1Z00B

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
total genus 22
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00B00
5EWFA 9ICMA 4NM1A 4KLHA 4M6WB 2ZJ8A 3V7KA 2F1JA 4QZ8A 2NRXA 3PO5A 3EPIA 2IMWP 5L1IA 1JXLA 4DL4A 2JEFA 1MSWD 1NK0A 5CR0A 3T5KA 3RR8A 3V6HA 3V72A 3RB4A 3C2LA 3H4DA 1NK7A 3ZD8A 4GC7A 4BXOB 4RQ2A 5HMLA 3Q8PB 1K1QA 3BQTA 4BWMA 4RU9A 4Z6EA 1NK8A 1T8EA 4MFFA 2NRWA 3T5HA 3KHGA 2IBKA 4DQQA 1ZQOA 1SKWA 4NLGA 4O5EA 5IIOA 4C8LA 3IM1A 1SL2A 5HHIA 5J2DA 3RH4A 2BCVA 4I2EA 1S0OA 1ZQFA 5IIMA 3OHAA 1ZQTA 3SI8A 2HHWA 4KN7A 4QZGA 3RB0A 2VANA 1NOMA 4M6WA 1X9SA 3G6YA 2XY6A 4O3RA 8ICHA 4QWBA 1XS9D 7ICFA 9ICLA 3PW2A 5DBBA 9ICNA 4O3SA 1X9WA 5KFWA 2JEJA 2W8KA 2HHQA 4KLFA 5KFVA 4R65A 5J0PA 1CUKA 2PXIA 4NY8A 9ICOA 5CB1A 2ZUBA 2AGPA 1KDHA 2ZTEA 3MR2A 2I9GA 2IHNA 4BGDA 2VA3A 2UVVA 1BPYA 5DG9A 1NK4A 3HP6A 3JPTA 1RYRA 3ZDAA 4DSEA 5J0TA 3AU6A 3T3FA 1BVSA 4J9SA 2NRTA 4BDPA 1HJPA 2XCPA 4F4ZA 2BGWA 4MF8A 4YFKA 3H8JA 2W9BA 3EZ5A 1NKEA 4Q8EA 4ED2A 4J9OA 3FDSA 2V4RA 4I2AA 1TK5A 4O5KA 4P4OA 2PI5A 3QZ7A 5TZVA 2BCQA 3HX0A 1IXRA 7ICQA 4I2IA 3NTUA 3T5JA 3RR7A 9ICKA 3PVXA 4R8UA 3MDAA 1T4GA 7ICLA 4PHAA 3TANA 1D8LA 1TK0A 4RNMA 3EWAA 2HHUA 4RQ1A 4DL6A 3BDPA 1S0MA 5J0OA 1QLNA 4KTQA 4M47A 4YR3A 3Q8QB 8ICGA 2AGOA 4I2GA 1ZQCA 2HHSA 1WCNA 4KLDA 4LVSA 1NJXA 1NKBA 4YXJA 4Q45A 3BQ2A 1ZQEA 2W8LA 4KLQA 2J6SA 4QZBA 3RJJA 1WCLA 3RRHA 2HW3A 7ICGA 5DB8A 2C2EA 3T5LA 1X2IA 5CJ7A 2W9MA 4M9HA 3B0YA 4LZDA 5IINA 2Y1JA 3UQ2A 1SZPA 4MEYA 5DKWA 5F9LA 5KFOA 4UB3A 3OJUA 4GXKA 1U47A 4KLSA 4IQTA 3TFRA 1EXNA 2M9NA 5KT2A 2ZUCA 5KFKA 4DLGA 1LB2B 2ZTCA 3H7IA 4ED6A 4ED8A 1ZQSA 3MR6A 9ICVA 4TUPA 1AROP 4EZ6A 2FPMA 1ZQIA 4I2CA 4UAWA 3ZDDA 5J2IA 8ICJA 5L9XA 4YR0A 5L1KA 4J9LA 4DSIA 2ZTDA 3PX4A 2BPFA 4E0DA 4NLZA 2HVIA 2WTFA 9ICUA 4FS2A 4XRHA 4QZDA 2DFLA 4EBCA 3PW4A 4RPZA 4DL3A 2KFZA 1KFDA 5DGBA 2W9CB 5KFGA 3PW0A 3RH6A 1C7YA 3BJYA 3UXNA 5KFMA 5KFJA 3PR4A 1QSYA 4ED3A 4F5QA 4O9MA 5CHGA 1NK5A 2JEIA 4DSKA 5KFDA 8ICSA 1Z00A 3TARA 5J2KA 3B0XA 3LK9A 2KN7A 4XA5A 3JPQA 3GDXA 1ZQYA 4DFMA 1S0NA 5KG4A 5KFFA 4KLGA 2AQ0A 4F4YA 1TAQA 1MC8A 4BWJA 5L1LA 1TFRA 4FS1A 3PY8A 3H40A 1S97A 1ZQRA 3TQ1A 1ZQQA 3EW9A 4KLOA 5CA7A 3RJKA 1JMSA 5HMMA 4UB5A 5DGAA 2NRZA 1D9DA 4HYKA 3GIIA 5L1JA 4YR2A 2NRVA 3M9MB 4DL7A 3IHQB 1BPDA 8ICQA 3ISDA 1ZYQA 4IRKA 3Q8RB 4DQIA 4R64A 1Z3EB 1A76A 4EBEA 4I28A 4RT3A 5KG2A 5J2FA 4J9MA 2BPGA 1SKRA 1HUOA 3H8SA 1KFSA 3GIJA 3RBDA 4R63A 2MUTB 3M8SA 4M9NA 1JIHA 4I2BA 2BR0A 3ETLA 4XUSA 1NK6A 1COOA 4UQGA 3PX0A 3MBYA 4I29A 4KLEA 5KFZA 2B21A 3LWLA 4GLXA 4DFPA 4KLUA 8ICVA 4UB1A 1BGXT 2XY7A 4QWEA 4DQPA 3MGHA 3PMNA 4PPXA 2FMQA 1Z00B 3Q8KA 5IIIA 4EEYA 4F91B 4YCXA 1BPXA 2ASJA 8ICIA 1L3VA 2J6UA 1S10A 4ECZA 2FLLA 2FLPA 4ELUA 4DSFA 1XC9A 4ECUA 3Q8LA 2H5XA 4DEZA 4QZEA 1K1SA 5KG0A 4KLIA 4RUCA 1BPBA 3OSNA 4ECTA 5IIJA 4YXMA 5D4BA 1L5UA 2ASLA 1S9FA 1TKDA 4DOBA 2Q0ZX 5HP4A 3JPNA 1ZQKA 1UT5A 4B9VA 9ICCA 3GV5B 7ICRA 4QZIA 1QSLA 2AGQA 2ZJAA 4K4IA 3RAQA 1CEZA 7ICPA 3N4MB 1ZQZA 4KLLA 5KG1A 4M9LA 4Z6CA 1PZNA 4K4GA 1DGSA 4MFCA 7ICNA 7ICVA 1ZQUA 5IIKA 1U9LA 4O3QA 5DG8A 1ZQAA 5J0WA 2P66A 1RZTA 4QWAA 3JPSA 4YVZA 4RQ7A 4JV2A 2ASDA 5KT5A 4YG2A 5DB6A 1ZQJA 7ICEA 3PMLA 1SL1A 4B9SA 2FMSA 2IHMA 1RPLA 4YN4A 4JUZA 3PX6A 4YMOA 4PGQA 5EWEA 5KFYA 2FLNA 4IR9A 9ICTA 5J29A 3JPOA 3OSPA 5J0YA 5IILA 4PGXA 5DQHA 1ZETA 3G6XA 4IQVA 2GWSA 3GFKB 5HNKA 4UAYA 2ATLA 2R8GA 1LV5A 3BQ1A 8ICMA 2XC9A 5KFBA 3EPGA 2C2RA 5DBAA 2JZBB 4J9QA 3RJHA 1KLNA 2HHTA 4I2JA 2BKEA 5CWRA 1U49A 9ICBA 3RB6A 4KMUA 7ICSA 5DQGA 4I27A 4J9NA 1BPZA 2BQ3A 3HWTA 5KFLA 5DLFA 2C28A 3PO4A 4Q43A 3SZ2A 8ICOA 8ICAA 1L3UA 4RNOA 4YD2A 4IQWA 1V9PA 4I2DA 4RZRA 3KHHA 2C22A 5KT6A 2R8HA 3C2MA 1NJYA 1X9MA 1D8YA 3ZDCA 3RAXA 5KFIA 4JV0A 2XY5A 4DLEA 4KN4A 2KZMA 4C8NA 4QZAA 2VA8A 5KT7A 3GIKA 4C8OA 4F3OA 4C8MA 4Q8FA 1B43A 4NXZA 1T7PA 5J2JA 1QSSA 3MR3A 4PHPA 2W9BB 3SYZA 4EYIB 4YMNA 3C2KA 4DFJA 2Y1IA 1MQ2A 4MF2A 2IA6A 1B22A 4TQRA 4J9KA 3MDCA 1XSLA 1L3TA 3ORYA 7ICMA 2BHNA 2J6TA 1IM4A 3NGDA 2BCSA 2KTQA 2ZUDA 3C21A 3OGUA 3M9OB 3HW8A 2W9CA 4GXIA 4ECWA 2R8IA 4M04A 1ZQPA 5KG6A 1T3NA 3ZDEA 4PHEA 5J0SA 4YQWA 4KLMA 5KTQA 4DS4A 3ISBA 5KFTA 5KFUA 4F92B 1KTQA 7ICHA 9ICPA 9ICGA 4IRDA 4F8RA 2KFNA 9ICSA 4UBCA 4TUQA 4O0IA 8ICWA 5EOZA 4DOAA 5HHHA 3LDAA 2FPKA 5KFEA 4P4MA 1UA1A 4KLJA 9ICRA 4O3OA 3GV7B 5D46A 4DQRA 1NKCA 4ECSA 3V6JA 5KFNA 4ED0A 3RJGA 4K4HA 2ISPA 2OWOA 1XO1A 1RXVA 9ICFA 2BQRA 5DDYA 7ICIA 5J2EA 4RUAA 8ICNA 4EBDA 3QE9Y 2UVUA 4F2RA 4KITB 4F4KA 3K4GA 1ZQBA 4KLTA 5KFSA 3RJIA 2P6RA 3K75D 3G6VA 1TV9A 3LWMA 2PFNA 8ICPA 4TURA 1HUZA 1KFTA 1XU4A 2V4QA 9ICXA 3MGIA 7ICUA 1ZQVA 4ELVA 3C23A 5CP2A 5J2BA 4RPYA 1KEJA 3C1ZA 4F5PA 3QEBZ 4B9MA 4JWMA 1RXWA 4YMMA 8ICLA 2ALZA 1NJZA 2DPIA 5EWGA 5KFXA 1Y88A 4R66A 4DF4A 4PGYA 4QWDA 3M8RA 4RQ5A 2W9AA 5F9NA 3PV8A 1SKSA 1KSPA 4FBTA 8ICKA 5J2AA 4QZCA 4DL5A 4YP3A 1ZQGA 4NM2A 4I2FA 4UBBA 1ZJNA 4CCHA 1ZQLA 2AJQA 3Q8MA 5KT3A 3ZDBA 4ECYA 2BCRA 9ICIA 1ZQMA 8ICUA 5BOLA 3UQ0A 7ICKA 1S77D 2BCUA 2KZ3A 3H4BA 2V9WA 7ICJA 5J2HA 3UXPA 4DSJA 3PR5B 1A77A 5BPCA 9ICQA 3C1YA 2RDIA 7ICOA 1BPEA 3MFHA 5KFRA 4FBUA 2RDJA 4M9JA 8ICFA 4F5OA 2PFQA 2F1HA 3QZ8A 2XGPA 3RTVA 3JPPA 3TAPA 4ELTA 4O5CA 2AU0A 8ICZA 9ICWA 4QZFA 4MEXA 1ZQNA 4DSLA 2UVWA 4FO6A 3V7LA 4JWNA 3SV4A 4EZ9A 4XQ8A 4TQSA 4RQ4A 3MFIA 9ICEA 2JEGA 8ICEA 2AQ4A 4F2SA 1QTMA 4ED1A 5DBCA 5DDMA 5J2GA 4UB4A 1NK9A 4EYHB 5J0RA 4QZHA 4PH5A 3TAQA 4X5VA 3PW5A 3PNCA 4DWIA 5KFHA 1XWLA 5J0UA 3TFSA 1N48A 3C5FA 3MR5A 3V7JA 4Q44A 1SL0A 5BOMA 3GILA 4DS5A 3PW7A 2R8JA 3E2EA 4YD1A 1JXEA 5KT4A 4ECRA 5DB9A 2KZZA 4ECQA 3RH5A 3V6KA 2A1JB 2F1IA 1L3SA 4P2HA 4GC6A 2I1QA 4DQSA 4IRCA 4M2YA 4IQUA 2DPJA 2FPLA 2XO7A 2R8KA 2BDPA 4BXOA 1TAUA 4JK1A 4M0AA 4F5NA 5J0QA 3Q8SB 1RYSA 2JZBA 1KRPA 4ECVA 4J9PA 1N56A 5KG5A 4NLKA 4B9NA 8ICBA 3OHBA 4F5RA 3KTQA 2PFOA 1UT8A 4B9UA 3FYHA 4UB2A 3QEAZ 1MQ3A 9ICHA 8ICYA 8ICTA 2XGQA 4UAZA 3RRGA 4G3IA 5J0XA 4DOCA 4O3NA 5DLGA 3HT3A 1U4BA 3HPOA 3KHRA 4RT2A 2BPCA 3MABA 4F4WA 1XSNA 5KG7A 1ZQWA 1ZQDA 3M9NB 2BQUA 5KG3A 1S76D 4RQ6A 3RB3A 1ZQXA 4DFKA 4B9LA 5KFAA 3OJSA 9ICJA 2ISOA 3RJEA 4F50A 4IR1A 5D49A 3EYZA 7ICTA 4NLNA 1ZQHA 3SV3A 4B9TA 5DB7A 2P6UA 3RJFA 4ZH4A 1NJWA 1D9FA 3AUOA 4C8KA 4I2HA 5DQIA 4MFAA 9ICAA 2LYHA 4ECXA 4QWCA 2ZJ5A 5KFQA 2HVHA 4Z6FA 4QZ9A 2PI4A 3GIMA 3THVA 1TVAA 2PFPA 3ISCA 4P4PA 2C2DA 4F93B 5JUMA 4RPXA 4RNNA 4DF8A 4PHDA 5DG7A 4LZGA 4RQ3A 1TK8A 3GQCA 1XSPA 3GV8B 2MAXA 1U48A 5C5JA 3KHLA 4TUSA 3JPRA 4J9RA 3UPQA 3TI0A 8ICCA 3H8WA 2HHVA 1S0VA 4JV1A 5J2CA 4QW9A 8ICRA 4DO9A 5KFPA 1JN3A 2MUTA 4R8UB 5KFCA 3AU2A 3C5GA 4M9GA 4DL2A 4ED7A 3RBEA 4F4XA 1UA0A 2UVRA 1JX4A 4QW8A 2XCAA 2A1JA 4RQ8A 2VA2A 4GXJA 1ZJMA 3UXOA 8ICXA 3N97B 2FMPA 3ZD9A 1U45A 1DOQA 3BQ0A 4O3PA 2HHXA 1H38A 4Z6DA 4RQ0A
chains in the Genus database with same CATH superfamily
4KLHA 2F1JA 1ZXIA 4QZ8A 4EENA 4DL4A 1MSWD 1NK0A 5CR0A 3T5KA 3C2LA 3H4DA 5AM3A 1NK7A 4GC7A 4RQ2A 5HMLA 3Q8PB 4Z6EA 4MFFA 1SKWA 3D6JA 5IIOA 4C8LA 1SL2A 3RH4A 1ZQFA 2OHFA 1SV0C 2KVCA 2YMMA 1X9SA 3IDWA 9ICLA 4QWBA 3PW2A 5AM1A 2HHQA 1LKYA 4KLFA 9ICOA 5CB1A 2IHNA 5AI5A 1BPYA 1NK4A 3JPTA 3ZDAA 4YFKA 3EZ5A 5ALQA 4O5KA 3L4PA 4PL1A 4P4OA 3QZ7A 4PZNA 2BCQA 3HX0A 7ICQA 3HKZC 3RR7A 4UASA 3KFUF 7ICLA 4RNMA 2QLTA 3EWAA 2K4HA 2KEYA 2AGOA 4I2GA 1NJXA 2GO7A 1ZQEA 3IRUA 2W8LA 1WCLA 3RRHA 7ICGA 5DB8A 5CJ7A 5IINA 2Y1JA 1Z4NA 4MEYA 5A0LA 3TFRA 1EXNA 2M9NA 5KT2A 4ED6A 3H0LB 4EZ6A 1AROP 4I2CA 1BNPA 2HVIA 5AHXA 2AHOB 2KJ5A 5AK3A 1CRXA 5KFMA 3D2NA 5KFJA 3PR4A 1QSYA 2OM6A 4O9MA 1Z00A 5AK6A 4US8A 3LK9A 4KLGA 3JPQA 1ZQYA 2OH2A 1PK1B 5KG4A 1UPHA 2E8OA 2NO5A 1P7DA 2HCFA 5G5GA 3EW9A 5J8YA 4RQNA 4KLOA 2F44A 3KKAC 5CA7A 1D9DA 2NRZA 1D8BA 2NRVA 4DL7A 1BPDA 2D6FC 4EBEA 4FZNA 4KX5A 1HUOA 4M9NA 3FC4A 2BR0A 4UQGA 3MBYA 1Q3UA 5KAFU 1A6SA 2B21A 4DFPA 4GLXA 4UB1A 2OCEA 4QWEA 3MGHA 1UQVA 2ZIWA 5IIIA 4EEYA 2ASJA 2K4IA 2FLPA 2E5SA 2H5XA 4DEZA 5KG0A 3GU3A 3KZXA 4ECTA 2ASLA 2DKXA 1S9FA 1TKDA 9ICCA 5HP4A 1UT5A 1LVHA 7ICRA 4K4IA 7ICPA 3RAQA 1CEZA 5ALKA 3OPXA 7ICVA 7ICNA 2WF6A 5DG8A 1RZTA 4QWAA 4CRXA 1Q8KA 3JPSA 4RQ7A 4JV2A 2F76X 7ICEA 4B9SA 3QUCA 4YMOA 5EWEA 5KFYA 2FLNA 4IR9A 5J29A 5IILA 1HIWA 1ZETA 2ATLA 1X42A 8ICMA 3S6JA 3EPGA 2C2RA 2HHTA 4J9QA 2JRZA 4I2JA 3RB6A 7ICSA 2BQ3A 5DLFA 3VC8A 8ICAA 4RNOA 4YD2A 4IQWA 3UM9A 4EELA 3R9KA 2EH9A 5KT6A 3RAXA 1SWWA 3GIKA 2KP7A 2EDUA 4Q8FA 4NXZA 5J2JA 1DK2A 3ALRA 4DFJA 2ZIUA 2Y1IA 2IA6A 5ALMA 5AKKA 5E79U 3F5AA 2BHNA 2K8AA 2BCSA 2ZIVB 4PHEA 5J0SA 4KLMA 3M6ZA 5KFTA 4IS7A 2FDRA 4JB3A 5TISU 4IRDA 1N2XA 5EOZA 4DOAA 2Y9TA 5HHHA 3NASA 4PZOA 5ALEA 1NKCA 1N63A 4K4HA 5DDYA 1NZPA 2H3IA 7ICIA 4RUAA 1SZHA 2UVUA 4KITB 3K4GA 5KFSA 2P6RA 1WUDA 3K75D 1N5XA 4TURA 1HUZA 4Y2TA 1XU4A 2H3ZA 5AKLA 9ICXA 1ZQVA 4F5PA 5J2BA 5CP2A 1JI7A 1KEJA 2CN1A 3C1ZA 3QU7A 1KL9A 2KVSA 3ZI4A 4YMMA 1NJZA 5EWGA 4R66A 4QWDA 3M8RA 2W9AA 5F9NA 3PV8A 4QZCA 4YP3A 2K4EA 1ZJNA 4CCHA 1ZQLA 4CGZA 5KT3A 3ZDBA 1QCKA 1S77D 2BCUA 3H4BA 4DSJA 4Y2SA 1A77A 3C1YA 2RDIA 5AM5A 1BPEA 2RDJA 4LJXA 3QZ8A 5GTIU 1F44A 4O5CA 8ICZA 4QZFA 4MEXA 2UVWA 2DBYA 4FO6A 3SV4A 4XQ8A 3MFIA 5EE9A 1NK9A 5ALUA 4CDGA 4X5VA 3PW5A 1M6YA 1OXJA 3V7JA 1SL0A 5BOMA 1JXEA 5DB9A 3RH5A 3J81j 3V6KA 4GC6A 4IQUA 2R8KA 2BDPA 1TAUA 4JK1A 2A19A 2JZBA 4ECVA 4J9PA 1NZBA 5KG5A 2GOLA 3FYHA 3PSTA 8ICYA 4DOCA 4O3NA 3A0BU 3HT3A 1QQ6A 3QX7A 3F2CA 1ZQ1C 4DCCA 1K5OA 4F4WA 1XSNA 3AL0B 1ZQWA 2B6GA 3I76A 1S76D 3UMCA 4RQ6A 3RB3A 4B9LA 1XNSA 3RJEA 4F50A 3LYSA 5HR7A 2A1AA 3EYZA 1RG6A 3SV3A 1XO0A 3RJFA 2LPEA 4I2HA 4MFAA 2G0AA 1OW5A 2ZJ5A 2PI4A 3GIMA 1TVAA 2PFPA 4F93B 5JUMA 4RNNA 3QXGA 3BS5A 3KOOA 2MAXA 1CI4A 3JPRA 4J9RA 3TI0A 2M0NA 3FM9A 3H8WA 3UMGA 1S0VA 2R18A 4QW9A 5AI0A 1JN3A 5AK4A 3HJEA 4DL2A 1JX4A 4QW8A 2XCAA 1JALA 1ZJMA 3KD3A 1U45A 1DOQA 4O3PA 3AEVA 2HHXA 3AMZA 4Z6DA 5EWFA 4M6WB 2ZJ8A 5AM0A 3PO5A 3EPIA 2JEFA 3NVVA 3V6HA 1PVPA 3RB4A 3RR8A 3CP8A 1K1QA 2RHFA 1O08A 5HHIA 2DWQA 5IIMA 2Q4TA 2VANA 3F2BA 8ICHA 1XS9D 5DBBA 2WF8A 4C7ZA 2JEJA 5KNIA 3NRWA 5J0PA 2ZXHA 1KDHA 2VA3A 1BNOA 3I28A 2G08A 3E58A 4BGDA 2UVVA 5DG9A 3BS5B 1RYRA 4HAIA 4DSEA 5J0TA 3T3FA 1BVSA 3QYPA 4BDPA 1HJPA 2XCPA 4F4ZA 3H8JA 2W9BA 2V4RA 1TK5A 2DF4B 1SV0A 4G9BA 3NTUA 9ICKA 3PVXA 3AQEA 4PHAA 3TANA 3RF9A 2HHUA 1S0MA 4YR3A 4Y2JA 1ZQCA 5ALLA 1WCNA 1NKBA 4Q45A 4QNLA 4QZBA 1N60A 3RJJA 2HW3A 1N62A 2C2EA 1N5WA 3T5LA 2W9MA 2HBJA 3B0YA 4LZDA 2KSOB 1ED1A 3UQ2A 4GXKA 5KFOA 2EQYA 2W7OA 4ED8A 2BZFA 5ALHA 1ZQIA 2D3DA 1L7PA 3ZDDA 1IV8A 5J2IA 5L9XA 4IC9A 4J9LA 2YX8A 3PX4A 4UAVA 4XRHA 2DFLA 4EBCA 3PW4A 3PSIA 4RPZA 2KFZA 5DGBA 1C7YA 3BJYA 2LHTA 2LM1A 1X9XA 1NK5A 4Y2PA 5KFDA 8ICSA 2KICA 3TARA 1SV4A 4XA5A 1ZD3A 5KFFA 1SXEA 2LKYA 1KQQA 1TAQA 2YB4A 1TFRA 3PY8A 2YMLA 3SAHA 3RJKA 2IOHA 5ALZA 8ICQA 1ZYQA 4R64A 1VDVA 4FZLA 2LYBA 4I28A 4Y2QA 3UMBA 3H8SA 1KFSA 3NS1A 3GZFA 4R63A 1X66A 4B6JA 1ECWA 2Z7JA 1JIHA 1F5SA 3DV9A 1COOA 1Z19A 2XY7A 4DQPA 3PMNA 4PPXA 4CNQA 4F91B 1BPXA 8ICIA 2WF9A 4ELUA 1XC9A 4ECUA 3IG8A 4QZEA 1IG6A 1BPBA 1DRGA 3OSNA 1L5UA 3RFAA 3JPNA 4B9VA 4QZIA 2HSZA 1QSLA 2ZJAA 3F53A 1ZQZA 4Z6CA 4K4GA 1ZQUA 2K60A 5IIKA 1SXDA 1TAMA 5AIBA 2AH5A 4KMOB 1ZQJA 3PMLA 1SL1A 4Y2RA 2VIXA 1RPLA 3L5KA 4YN4A 4PGQA 4IL6U 3OSPA 4USAA 2KSOA 2R8GA 1LV5A 3BQ1A 2XC9A 5KFBA 2JZBB 3QUQA 3RJHA 3WKBA 2BKEA 4KMUA 4J9NA 4C7YA 2LYAA 3HKZF 2XIDA 5KFLA 3PO4A 1J2MA 8ICOA 1V9PA 3C2MA 1QH9A 5AKYA 1ZOLA 1QQ5A 2VA8A 5KT7A 2F77X 1DXSA 2HOFA 3IN5A 5AI9A 1QSSA 3SYZA 1NI3A 4YMNA 3T79A 5HR6A 1B22A 4TQRA 3NVZA 4NLBA 5ALTA 4J9KA 1L3TA 2FI1A 3NGDA 4GXIA 3M9OB 3HW8A 2W9CA 2R8IA 1T3NA 3ZDEA 1KTQA 2WAQC 9ICGA 2F8LA 2JV3A 8ICWA 5CRXA 4O3OA 3GV7B 4DQRA 4ED0A 2ISPA 2OWOA 1RXVA 2BQRA 8ICNA 3QE9Y 4F2RA 4F4KA 3SD7A 5F3XB 1ZQBA 2QKQA 1B0XA 2ZIXB 4QJFB 3G6VA 3K1RB 3LWMA 2PFNA 5CEHA 4BUGA 3MGIA 4CF3A 2IOFA 4B9MA 8ICLA 3ED5A 2ALZA 2L5YA 2DPIA 3KKAA 1OUQA 1KSPA 8ICKA 2KHQA 4DL5A 2YMQA 4NM2A 4I2FA 4UBBA 4ECYA 5AKEA 4C80A 4NL9A 2KZ3A 7ICJA 2ZIVA 4CF5A 3PR5B 7ICOA 5AIAA 3MFHA 4M9JA 2PFQA 2QARA 2XGPA 3JPPA 3TAPA 4ELTA 9ICWA 4DSLA 3V7LA 4EZ9A 9ICEA 3M7DA 3C28A 2AQ4A 2JHDA 1QTMA 5J0RA 3NUQA 4QZHA 3MGVA 4WJ3B 1XWLA 5ALXA 3GILA 4DS5A 4YD1A 4ECRA 2YQEA 2W3RA 2A1JB 2F1IA 5EE0A 4Y2YA 4P2HA 2NV3A 2I1QA 4M2YA 3CW2C 4BXOA 4M0AA 4F5NA 5J0QA 3Q8SB 3WK4A 4AP9A 8ICBA 4B9NA 3OHBA 4F5RA 3QUTA 1KW4A 3KTQA 2PFOA 4ICAA 4AYBC 5ALNA 2XGQA 4G3IA 5J0XA 2DGZA 5DLGA 3C29A 3KHRA 4RT2A 1JUDA 5KG7A 1ZQDA 4Y2UA 3DDHA 3M9NB 2BQUA 2K8BB 3QU9A 3H0RB 2K89A 5KFAA 5C0YA 2YN4A 4IR1A 2K8CB 3LVWA 3AUOA 5FP0A 2IOFK 4ECXA 4QZ9A 2C2DA 4RPXA 2KKVA 2DUYA 4PHDA 4LZGA 2G5HB 1TK8A 3GQCA 2ZIXA 5C5JA 3KHLA 1WWUA 3MC1A 4NWIA 4C4RA 8ICCA 2ES6A 4EX6A 2HHVA 4JV1A 5ALGA 4O3MA 8ICRA 3BZKA 2MU2A 1WYGA 4ED7A 4F4XA 2UVRA 2VA2A 4RQ8A 4FZMA 4FE3A 3UXOA 8ICXA 3BS7A 3N97B 2Y0SC 2WFAA 4Y2VA 2VJ4A 2GH1A 1L3SA 9ICMA 4NM1A 4P0QA 5JU5A 5L1IA 1JXLA 2O6KA 3V72A 4BXOB 1NK8A 2WB1F 4DQQA 3K1ZA 4NLGA 4O5EA 3IM1A 3KBBA 1AQ6A 5J2DA 1S0OA 3HRDD 2YY6A 2HHWA 4KN7A 3RB0A 2EZZA 3QU2A 4M6WA 4O3RA 7ICFA 4O3SA 5KFWA 2W8KA 5KFVA 4NY8A 2E8PA 2ZUBA 4F72A 2AGPA 3ZDCA 3MR2A 1S8OA 4J9SA 1FIQA 4ED2A 2H3VA 3FDSA 5TZVA 1IXRA 3AQFA 4I2IA 5B66U 4R8UA 3MDAA 1T4GA 5AKHA 1GO3F 1D8LA 1TK0A 4RQ1A 4DL6A 1QLNA 3N7RC 5J0OA 4M47A 3Q8QB 8ICGA 2HHSA 3ICXA 1ZD2P 3BQ2A 4KLQA 1WG8A 2G06A 2YMPA 1SZPA 2F2AB 3OJUA 4PJ0U 1U47A 4KLSA 1PUZA 4OJLA 4DLGA 2ZTCA 1ZQSA 2HI0A 4TUPA 4UAWA 8ICJA 5AI4A 4JMUA 4DSIA 2ZTDA 4FS2A 2W9CB 1V97A 5KFGA 3PW0A 3RH6A 5L1MA 2KOBA 3SR6A 2LM4A 3NRZA 5CHGA 4DSKA 2KN7A 2Y0SF 3WKEA 1MC8A 5L1LA 4FS1A 1FFUA 3H40A 1ZQRA 3TQ1A 1DK3A 1JMSA 5HMMA 5DGAA 4HYKA 5L1JA 2AXTU 3M9MB 3ISDA 4IRKA 2K4PA 3Q8RB 4DQIA 2A3VA 3FAHA 2W03A 4QIWC 4J9MA 2BPGA 1SKRA 4I2BA 1MA7A 3ETLA 2XI9A 1NK6A 3PX0A 5EE3A 3NVWA 3SQIA 3TACB 3WK7A 5EE1A 1Z00B 3Q8KA 2J6UA 4ECZA 3D2SA 3Q8LA 1RM6C 1K1SA 4KLIA 2ODGA 4YXMA 5D4BA 4DOBA 2Q0ZX 1J2NA 2HBKA 4OJ6A 2I6XA 3N4MB 2B0CA 4M9LA 1PZNA 1DGSA 4MFCA 1U9LA 1ZQAA 5J0WA 4F71A 4KX3A 2ASDA 1T94A 5KT5A 2H3FA 4YG2A 5DB6A 5AM2A 2FMSA 2IHMA 3TKAA 4JUZA 9ICTA 5J0YA 3U26A 4PGXA 5DQHA 3G6XA 4IQVA 2GWSA 1T3QA 2N1RA 5DBAA 5CWRA 1U49A 9ICBA 3I1YA 5DQGA 5B5EU 3HWTA 3SZ2A 2OEHA 2VJ5A 5GTHU 4I2DA 1TE2A 4RZRA 3KHHA 2C22A 2R8HA 1D8YA 5KFIA 4KN4A 1YZ6A 4C8NA 4QZAA 2BDUA 4F3OA 4C8MA 3MR3A 4PHPA 2W9BB 4EYIB 3C2KA 2VKQA 2XICA 2KMDA 1MQ2A 4MF2A 3F5EA 3ORYA 2J6TA 3QNMA 1IM4A 3WKCA 2KTQA 4ECWA 2HBLA 5KG6A 2JXJA 4YQWA 5J8YC 5KTQA 4DS4A 3ISBA 9ICPA 4F92B 4ACOA 3DEEA 4F8RA 2KFNA 4UBCA 1F0MA 2W11A 1UA1A 3LDAA 2FPKA 5KFEA 4KLJA 1ZD4A 5G5HA 4EEKA 5D46A 2EAOA 3V6JA 2EZYA 5KFNA 1L7MA 1XO1A 9ICFA 5J2EA 4C0ZA 1JRPA 3RJIA 8ICPA 1J97A 3D2QA 1Z1BA 3C23A 4RPYA 3QEBZ 1RXWA 2LI6A 3SENA 5KFXA 1Y88A 4DF4A 1QQ7A 4PGYA 3WK9A 5J2AA 2W43A 3A0HU 4OO1J 2AJQA 3Q8MA 2KKPA 2BCRA 1ZQMA 4UATA 7ICKA 5J2HA 2PMZC 5BPCA 9ICQA 2E8NA 1Z4OA 5KFRA 4FBUA 8ICFA 2KIVA 2AU0A 2E3TA 1RQLA 1Q3VA 4JWNA 1MN8A 1Z1VA 1LKYB 2JEGA 4F2SA 4UB4A 4EYHB 3TAQA 3PNCA 4DWIA 5KFHA 3N28A 5J0UA 1N48A 1IIPA 3C5FA 1ZD5A 4Q44A 3PW7A 2R8JA 2KJ8A 2KZZA 2ZXIA 1PK3A 2PKEA 4ECQA 1C20A 5KL8B 2DL0A 2XO7A 5JRTA 2KG5A 1RYSA 2CXYA 1N56A 1ZRNA 4UB6U 4BJQA 5AKZA 2WF5A 1MQ3A 9ICHA 3RRGA 1U4BA 2ZIWB 2BPCA 2KD1A 4C4SA 5AM4A 4P0QB 1ZQXA 2RRDA 3OJSA 9ICJA 2ISOA 3VCBA 1S5LU 1ZQHA 4U6PA 4C8KA 2W7PA 4QWCA 5KFQA 5DG7A 4RQ3A 5ALYA 4GFJA 1B4FA 5AICA 4TUSA 3UPQA 2KHVA 3WKAA 1O03A 5J2CA 5KFPA 5KFCA 3C5GA 4M9GA 4AYBF 3RBEA 1YZ7A 1UA0A 4NJ8A 4GXJA 2EAMA 2W55A 2P35A 3SAGA 2MA1A 3BQ0A 3PZPA 3TADA 4RQ0A 1FFVA 2JR5A 3V7KA 2NRXA 2IMWP 3E0FA 3N7PD 4Y2XA 3F2DA 3PSFA 3ZD8A 2EZXA 2JMGA 3BQTA 4BWMA 4RU9A 3ONNA 1T8EA 2NRWA 2JGAA 3T5HA 3PSPA 3KHGA 2IBKA 1ZQOA 2BCVA 4I2EA 3OHAA 1ZQTA 3SI8A 5ALFA 4QZGA 1NOMA 3G6YA 2XY6A 2W54A 3IV6A 2NO4A 9ICNA 1X9WA 1X6IA 2F3NA 1FO4A 2PXIA 4R65A 1CUKA 1PVRA 2ZTEA 2I9GA 2WHEA 3IG5A 3HP6A 3AU6A 2NRTA 4A8EA 2BGWA 4MF8A 1NKEA 4Q8EA 4J9OA 3BZCA 4I2AA 2PI5A 3NVYA 2I5HA 4OD0A 3T5JA 5AKGA 2W04A 4PL2A 2GLEA 2LMRA 5KL1B 3BDPA 4KTQA 4UARA 4KLDA 4LVSA 1L7NA 4NL9C 4YXJA 1URJA 2J6SA 5ALVA 4M9HA 1X2IA 2MRLA 4QIWF 5ALSA 4UW9A 5DKWA 5F9LA 4UB3A 4IQTA 5AI6A 5KFKA 2ZUCA 1LB2B 3H7IA 3MR6A 9ICVA 2D8CA 3HILA 2FPMA 4NV0A 4YR0A 5L1KA 4NLZA 3QUBA 2BPFA 4E0DA 2WTFA 9ICUA 3M1YA 4QZDA 4DL3A 1KFDA 2KK0A 4UB8U 3N7SC 3UXNA 4BX9C 1RQNA 4ED3A 4F5QA 2JEIA 5J2KA 3B0XA 4DFMA 3GDXA 1S0NA 2AQ0A 5ALJA 4CF4A 4F4YA 4BWJA 2NYVA 2HOQA 1YT3A 1S97A 5ALDA 1ZQQA 4UB5A 3WU2U 2ZG6A 2XVTA 3GIIA 4YR2A 2G5IB 3IHQB 4ZOHC 2G07A 1Z3EB 1A76A 3O0FA 4RT3A 5KG2A 5J2FA 3WK8A 3GIJA 3RBDA 2MUTB 3M8SA 1UCVA 5AKXA 4XUSA 4I29A 4KLEA 5KFZA 5AKJA 2OYYA 4DFDA 1KKXA 4KLUA 3LWLA 2W3SA 8ICVA 1BGXT 1N61A 2RLTA 2FMQA 1Q46A 4YCXA 2KJ9A 1L3VA 1S10A 2FLLA 4C4TA 4DSFA 1WWVA 4RUCA 2RQ5A 2WB1C 5IIJA 3CYMA 2KE7A 1ZQKA 3GV5B 3TADC 2AGQA 5ALIA 5KG1A 4KLLA 2QB0A 2Y9UA 4P0PA 3AN1A 4O3QA 2P66A 2G09A 3H0MB 4YVZA 2OXOA 4OJPA 3L3FX 4U7CA 3PX6A 5ALOA 3JPOA 1A0PA 3EUB2 3QU4A 5AK5A 2F8KA 5KAIU 3WK6A 3GFKB 2EAPA 5HNKA 4UAYA 3CNHA 1KLNA 1L8OA 4I27A 1BPZA 2C28A 2YB1A 4Q43A 1L3UA 2CRXA 2KNJA 1NJYA 1X9MA 3WKDA 4JV0A 1VJ5A 5T14A 2XY5A 4DLEA 2KZMA 2E1EA 3M6KA 2PMZF 2KV2A 4C8OA 2YTUA 1B43A 2FE9A 2H3QA 1T7PA 1L6NA 2WAQF 4US9A 1XSLA 3MDCA 7ICMA 2ZUDA 3C21A 3OGUA 4M04A 4KLTA 1ZQPA 1SIJA 4P0PB 4J03A 5KFUA 7ICHA 1FEZA 2WF7A 9ICSA 4TUQA 2FJ6A 4O0IA 9ICRA 3SEIA 4P4MA 2HMXA 2DKZA 4ECSA 1RYUA 3RJGA 3ETRA 1PVQA 2QB0B 1L7OA 4EBDA 4OJOA 1COKA 2QB1A 3IP4B 2LBOA 2JH7A 1TV9A 1KFTA 2V4QA 4OCZA 7ICUA 4ELVA 4JWMA 2KIWA 1PK1A 4FFDA 5AI8A 4OJ5A 1SKSA 4RQ5A 4FBTA 2E8MA 1ZQGA 2CPRA 1V85A 3QU5A 9ICIA 8ICUA 5BOLA 3UQ0A 2V9WA 3UXPA 1VLBA 3SMVA 5K4LA 2E1FA 3LVVA 2ESEA 4F5OA 2F1HA 3RTVA 3B9JA 5JTIA 1ZQNA 4TQSA 4RQ4A 1KBUA 8ICEA 4ED1A 5DBCA 5DDMA 5J2GA 2MSNA 4PH5A 1UHUA 5ALRA 3TFSA 1HEKA 3MR5A 3E2EA 4UAUA 3CRXA 1ZRMA 5KT4A 3WK5A 1SWVA 4DQSA 4IRCA 2DPJA 2FPLA 3BQ7A 1KRPA 1JROA 4CE6A 4NLKA 4GIBA 1UT8A 4B9UA 2QARB 3AM9A 4UB2A 3QEAZ 3KZIU 8ICTA 4EX7A 4UAZA 1SGGA 3HPOA 3MABA 5ALPA 5KG3A 4MHVA 2EANA 4DFKA 3OTQA 2JH1A 4RQMA 1RDFA 2HBMA 5D49A 2RP5A 7ICTA 4NLNA 4B9TA 5DB7A 2P6UA 1SB3C 4ZH4A 1NJWA 1D9FA 5DQIA 9ICAA 2LYHA 2HVHA 5ALWA 4Z6FA 3THVA 1DGJA 1KN5A 3ISCA 4P4PA 3SAFA 2DQNB 4DF8A 2ZIUB 2HDOA 1XSPA 3GV8B 1U48A 4NLCA 5H2FU 2HOIA 1V38A 4DO9A 1X40A 4R8UB 2MUTA 3H8MA 3AU2A 1X6JA 1NNLA 2A1JA 5AKIA 2FMPA 3ZD9A 1L8LA 1H38A
chains in the Genus database with same CATH topology
5EWFA 9ICMA 4NM1A 4KLHA 4M6WB 2ZJ8A 3V7KA 2F1JA 4QZ8A 2NRXA 3PO5A 3EPIA 2IMWP 5L1IA 1JXLA 4DL4A 2JEFA 1MSWD 1NK0A 5CR0A 3T5KA 3RR8A 3V6HA 3V72A 3RB4A 3C2LA 3H4DA 1NK7A 3ZD8A 4GC7A 4BXOB 4RQ2A 5HMLA 3Q8PB 1K1QA 3BQTA 4BWMA 4RU9A 4Z6EA 1NK8A 1T8EA 4MFFA 2NRWA 3T5HA 3KHGA 2IBKA 4DQQA 1ZQOA 1SKWA 4NLGA 4O5EA 5IIOA 4C8LA 3IM1A 1SL2A 5HHIA 5J2DA 3RH4A 2BCVA 4I2EA 1S0OA 1ZQFA 5IIMA 3OHAA 1ZQTA 3SI8A 2HHWA 4KN7A 4QZGA 3RB0A 2VANA 1NOMA 4M6WA 1X9SA 3G6YA 2XY6A 4O3RA 8ICHA 4QWBA 1XS9D 7ICFA 9ICLA 3PW2A 5DBBA 9ICNA 4O3SA 1X9WA 5KFWA 2JEJA 2W8KA 2HHQA 4KLFA 5KFVA 4R65A 5J0PA 1CUKA 2PXIA 4NY8A 9ICOA 5CB1A 2ZUBA 2AGPA 1KDHA 2ZTEA 3MR2A 2I9GA 2IHNA 4BGDA 2VA3A 2UVVA 1BPYA 5DG9A 1NK4A 3HP6A 3JPTA 1RYRA 3ZDAA 4DSEA 5J0TA 3AU6A 3T3FA 1BVSA 4J9SA 2NRTA 4BDPA 1HJPA 2XCPA 4F4ZA 2BGWA 4MF8A 4YFKA 3H8JA 2W9BA 3EZ5A 1NKEA 4Q8EA 4ED2A 4J9OA 3FDSA 2V4RA 4I2AA 1TK5A 4O5KA 4P4OA 2PI5A 3QZ7A 5TZVA 2BCQA 3HX0A 1IXRA 7ICQA 4I2IA 3NTUA 3T5JA 3RR7A 9ICKA 3PVXA 4R8UA 3MDAA 1T4GA 7ICLA 4PHAA 3TANA 1D8LA 1TK0A 4RNMA 3EWAA 2HHUA 4RQ1A 4DL6A 3BDPA 1S0MA 5J0OA 1QLNA 4KTQA 4M47A 4YR3A 3Q8QB 8ICGA 2AGOA 4I2GA 1ZQCA 2HHSA 1WCNA 4KLDA 4LVSA 1NJXA 1NKBA 4YXJA 4Q45A 3BQ2A 1ZQEA 2W8LA 4KLQA 2J6SA 4QZBA 3RJJA 1WCLA 3RRHA 2HW3A 7ICGA 5DB8A 2C2EA 3T5LA 1X2IA 5CJ7A 2W9MA 4M9HA 3B0YA 4LZDA 5IINA 2Y1JA 3UQ2A 1SZPA 4MEYA 5DKWA 5F9LA 5KFOA 4UB3A 3OJUA 4GXKA 1U47A 4KLSA 4IQTA 3TFRA 1EXNA 2M9NA 5KT2A 2ZUCA 5KFKA 4DLGA 1LB2B 2ZTCA 3H7IA 4ED6A 4ED8A 1ZQSA 3MR6A 9ICVA 4TUPA 1AROP 4EZ6A 2FPMA 1ZQIA 4I2CA 4UAWA 3ZDDA 5J2IA 8ICJA 5L9XA 4YR0A 5L1KA 4J9LA 4DSIA 2ZTDA 3PX4A 2BPFA 4E0DA 4NLZA 2HVIA 2WTFA 9ICUA 4FS2A 4XRHA 4QZDA 2DFLA 4EBCA 3PW4A 4RPZA 4DL3A 2KFZA 1KFDA 5DGBA 2W9CB 5KFGA 3PW0A 3RH6A 1C7YA 3BJYA 3UXNA 5KFMA 5KFJA 3PR4A 1QSYA 4ED3A 4F5QA 4O9MA 5CHGA 1NK5A 2JEIA 4DSKA 5KFDA 8ICSA 1Z00A 3TARA 5J2KA 3B0XA 3LK9A 2KN7A 4XA5A 3JPQA 3GDXA 1ZQYA 4DFMA 1S0NA 5KG4A 5KFFA 4KLGA 2AQ0A 4F4YA 1TAQA 1MC8A 4BWJA 5L1LA 1TFRA 4FS1A 3PY8A 3H40A 1S97A 1ZQRA 3TQ1A 1ZQQA 3EW9A 4KLOA 5CA7A 3RJKA 1JMSA 5HMMA 4UB5A 5DGAA 2NRZA 1D9DA 4HYKA 3GIIA 5L1JA 4YR2A 2NRVA 3M9MB 4DL7A 3IHQB 1BPDA 8ICQA 3ISDA 1ZYQA 4IRKA 3Q8RB 4DQIA 4R64A 1Z3EB 1A76A 4EBEA 4I28A 4RT3A 5KG2A 5J2FA 4J9MA 2BPGA 1SKRA 1HUOA 3H8SA 1KFSA 3GIJA 3RBDA 4R63A 2MUTB 3M8SA 4M9NA 1JIHA 4I2BA 2BR0A 3ETLA 4XUSA 1NK6A 1COOA 4UQGA 3PX0A 3MBYA 4I29A 4KLEA 5KFZA 2B21A 3LWLA 4GLXA 4DFPA 4KLUA 8ICVA 4UB1A 1BGXT 2XY7A 4QWEA 4DQPA 3MGHA 3PMNA 4PPXA 2FMQA 1Z00B 3Q8KA 5IIIA 4EEYA 4F91B 4YCXA 1BPXA 2ASJA 8ICIA 1L3VA 2J6UA 1S10A 4ECZA 2FLLA 2FLPA 4ELUA 4DSFA 1XC9A 4ECUA 3Q8LA 2H5XA 4DEZA 4QZEA 1K1SA 5KG0A 4KLIA 4RUCA 1BPBA 3OSNA 4ECTA 5IIJA 4YXMA 5D4BA 1L5UA 2ASLA 1S9FA 1TKDA 4DOBA 2Q0ZX 5HP4A 3JPNA 1ZQKA 1UT5A 4B9VA 9ICCA 3GV5B 7ICRA 4QZIA 1QSLA 2AGQA 2ZJAA 4K4IA 3RAQA 1CEZA 7ICPA 3N4MB 1ZQZA 4KLLA 5KG1A 4M9LA 4Z6CA 1PZNA 4K4GA 1DGSA 4MFCA 7ICNA 7ICVA 1ZQUA 5IIKA 1U9LA 4O3QA 5DG8A 1ZQAA 5J0WA 2P66A 1RZTA 4QWAA 3JPSA 4YVZA 4RQ7A 4JV2A 2ASDA 5KT5A 4YG2A 5DB6A 1ZQJA 7ICEA 3PMLA 1SL1A 4B9SA 2FMSA 2IHMA 1RPLA 4YN4A 4JUZA 3PX6A 4YMOA 4PGQA 5EWEA 5KFYA 2FLNA 4IR9A 9ICTA 5J29A 3JPOA 3OSPA 5J0YA 5IILA 4PGXA 5DQHA 1ZETA 3G6XA 4IQVA 2GWSA 3GFKB 5HNKA 4UAYA 2ATLA 2R8GA 1LV5A 3BQ1A 8ICMA 2XC9A 5KFBA 3EPGA 2C2RA 5DBAA 2JZBB 4J9QA 3RJHA 1KLNA 2HHTA 4I2JA 2BKEA 5CWRA 1U49A 9ICBA 3RB6A 4KMUA 7ICSA 5DQGA 4I27A 4J9NA 1BPZA 2BQ3A 3HWTA 5KFLA 5DLFA 2C28A 3PO4A 4Q43A 3SZ2A 8ICOA 8ICAA 1L3UA 4RNOA 4YD2A 4IQWA 1V9PA 4I2DA 4RZRA 3KHHA 2C22A 5KT6A 2R8HA 3C2MA 1NJYA 1X9MA 1D8YA 3ZDCA 3RAXA 5KFIA 4JV0A 2XY5A 4DLEA 4KN4A 2KZMA 4C8NA 4QZAA 2VA8A 5KT7A 3GIKA 4C8OA 4F3OA 4C8MA 4Q8FA 1B43A 4NXZA 1T7PA 5J2JA 1QSSA 3MR3A 4PHPA 2W9BB 3SYZA 4EYIB 4YMNA 3C2KA 4DFJA 2Y1IA 1MQ2A 4MF2A 2IA6A 1B22A 4TQRA 4J9KA 3MDCA 1XSLA 1L3TA 3ORYA 7ICMA 2BHNA 2J6TA 1IM4A 3NGDA 2BCSA 2KTQA 2ZUDA 3C21A 3OGUA 3M9OB 3HW8A 2W9CA 4GXIA 4ECWA 2R8IA 4M04A 1ZQPA 5KG6A 1T3NA 3ZDEA 4PHEA 5J0SA 4YQWA 4KLMA 5KTQA 4DS4A 3ISBA 5KFTA 5KFUA 4F92B 1KTQA 7ICHA 9ICPA 9ICGA 4IRDA 4F8RA 2KFNA 9ICSA 4UBCA 4TUQA 4O0IA 8ICWA 5EOZA 4DOAA 5HHHA 3LDAA 2FPKA 5KFEA 4P4MA 1UA1A 4KLJA 9ICRA 4O3OA 3GV7B 5D46A 4DQRA 1NKCA 4ECSA 3V6JA 5KFNA 4ED0A 3RJGA 4K4HA 2ISPA 2OWOA 1XO1A 1RXVA 9ICFA 2BQRA 5DDYA 7ICIA 5J2EA 4RUAA 8ICNA 4EBDA 3QE9Y 2UVUA 4F2RA 4KITB 4F4KA 3K4GA 1ZQBA 4KLTA 5KFSA 3RJIA 2P6RA 3K75D 3G6VA 1TV9A 3LWMA 2PFNA 8ICPA 4TURA 1HUZA 1KFTA 1XU4A 2V4QA 9ICXA 3MGIA 7ICUA 1ZQVA 4ELVA 3C23A 5CP2A 5J2BA 4RPYA 1KEJA 3C1ZA 4F5PA 3QEBZ 4B9MA 4JWMA 1RXWA 4YMMA 8ICLA 2ALZA 1NJZA 2DPIA 5EWGA 5KFXA 1Y88A 4R66A 4DF4A 4PGYA 4QWDA 3M8RA 4RQ5A 2W9AA 5F9NA 3PV8A 1SKSA 1KSPA 4FBTA 8ICKA 5J2AA 4QZCA 4DL5A 4YP3A 1ZQGA 4NM2A 4I2FA 4UBBA 1ZJNA 4CCHA 1ZQLA 2AJQA 3Q8MA 5KT3A 3ZDBA 4ECYA 2BCRA 9ICIA 1ZQMA 8ICUA 5BOLA 3UQ0A 7ICKA 1S77D 2BCUA 2KZ3A 3H4BA 2V9WA 7ICJA 5J2HA 3UXPA 4DSJA 3PR5B 1A77A 5BPCA 9ICQA 3C1YA 2RDIA 7ICOA 1BPEA 3MFHA 5KFRA 4FBUA 2RDJA 4M9JA 8ICFA 4F5OA 2PFQA 2F1HA 3QZ8A 2XGPA 3RTVA 3JPPA 3TAPA 4ELTA 4O5CA 2AU0A 8ICZA 9ICWA 4QZFA 4MEXA 1ZQNA 4DSLA 2UVWA 4FO6A 3V7LA 4JWNA 3SV4A 4EZ9A 4XQ8A 4TQSA 4RQ4A 3MFIA 9ICEA 2JEGA 8ICEA 2AQ4A 4F2SA 1QTMA 4ED1A 5DBCA 5DDMA 5J2GA 4UB4A 1NK9A 4EYHB 5J0RA 4QZHA 4PH5A 3TAQA 4X5VA 3PW5A 3PNCA 4DWIA 5KFHA 1XWLA 5J0UA 3TFSA 1N48A 3C5FA 3MR5A 3V7JA 4Q44A 1SL0A 5BOMA 3GILA 4DS5A 3PW7A 2R8JA 3E2EA 4YD1A 1JXEA 5KT4A 4ECRA 5DB9A 2KZZA 4ECQA 3RH5A 3V6KA 2A1JB 2F1IA 1L3SA 4P2HA 4GC6A 2I1QA 4DQSA 4IRCA 4M2YA 4IQUA 2DPJA 2FPLA 2XO7A 2R8KA 2BDPA 4BXOA 1TAUA 4JK1A 4M0AA 4F5NA 5J0QA 3Q8SB 1RYSA 2JZBA 1KRPA 4ECVA 4J9PA 1N56A 5KG5A 4NLKA 4B9NA 8ICBA 3OHBA 4F5RA 3KTQA 2PFOA 1UT8A 4B9UA 3FYHA 4UB2A 3QEAZ 1MQ3A 9ICHA 8ICYA 8ICTA 2XGQA 4UAZA 3RRGA 4G3IA 5J0XA 4DOCA 4O3NA 5DLGA 3HT3A 1U4BA 3HPOA 3KHRA 4RT2A 2BPCA 3MABA 4F4WA 1XSNA 5KG7A 1ZQWA 1ZQDA 3M9NB 2BQUA 5KG3A 1S76D 4RQ6A 3RB3A 1ZQXA 4DFKA 4B9LA 5KFAA 3OJSA 9ICJA 2ISOA 3RJEA 4F50A 4IR1A 5D49A 3EYZA 7ICTA 4NLNA 1ZQHA 3SV3A 4B9TA 5DB7A 2P6UA 3RJFA 4ZH4A 1NJWA 1D9FA 3AUOA 4C8KA 4I2HA 5DQIA 4MFAA 9ICAA 2LYHA 4ECXA 4QWCA 2ZJ5A 5KFQA 2HVHA 4Z6FA 4QZ9A 2PI4A 3GIMA 3THVA 1TVAA 2PFPA 3ISCA 4P4PA 2C2DA 4F93B 5JUMA 4RPXA 4RNNA 4DF8A 4PHDA 5DG7A 4LZGA 4RQ3A 1TK8A 3GQCA 1XSPA 3GV8B 2MAXA 1U48A 5C5JA 3KHLA 4TUSA 3JPRA 4J9RA 3UPQA 3TI0A 8ICCA 3H8WA 2HHVA 1S0VA 4JV1A 5J2CA 4QW9A 8ICRA 4DO9A 5KFPA 1JN3A 2MUTA 4R8UB 5KFCA 3AU2A 3C5GA 4M9GA 4DL2A 4ED7A 3RBEA 4F4XA 1UA0A 2UVRA 1JX4A 4QW8A 2XCAA 2A1JA 4RQ8A 2VA2A 4GXJA 1ZJMA 3UXOA 8ICXA 3N97B 2FMPA 3ZD9A 1U45A 1DOQA 3BQ0A 4O3PA 2HHXA 1H38A 4Z6DA 4RQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWF A;  9ICM A;  4NM1 A;  4KLH A;  4M6W B;  2ZJ8 A;  3V7K A;  2F1J A;  4QZ8 A;  2NRX A;  3PO5 A;  3EPI A;  2IMW P;  5L1I A;  1JXL A;  4DL4 A;  2JEF A;  1MSW D;  1NK0 A;  5CR0 A;  3T5K A;  3RR8 A;  3V6H A;  3V72 A;  3RB4 A;  3C2L A;  3H4D A;  1NK7 A;  3ZD8 A;  4GC7 A;  4BXO B;  4RQ2 A;  5HML A;  3Q8P B;  1K1Q A;  3BQT A;  4BWM A;  4RU9 A;  4Z6E A;  1NK8 A;  1T8E A;  4MFF A;  2NRW A;  3T5H A;  3KHG A;  2IBK A;  4DQQ A;  1ZQO A;  1SKW A;  4NLG A;  4O5E A;  5IIO A;  4C8L A;  3IM1 A;  1SL2 A;  5HHI A;  5J2D A;  3RH4 A;  2BCV A;  4I2E A;  1S0O A;  1ZQF A;  5IIM A;  3OHA A;  1ZQT A;  3SI8 A;  2HHW A;  4KN7 A;  4QZG A;  3RB0 A;  2VAN A;  1NOM A;  4M6W A;  1X9S A;  3G6Y A;  2XY6 A;  4O3R A;  8ICH A;  4QWB A;  1XS9 D;  7ICF A;  9ICL A;  3PW2 A;  5DBB A;  9ICN A;  4O3S A;  1X9W A;  5KFW A;  2JEJ A;  2W8K A;  2HHQ A;  4KLF A;  5KFV A;  4R65 A;  5J0P A;  1CUK A;  2PXI A;  4NY8 A;  9ICO A;  5CB1 A;  2ZUB A;  2AGP A;  1KDH A;  2ZTE A;  3MR2 A;  2I9G A;  2IHN A;  4BGD A;  2VA3 A;  2UVV A;  1BPY A;  5DG9 A;  1NK4 A;  3HP6 A;  3JPT A;  1RYR A;  3ZDA A;  4DSE A;  5J0T A;  3AU6 A;  3T3F A;  1BVS A;  4J9S A;  2NRT A;  4BDP A;  1HJP A;  2XCP A;  4F4Z A;  2BGW A;  4MF8 A;  4YFK A;  3H8J A;  2W9B A;  3EZ5 A;  1NKE A;  4Q8E A;  4ED2 A;  4J9O A;  3FDS A;  2V4R A;  4I2A A;  1TK5 A;  4O5K A;  4P4O A;  2PI5 A;  3QZ7 A;  5TZV A;  2BCQ A;  3HX0 A;  1IXR A;  7ICQ A;  4I2I A;  3NTU A;  3T5J A;  3RR7 A;  9ICK A;  3PVX A;  4R8U A;  3MDA A;  1T4G A;  7ICL A;  4PHA A;  3TAN A;  1D8L A;  1TK0 A;  4RNM A;  3EWA A;  2HHU A;  4RQ1 A;  4DL6 A;  3BDP A;  1S0M A;  5J0O A;  1QLN A;  4KTQ A;  4M47 A;  4YR3 A;  3Q8Q B;  8ICG A;  2AGO A;  4I2G A;  1ZQC A;  2HHS A;  1WCN A;  4KLD A;  4LVS A;  1NJX A;  1NKB A;  4YXJ A;  4Q45 A;  3BQ2 A;  1ZQE A;  2W8L A;  4KLQ A;  2J6S A;  4QZB A;  3RJJ A;  1WCL A;  3RRH A;  2HW3 A;  7ICG A;  5DB8 A;  2C2E A;  3T5L A;  1X2I A;  5CJ7 A;  2W9M A;  4M9H A;  3B0Y A;  4LZD A;  5IIN A;  2Y1J A;  3UQ2 A;  1SZP A;  4MEY A;  5DKW A;  5F9L A;  5KFO A;  4UB3 A;  3OJU A;  4GXK A;  1U47 A;  4KLS A;  4IQT A;  3TFR A;  1EXN A;  2M9N A;  5KT2 A;  2ZUC A;  5KFK A;  4DLG A;  1LB2 B;  2ZTC A;  3H7I A;  4ED6 A;  4ED8 A;  1ZQS A;  3MR6 A;  9ICV A;  4TUP A;  1ARO P;  4EZ6 A;  2FPM A;  1ZQI A;  4I2C A;  4UAW A;  3ZDD A;  5J2I A;  8ICJ A;  5L9X A;  4YR0 A;  5L1K A;  4J9L A;  4DSI A;  2ZTD A;  3PX4 A;  2BPF A;  4E0D A;  4NLZ A;  2HVI A;  2WTF A;  9ICU A;  4FS2 A;  4XRH A;  4QZD A;  2DFL A;  4EBC A;  3PW4 A;  4RPZ A;  4DL3 A;  2KFZ A;  1KFD A;  5DGB A;  2W9C B;  5KFG A;  3PW0 A;  3RH6 A;  1C7Y A;  3BJY A;  3UXN A;  5KFM A;  5KFJ A;  3PR4 A;  1QSY A;  4ED3 A;  4F5Q A;  4O9M A;  5CHG A;  1NK5 A;  2JEI A;  4DSK A;  5KFD A;  8ICS A;  1Z00 A;  3TAR A;  5J2K A;  3B0X A;  3LK9 A;  2KN7 A;  4XA5 A;  3JPQ A;  3GDX A;  1ZQY A;  4DFM A;  1S0N A;  5KG4 A;  5KFF A;  4KLG A;  2AQ0 A;  4F4Y A;  1TAQ A;  1MC8 A;  4BWJ A;  5L1L A;  1TFR A;  4FS1 A;  3PY8 A;  3H40 A;  1S97 A;  1ZQR A;  3TQ1 A;  1ZQQ A;  3EW9 A;  4KLO A;  5CA7 A;  3RJK A;  1JMS A;  5HMM A;  4UB5 A;  5DGA A;  2NRZ A;  1D9D A;  4HYK A;  3GII A;  5L1J A;  4YR2 A;  2NRV A;  3M9M B;  4DL7 A;  3IHQ B;  1BPD A;  8ICQ A;  3ISD A;  1ZYQ A;  4IRK A;  3Q8R B;  4DQI A;  4R64 A;  1Z3E B;  1A76 A;  4EBE A;  4I28 A;  4RT3 A;  5KG2 A;  5J2F A;  4J9M A;  2BPG A;  1SKR A;  1HUO A;  3H8S A;  1KFS A;  3GIJ A;  3RBD A;  4R63 A;  2MUT B;  3M8S A;  4M9N A;  1JIH A;  4I2B A;  2BR0 A;  3ETL A;  4XUS A;  1NK6 A;  1COO A;  4UQG A;  3PX0 A;  3MBY A;  4I29 A;  4KLE A;  5KFZ A;  2B21 A;  3LWL A;  4GLX A;  4DFP A;  4KLU A;  8ICV A;  4UB1 A;  1BGX T;  2XY7 A;  4QWE A;  4DQP A;  3MGH A;  3PMN A;  4PPX A;  2FMQ A;  1Z00 B;  3Q8K A;  5III A;  4EEY A;  4F91 B;  4YCX A;  1BPX A;  2ASJ A;  8ICI A;  1L3V A;  2J6U A;  1S10 A;  4ECZ A;  2FLL A;  2FLP A;  4ELU A;  4DSF A;  1XC9 A;  4ECU A;  3Q8L A;  2H5X A;  4DEZ A;  4QZE A;  1K1S A;  5KG0 A;  4KLI A;  4RUC A;  1BPB A;  3OSN A;  4ECT A;  5IIJ A;  4YXM A;  5D4B A;  1L5U A;  2ASL A;  1S9F A;  1TKD A;  4DOB A;  2Q0Z X;  5HP4 A;  3JPN A;  1ZQK A;  1UT5 A;  4B9V A;  9ICC A;  3GV5 B;  7ICR A;  4QZI A;  1QSL A;  2AGQ A;  2ZJA A;  4K4I A;  3RAQ A;  1CEZ A;  7ICP A;  3N4M B;  1ZQZ A;  4KLL A;  5KG1 A;  4M9L A;  4Z6C A;  1PZN A;  4K4G A;  1DGS A;  4MFC A;  7ICN A;  7ICV A;  1ZQU A;  5IIK A;  1U9L A;  4O3Q A;  5DG8 A;  1ZQA A;  5J0W A;  2P66 A;  1RZT A;  4QWA A;  3JPS A;  4YVZ A;  4RQ7 A;  4JV2 A;  2ASD A;  5KT5 A;  4YG2 A;  5DB6 A;  1ZQJ A;  7ICE A;  3PML A;  1SL1 A;  4B9S A;  2FMS A;  2IHM A;  1RPL A;  4YN4 A;  4JUZ A;  3PX6 A;  4YMO A;  4PGQ A;  5EWE A;  5KFY A;  2FLN A;  4IR9 A;  9ICT A;  5J29 A;  3JPO A;  3OSP A;  5J0Y A;  5IIL A;  4PGX A;  5DQH A;  1ZET A;  3G6X A;  4IQV A;  2GWS A;  3GFK B;  5HNK A;  4UAY A;  2ATL A;  2R8G A;  1LV5 A;  3BQ1 A;  8ICM A;  2XC9 A;  5KFB A;  3EPG A;  2C2R A;  5DBA A;  2JZB B;  4J9Q A;  3RJH A;  1KLN A;  2HHT A;  4I2J A;  2BKE A;  5CWR A;  1U49 A;  9ICB A;  3RB6 A;  4KMU A;  7ICS A;  5DQG A;  4I27 A;  4J9N A;  1BPZ A;  2BQ3 A;  3HWT A;  5KFL A;  5DLF A;  2C28 A;  3PO4 A;  4Q43 A;  3SZ2 A;  8ICO A;  8ICA A;  1L3U A;  4RNO A;  4YD2 A;  4IQW A;  1V9P A;  4I2D A;  4RZR A;  3KHH A;  2C22 A;  5KT6 A;  2R8H A;  3C2M A;  1NJY A;  1X9M A;  1D8Y A;  3ZDC A;  3RAX A;  5KFI A;  4JV0 A;  2XY5 A;  4DLE A;  4KN4 A;  2KZM A;  4C8N A;  4QZA A;  2VA8 A;  5KT7 A;  3GIK A;  4C8O A;  4F3O A;  4C8M A;  4Q8F A;  1B43 A;  4NXZ A;  1T7P A;  5J2J A;  1QSS A;  3MR3 A;  4PHP A;  2W9B B;  3SYZ A;  4EYI B;  4YMN A;  3C2K A;  4DFJ A;  2Y1I A;  1MQ2 A;  4MF2 A;  2IA6 A;  1B22 A;  4TQR A;  4J9K A;  3MDC A;  1XSL A;  1L3T A;  3ORY A;  7ICM A;  2BHN A;  2J6T A;  1IM4 A;  3NGD A;  2BCS A;  2KTQ A;  2ZUD A;  3C21 A;  3OGU A;  3M9O B;  3HW8 A;  2W9C A;  4GXI A;  4ECW A;  2R8I A;  4M04 A;  1ZQP A;  5KG6 A;  1T3N A;  3ZDE A;  4PHE A;  5J0S A;  4YQW A;  4KLM A;  5KTQ A;  4DS4 A;  3ISB A;  5KFT A;  5KFU A;  4F92 B;  1KTQ A;  7ICH A;  9ICP A;  9ICG A;  4IRD A;  4F8R A;  2KFN A;  9ICS A;  4UBC A;  4TUQ A;  4O0I A;  8ICW A;  5EOZ A;  4DOA A;  5HHH A;  3LDA A;  2FPK A;  5KFE A;  4P4M A;  1UA1 A;  4KLJ A;  9ICR A;  4O3O A;  3GV7 B;  5D46 A;  4DQR A;  1NKC A;  4ECS A;  3V6J A;  5KFN A;  4ED0 A;  3RJG A;  4K4H A;  2ISP A;  2OWO A;  1XO1 A;  1RXV A;  9ICF A;  2BQR A;  5DDY A;  7ICI A;  5J2E A;  4RUA A;  8ICN A;  4EBD A;  3QE9 Y;  2UVU A;  4F2R A;  4KIT B;  4F4K A;  3K4G A;  1ZQB A;  4KLT A;  5KFS A;  3RJI A;  2P6R A;  3K75 D;  3G6V A;  1TV9 A;  3LWM A;  2PFN A;  8ICP A;  4TUR A;  1HUZ A;  1KFT A;  1XU4 A;  2V4Q A;  9ICX A;  3MGI A;  7ICU A;  1ZQV A;  4ELV A;  3C23 A;  5CP2 A;  5J2B A;  4RPY A;  1KEJ A;  3C1Z A;  4F5P A;  3QEB Z;  4B9M A;  4JWM A;  1RXW A;  4YMM A;  8ICL A;  2ALZ A;  1NJZ A;  2DPI A;  5EWG A;  5KFX A;  1Y88 A;  4R66 A;  4DF4 A;  4PGY A;  4QWD A;  3M8R A;  4RQ5 A;  2W9A A;  5F9N A;  3PV8 A;  1SKS A;  1KSP A;  4FBT A;  8ICK A;  5J2A A;  4QZC A;  4DL5 A;  4YP3 A;  1ZQG A;  4NM2 A;  4I2F A;  4UBB A;  1ZJN A;  4CCH A;  1ZQL A;  2AJQ A;  3Q8M A;  5KT3 A;  3ZDB A;  4ECY A;  2BCR A;  9ICI A;  1ZQM A;  8ICU A;  5BOL A;  3UQ0 A;  7ICK A;  1S77 D;  2BCU A;  2KZ3 A;  3H4B A;  2V9W A;  7ICJ A;  5J2H A;  3UXP A;  4DSJ A;  3PR5 B;  1A77 A;  5BPC A;  9ICQ A;  3C1Y A;  2RDI A;  7ICO A;  1BPE A;  3MFH A;  5KFR A;  4FBU A;  2RDJ A;  4M9J A;  8ICF A;  4F5O A;  2PFQ A;  2F1H A;  3QZ8 A;  2XGP A;  3RTV A;  3JPP A;  3TAP A;  4ELT A;  4O5C A;  2AU0 A;  8ICZ A;  9ICW A;  4QZF A;  4MEX A;  1ZQN A;  4DSL A;  2UVW A;  4FO6 A;  3V7L A;  4JWN A;  3SV4 A;  4EZ9 A;  4XQ8 A;  4TQS A;  4RQ4 A;  3MFI A;  9ICE A;  2JEG A;  8ICE A;  2AQ4 A;  4F2S A;  1QTM A;  4ED1 A;  5DBC A;  5DDM A;  5J2G A;  4UB4 A;  1NK9 A;  4EYH B;  5J0R A;  4QZH A;  4PH5 A;  3TAQ A;  4X5V A;  3PW5 A;  3PNC A;  4DWI A;  5KFH A;  1XWL A;  5J0U A;  3TFS A;  1N48 A;  3C5F A;  3MR5 A;  3V7J A;  4Q44 A;  1SL0 A;  5BOM A;  3GIL A;  4DS5 A;  3PW7 A;  2R8J A;  3E2E A;  4YD1 A;  1JXE A;  5KT4 A;  4ECR A;  5DB9 A;  2KZZ A;  4ECQ A;  3RH5 A;  3V6K A;  2A1J B;  2F1I A;  1L3S A;  4P2H A;  4GC6 A;  2I1Q A;  4DQS A;  4IRC A;  4M2Y A;  4IQU A;  2DPJ A;  2FPL A;  2XO7 A;  2R8K A;  2BDP A;  4BXO A;  1TAU A;  4JK1 A;  4M0A A;  4F5N A;  5J0Q A;  3Q8S B;  1RYS A;  2JZB A;  1KRP A;  4ECV A;  4J9P A;  1N56 A;  5KG5 A;  4NLK A;  4B9N A;  8ICB A;  3OHB A;  4F5R A;  3KTQ A;  2PFO A;  1UT8 A;  4B9U A;  3FYH A;  4UB2 A;  3QEA Z;  1MQ3 A;  9ICH A;  8ICY A;  8ICT A;  2XGQ A;  4UAZ A;  3RRG A;  4G3I A;  5J0X A;  4DOC A;  4O3N A;  5DLG A;  3HT3 A;  1U4B A;  3HPO A;  3KHR A;  4RT2 A;  2BPC A;  3MAB A;  4F4W A;  1XSN A;  5KG7 A;  1ZQW A;  1ZQD A;  3M9N B;  2BQU A;  5KG3 A;  1S76 D;  4RQ6 A;  3RB3 A;  1ZQX A;  4DFK A;  4B9L A;  5KFA A;  3OJS A;  9ICJ A;  2ISO A;  3RJE A;  4F50 A;  4IR1 A;  5D49 A;  3EYZ A;  7ICT A;  4NLN A;  1ZQH A;  3SV3 A;  4B9T A;  5DB7 A;  2P6U A;  3RJF A;  4ZH4 A;  1NJW A;  1D9F A;  3AUO A;  4C8K A;  4I2H A;  5DQI A;  4MFA A;  9ICA A;  2LYH A;  4ECX A;  4QWC A;  2ZJ5 A;  5KFQ A;  2HVH A;  4Z6F A;  4QZ9 A;  2PI4 A;  3GIM A;  3THV A;  1TVA A;  2PFP A;  3ISC A;  4P4P A;  2C2D A;  4F93 B;  5JUM A;  4RPX A;  4RNN A;  4DF8 A;  4PHD A;  5DG7 A;  4LZG A;  4RQ3 A;  1TK8 A;  3GQC A;  1XSP A;  3GV8 B;  2MAX A;  1U48 A;  5C5J A;  3KHL A;  4TUS A;  3JPR A;  4J9R A;  3UPQ A;  3TI0 A;  8ICC A;  3H8W A;  2HHV A;  1S0V A;  4JV1 A;  5J2C A;  4QW9 A;  8ICR A;  4DO9 A;  5KFP A;  1JN3 A;  2MUT A;  4R8U B;  5KFC A;  3AU2 A;  3C5G A;  4M9G A;  4DL2 A;  4ED7 A;  3RBE A;  4F4X A;  1UA0 A;  2UVR A;  1JX4 A;  4QW8 A;  2XCA A;  2A1J A;  4RQ8 A;  2VA2 A;  4GXJ A;  1ZJM A;  3UXO A;  8ICX A;  3N97 B;  2FMP A;  3ZD9 A;  1U45 A;  1DOQ A;  3BQ0 A;  4O3P A;  2HHX A;  1H38 A;  4Z6D A;  4RQ0 A; 
#chains in the Genus database with same CATH topology
 4KLH A;  2F1J A;  1ZXI A;  4QZ8 A;  4EEN A;  4DL4 A;  1MSW D;  1NK0 A;  5CR0 A;  3T5K A;  3C2L A;  3H4D A;  5AM3 A;  1NK7 A;  4GC7 A;  4RQ2 A;  5HML A;  3Q8P B;  4Z6E A;  4MFF A;  1SKW A;  3D6J A;  5IIO A;  4C8L A;  1SL2 A;  3RH4 A;  1ZQF A;  2OHF A;  1SV0 C;  2KVC A;  2YMM A;  1X9S A;  3IDW A;  9ICL A;  4QWB A;  3PW2 A;  5AM1 A;  2HHQ A;  1LKY A;  4KLF A;  9ICO A;  5CB1 A;  2IHN A;  5AI5 A;  1BPY A;  1NK4 A;  3JPT A;  3ZDA A;  4YFK A;  3EZ5 A;  5ALQ A;  4O5K A;  3L4P A;  4PL1 A;  4P4O A;  3QZ7 A;  4PZN A;  2BCQ A;  3HX0 A;  7ICQ A;  3HKZ C;  3RR7 A;  4UAS A;  3KFU F;  7ICL A;  4RNM A;  2QLT A;  3EWA A;  2K4H A;  2KEY A;  2AGO A;  4I2G A;  1NJX A;  2GO7 A;  1ZQE A;  3IRU A;  2W8L A;  1WCL A;  3RRH A;  7ICG A;  5DB8 A;  5CJ7 A;  5IIN A;  2Y1J A;  1Z4N A;  4MEY A;  5A0L A;  3TFR A;  1EXN A;  2M9N A;  5KT2 A;  4ED6 A;  3H0L B;  4EZ6 A;  1ARO P;  4I2C A;  1BNP A;  2HVI A;  5AHX A;  2AHO B;  2KJ5 A;  5AK3 A;  1CRX A;  5KFM A;  3D2N A;  5KFJ A;  3PR4 A;  1QSY A;  2OM6 A;  4O9M A;  1Z00 A;  5AK6 A;  4US8 A;  3LK9 A;  4KLG A;  3JPQ A;  1ZQY A;  2OH2 A;  1PK1 B;  5KG4 A;  1UPH A;  2E8O A;  2NO5 A;  1P7D A;  2HCF A;  5G5G A;  3EW9 A;  5J8Y A;  4RQN A;  4KLO A;  2F44 A;  3KKA C;  5CA7 A;  1D9D A;  2NRZ A;  1D8B A;  2NRV A;  4DL7 A;  1BPD A;  2D6F C;  4EBE A;  4FZN A;  4KX5 A;  1HUO A;  4M9N A;  3FC4 A;  2BR0 A;  4UQG A;  3MBY A;  1Q3U A;  5KAF U;  1A6S A;  2B21 A;  4DFP A;  4GLX A;  4UB1 A;  2OCE A;  4QWE A;  3MGH A;  1UQV A;  2ZIW A;  5III A;  4EEY A;  2ASJ A;  2K4I A;  2FLP A;  2E5S A;  2H5X A;  4DEZ A;  5KG0 A;  3GU3 A;  3KZX A;  4ECT A;  2ASL A;  2DKX A;  1S9F A;  1TKD A;  9ICC A;  5HP4 A;  1UT5 A;  1LVH A;  7ICR A;  4K4I A;  7ICP A;  3RAQ A;  1CEZ A;  5ALK A;  3OPX A;  7ICV A;  7ICN A;  2WF6 A;  5DG8 A;  1RZT A;  4QWA A;  4CRX A;  1Q8K A;  3JPS A;  4RQ7 A;  4JV2 A;  2F76 X;  7ICE A;  4B9S A;  3QUC A;  4YMO A;  5EWE A;  5KFY A;  2FLN A;  4IR9 A;  5J29 A;  5IIL A;  1HIW A;  1ZET A;  2ATL A;  1X42 A;  8ICM A;  3S6J A;  3EPG A;  2C2R A;  2HHT A;  4J9Q A;  2JRZ A;  4I2J A;  3RB6 A;  7ICS A;  2BQ3 A;  5DLF A;  3VC8 A;  8ICA A;  4RNO A;  4YD2 A;  4IQW A;  3UM9 A;  4EEL A;  3R9K A;  2EH9 A;  5KT6 A;  3RAX A;  1SWW A;  3GIK A;  2KP7 A;  2EDU A;  4Q8F A;  4NXZ A;  5J2J A;  1DK2 A;  3ALR A;  4DFJ A;  2ZIU A;  2Y1I A;  2IA6 A;  5ALM A;  5AKK A;  5E79 U;  3F5A A;  2BHN A;  2K8A A;  2BCS A;  2ZIV B;  4PHE A;  5J0S A;  4KLM A;  3M6Z A;  5KFT A;  4IS7 A;  2FDR A;  4JB3 A;  5TIS U;  4IRD A;  1N2X A;  5EOZ A;  4DOA A;  2Y9T A;  5HHH A;  3NAS A;  4PZO A;  5ALE A;  1NKC A;  1N63 A;  4K4H A;  5DDY A;  1NZP A;  2H3I A;  7ICI A;  4RUA A;  1SZH A;  2UVU A;  4KIT B;  3K4G A;  5KFS A;  2P6R A;  1WUD A;  3K75 D;  1N5X A;  4TUR A;  1HUZ A;  4Y2T A;  1XU4 A;  2H3Z A;  5AKL A;  9ICX A;  1ZQV A;  4F5P A;  5J2B A;  5CP2 A;  1JI7 A;  1KEJ A;  2CN1 A;  3C1Z A;  3QU7 A;  1KL9 A;  2KVS A;  3ZI4 A;  4YMM A;  1NJZ A;  5EWG A;  4R66 A;  4QWD A;  3M8R A;  2W9A A;  5F9N A;  3PV8 A;  4QZC A;  4YP3 A;  2K4E A;  1ZJN A;  4CCH A;  1ZQL A;  4CGZ A;  5KT3 A;  3ZDB A;  1QCK A;  1S77 D;  2BCU A;  3H4B A;  4DSJ A;  4Y2S A;  1A77 A;  3C1Y A;  2RDI A;  5AM5 A;  1BPE A;  2RDJ A;  4LJX A;  3QZ8 A;  5GTI U;  1F44 A;  4O5C A;  8ICZ A;  4QZF A;  4MEX A;  2UVW A;  2DBY A;  4FO6 A;  3SV4 A;  4XQ8 A;  3MFI A;  5EE9 A;  1NK9 A;  5ALU A;  4CDG A;  4X5V A;  3PW5 A;  1M6Y A;  1OXJ A;  3V7J A;  1SL0 A;  5BOM A;  1JXE A;  5DB9 A;  3RH5 A;  3J81 j;  3V6K A;  4GC6 A;  4IQU A;  2R8K A;  2BDP A;  1TAU A;  4JK1 A;  2A19 A;  2JZB A;  4ECV A;  4J9P A;  1NZB A;  5KG5 A;  2GOL A;  3FYH A;  3PST A;  8ICY A;  4DOC A;  4O3N A;  3A0B U;  3HT3 A;  1QQ6 A;  3QX7 A;  3F2C A;  1ZQ1 C;  4DCC A;  1K5O A;  4F4W A;  1XSN A;  3AL0 B;  1ZQW A;  2B6G A;  3I76 A;  1S76 D;  3UMC A;  4RQ6 A;  3RB3 A;  4B9L A;  1XNS A;  3RJE A;  4F50 A;  3LYS A;  5HR7 A;  2A1A A;  3EYZ A;  1RG6 A;  3SV3 A;  1XO0 A;  3RJF A;  2LPE A;  4I2H A;  4MFA A;  2G0A A;  1OW5 A;  2ZJ5 A;  2PI4 A;  3GIM A;  1TVA A;  2PFP A;  4F93 B;  5JUM A;  4RNN A;  3QXG A;  3BS5 A;  3KOO A;  2MAX A;  1CI4 A;  3JPR A;  4J9R A;  3TI0 A;  2M0N A;  3FM9 A;  3H8W A;  3UMG A;  1S0V A;  2R18 A;  4QW9 A;  5AI0 A;  1JN3 A;  5AK4 A;  3HJE A;  4DL2 A;  1JX4 A;  4QW8 A;  2XCA A;  1JAL A;  1ZJM A;  3KD3 A;  1U45 A;  1DOQ A;  4O3P A;  3AEV A;  2HHX A;  3AMZ A;  4Z6D A;  5EWF A;  4M6W B;  2ZJ8 A;  5AM0 A;  3PO5 A;  3EPI A;  2JEF A;  3NVV A;  3V6H A;  1PVP A;  3RB4 A;  3RR8 A;  3CP8 A;  1K1Q A;  2RHF A;  1O08 A;  5HHI A;  2DWQ A;  5IIM A;  2Q4T A;  2VAN A;  3F2B A;  8ICH A;  1XS9 D;  5DBB A;  2WF8 A;  4C7Z A;  2JEJ A;  5KNI A;  3NRW A;  5J0P A;  2ZXH A;  1KDH A;  2VA3 A;  1BNO A;  3I28 A;  2G08 A;  3E58 A;  4BGD A;  2UVV A;  5DG9 A;  3BS5 B;  1RYR A;  4HAI A;  4DSE A;  5J0T A;  3T3F A;  1BVS A;  3QYP A;  4BDP A;  1HJP A;  2XCP A;  4F4Z A;  3H8J A;  2W9B A;  2V4R A;  1TK5 A;  2DF4 B;  1SV0 A;  4G9B A;  3NTU A;  9ICK A;  3PVX A;  3AQE A;  4PHA A;  3TAN A;  3RF9 A;  2HHU A;  1S0M A;  4YR3 A;  4Y2J A;  1ZQC A;  5ALL A;  1WCN A;  1NKB A;  4Q45 A;  4QNL A;  4QZB A;  1N60 A;  3RJJ A;  2HW3 A;  1N62 A;  2C2E A;  1N5W A;  3T5L A;  2W9M A;  2HBJ A;  3B0Y A;  4LZD A;  2KSO B;  1ED1 A;  3UQ2 A;  4GXK A;  5KFO A;  2EQY A;  2W7O A;  4ED8 A;  2BZF A;  5ALH A;  1ZQI A;  2D3D A;  1L7P A;  3ZDD A;  1IV8 A;  5J2I A;  5L9X A;  4IC9 A;  4J9L A;  2YX8 A;  3PX4 A;  4UAV A;  4XRH A;  2DFL A;  4EBC A;  3PW4 A;  3PSI A;  4RPZ A;  2KFZ A;  5DGB A;  1C7Y A;  3BJY A;  2LHT A;  2LM1 A;  1X9X A;  1NK5 A;  4Y2P A;  5KFD A;  8ICS A;  2KIC A;  3TAR A;  1SV4 A;  4XA5 A;  1ZD3 A;  5KFF A;  1SXE A;  2LKY A;  1KQQ A;  1TAQ A;  2YB4 A;  1TFR A;  3PY8 A;  2YML A;  3SAH A;  3RJK A;  2IOH A;  5ALZ A;  8ICQ A;  1ZYQ A;  4R64 A;  1VDV A;  4FZL A;  2LYB A;  4I28 A;  4Y2Q A;  3UMB A;  3H8S A;  1KFS A;  3NS1 A;  3GZF A;  4R63 A;  1X66 A;  4B6J A;  1ECW A;  2Z7J A;  1JIH A;  1F5S A;  3DV9 A;  1COO A;  1Z19 A;  2XY7 A;  4DQP A;  3PMN A;  4PPX A;  4CNQ A;  4F91 B;  1BPX A;  8ICI A;  2WF9 A;  4ELU A;  1XC9 A;  4ECU A;  3IG8 A;  4QZE A;  1IG6 A;  1BPB A;  1DRG A;  3OSN A;  1L5U A;  3RFA A;  3JPN A;  4B9V A;  4QZI A;  2HSZ A;  1QSL A;  2ZJA A;  3F53 A;  1ZQZ A;  4Z6C A;  4K4G A;  1ZQU A;  2K60 A;  5IIK A;  1SXD A;  1TAM A;  5AIB A;  2AH5 A;  4KMO B;  1ZQJ A;  3PML A;  1SL1 A;  4Y2R A;  2VIX A;  1RPL A;  3L5K A;  4YN4 A;  4PGQ A;  4IL6 U;  3OSP A;  4USA A;  2KSO A;  2R8G A;  1LV5 A;  3BQ1 A;  2XC9 A;  5KFB A;  2JZB B;  3QUQ A;  3RJH A;  3WKB A;  2BKE A;  4KMU A;  4J9N A;  4C7Y A;  2LYA A;  3HKZ F;  2XID A;  5KFL A;  3PO4 A;  1J2M A;  8ICO A;  1V9P A;  3C2M A;  1QH9 A;  5AKY A;  1ZOL A;  1QQ5 A;  2VA8 A;  5KT7 A;  2F77 X;  1DXS A;  2HOF A;  3IN5 A;  5AI9 A;  1QSS A;  3SYZ A;  1NI3 A;  4YMN A;  3T79 A;  5HR6 A;  1B22 A;  4TQR A;  3NVZ A;  4NLB A;  5ALT A;  4J9K A;  1L3T A;  2FI1 A;  3NGD A;  4GXI A;  3M9O B;  3HW8 A;  2W9C A;  2R8I A;  1T3N A;  3ZDE A;  1KTQ A;  2WAQ C;  9ICG A;  2F8L A;  2JV3 A;  8ICW A;  5CRX A;  4O3O A;  3GV7 B;  4DQR A;  4ED0 A;  2ISP A;  2OWO A;  1RXV A;  2BQR A;  8ICN A;  3QE9 Y;  4F2R A;  4F4K A;  3SD7 A;  5F3X B;  1ZQB A;  2QKQ A;  1B0X A;  2ZIX B;  4QJF B;  3G6V A;  3K1R B;  3LWM A;  2PFN A;  5CEH A;  4BUG A;  3MGI A;  4CF3 A;  2IOF A;  4B9M A;  8ICL A;  3ED5 A;  2ALZ A;  2L5Y A;  2DPI A;  3KKA A;  1OUQ A;  1KSP A;  8ICK A;  2KHQ A;  4DL5 A;  2YMQ A;  4NM2 A;  4I2F A;  4UBB A;  4ECY A;  5AKE A;  4C80 A;  4NL9 A;  2KZ3 A;  7ICJ A;  2ZIV A;  4CF5 A;  3PR5 B;  7ICO A;  5AIA A;  3MFH A;  4M9J A;  2PFQ A;  2QAR A;  2XGP A;  3JPP A;  3TAP A;  4ELT A;  9ICW A;  4DSL A;  3V7L A;  4EZ9 A;  9ICE A;  3M7D A;  3C28 A;  2AQ4 A;  2JHD A;  1QTM A;  5J0R A;  3NUQ A;  4QZH A;  3MGV A;  4WJ3 B;  1XWL A;  5ALX A;  3GIL A;  4DS5 A;  4YD1 A;  4ECR A;  2YQE A;  2W3R A;  2A1J B;  2F1I A;  5EE0 A;  4Y2Y A;  4P2H A;  2NV3 A;  2I1Q A;  4M2Y A;  3CW2 C;  4BXO A;  4M0A A;  4F5N A;  5J0Q A;  3Q8S B;  3WK4 A;  4AP9 A;  8ICB A;  4B9N A;  3OHB A;  4F5R A;  3QUT A;  1KW4 A;  3KTQ A;  2PFO A;  4ICA A;  4AYB C;  5ALN A;  2XGQ A;  4G3I A;  5J0X A;  2DGZ A;  5DLG A;  3C29 A;  3KHR A;  4RT2 A;  1JUD A;  5KG7 A;  1ZQD A;  4Y2U A;  3DDH A;  3M9N B;  2BQU A;  2K8B B;  3QU9 A;  3H0R B;  2K89 A;  5KFA A;  5C0Y A;  2YN4 A;  4IR1 A;  2K8C B;  3LVW A;  3AUO A;  5FP0 A;  2IOF K;  4ECX A;  4QZ9 A;  2C2D A;  4RPX A;  2KKV A;  2DUY A;  4PHD A;  4LZG A;  2G5H B;  1TK8 A;  3GQC A;  2ZIX A;  5C5J A;  3KHL A;  1WWU A;  3MC1 A;  4NWI A;  4C4R A;  8ICC A;  2ES6 A;  4EX6 A;  2HHV A;  4JV1 A;  5ALG A;  4O3M A;  8ICR A;  3BZK A;  2MU2 A;  1WYG A;  4ED7 A;  4F4X A;  2UVR A;  2VA2 A;  4RQ8 A;  4FZM A;  4FE3 A;  3UXO A;  8ICX A;  3BS7 A;  3N97 B;  2Y0S C;  2WFA A;  4Y2V A;  2VJ4 A;  2GH1 A;  1L3S A;  9ICM A;  4NM1 A;  4P0Q A;  5JU5 A;  5L1I A;  1JXL A;  2O6K A;  3V72 A;  4BXO B;  1NK8 A;  2WB1 F;  4DQQ A;  3K1Z A;  4NLG A;  4O5E A;  3IM1 A;  3KBB A;  1AQ6 A;  5J2D A;  1S0O A;  3HRD D;  2YY6 A;  2HHW A;  4KN7 A;  3RB0 A;  2EZZ A;  3QU2 A;  4M6W A;  4O3R A;  7ICF A;  4O3S A;  5KFW A;  2W8K A;  5KFV A;  4NY8 A;  2E8P A;  2ZUB A;  4F72 A;  2AGP A;  3ZDC A;  3MR2 A;  1S8O A;  4J9S A;  1FIQ A;  4ED2 A;  2H3V A;  3FDS A;  5TZV A;  1IXR A;  3AQF A;  4I2I A;  5B66 U;  4R8U A;  3MDA A;  1T4G A;  5AKH A;  1GO3 F;  1D8L A;  1TK0 A;  4RQ1 A;  4DL6 A;  1QLN A;  3N7R C;  5J0O A;  4M47 A;  3Q8Q B;  8ICG A;  2HHS A;  3ICX A;  1ZD2 P;  3BQ2 A;  4KLQ A;  1WG8 A;  2G06 A;  2YMP A;  1SZP A;  2F2A B;  3OJU A;  4PJ0 U;  1U47 A;  4KLS A;  1PUZ A;  4OJL A;  4DLG A;  2ZTC A;  1ZQS A;  2HI0 A;  4TUP A;  4UAW A;  8ICJ A;  5AI4 A;  4JMU A;  4DSI A;  2ZTD A;  4FS2 A;  2W9C B;  1V97 A;  5KFG A;  3PW0 A;  3RH6 A;  5L1M A;  2KOB A;  3SR6 A;  2LM4 A;  3NRZ A;  5CHG A;  4DSK A;  2KN7 A;  2Y0S F;  3WKE A;  1MC8 A;  5L1L A;  4FS1 A;  1FFU A;  3H40 A;  1ZQR A;  3TQ1 A;  1DK3 A;  1JMS A;  5HMM A;  5DGA A;  4HYK A;  5L1J A;  2AXT U;  3M9M B;  3ISD A;  4IRK A;  2K4P A;  3Q8R B;  4DQI A;  2A3V A;  3FAH A;  2W03 A;  4QIW C;  4J9M A;  2BPG A;  1SKR A;  4I2B A;  1MA7 A;  3ETL A;  2XI9 A;  1NK6 A;  3PX0 A;  5EE3 A;  3NVW A;  3SQI A;  3TAC B;  3WK7 A;  5EE1 A;  1Z00 B;  3Q8K A;  2J6U A;  4ECZ A;  3D2S A;  3Q8L A;  1RM6 C;  1K1S A;  4KLI A;  2ODG A;  4YXM A;  5D4B A;  4DOB A;  2Q0Z X;  1J2N A;  2HBK A;  4OJ6 A;  2I6X A;  3N4M B;  2B0C A;  4M9L A;  1PZN A;  1DGS A;  4MFC A;  1U9L A;  1ZQA A;  5J0W A;  4F71 A;  4KX3 A;  2ASD A;  1T94 A;  5KT5 A;  2H3F A;  4YG2 A;  5DB6 A;  5AM2 A;  2FMS A;  2IHM A;  3TKA A;  4JUZ A;  9ICT A;  5J0Y A;  3U26 A;  4PGX A;  5DQH A;  3G6X A;  4IQV A;  2GWS A;  1T3Q A;  2N1R A;  5DBA A;  5CWR A;  1U49 A;  9ICB A;  3I1Y A;  5DQG A;  5B5E U;  3HWT A;  3SZ2 A;  2OEH A;  2VJ5 A;  5GTH U;  4I2D A;  1TE2 A;  4RZR A;  3KHH A;  2C22 A;  2R8H A;  1D8Y A;  5KFI A;  4KN4 A;  1YZ6 A;  4C8N A;  4QZA A;  2BDU A;  4F3O A;  4C8M A;  3MR3 A;  4PHP A;  2W9B B;  4EYI B;  3C2K A;  2VKQ A;  2XIC A;  2KMD A;  1MQ2 A;  4MF2 A;  3F5E A;  3ORY A;  2J6T A;  3QNM A;  1IM4 A;  3WKC A;  2KTQ A;  4ECW A;  2HBL A;  5KG6 A;  2JXJ A;  4YQW A;  5J8Y C;  5KTQ A;  4DS4 A;  3ISB A;  9ICP A;  4F92 B;  4ACO A;  3DEE A;  4F8R A;  2KFN A;  4UBC A;  1F0M A;  2W11 A;  1UA1 A;  3LDA A;  2FPK A;  5KFE A;  4KLJ A;  1ZD4 A;  5G5H A;  4EEK A;  5D46 A;  2EAO A;  3V6J A;  2EZY A;  5KFN A;  1L7M A;  1XO1 A;  9ICF A;  5J2E A;  4C0Z A;  1JRP A;  3RJI A;  8ICP A;  1J97 A;  3D2Q A;  1Z1B A;  3C23 A;  4RPY A;  3QEB Z;  1RXW A;  2LI6 A;  3SEN A;  5KFX A;  1Y88 A;  4DF4 A;  1QQ7 A;  4PGY A;  3WK9 A;  5J2A A;  2W43 A;  3A0H U;  4OO1 J;  2AJQ A;  3Q8M A;  2KKP A;  2BCR A;  1ZQM A;  4UAT A;  7ICK A;  5J2H A;  2PMZ C;  5BPC A;  9ICQ A;  2E8N A;  1Z4O A;  5KFR A;  4FBU A;  8ICF A;  2KIV A;  2AU0 A;  2E3T A;  1RQL A;  1Q3V A;  4JWN A;  1MN8 A;  1Z1V A;  1LKY B;  2JEG A;  4F2S A;  4UB4 A;  4EYH B;  3TAQ A;  3PNC A;  4DWI A;  5KFH A;  3N28 A;  5J0U A;  1N48 A;  1IIP A;  3C5F A;  1ZD5 A;  4Q44 A;  3PW7 A;  2R8J A;  2KJ8 A;  2KZZ A;  2ZXI A;  1PK3 A;  2PKE A;  4ECQ A;  1C20 A;  5KL8 B;  2DL0 A;  2XO7 A;  5JRT A;  2KG5 A;  1RYS A;  2CXY A;  1N56 A;  1ZRN A;  4UB6 U;  4BJQ A;  5AKZ A;  2WF5 A;  1MQ3 A;  9ICH A;  3RRG A;  1U4B A;  2ZIW B;  2BPC A;  2KD1 A;  4C4S A;  5AM4 A;  4P0Q B;  1ZQX A;  2RRD A;  3OJS A;  9ICJ A;  2ISO A;  3VCB A;  1S5L U;  1ZQH A;  4U6P A;  4C8K A;  2W7P A;  4QWC A;  5KFQ A;  5DG7 A;  4RQ3 A;  5ALY A;  4GFJ A;  1B4F A;  5AIC A;  4TUS A;  3UPQ A;  2KHV A;  3WKA A;  1O03 A;  5J2C A;  5KFP A;  5KFC A;  3C5G A;  4M9G A;  4AYB F;  3RBE A;  1YZ7 A;  1UA0 A;  4NJ8 A;  4GXJ A;  2EAM A;  2W55 A;  2P35 A;  3SAG A;  2MA1 A;  3BQ0 A;  3PZP A;  3TAD A;  4RQ0 A;  1FFV A;  2JR5 A;  3V7K A;  2NRX A;  2IMW P;  3E0F A;  3N7P D;  4Y2X A;  3F2D A;  3PSF A;  3ZD8 A;  2EZX A;  2JMG A;  3BQT A;  4BWM A;  4RU9 A;  3ONN A;  1T8E A;  2NRW A;  2JGA A;  3T5H A;  3PSP A;  3KHG A;  2IBK A;  1ZQO A;  2BCV A;  4I2E A;  3OHA A;  1ZQT A;  3SI8 A;  5ALF A;  4QZG A;  1NOM A;  3G6Y A;  2XY6 A;  2W54 A;  3IV6 A;  2NO4 A;  9ICN A;  1X9W A;  1X6I A;  2F3N A;  1FO4 A;  2PXI A;  4R65 A;  1CUK A;  1PVR A;  2ZTE A;  2I9G A;  2WHE A;  3IG5 A;  3HP6 A;  3AU6 A;  2NRT A;  4A8E A;  2BGW A;  4MF8 A;  1NKE A;  4Q8E A;  4J9O A;  3BZC A;  4I2A A;  2PI5 A;  3NVY A;  2I5H A;  4OD0 A;  3T5J A;  5AKG A;  2W04 A;  4PL2 A;  2GLE A;  2LMR A;  5KL1 B;  3BDP A;  4KTQ A;  4UAR A;  4KLD A;  4LVS A;  1L7N A;  4NL9 C;  4YXJ A;  1URJ A;  2J6S A;  5ALV A;  4M9H A;  1X2I A;  2MRL A;  4QIW F;  5ALS A;  4UW9 A;  5DKW A;  5F9L A;  4UB3 A;  4IQT A;  5AI6 A;  5KFK A;  2ZUC A;  1LB2 B;  3H7I A;  3MR6 A;  9ICV A;  2D8C A;  3HIL A;  2FPM A;  4NV0 A;  4YR0 A;  5L1K A;  4NLZ A;  3QUB A;  2BPF A;  4E0D A;  2WTF A;  9ICU A;  3M1Y A;  4QZD A;  4DL3 A;  1KFD A;  2KK0 A;  4UB8 U;  3N7S C;  3UXN A;  4BX9 C;  1RQN A;  4ED3 A;  4F5Q A;  2JEI A;  5J2K A;  3B0X A;  4DFM A;  3GDX A;  1S0N A;  2AQ0 A;  5ALJ A;  4CF4 A;  4F4Y A;  4BWJ A;  2NYV A;  2HOQ A;  1YT3 A;  1S97 A;  5ALD A;  1ZQQ A;  4UB5 A;  3WU2 U;  2ZG6 A;  2XVT A;  3GII A;  4YR2 A;  2G5I B;  3IHQ B;  4ZOH C;  2G07 A;  1Z3E B;  1A76 A;  3O0F A;  4RT3 A;  5KG2 A;  5J2F A;  3WK8 A;  3GIJ A;  3RBD A;  2MUT B;  3M8S A;  1UCV A;  5AKX A;  4XUS A;  4I29 A;  4KLE A;  5KFZ A;  5AKJ A;  2OYY A;  4DFD A;  1KKX A;  4KLU A;  3LWL A;  2W3S A;  8ICV A;  1BGX T;  1N61 A;  2RLT A;  2FMQ A;  1Q46 A;  4YCX A;  2KJ9 A;  1L3V A;  1S10 A;  2FLL A;  4C4T A;  4DSF A;  1WWV A;  4RUC A;  2RQ5 A;  2WB1 C;  5IIJ A;  3CYM A;  2KE7 A;  1ZQK A;  3GV5 B;  3TAD C;  2AGQ A;  5ALI A;  5KG1 A;  4KLL A;  2QB0 A;  2Y9U A;  4P0P A;  3AN1 A;  4O3Q A;  2P66 A;  2G09 A;  3H0M B;  4YVZ A;  2OXO A;  4OJP A;  3L3F X;  4U7C A;  3PX6 A;  5ALO A;  3JPO A;  1A0P A;  3EUB 2;  3QU4 A;  5AK5 A;  2F8K A;  5KAI U;  3WK6 A;  3GFK B;  2EAP A;  5HNK A;  4UAY A;  3CNH A;  1KLN A;  1L8O A;  4I27 A;  1BPZ A;  2C28 A;  2YB1 A;  4Q43 A;  1L3U A;  2CRX A;  2KNJ A;  1NJY A;  1X9M A;  3WKD A;  4JV0 A;  1VJ5 A;  5T14 A;  2XY5 A;  4DLE A;  2KZM A;  2E1E A;  3M6K A;  2PMZ F;  2KV2 A;  4C8O A;  2YTU A;  1B43 A;  2FE9 A;  2H3Q A;  1T7P A;  1L6N A;  2WAQ F;  4US9 A;  1XSL A;  3MDC A;  7ICM A;  2ZUD A;  3C21 A;  3OGU A;  4M04 A;  4KLT A;  1ZQP A;  1SIJ A;  4P0P B;  4J03 A;  5KFU A;  7ICH A;  1FEZ A;  2WF7 A;  9ICS A;  4TUQ A;  2FJ6 A;  4O0I A;  9ICR A;  3SEI A;  4P4M A;  2HMX A;  2DKZ A;  4ECS A;  1RYU A;  3RJG A;  3ETR A;  1PVQ A;  2QB0 B;  1L7O A;  4EBD A;  4OJO A;  1COK A;  2QB1 A;  3IP4 B;  2LBO A;  2JH7 A;  1TV9 A;  1KFT A;  2V4Q A;  4OCZ A;  7ICU A;  4ELV A;  4JWM A;  2KIW A;  1PK1 A;  4FFD A;  5AI8 A;  4OJ5 A;  1SKS A;  4RQ5 A;  4FBT A;  2E8M A;  1ZQG A;  2CPR A;  1V85 A;  3QU5 A;  9ICI A;  8ICU A;  5BOL A;  3UQ0 A;  2V9W A;  3UXP A;  1VLB A;  3SMV A;  5K4L A;  2E1F A;  3LVV A;  2ESE A;  4F5O A;  2F1H A;  3RTV A;  3B9J A;  5JTI A;  1ZQN A;  4TQS A;  4RQ4 A;  1KBU A;  8ICE A;  4ED1 A;  5DBC A;  5DDM A;  5J2G A;  2MSN A;  4PH5 A;  1UHU A;  5ALR A;  3TFS A;  1HEK A;  3MR5 A;  3E2E A;  4UAU A;  3CRX A;  1ZRM A;  5KT4 A;  3WK5 A;  1SWV A;  4DQS A;  4IRC A;  2DPJ A;  2FPL A;  3BQ7 A;  1KRP A;  1JRO A;  4CE6 A;  4NLK A;  4GIB A;  1UT8 A;  4B9U A;  2QAR B;  3AM9 A;  4UB2 A;  3QEA Z;  3KZI U;  8ICT A;  4EX7 A;  4UAZ A;  1SGG A;  3HPO A;  3MAB A;  5ALP A;  5KG3 A;  4MHV A;  2EAN A;  4DFK A;  3OTQ A;  2JH1 A;  4RQM A;  1RDF A;  2HBM A;  5D49 A;  2RP5 A;  7ICT A;  4NLN A;  4B9T A;  5DB7 A;  2P6U A;  1SB3 C;  4ZH4 A;  1NJW A;  1D9F A;  5DQI A;  9ICA A;  2LYH A;  2HVH A;  5ALW A;  4Z6F A;  3THV A;  1DGJ A;  1KN5 A;  3ISC A;  4P4P A;  3SAF A;  2DQN B;  4DF8 A;  2ZIU B;  2HDO A;  1XSP A;  3GV8 B;  1U48 A;  4NLC A;  5H2F U;  2HOI A;  1V38 A;  4DO9 A;  1X40 A;  4R8U B;  2MUT A;  3H8M A;  3AU2 A;  1X6J A;  1NNL A;  2A1J A;  5AKI A;  2FMP A;  3ZD9 A;  1L8L A;  1H38 A; 
#chains in the Genus database with same CATH homology
 5EWF A;  9ICM A;  4NM1 A;  4KLH A;  4M6W B;  2ZJ8 A;  3V7K A;  2F1J A;  4QZ8 A;  2NRX A;  3PO5 A;  3EPI A;  2IMW P;  5L1I A;  1JXL A;  4DL4 A;  2JEF A;  1MSW D;  1NK0 A;  5CR0 A;  3T5K A;  3RR8 A;  3V6H A;  3V72 A;  3RB4 A;  3C2L A;  3H4D A;  1NK7 A;  3ZD8 A;  4GC7 A;  4BXO B;  4RQ2 A;  5HML A;  3Q8P B;  1K1Q A;  3BQT A;  4BWM A;  4RU9 A;  4Z6E A;  1NK8 A;  1T8E A;  4MFF A;  2NRW A;  3T5H A;  3KHG A;  2IBK A;  4DQQ A;  1ZQO A;  1SKW A;  4NLG A;  4O5E A;  5IIO A;  4C8L A;  3IM1 A;  1SL2 A;  5HHI A;  5J2D A;  3RH4 A;  2BCV A;  4I2E A;  1S0O A;  1ZQF A;  5IIM A;  3OHA A;  1ZQT A;  3SI8 A;  2HHW A;  4KN7 A;  4QZG A;  3RB0 A;  2VAN A;  1NOM A;  4M6W A;  1X9S A;  3G6Y A;  2XY6 A;  4O3R A;  8ICH A;  4QWB A;  1XS9 D;  7ICF A;  9ICL A;  3PW2 A;  5DBB A;  9ICN A;  4O3S A;  1X9W A;  5KFW A;  2JEJ A;  2W8K A;  2HHQ A;  4KLF A;  5KFV A;  4R65 A;  5J0P A;  1CUK A;  2PXI A;  4NY8 A;  9ICO A;  5CB1 A;  2ZUB A;  2AGP A;  1KDH A;  2ZTE A;  3MR2 A;  2I9G A;  2IHN A;  4BGD A;  2VA3 A;  2UVV A;  1BPY A;  5DG9 A;  1NK4 A;  3HP6 A;  3JPT A;  1RYR A;  3ZDA A;  4DSE A;  5J0T A;  3AU6 A;  3T3F A;  1BVS A;  4J9S A;  2NRT A;  4BDP A;  1HJP A;  2XCP A;  4F4Z A;  2BGW A;  4MF8 A;  4YFK A;  3H8J A;  2W9B A;  3EZ5 A;  1NKE A;  4Q8E A;  4ED2 A;  4J9O A;  3FDS A;  2V4R A;  4I2A A;  1TK5 A;  4O5K A;  4P4O A;  2PI5 A;  3QZ7 A;  5TZV A;  2BCQ A;  3HX0 A;  1IXR A;  7ICQ A;  4I2I A;  3NTU A;  3T5J A;  3RR7 A;  9ICK A;  3PVX A;  4R8U A;  3MDA A;  1T4G A;  7ICL A;  4PHA A;  3TAN A;  1D8L A;  1TK0 A;  4RNM A;  3EWA A;  2HHU A;  4RQ1 A;  4DL6 A;  3BDP A;  1S0M A;  5J0O A;  1QLN A;  4KTQ A;  4M47 A;  4YR3 A;  3Q8Q B;  8ICG A;  2AGO A;  4I2G A;  1ZQC A;  2HHS A;  1WCN A;  4KLD A;  4LVS A;  1NJX A;  1NKB A;  4YXJ A;  4Q45 A;  3BQ2 A;  1ZQE A;  2W8L A;  4KLQ A;  2J6S A;  4QZB A;  3RJJ A;  1WCL A;  3RRH A;  2HW3 A;  7ICG A;  5DB8 A;  2C2E A;  3T5L A;  1X2I A;  5CJ7 A;  2W9M A;  4M9H A;  3B0Y A;  4LZD A;  5IIN A;  2Y1J A;  3UQ2 A;  1SZP A;  4MEY A;  5DKW A;  5F9L A;  5KFO A;  4UB3 A;  3OJU A;  4GXK A;  1U47 A;  4KLS A;  4IQT A;  3TFR A;  1EXN A;  2M9N A;  5KT2 A;  2ZUC A;  5KFK A;  4DLG A;  1LB2 B;  2ZTC A;  3H7I A;  4ED6 A;  4ED8 A;  1ZQS A;  3MR6 A;  9ICV A;  4TUP A;  1ARO P;  4EZ6 A;  2FPM A;  1ZQI A;  4I2C A;  4UAW A;  3ZDD A;  5J2I A;  8ICJ A;  5L9X A;  4YR0 A;  5L1K A;  4J9L A;  4DSI A;  2ZTD A;  3PX4 A;  2BPF A;  4E0D A;  4NLZ A;  2HVI A;  2WTF A;  9ICU A;  4FS2 A;  4XRH A;  4QZD A;  2DFL A;  4EBC A;  3PW4 A;  4RPZ A;  4DL3 A;  2KFZ A;  1KFD A;  5DGB A;  2W9C B;  5KFG A;  3PW0 A;  3RH6 A;  1C7Y A;  3BJY A;  3UXN A;  5KFM A;  5KFJ A;  3PR4 A;  1QSY A;  4ED3 A;  4F5Q A;  4O9M A;  5CHG A;  1NK5 A;  2JEI A;  4DSK A;  5KFD A;  8ICS A;  1Z00 A;  3TAR A;  5J2K A;  3B0X A;  3LK9 A;  2KN7 A;  4XA5 A;  3JPQ A;  3GDX A;  1ZQY A;  4DFM A;  1S0N A;  5KG4 A;  5KFF A;  4KLG A;  2AQ0 A;  4F4Y A;  1TAQ A;  1MC8 A;  4BWJ A;  5L1L A;  1TFR A;  4FS1 A;  3PY8 A;  3H40 A;  1S97 A;  1ZQR A;  3TQ1 A;  1ZQQ A;  3EW9 A;  4KLO A;  5CA7 A;  3RJK A;  1JMS A;  5HMM A;  4UB5 A;  5DGA A;  2NRZ A;  1D9D A;  4HYK A;  3GII A;  5L1J A;  4YR2 A;  2NRV A;  3M9M B;  4DL7 A;  3IHQ B;  1BPD A;  8ICQ A;  3ISD A;  1ZYQ A;  4IRK A;  3Q8R B;  4DQI A;  4R64 A;  1Z3E B;  1A76 A;  4EBE A;  4I28 A;  4RT3 A;  5KG2 A;  5J2F A;  4J9M A;  2BPG A;  1SKR A;  1HUO A;  3H8S A;  1KFS A;  3GIJ A;  3RBD A;  4R63 A;  2MUT B;  3M8S A;  4M9N A;  1JIH A;  4I2B A;  2BR0 A;  3ETL A;  4XUS A;  1NK6 A;  1COO A;  4UQG A;  3PX0 A;  3MBY A;  4I29 A;  4KLE A;  5KFZ A;  2B21 A;  3LWL A;  4GLX A;  4DFP A;  4KLU A;  8ICV A;  4UB1 A;  1BGX T;  2XY7 A;  4QWE A;  4DQP A;  3MGH A;  3PMN A;  4PPX A;  2FMQ A;  1Z00 B;  3Q8K A;  5III A;  4EEY A;  4F91 B;  4YCX A;  1BPX A;  2ASJ A;  8ICI A;  1L3V A;  2J6U A;  1S10 A;  4ECZ A;  2FLL A;  2FLP A;  4ELU A;  4DSF A;  1XC9 A;  4ECU A;  3Q8L A;  2H5X A;  4DEZ A;  4QZE A;  1K1S A;  5KG0 A;  4KLI A;  4RUC A;  1BPB A;  3OSN A;  4ECT A;  5IIJ A;  4YXM A;  5D4B A;  1L5U A;  2ASL A;  1S9F A;  1TKD A;  4DOB A;  2Q0Z X;  5HP4 A;  3JPN A;  1ZQK A;  1UT5 A;  4B9V A;  9ICC A;  3GV5 B;  7ICR A;  4QZI A;  1QSL A;  2AGQ A;  2ZJA A;  4K4I A;  3RAQ A;  1CEZ A;  7ICP A;  3N4M B;  1ZQZ A;  4KLL A;  5KG1 A;  4M9L A;  4Z6C A;  1PZN A;  4K4G A;  1DGS A;  4MFC A;  7ICN A;  7ICV A;  1ZQU A;  5IIK A;  1U9L A;  4O3Q A;  5DG8 A;  1ZQA A;  5J0W A;  2P66 A;  1RZT A;  4QWA A;  3JPS A;  4YVZ A;  4RQ7 A;  4JV2 A;  2ASD A;  5KT5 A;  4YG2 A;  5DB6 A;  1ZQJ A;  7ICE A;  3PML A;  1SL1 A;  4B9S A;  2FMS A;  2IHM A;  1RPL A;  4YN4 A;  4JUZ A;  3PX6 A;  4YMO A;  4PGQ A;  5EWE A;  5KFY A;  2FLN A;  4IR9 A;  9ICT A;  5J29 A;  3JPO A;  3OSP A;  5J0Y A;  5IIL A;  4PGX A;  5DQH A;  1ZET A;  3G6X A;  4IQV A;  2GWS A;  3GFK B;  5HNK A;  4UAY A;  2ATL A;  2R8G A;  1LV5 A;  3BQ1 A;  8ICM A;  2XC9 A;  5KFB A;  3EPG A;  2C2R A;  5DBA A;  2JZB B;  4J9Q A;  3RJH A;  1KLN A;  2HHT A;  4I2J A;  2BKE A;  5CWR A;  1U49 A;  9ICB A;  3RB6 A;  4KMU A;  7ICS A;  5DQG A;  4I27 A;  4J9N A;  1BPZ A;  2BQ3 A;  3HWT A;  5KFL A;  5DLF A;  2C28 A;  3PO4 A;  4Q43 A;  3SZ2 A;  8ICO A;  8ICA A;  1L3U A;  4RNO A;  4YD2 A;  4IQW A;  1V9P A;  4I2D A;  4RZR A;  3KHH A;  2C22 A;  5KT6 A;  2R8H A;  3C2M A;  1NJY A;  1X9M A;  1D8Y A;  3ZDC A;  3RAX A;  5KFI A;  4JV0 A;  2XY5 A;  4DLE A;  4KN4 A;  2KZM A;  4C8N A;  4QZA A;  2VA8 A;  5KT7 A;  3GIK A;  4C8O A;  4F3O A;  4C8M A;  4Q8F A;  1B43 A;  4NXZ A;  1T7P A;  5J2J A;  1QSS A;  3MR3 A;  4PHP A;  2W9B B;  3SYZ A;  4EYI B;  4YMN A;  3C2K A;  4DFJ A;  2Y1I A;  1MQ2 A;  4MF2 A;  2IA6 A;  1B22 A;  4TQR A;  4J9K A;  3MDC A;  1XSL A;  1L3T A;  3ORY A;  7ICM A;  2BHN A;  2J6T A;  1IM4 A;  3NGD A;  2BCS A;  2KTQ A;  2ZUD A;  3C21 A;  3OGU A;  3M9O B;  3HW8 A;  2W9C A;  4GXI A;  4ECW A;  2R8I A;  4M04 A;  1ZQP A;  5KG6 A;  1T3N A;  3ZDE A;  4PHE A;  5J0S A;  4YQW A;  4KLM A;  5KTQ A;  4DS4 A;  3ISB A;  5KFT A;  5KFU A;  4F92 B;  1KTQ A;  7ICH A;  9ICP A;  9ICG A;  4IRD A;  4F8R A;  2KFN A;  9ICS A;  4UBC A;  4TUQ A;  4O0I A;  8ICW A;  5EOZ A;  4DOA A;  5HHH A;  3LDA A;  2FPK A;  5KFE A;  4P4M A;  1UA1 A;  4KLJ A;  9ICR A;  4O3O A;  3GV7 B;  5D46 A;  4DQR A;  1NKC A;  4ECS A;  3V6J A;  5KFN A;  4ED0 A;  3RJG A;  4K4H A;  2ISP A;  2OWO A;  1XO1 A;  1RXV A;  9ICF A;  2BQR A;  5DDY A;  7ICI A;  5J2E A;  4RUA A;  8ICN A;  4EBD A;  3QE9 Y;  2UVU A;  4F2R A;  4KIT B;  4F4K A;  3K4G A;  1ZQB A;  4KLT A;  5KFS A;  3RJI A;  2P6R A;  3K75 D;  3G6V A;  1TV9 A;  3LWM A;  2PFN A;  8ICP A;  4TUR A;  1HUZ A;  1KFT A;  1XU4 A;  2V4Q A;  9ICX A;  3MGI A;  7ICU A;  1ZQV A;  4ELV A;  3C23 A;  5CP2 A;  5J2B A;  4RPY A;  1KEJ A;  3C1Z A;  4F5P A;  3QEB Z;  4B9M A;  4JWM A;  1RXW A;  4YMM A;  8ICL A;  2ALZ A;  1NJZ A;  2DPI A;  5EWG A;  5KFX A;  1Y88 A;  4R66 A;  4DF4 A;  4PGY A;  4QWD A;  3M8R A;  4RQ5 A;  2W9A A;  5F9N A;  3PV8 A;  1SKS A;  1KSP A;  4FBT A;  8ICK A;  5J2A A;  4QZC A;  4DL5 A;  4YP3 A;  1ZQG A;  4NM2 A;  4I2F A;  4UBB A;  1ZJN A;  4CCH A;  1ZQL A;  2AJQ A;  3Q8M A;  5KT3 A;  3ZDB A;  4ECY A;  2BCR A;  9ICI A;  1ZQM A;  8ICU A;  5BOL A;  3UQ0 A;  7ICK A;  1S77 D;  2BCU A;  2KZ3 A;  3H4B A;  2V9W A;  7ICJ A;  5J2H A;  3UXP A;  4DSJ A;  3PR5 B;  1A77 A;  5BPC A;  9ICQ A;  3C1Y A;  2RDI A;  7ICO A;  1BPE A;  3MFH A;  5KFR A;  4FBU A;  2RDJ A;  4M9J A;  8ICF A;  4F5O A;  2PFQ A;  2F1H A;  3QZ8 A;  2XGP A;  3RTV A;  3JPP A;  3TAP A;  4ELT A;  4O5C A;  2AU0 A;  8ICZ A;  9ICW A;  4QZF A;  4MEX A;  1ZQN A;  4DSL A;  2UVW A;  4FO6 A;  3V7L A;  4JWN A;  3SV4 A;  4EZ9 A;  4XQ8 A;  4TQS A;  4RQ4 A;  3MFI A;  9ICE A;  2JEG A;  8ICE A;  2AQ4 A;  4F2S A;  1QTM A;  4ED1 A;  5DBC A;  5DDM A;  5J2G A;  4UB4 A;  1NK9 A;  4EYH B;  5J0R A;  4QZH A;  4PH5 A;  3TAQ A;  4X5V A;  3PW5 A;  3PNC A;  4DWI A;  5KFH A;  1XWL A;  5J0U A;  3TFS A;  1N48 A;  3C5F A;  3MR5 A;  3V7J A;  4Q44 A;  1SL0 A;  5BOM A;  3GIL A;  4DS5 A;  3PW7 A;  2R8J A;  3E2E A;  4YD1 A;  1JXE A;  5KT4 A;  4ECR A;  5DB9 A;  2KZZ A;  4ECQ A;  3RH5 A;  3V6K A;  2A1J B;  2F1I A;  1L3S A;  4P2H A;  4GC6 A;  2I1Q A;  4DQS A;  4IRC A;  4M2Y A;  4IQU A;  2DPJ A;  2FPL A;  2XO7 A;  2R8K A;  2BDP A;  4BXO A;  1TAU A;  4JK1 A;  4M0A A;  4F5N A;  5J0Q A;  3Q8S B;  1RYS A;  2JZB A;  1KRP A;  4ECV A;  4J9P A;  1N56 A;  5KG5 A;  4NLK A;  4B9N A;  8ICB A;  3OHB A;  4F5R A;  3KTQ A;  2PFO A;  1UT8 A;  4B9U A;  3FYH A;  4UB2 A;  3QEA Z;  1MQ3 A;  9ICH A;  8ICY A;  8ICT A;  2XGQ A;  4UAZ A;  3RRG A;  4G3I A;  5J0X A;  4DOC A;  4O3N A;  5DLG A;  3HT3 A;  1U4B A;  3HPO A;  3KHR A;  4RT2 A;  2BPC A;  3MAB A;  4F4W A;  1XSN A;  5KG7 A;  1ZQW A;  1ZQD A;  3M9N B;  2BQU A;  5KG3 A;  1S76 D;  4RQ6 A;  3RB3 A;  1ZQX A;  4DFK A;  4B9L A;  5KFA A;  3OJS A;  9ICJ A;  2ISO A;  3RJE A;  4F50 A;  4IR1 A;  5D49 A;  3EYZ A;  7ICT A;  4NLN A;  1ZQH A;  3SV3 A;  4B9T A;  5DB7 A;  2P6U A;  3RJF A;  4ZH4 A;  1NJW A;  1D9F A;  3AUO A;  4C8K A;  4I2H A;  5DQI A;  4MFA A;  9ICA A;  2LYH A;  4ECX A;  4QWC A;  2ZJ5 A;  5KFQ A;  2HVH A;  4Z6F A;  4QZ9 A;  2PI4 A;  3GIM A;  3THV A;  1TVA A;  2PFP A;  3ISC A;  4P4P A;  2C2D A;  4F93 B;  5JUM A;  4RPX A;  4RNN A;  4DF8 A;  4PHD A;  5DG7 A;  4LZG A;  4RQ3 A;  1TK8 A;  3GQC A;  1XSP A;  3GV8 B;  2MAX A;  1U48 A;  5C5J A;  3KHL A;  4TUS A;  3JPR A;  4J9R A;  3UPQ A;  3TI0 A;  8ICC A;  3H8W A;  2HHV A;  1S0V A;  4JV1 A;  5J2C A;  4QW9 A;  8ICR A;  4DO9 A;  5KFP A;  1JN3 A;  2MUT A;  4R8U B;  5KFC A;  3AU2 A;  3C5G A;  4M9G A;  4DL2 A;  4ED7 A;  3RBE A;  4F4X A;  1UA0 A;  2UVR A;  1JX4 A;  4QW8 A;  2XCA A;  2A1J A;  4RQ8 A;  2VA2 A;  4GXJ A;  1ZJM A;  3UXO A;  8ICX A;  3N97 B;  2FMP A;  3ZD9 A;  1U45 A;  1DOQ A;  3BQ0 A;  4O3P A;  2HHX A;  1H38 A;  4Z6D A;  4RQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...