPM A;  4UB1 A;  1X9W A;  9ICP A;  3V7J A;  4ELT A;  2HHU A;  1U9L A;  5KFL A;  4JV0 A;  4EBE A;  4FO6 A;  3PW2 A;  8ICE A;  4UAY A;  2XY6 A;  3LDA A;  4BWJ A;  5J2A A;  2XO7 A;  4O3Q A;  7ICR A;  4IR1 A;  5KFJ A;  1NJX A;  9ICX A;  3GFK B;  4EYH B;  3TFR A;  1UT5 A;  4PHA A;  2NRV A;  3RAX A;  2C2R A;  3V7L A;  3NGD A;  2AU0 A;  5CP2 A;  1TK5 A;  3KHL A;  4M9H A;  5IIO A;  3QE9 Y;  2ISP A;  4Z6F A;  1QLN A;  8ICW A;  1K1S A;  1CUK A;  4QZE A;  5J0P A;  2UVR A;  3C1Z A;  3M9N B;  2ASL A;  4DFP A;  4RPX A;  5KFX A;  1S10 A;  7ICH A;  2BCV A;  1A76 A;  4QWE A;  3TI0 A;  3PW7 A;  5CA7 A;  1B43 A;  5DLF A;  5KT7 A;  5J0U A;  4I2C A;  1XC9 A;  3GQC A;  4F4Y A;  7ICN A;  4R8U A;  3RJF A;  4IQU A;  5J2C A;  4UQG A;  1NK9 A;  7ICG A;  2W9C B;  3MFH A;  3H4D A;  5JUM A;  4K4I A;  3GIK A;  1SZP A;  3GV7 B;  2MUT B;  1UT8 A;  4DF4 A;  3RAQ A;  1MC8 A;  4YXM A;  1KTQ A;  1ZQW A;  1WCL A;  3QEB Z;  5DB8 A;  7ICF A;  8ICO A;  3MR5 A;  4YD1 A;  4MFF A;  2UVV A;  3SV4 A;  2C2D A;  5KT5 A;  4I27 A;  5KG3 A;  4PGX A;  4JV2 A;  4RQ5 A;  2XGP A;  5J2F A;  3JPR A;  1SKS A;  1S97 A;  4YCX A;  5DDM A;  2PXI A;  2PFN A;  5KFO A;  8ICA A;  1ZQR A;  3UQ0 A;  2ISO A;  3HT3 A;  4RT2 A;  2V4Q A;  5KG7 A;  3C21 A;  3H8W A;  3HW8 A;  1ZQF A;  3MGH A;  1ZQE A;  7ICS A;  4ED7 A;  9ICS A;  4DSJ A;  5KFS A;  2KZ3 A;  3NTU A;  4I2H A;  2XC9 A;  1TK0 A;  1ZQU A;  1MQ3 A;  2J6U A;  4ED1 A;  2XGQ A;  2NRZ A;  4F91 B;  4QWB A;  1T3N A;  4BXO A;  3GIL A;  3ZDA A;  4NLN A;  3MAB A;  1NJY A;  4QZH A;  4DOB A;  2ALZ A;  1C7Y A;  4GLX A;  5KT3 A;  1RXW A;  4ECR A;  2HHS A;  4ECX A;  1ZQY A;  2ZTE A;  4DSK A;  4KLS A;  2Q0Z X;  4TUR A;  4KLT A;  4TUP A;  2KN7 A;  1RXV A;  3RJG A;  4B9N A;  5DG7 A;  4K4G A;  4DSI A;  1Z3E B;  4TUS A;  3C2L A;  5L1I A;  1ZQO A;  4F2R A;  2XY7 A;  3N97 B;  1BPE A;  3PO4 A;  4M9L A;  4O3P A;  5EWF A;  4K4H A;  2DPJ A;  2VA8 A;  4QW8 A;  4DL5 A;  2UVW A;  2ZUD A;  2R8G A;  3QZ7 A;  3JPP A;  4UB5 A;  2UVU A;  3RR8 A;  2W9B B;  3MFI A;  8ICC A;  3RB6 A;  1XSN A;  4IQW A;  5KFI A;  5J0W A;  4J9N A;  2FMP A;  4DQP A;  2KZZ A;  7ICI A;  5KFR A;  4I2I A;  4YMN A;  2HHX A;  5KG2 A;  3PNC A;  4RQ1 A;  1ZQH A;  1JIH A;  1TAQ A;  2ZUB A;  5D46 A;  5KFM A;  5KFK A;  3ZDD A;  4QZF A;  8ICX A;  3RB4 A;  1QSS A;  4UB4 A;  4DS4 A;  2W9B A;  3BQ1 A;  1ZQQ A;  5KFF A;  2PI5 A;  4BWM A;  7ICE A;  1S77 D;  4JV1 A;  2DFL A;  4F5Q A;  4J9P A;  2MAX A;  9ICU A;  4JUZ A;  2FMS A;  5F9L A;  5DG8 A;  4R8U B;  2BGW A;  4DF8 A;  3RR7 A;  3M9O B;  3EPG A;  7ICL A;  8ICJ A;  2W9A A;  4PHD A;  4YN4 A;  5J2H A;  4Q8E A;  3GDX A;  3C2K A;  4UBB A;  3FDS A;  5DG9 A;  5KFA A;  5HNK A;  1KRP A;  4B9T A;  4KLF A;  3M8R A;  8ICZ A;  4M6W B;  4EEY A;  2BPC A;  2ZUC A;  5KG0 A;  3K75 D;  4RUC A;  3GIJ A;  1D9D A;  2J6S A;  3GIM A;  2HHV A;  2HHW A;  5BOM A;  3T5H A;  1MQ2 A;  1NKC A;  4O3S A;  4DL4 A;  1L3V A;  2HHT A;  3BQT A;  8ICP A;  1KFT A;  3QZ8 A;  3RB0 A;  1U48 A;  3IM1 A;  1ZET A;  3HP6 A;  3RRH A;  4QZD A;  4PPX A;  2H5X A;  4KN4 A;  4R63 A;  1ZQJ A;  3H4B A;  3RBD A;  4O0I A;  1XSP A;  4YD2 A;  3MBY A;  1ZQP A;  3E2E A;  4F92 B;  1Z00 B;  5KFV A;  1NOM A;  2LYH A;  2RDI A;  3PO5 A;  1TKD A;  2P6R A;  2M9N A;  4CCH A;  4O3R A;  1S0V A;  4ECU A;  1RYS A;  1U4B A;  4I2B A;  2DPI A;  3ISC A;  4RQ0 A;  3Q8P B;  5IIL A;  3V6J A;  4PHP A;  3UQ2 A;  5J0T A;  4J9R A;  3C5G A;  4DFJ A;  1NKE A;  4M9G A;  9ICG A;  2F1I A;  4RQ2 A;  2V9W A;  4XQ8 A;  5KFG A;  4KLJ A;  4UB2 A;  4C8O A;  1ZQK A;  8ICU A;  4YFK A;  5KT4 A;  4J9M A;  4R64 A;  3LK9 A;  3MR6 A;  4TUQ A;  1NK8 A;  9ICQ A;  1ZYQ A;  1SKR A;  3PW0 A;  2OWO A;  4QZ9 A;  5HHI A;  4QZI A;  2AGP A;  3OSN A;  4ED6 A;  1X2I A;  4IR9 A;  3RJK A;  4RZR A;  4ECZ A;  1JX4 A;  2BDP A;  4DEZ A;  4DQQ A;  1ZQS A;  1ZQT A;  4KLE A;  1BPY A;  4ECV A;  4G3I A;  4DLG A;  5KG6 A;  1SL0 A;  4O9M A;  5CWR A;  4GC7 A;  5KT6 A;  4YR0 A;  1N48 A;  4DOC A;  3KTQ A;  4JWM A;  4R65 A;  5J0Y A;  1RPL A;  1XU4 A;  3EWA A;  3Q8L A;  3ORY A;  4KLU A;  4KIT B;  4YMO A;  4O5E A;  4YVZ A;  2ZJ8 A;  2XCA A;  7ICQ A;  4J9K A;  3T5J A;  2I9G A;  7ICT A;  4RQ6 A;  2F1H A;  3PX4 A;  2IHM A;  4DWI A;  4QZC A;  4I2F A;  5DGB A;  9ICN A;  4NY8 A;  1WCN A;  2JZB A;  5D4B A;  1HUZ A;  1HUO A;  5IIN A;  9ICL A;  2VA2 A;  1ZJM A;  1ZQA A;  4DO9 A;  1ZQG A;  2KZM A;  1Y88 A;  2AQ0 A;  4O3O A;  2XCP A;  9ICB A;  2W9M A;  4RPY A;  4FBU A;  3IHQ B;  2PFO A;  9ICF A;  4RUA A;  4YR2 A;  4DFM A;  4KMU A;  8ICS A;  5KFE A;  3AUO A;  4RQ4 A;  1ZQI A;  4XA5 A;  2P6U A;  1ZJN A;  5KFB A;  3JPN A;  4DFK A;  4M04 A;  1NK0 A;  8ICV A;  3SZ2 A;  1ZQM A;  4EBD A;  3PV8 A;  4DL6 A;  5HMM A;  4ELU A;  5J0O A;  1ZQV A;  1BPD A;  4I2D A;  4I2G A;  2W8K A;  2AGQ A;  2W8L A;  2VA3 A;  4PH5 A;  5DB7 A;  4M6W A;  5J2B A;  1T4G A;  1L5U A;  4EBC A;  1EXN A;  3ISD A;  2KFZ A;  1TK8 A;  1U47 A;  2Y1I A;  2XY5 A;  2FLL A;  8ICL A;  9ICM A;  1JXL A;  2A1J B;  3Q8S B;  4M2Y A;  1TVA A;  2JEJ A;  4NM2 A;  4HYK A;  5J2K A;  2IHN A;  3GV5 B;  1L3U A;  5KG5 A;  1ZQZ A;  8ICF A;  2R8I A;  2FPK A;  5J0R A;  4RU9 A;  5KG1 A;  3RH6 A;  2C22 A;  4F3O A;  4Q44 A;  5D49 A;  3GII A;  4B9L A;  5DBB A;  3Q8Q B;  1ZQD A;  5DLG A;  2IMW P;  1NJZ A;  3KHR A;  5J0Q A;  3HPO A;  4KLO A;  1V9P A;  3T5L A;  1UA0 A;  1ZQB A;  1S76 D;  1RYR A;  2HW3 A;  4O5K A;  4DQR A;  3H8S A;  5KFY A;  1SL2 A;  2FMQ A;  9ICE A;  5CHG A;  4E0D A;  7ICU A;  3ZDB A;  3B0X A;  4M9N A;  3G6V A;  5DQI A;  2AQ4 A;  4C8L A;  4FS1 A;  3KHH A;  3FYH A;  2AGO A;  8ICK A;  4Z6E A;  3OHB A;  3SYZ A;  4B9S A;  4KLQ A;  2BPF A;  5KFU A;  5CR0 A;  1IXR A;  9ICW A;  5KFN A;  2PI4 A;  4DQI A;  2NRT A;  5IIK A;  4IQT A;  5F9N A;  1TFR A;  4F50 A;  7ICK A;  2JEG A;  5BPC A;  8ICI A;  4DL3 A;  4F5R A;  1LB2 B;  4MFA A;  1X9M A;  4P4M A;  4EYI B;  4IQV A;  3GV8 B;  3UXP A;  2A1J A;  3RJI A;  8ICH A;  3KHG A;  3ZD9 A;  3AU2 A;  3H7I A;  3MR2 A;  4ECS A;  4J9Q A;  7ICP A;  1MSW D;  1QTM A;  4ZH4 A;  1DOQ A;  2R8K A;  4DLE A;  1ZQN A;  1K1Q A;  4QZ8 A;  2BCS A;  2BKE A;  2P66 A;  1U49 A;  1NJW A;  2JZB B;  1CEZ A;  1QSL A;  9ICR A;  1S9F A;  4XRH A;  4J9L A;  5TZV A;  4RNO A;  1L3T A;  4NLK A;  4ED0 A;  5J2I A;  5HP4 A;  2KTQ A;  2BCQ A;  4NLZ A;  4DS5 A;  4ECW A;  5KG4 A;  3ZD8 A;  1BVS A;  4MEX A;  5EWG A;  1BGX T;  3TAR A;  4KLM A;  1KEJ A;  5L1K A;  2BQ3 A;  4Q43 A;  4EZ6 A;  4FBT A;  4KLG A;  3RB3 A;  2BQR A;  3C5F A;  1NK7 A;  4DL2 A;  5KFC A;  1BPB A;  3PW5 A;  5KFH A;  4F4W A;  2C28 A;  4P2H A;  4Q8F A;  1BPX A;  4RNM A;  4ECT A;  4MF8 A;  4M0A A;  4KLI A;  2FLN A;  5J29 A;  3BQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...