1Z00B

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
b'MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00B00
2A1JB 4M47A 1ZQKA 4F2RA 9ICNA 2HHQA 2KFZA 1RZTA 3MABA 4DO9A 5KFPA 3H40A 1SKWA 1B22A 1Z00B 3MFIA 5TZVA 4ED2A 4NM2A 4TUQA 3BJYA 3LWMA 1B43A 5J29A 4KN4A 5KG1A 4TQSA 4QZ8A 4QWDA 5D4BA 5DB6A 3V6JA 5DB7A 4DFKA 2ISPA 4M9LA 4YR2A 1BGXT 5J2JA 1C7YA 3H8WA 1HUOA 5J2CA 4RUCA 1ZQHA 4ELUA 5KFHA 4YD1A 5BOMA 1MQ3A 4DF4A 2BCRA 4PHPA 3MR6A 1X2IA 2R8IA 5DDYA 2XO7A 2VA8A 4RQ8A 4J9PA 1ZQOA 4EYHB 3TFRA 3GQCA 5DLFA 4NLKA 2ZTEA 4O3NA 2AQ0A 4ECQA 4GC7A 3T5HA 5IINA 3QE9Y 2KTQA 1NKEA 2HVIA 1K1SA 4RNOA 2XCAA 5DBBA 2W9MA 5EWGA 4DEZA 1ZQSA 4ELTA 2F1HA 9ICEA 8ICUA 4NM1A 4B9UA 4DSLA 3GV5B 9ICAA 4RQ2A 4Z6EA 4DL6A 4R65A 4QZBA 1ZQNA 9ICTA 2C2EA 3HP6A 5KT6A 1Z3EB 1CEZA 3GV7B 2P6UA 4ED1A 2H5XA 2IA6A 5KTQA 3IHQB 5IIOA 3HPOA 3GIIA 1NOMA 2RDIA 3PMNA 3JPSA 4DS4A 4I2BA 7ICLA 3PW7A 1UA0A 8ICFA 2XY5A 8ICLA 4YG2A 5DKWA 5CHGA 1TK0A 2R8GA 4KLEA 7ICFA 1L3UA 1U48A 3B0XA 4Q8FA 5DB9A 2AGOA 1ZQUA 5KG3A 5J0QA 3MDAA 4BWMA 4Q44A 5J2AA 1XC9A 4F5QA 2I1QA 3JPPA 4EEYA 1ZYQA 5J2KA 1NK7A 4KTQA 5CWRA 4EBDA 2KZZA 4F5RA 3MDCA 4DF8A 1ZJNA 4YN4A 5KFJA 2FMSA 4R8UB 9ICFA 2BQ3A 4O0IA 3TFSA 1U4BA 5L1LA 4DSEA 4YQWA 4JWNA 4QW8A 4IR9A 2ZUBA 5KG6A 2ZUDA 3KHRA 4F8RA 5KFZA 2W9CA 8ICKA 1D9FA 4K4GA 5KG7A 3OSNA 5KT4A 2FMQA 1BPZA 9ICGA 4YMMA 2AQ4A 2V9WA 2BPGA 4RQ5A 2OWOA 1QLNA 4RU9A 4JUZA 2ZUCA 8ICHA 4Q43A 1S0VA 4J9KA 3THVA 5IIJA 4FS1A 3IM1A 1Z00A 5KFNA 4RQ0A 1JIHA 4UAWA 1QTMA 2XY7A 4QZ9A 4DSIA 3T5JA 4QZCA 3LWLA 4KLTA 3K75D 2W9AA 1SL0A 2MAXA 5KT7A 1QSSA 9ICBA 2XC9A 4J9RA 1S77D 3ISCA 4MFAA 2IMWP 4ECRA 8ICBA 3T5KA 5DBCA 3RB4A 3JPRA 3GFKB 4ECZA 1KFTA 3RJFA 4C8OA 4IQTA 1UA1A 1S0MA 3PO4A 4BXOB 7ICOA 1LB2B 4YR3A 1NK8A 2P6RA 1KFDA 5KG5A 4IRKA 4MFFA 4IQUA 3MR2A 3QZ8A 4YMOA 3SZ2A 5KFKA 4Q8EA 3PY8A 4ZH4A 4RT2A 1ZQPA 2JEGA 9ICLA 2ZTCA 5CJ7A 2R8JA 3NGDA 3TAQA 2HHWA 1BPYA 1ZQLA 3M8SA 4C8KA 2W8KA 9ICWA 4QW9A 4O3OA 4MFCA 5KT3A 3RH6A 5CA7A 2I9GA 5IILA 2FPMA 4CCHA 4M9JA 4DQIA 4NY8A 5KG4A 1QSLA 4ELVA 2BCVA 4I2GA 4XQ8A 4KLHA 1JN3A 4PGQA 3H4BA 1S10A 3H7IA 5CB1A 4DL5A 4MEXA 4YFKA 4C8LA 4QZHA 1N48A 4NLGA 4RPXA 4RZRA 3GIKA 5L1JA 3RR8A 8ICIA 3EYZA 3PW0A 5BPCA 3C2LA 1XS9D 2KZ3A 4DSFA 3ZDDA 3TI0A 3FDSA 5HMMA 4LZGA 3ISDA 4C8NA 5DG8A 3MR3A 4UQGA 4KLMA 1NKBA 4DFPA 3Q8KA 3C21A 3K4GA 1ZJMA 4ED0A 4RT3A 3KHGA 2FPLA 4QZIA 5DG9A 4UB5A 3EPGA 4R63A 5DB8A 9ICUA 4B9MA 5CR0A 7ICHA 2PFPA 5F9NA 4DOBA 4DOAA 5J2GA 2BR0A 4M6WB 4RQ7A 3OJSA 1L3TA 4M9NA 3UPQA 4YXJA 5DLGA 3EW9A 3ZDAA 3QEBZ 3PO5A 3PVXA 2BQUA 5D46A 7ICMA 4QWCA 1ZETA 4TURA 9ICIA 3RRGA 2UVUA 1ZQYA 1S0OA 5J0PA 1KSPA 8ICJA 1XWLA 4KN7A 8ICPA 4LZDA 2B21A 5EWEA 5KG0A 1ZQCA 4O5EA 1MC8A 3BDPA 7ICTA 2W9BB 1L3VA 1IXRA 3RB6A 1V9PA 5DDMA 4ED7A 4K4IA 4YMNA 4F91B 4Q45A 3EPIA 4I2JA 2C2RA 3KTQA 4O3RA 2HHTA 9ICSA 7ICSA 3GDXA 3RJGA 3RTVA 8ICWA 2BCQA 1ZQZA 2ASLA 3TANA 4M9HA 1BPDA 4YR0A 4I2EA 2W8LA 4M04A 4O5KA 1HUZA 5KFEA 3SV4A 1ZQQA 4R66A 4GLXA 1U45A 4TUSA 3M9OB 1T7PA 4BXOA 4I29A 5J0OA 3Q8SB 2UVVA 4KLGA 2AJQA 3C5GA 2JEFA 1HJPA 3ETLA 4BWJA 1DOQA 4P4MA 2DFLA 3ZD9A 3MGHA 3OJUA 4DQQA 1H38A 2ISOA 1KLNA 2BPFA 2ZJAA 5HHIA 3C23A 4FBTA 2HHUA 4DS5A 4I27A 2NRXA 5L1KA 4QWBA 4IQVA 4QZGA 3Q8RB 3H8JA 1SL1A 3ZDCA 8ICQA 9ICXA 5KFFA 5KFMA 5KFBA 2FLLA 2XY6A 1NJZA 1N56A 5J0YA 5J0RA 4RNMA 4ED3A 1TKDA 5J0WA 4I2AA 4TQRA 5KFCA 4RQ1A 3N4MB 9ICQA 4O3SA 8ICTA 4F4ZA 3LK9A 4EYIB 3E2EA 4DFJA 2A1JA 1ZQJA 4UB3A 1TAUA 3HT3A 3RAQA 4XA5A 3RJKA 3Q8MA 1MQ2A 4UB4A 5J0TA 2V4RA 3BQ2A 3T3FA 3PR4A 7ICGA 4J9NA 3RB3A 4MEYA 3PX4A 4B9TA 2V4QA 7ICJA 3Q8PB 2NRVA 5J2FA 3JPTA 4F5PA 4J9QA 4GXKA 2F1JA 5KFXA 1COOA 1TAQA 3V6HA 3MR5A 2FLPA 3N97B 3RB0A 2JZBB 3V7KA 7ICUA 7ICNA 1RXVA 5EWFA 3G6YA 4B9VA 1DGSA 1T8EA 4I2IA 4PHAA 4TUPA 3JPOA 1ZQRA 2HHSA 1NJWA 4ED6A 4IRDA 3UQ0A 4EBEA 4UAYA 2PFQA 8ICZA 3BQTA 4ED8A 5J2DA 1JMSA 3G6XA 4EZ9A 4I2DA 5DQHA 3TAPA 4FBUA 4F4WA 4F5OA 4O9MA 5HNKA 4Z6CA 1ZQDA 4R64A 3RRHA 1SKSA 1NK9A 1EXNA 2NRZA 4YVZA 5KFAA 3RBEA 4JK1A 4QWAA 3RJIA 1UT8A 2J6TA 4O3QA 3V6KA 7ICEA 3ZDBA 5HP4A 3RR7A 2C22A 4UBCA 2IHNA 5IIIA 1D9DA 4FO6A 3PNCA 1SL2A 7ICKA 8ICNA 8ICCA 8ICRA 8ICSA 4ECTA 3RH5A 4YXMA 8ICAA 5J2EA 3JPNA 3C1ZA 2RDJA 5KFWA 4X5VA 2VA2A 4O5CA 4DL2A 2HW3A 1NK5A 1WCNA 2PI4A 3HW8A 3PX6A 5L1IA 2BKEA 5C5JA 1TK5A 2HVHA 3V7JA 3T5LA 4P4PA 7ICIA 3M9MB 2C28A 2MUTB 4I2FA 4IR1A 4EBCA 3UXOA 2ZJ8A 5KFIA 3UQ2A 1KRPA 2HHXA 1Y88A 4XRHA 3PW4A 5KFRA 4DQSA 2KFNA 3FYHA 5KFTA 4R8UA 2W9CB 1T3NA 8ICYA 4FS2A 2DPIA 2FPKA 4YP3A 4QWEA 3PX0A 3QEAZ 8ICGA 1A77A 4DWIA 2ASDA 4QZAA 3GV8B 1ZQWA 4DL4A 3C2MA 3PW5A 1NJXA 3SYZA 1ZQTA 3H8SA 4DL7A 1PZNA 1JX4A 1NK0A 3MFHA 5KFLA 5J0UA 3UXNA 3MBYA 4BGDA 4B9LA 2WTFA 4J9MA 3KHLA 4F5NA 5KFUA 5HMLA 3QZ7A 4NXZA 4F4YA 1ZQIA 1ZQEA 1JXEA 1RXWA 5BOLA 2Q0ZX 1D8LA 2XCPA 2BCUA 5DQIA 4RNNA 2DPJA 4Z6FA 3GILA 1ZQVA 4NLZA 1NK6A 8ICXA 5EOZA 4IRCA 2PFOA 5KFYA 1L3SA 4QZFA 2R8HA 4GXIA 4UB1A 2R8KA 8ICOA 9ICVA 3OHAA 3RAXA 4KLOA 2AGPA 1RYRA 9ICJA 4KITB 2ASJA 2UVRA 2BQRA 2KN7A 1KEJA 5DG7A 4JV2A 5J2HA 4DOCA 4IQWA 1S9FA 4RQ3A 5KFQA 2JEIA 2BHNA 2JZBA 4DSKA 9ICPA 3OSPA 3ORYA 1S97A 4JV0A 2JEJA 9ICCA 3Q8QB 2BPCA 5KFOA 3AU2A 3OGUA 1SKRA 4GXJA 4F2SA 5L9XA 2VANA 3C1YA 4PPXA 4EZ6A 4F92B 2PI5A 3V7LA 4QZDA 4PGXA 8ICMA 3UXPA 3ZD8A 2AU0A 4BDPA 1S76D 3JPQA 4F3OA 1CUKA 8ICVA 1K1QA 2GWSA 2FMPA 4ECSA 1QSYA 4RQ6A 4PHDA 1ZQFA 2C2DA 4DQPA 3SI8A 3ISBA 4I2CA 4M0AA 1TFRA 4JV1A 1U9LA 1NK4A 2KZMA 4UBBA 3SV3A 5HHHA 3ZDEA 1NJYA 1KFSA 9ICOA 4Z6DA 4DL3A 4JWMA 1XSNA 2PFNA 5DBAA 4KMUA 1BPXA 4G3IA 1UT5A 4KLSA 2VA3A 5KFGA 1L5UA 7ICQA 4F93B 4I2HA 3PV8A 3HX0A 3MGIA 2ATLA 2P66A 4PH5A 5KT5A 1JXLA 7ICVA 2IBKA 1IM4A 4KLUA 2HHVA 5KT2A 2AGQA 1XSLA 2MUTA 3C2KA 1U49A 2F1IA 1KDHA 4F4KA 9ICHA 3RH4A 3BQ1A 4KLDA 3LDAA 4C8MA 5J2IA 3RJJA 4NLNA 2Y1JA 8ICEA 9ICRA 1T4GA 1XO1A 3Q8LA 4KLLA 4M2YA 4DQRA 5KFDA 4RPYA 4KLIA 3PR5B 2NRWA 1ZQGA 4M6WA 7ICRA 5D49A 3TQ1A 1S0NA 3EWAA 3HWTA 1ZQAA 2BCSA 3BQ0A 1D8YA 2ZJ5A 5KFVA 4UB2A 2BDPA 5DQGA 2Y1IA 1X9WA 1ZQMA 3GIJA 4HYKA 1XSPA 1XU4A 1RYSA 5IIKA 1NKCA 1WCLA 1SZPA 1X9SA 2XGPA 4DLEA 5J0SA 4J9SA 4I28A 1U47A 3TARA 1BVSA 4DFMA 5J2BA 3KHHA 1RPLA 1ZQBA 2W9BA 3AUOA 4ECUA 9ICKA 4GC6A 4F4XA 4P2HA 2LYHA 4P4OA 1TV9A 2BGWA 3RBDA 5J0XA 1KTQA 1ZQXA 5F9LA 3EZ5A 3GIMA 3H4DA 1X9MA 2XGQA 4K4HA 4MF2A 2M9NA 4F50A 1LV5A 2J6SA 4ECXA 3RJHA 4E0DA 4YD2A 2UVWA 4O3PA 3B0YA 3RJEA 2PXIA 4ECWA 3PW2A 1TK8A 4PHEA 2NRTA 3G6VA 4B9NA 1BPBA 2IHMA 4RPZA 5JUMA 4XUSA 5IIMA 4KLJA 1BPEA 7ICPA 3C5FA 1AROP 4B9SA 5DGBA 4DSJA 4ECYA 4LVSA 4RUAA 1A76A 3M9NB 2ZTDA 9ICMA 1MSWD 5CP2A 4J9LA 4KLFA 4QZEA 1TVAA 3PMLA 2FLNA 3M8RA 5KG2A 4ECVA 3AU6A 5KFSA 3NTUA 2J6UA 4RQ4A 4UAZA 4MF8A 2ALZA 3V72A 4PGYA 4J9OA 4KLQA 4YCXA 4DLGA 3OHBA 4M9GA 5DGAA
chains in the Genus database with same CATH superfamily
4UATA 4M47A 1ZQKA 2HHQA 1SKWA 1ED1A 3BJYA 1VLBA 4KN4A 4QZ8A 2W43A 5J2JA 4EEKA 5AM2A 1F44A 1C7YA 1ZQHA 5J2CA 5KFHA 4YD1A 5BOMA 5ALMA 2CRXA 3SAGA 4RQ8A 4J9PA 1ZQOA 4Y2SA 4USAA 3T5HA 2AQ0A 3WK6A 2NO4A 1X6IA 1NKEA 2JH7A 1K1SA 2W9MA 4GFJA 4B9UA 1NZBA 2E8NA 4DL6A 4R65A 5E79U 2EANA 5KT6A 3K1RB 2KOBA 3GZFA 2P6UA 4PJ0U 3QNMA 2MRLA 3IHQB 1IIPA 3JPSA 3A0BU 2RRDA 1U48A 3B0XA 4Q8FA 4ACOA 3MDAA 2LI6A 4OD0A 4F5QA 3JPPA 2NO5A 3NRZA 5AK4A 2YQEA 9ICFA 4O0IA 1Z19A 3KHRA 4UW9A 3AEVA 2D3DA 2DUYA 3NVVA 2AQ4A 2BPGA 4RQ5A 2KVCA 5K4LA 1S0VA 3VC8A 3THVA 5KFNA 2KG5A 2Q4TA 1JIHA 5ALIA 4UAWA 4UARA 1SL0A 2M0NA 4J9RA 1S77D 3ISCA 4ECRA 5DBCA 3JPRA 4ECZA 3QUTA 1UA1A 3TADA 2WF7A 4YR3A 4MFFA 3WKEA 4YMOA 2ZXHA 2ZXIA 4ZH4A 2VKQA 4RT2A 2ZTCA 3NGDA 2QLTA 2LPEA 4MFCA 5KT3A 5CA7A 4M9JA 4DQIA 2HOQA 4XQ8A 4CF3A 5CB1A 1J2NA 1OUQA 4YFKA 3CRXA 4RZRA 5L1JA 2WB1C 3WK5A 1XS9D 2XI9A 2W54A 3ZDDA 3TI0A 1LKYB 3NUQA 4C8NA 2RLTA 1NKBA 4QJFB 2K4IA 3Q8KA 4ED0A 2ZIVA 4LJXA 3KOOA 7ICHA 2A19A 2G0AA 3UPQA 1QQ7A 5DLGA 3ZDAA 2YN4A 3PO5A 3PSFA 3PVXA 4QWCA 9ICIA 3RRGA 2UVUA 5ALZA 1KSPA 3HRDD 5CEHA 1ZQCA 1MC8A 7ICTA 5AKIA 2W9BB 1IXRA 4ED7A 4YMNA 3DDHA 3SAFA 3ALRA 3L5KA 1N5XA 8ICWA 4M9HA 2ASLA 4I2EA 2FE9A 4PZNA 2K8CB 4M04A 5KFEA 3SV4A 4O5KA 4R66A 4GLXA 3M9OB 4C4RA 4I29A 3Q8SB 2UVVA 4KLGA 2Y9UA 4C80A 3F5EA 4P4MA 3ZD9A 1H38A 2F2AB 2HI0A 5AK5A 2VIXA 3H0RB 3KZIU 2XY6A 1N56A 5J0YA 5KFCA 1FFUA 4CDGA 4UAVA 1ZRMA 1MQ2A 4Y2QA 3D2SA 1SGGA 1DK3A 4OCZA 4MEYA 1MA7A 1T94A 2HBLA 1ZD3A 2JRZA 2K89A 3JPTA 4F5PA 4GXKA 2F1JA 1COOA 3H0MB 2QB0A 1RXVA 5EWFA 4CF4A 2PKEA 2G08A 3FAHA 4CE6A 5J8YC 4EBEA 2JHDA 3WK4A 5AKYA 4UAYA 8ICZA 3BQTA 1JMSA 4F4WA 1ZQDA 1NK9A 1EXNA 2NRZA 3H8MA 5H2FU 3RJIA 3UMGA 3RR7A 2ZIWB 4ECTA 2HW3A 2B0CA 3C1ZA 4X5VA 2PI4A 3PX6A 2MU2A 5ALWA 1KRPA 2HHXA 4XRHA 3PW4A 4A8EA 2W9CB 8ICYA 3PX0A 4DWIA 2W3SA 3PW5A 1NJXA 1RYUA 3H8SA 1JX4A 1NK0A 3MC1A 4J9MA 5HMLA 3WU2U 1ZQEA 1ZQIA 2E3TA 3SMVA 2DPJA 7ICQA 3CYMA 3GILA 3EUB2 4UB1A 1N63A 2AGPA 2YY6A 3NRWA 4DOCA 1Z1VA 5KFQA 2JEIA 5AIBA 1S97A 3QYPA 3AU2A 3SAHA 1SKRA 2G07A 4JB3A 5L9XA 2PI5A 3UMCA 3UXPA 1X40A 4F3OA 1K1QA 1L7PA 1JI7A 1QSYA 4RQ6A 4PHDA 2C2DA 4DQPA 3SI8A 3ISBA 4CGZA 2BDUA 4UBBA 5HHHA 1XSNA 5DBAA 4KMUA 2HSZA 3WKDA 5KFGA 1L5UA 3HX0A 7ICVA 4KLUA 3QX7A 5KT2A 2AGQA 2MUTA 9ICHA 2KMDA 8ICEA 5KFDA 4HAIA 1Q3VA 3HILA 4M6WA 3TQ1A 5DQGA 1X9WA 5IIKA 1WCLA 1X9SA 3NVYA 5ALJA 4DFMA 5J2BA 3KHHA 3E0FA 1KTQA 1ZQXA 2RP5A 1L6NA 4MF2A 2WFAA 1LV5A 4ECXA 4O3PA 3B0YA 4EELA 4B9NA 2DBYA 2EAOA 2WF9A 4DSJA 4ECYA 3M9NB 2ZTDA 5CP2A 4J9LA 4KLFA 5AKXA 4QZEA 1J2MA 5KFSA 1PK1A 1ZQ1C 3V72A 4PGYA 5AM4A 1Z4NA 3OHBA 5DGAA 2A1JB 4F2RA 1N5WA 9ICNA 1B22A 2KFZA 3MFIA 5TZVA 3M7DA 4NM2A 3MGVA 3LWMA 4TQSA 5DB6A 4OJLA 4M9LA 1V97A 2Y0SC 5T14A 2K8BB 3B9JA 7ICNA 3RJEA 4NLGA 4DF4A 3ONNA 1FFVA 3GQCA 2ZTEA 4O3NA 1Z1BA 3QE9Y 4F72A 9ICOA 4ELTA 2F1HA 2A3VA 3QU5A 1ZQNA 5ALXA 2C2EA 2H5XA 5KTQA 5IIOA 3GIIA 1NOMA 2RDIA 2PMZC 8ICFA 2F3NA 2DL0A 1ZQUA 2O6KA 5B5EU 4Q44A 1YT3A 1ZYQA 5J2KA 4KTQA 1KQQA 2KVSA 5KFJA 1UHUA 5AKZA 5ALYA 3TFSA 1U4BA 5L1LA 4DSEA 4YQWA 5KL8B 4IR9A 8ICKA 1D9FA 3PZPA 5KT4A 2FMQA 1BPZA 4YMMA 2OWOA 4RU9A 2ZUCA 5FP0A 5AI4A 4P0QA 5AHXA 4DSIA 4QZCA 5ALFA 4DCCA 3T79A 1A0PA 2MAXA 4MHVA 9ICBA 2F8LA 3IG5A 1B0XA 3PSPA 2HDOA 2AXTU 4KMOB 4C8OA 4BXOB 2HOIA 4QIWC 4FZNA 5AM0A 3AL0B 3SR6A 2P6RA 4IC9A 3MR2A 3QZ8A 5C0YA 3PY8A 4QNLA 2JEGA 2R8JA 2HHWA 1ZQLA 4AYBF 3M8SA 4C8KA 1YZ7A 1HEKA 2W8KA 1IV8A 3J81j 4QW9A 5IILA 2FPMA 4C7YA 5EE0A 4KLHA 5KG4A 4PGQA 1QCKA 4C8LA 4QZHA 5JU5A 4RPXA 2WAQF 4DSFA 4UQGA 1F5SA 2W04A 3LVVA 3C21A 1SIJA 2FPLA 4UB5A 5DG9A 4R63A 5DB8A 4FZLA 2PFPA 2BR0A 4RQ7A 4M9NA 2E8PA 1L3TA 2KD1A 3EW9A 3NS1A 4ICAA 5AKJA 1S0OA 3IN5A 8ICJA 4KN7A 4LZDA 3ETRA 5KG0A 5F3XB 2OCEA 2W7OA 4O3RA 3EPIA 3KTQA 5AK6A 2HHTA 3GDXA 2BCQA 1BPDA 2KKVA 2W8LA 3D2NA 1ZQQA 1U45A 5J0OA 2AJQA 1HJPA 3SD7A 4J03A 4BWJA 2ISOA 3OJUA 2ZJAA 3WK8A 1SV0A 5EE1A 4I27A 2NRXA 4QZGA 3QU4A 8ICQA 1A6SA 3H8JA 1JRPA 9ICXA 3AQFA 5KFBA 5EE3A 2FLLA 1NJZA 1TKDA 4TQRA 4OJPA 4O3SA 5HR6A 1L8LA 4PL2A 1BNOA 3RJKA 3IV6A 5J0TA 1M6YA 2V4RA 7ICGA 2DF4B 5L1MA 4B9TA 3Q8PB 1L8OA 5KFXA 1KW4A 2FLPA 2G09A 2JZBB 4UB8U 4PHAA 4TUPA 5JRTA 3JPOA 3KKAA 1NJWA 4ED6A 3I28A 3UQ0A 3O0FA 4ED8A 5J2DA 3TAPA 5HNKA 4Z6CA 5G5HA 4YVZA 1X6JA 4JK1A 3RBEA 2J6TA 4Y2TA 3IG8A 5HP4A 1Z4OA 1D9DA 8ICCA 5J2EA 2RDJA 2VA2A 5KFWA 1WWUA 4DL2A 1WCNA 3SEIA 4P4PA 4WJ3B 1SB3C 3UMBA 1LVHA 4EBCA 4BJQA 1RQLA 2EZYA 3QUQA 4DQSA 5KFTA 4R8UA 1T3NA 3BZKA 4FS2A 1SWVA 4YP3A 4QWEA 3QEAZ 1FIQA 2ZIXA 1A77A 8ICGA 4QZAA 1X9XA 3C2MA 3SYZA 4DL7A 5KFLA 4BGDA 2DGZA 2H3FA 1WUDA 1CEZA 2JH1A 2K4HA 2BCUA 1ZQVA 2KSOB 1NK6A 5EOZA 2PFOA 1KL9A 2E1EA 1L3SA 4QZFA 4GXIA 3RAXA 4KLOA 1RM6C 4JV2A 4Y2PA 4EX6A 4RQ3A 2FI1A 4DSKA 5AI5A 2IOFA 3OGUA 3WK9A 2VANA 1XNSA 2KIVA 4PPXA 1COKA 3V7LA 4QZDA 2H3QA 3TADC 8ICMA 1S76D 1VJ5A 4BDPA 3WK7A 2FJ6A 2FMPA 3KKAC 2EAPA 2EZXA 2HBJA 1T3QA 1SZHA 4JV1A 1NK4A 1WWVA 3ICXA 3SV3A 1NJYA 3ZDEA 1HIWA 4Z6DA 4DL3A 4G3IA 1UT5A 3PV8A 2W11A 4PZOA 3F53A 4PH5A 2W03A 1IM4A 3F2DA 3OPXA 1U49A 4F4KA 2F1IA 3RH4A 4NLNA 3RJJA 1X66A 1T4GA 3Q8LA 4KLLA 4M2YA 1ZQGA 1S0NA 5ALNA 3HWTA 2BCSA 3RFAA 1XU4A 1RYSA 4ZOHC 4FE3A 2XGPA 4J9SA 3TARA 4F4XA 4P0PA 4P4OA 3RBDA 3IP4B 3GIMA 1PK3A 1RDFA 3SQIA 1X9MA 2JXJA 5ALVA 2M9NA 4F50A 2J6SA 3QXGA 2PXIA 4B6JA 3G6VA 3F5AA 1QQ6A 7ICPA 2G5IB 1SV4A 4OJ6A 4LVSA 4RUAA 1ZXIA 4O3MA 1MSWD 2FLNA 3M8RA 4RQ4A 2ALZA 4IL6U 5ALEA 1DXSA 4J9OA 2HOFA 4M9GA 5ALGA 4BUGA 3D2QA 3U26A 5G5GA 3MABA 4DO9A 5KFPA 1Z00B 5HR7A 4TUQA 1B43A 5AM5A 5D4BA 3HKZC 4UB6U 4QWDA 1ECWA 4DFKA 5DB7A 3D6JA 4YR2A 1BGXT 2LYBA 2EQYA 2QB0B 4UAUA 1HUOA 4ELUA 2XVTA 1MQ3A 2BCRA 4PHPA 3MR6A 2R8IA 5DDYA 3LVWA 4EYHB 5DLFA 4NLKA 3PSTA 4F71A 4GC7A 2HVIA 1QQ5A 2XCAA 9ICEA 5EWGA 4DEZA 1FEZA 1S8OA 1ZD5A 4NM1A 4DSLA 4RQ2A 1WG8A 9ICTA 3FM9A 3HP6A 1L7NA 3GV7B 4ED1A 3K1ZA 2IA6A 2DKZA 2E8OA 3HPOA 3PMNA 4DS4A 7ICLA 3PW7A 1UA0A 2XY5A 4YG2A 2R8GA 3BS5A 2I1QA 1NK7A 4F5RA 3MDCA 2KICA 4JWNA 2ZUBA 4F8RA 2ZUDA 5KFZA 9ICGA 4Y2RA 3A0HU 4Q43A 4J9KA 4FS1A 3IM1A 4QZ9A 5AKEA 3I1YA 4KX3A 4KLTA 2VJ4A 3K75D 2W9AA 1DK2A 5KT7A 2WF5A 2XICA 4UASA 4MFAA 2IMWP 3RB4A 4IQTA 7ICOA 5CRXA 1NK8A 1Q8KA 2RQ5A 1C20A 3SZ2A 2RHFA 3TAQA 4Y2VA 1BPYA 1AQ6A 5AM3A 2EZZA 5ALDA 2OXOA 4O3OA 9ICCA 3RH6A 4CCHA 4US8A 2BCVA 1UQVA 1JN3A 1MN8A 1S10A 3H7IA 4MEXA 2B6GA 5KAFU 3L3FX 3RR8A 3EYZA 3TACB 2E5SA 5BPCA 3C2LA 5A0LA 2JMGA 1ZRNA 3ISDA 3MR3A 4DFPA 1NI3A 4AP9A 2MSNA 4FZMA 4RT3A 1PVPA 4QZIA 3EPGA 3OTQA 2KJ8A 1XO0A 4B9MA 5CR0A 5F9NA 4DOBA 4M6WB 3OJSA 1N61A 7ICMA 2BQUA 2KHQA 1ZETA 4NV0A 2KKPA 1ZQYA 1B4FA 5J0PA 1XWLA 5AICA 5AIAA 4O5EA 3BDPA 3QU7A 4K4IA 5DDMA 1L7MA 4IS7A 2QARA 1DGJA 4F91B 4I2JA 4RQMA 9ICSA 3RJGA 3RTVA 1ZQZA 3TANA 4YR0A 1HUZA 1GO3F 5KL1B 1T7PA 4BXOA 2WF6A 2JEFA 3CNHA 2W3RA 3AM9A 2YMMA 2DFLA 3MGHA 5AI0A 3LYSA 2AHOB 3C23A 2F8KA 3AQEA 2OH2A 4IQVA 3Q8RB 1SL1A 2HMXA 3CW2C 1QH9A 3C28A 1PK1B 3F2CA 3TKAA 4ED3A 2D8CA 1PUZA 2P35A 4PL1A 1SWWA 9ICQA 8ICTA 4F4ZA 4US9A 3E2EA 4DFJA 2LYAA 1TAUA 3HT3A 3RAQA 3Q8MA 3BQ2A 4UB4A 2FDRA 5GTHU 3T3FA 3RB3A 2YX8A 1V85A 2V4QA 1ZD2P 2LM1A 2NRVA 5J2FA 1TAQA 3V6HA 3N97B 3RB0A 2OEHA 5KAIU 4B9VA 3FC4A 4I2IA 1J97A 2H3ZA 1ZQRA 2HHSA 4IRDA 2PFQA 3N7SC 1Q46A 1ZOLA 1S5LU 2F76X 3G6XA 4EZ9A 2HBKA 2KIWA 4F5OA 2YMPA 3S6JA 1SKSA 2K60A 3R9KA 5EE9A 5GTIU 5AI6A 1JALA 7ICKA 8ICNA 4BX9C 8ICSA 8ICRA 2W7PA 1PVRA 3RH5A 4YXMA 3JPNA 4O5CA 3QU9A 1NK5A 5C5JA 2HVHA 1K5OA 3T5LA 7ICIA 2C28A 1NNLA 4I2FA 4IR1A 2KP7A 3UQ2A 5KFIA 3UM9A 2EDUA 5AI9A 1Y88A 3M6ZA 5KFRA 1CRXA 2FPKA 3ED5A 2WB1F 5ALKA 2ASDA 1ZD4A 4KX5A 5J0UA 3UXNA 3HJEA 2KNJA 4B9LA 4P0QB 2WTFA 3KZXA 4F5NA 3KHLA 3QZ7A 4NXZA 4F4YA 5BOLA 4G9BA 2Q0ZX 1D8LA 2XCPA 7ICFA 4RNNA 2GH1A 4IRCA 2R8HA 2R8KA 3OHAA 4NL9A 1RYRA 4Y2YA 2BQRA 5DG7A 4IQWA 2BHNA 2JZBA 9ICPA 3OSPA 3ORYA 2N1RA 2JEJA 3Q8QB 5KFOA 2F77X 2K8AA 4GXJA 2OM6A 2ZIUB 3C1YA 3JPQA 8ICVA 1CUKA 1N60A 2GWSA 4ECSA 5AKKA 4C7ZA 2DQNB 1ZQFA 4M0AA 1U9LA 2CN1A 1KFSA 3L4PA 4C0ZA 4JWMA 2ESEA 2VA3A 4F93B 4I2HA 2P66A 2ATLA 1JXLA 2IBKA 2E1FA 2HHVA 1Q3UA 1LKYA 1XSLA 3C2KA 1KDHA 2HBMA 3IRUA 3BQ1A 3BQ7A 4KLDA 3E58A 3LDAA 4C8MA 2ZG6A 2Y1JA 2JR5A 1XO1A 4NJ8A 4RPYA 3QUCA 5D49A 4DFDA 1ZQAA 3BQ0A 2JV3A 1D8YA 2NYVA 4UB2A 3WKBA 2BDPA 2KJ5A 1O08A 4HYKA 1NKCA 1SZPA 3AMZA 4CRXA 5J0SA 1U47A 2KSOA 1BVSA 3QU2A 1RPLA 2W9BA 3AUOA 2YB4A 4ECUA 4GC6A 4P2HA 2LYHA 4AYBC 2KJ9A 4K4HA 3RJHA 4YD2A 2UVWA 4NL9C 4PHEA 2NRTA 1BPBA 5AI8A 2IHMA 5JUMA 4XUSA 5IIMA 4KLJA 1BPEA 2WAQC 3C5FA 1AROP 1URJA 1A76A 1YZ6A 1TVAA 5KG2A 4ECVA 3NTUA 2J6UA 2H3VA 5AKLA 4UAZA 3SENA 4KLQA 4YCXA 4DLGA 1SV0C 2XIDA 1JROA 2E8MA 5ALLA 1RZTA 3H40A 4ED2A 2K4EA 5J29A 5KG1A 2YTUA 2F44A 2QKQA 3V6JA 2ISPA 3WKCA 2DWQA 5J8YA 2AH5A 3H8WA 1VDVA 4RUCA 1DRGA 1X2IA 2XO7A 2VA8A 3TFRA 1BNPA 3HKZF 2KTQA 1JUDA 4ECQA 5IINA 4RNOA 5DBBA 1ZQSA 8ICUA 3GV5B 5ALQA 9ICAA 4Z6EA 4QZBA 1N2XA 2GOLA 1Z3EB 3RF9A 4U7CA 3NASA 2EH9A 4I2BA 8ICLA 2ZIWA 5DKWA 5CHGA 1TK0A 4KLEA 1L3UA 2KHVA 5ALSA 5DB9A 2AGOA 5KG3A 5J0QA 4BWMA 5J2AA 1XC9A 9ICVA 4EEYA 2KZZA 5CWRA 4EBDA 4DF8A 1ZJNA 2ZIVB 4YN4A 2FMSA 4R8UB 4C4TA 2BQ3A 2YMQA 4QW8A 5KG6A 2ZIXB 2W9CA 4K4GA 5KG7A 2W55A 3OSNA 2V9WA 1QLNA 4JUZA 1UPHA 8ICHA 4NWIA 5IIJA 3M6KA 1Z00A 1QTMA 4RQ0A 2XY7A 3T5JA 3LWLA 2MA1A 1QSSA 2XC9A 8ICBA 2A1AA 5AK3A 2OHFA 5AM1A 3T5KA 3GFKB 2NV3A 1KFTA 3RJFA 1S0MA 3PO4A 2BZFA 1LB2B 4U6PA 1KFDA 2I5HA 5KG5A 4IRKA 4IQUA 2LMRA 5KFKA 4Q8EA 1ZQPA 9ICLA 2WF8A 5CJ7A 2KK0A 4JMUA 9ICWA 2I9GA 4Y2JA 4NY8A 2KEYA 4I2GA 1QSLA 4ELVA 3H4BA 4DL5A 4OJOA 1N48A 3GIKA 1F0MA 8ICIA 2WHEA 5B66U 3PW0A 2KZ3A 3C29A 3N28A 3FDSA 5HMMA 2D6FC 4LZGA 5DG8A 2ODGA 1P7DA 4KLMA 4OJ5A 5ALHA 3K4GA 1ZJMA 3F2BA 3KHGA 2ES6A 5ALTA 2GO7A 9ICUA 1PVQA 3AN1A 2LM4A 1UCVA 2LBOA 4CF5A 2YMLA 5J2GA 4DOAA 4Y2XA 4YXJA 3QEBZ 5D46A 1D8BA 2Y9TA 4TURA 1OW5A 3DV9A 2HCFA 3BS7A 2R18A 8ICPA 2B21A 3WKAA 5EWEA 1RG6A 2L5YA 1L3VA 3RB6A 1V9PA 2Y0SF 4P0PB 4Q45A 2C2RA 7ICSA 3KFUF 5AKGA 4TUSA 2CXYA 3C5GA 2G5HB 3GU3A 3ETLA 1DOQA 3DEEA 4DQQA 2IOFK 1KLNA 2CPRA 2BPFA 5HHIA 4FBTA 2HHUA 2K4PA 4DS5A 5TISU 8ICOA 5L1KA 4QWBA 3ZDCA 1TE2A 2PMZF 5KFFA 5KFMA 5J0RA 4RNMA 5J0WA 4I2AA 3QUBA 4RQ1A 3N4MB 1IG6A 3LK9A 4EYIB 2A1JA 1ZQJA 4UB3A 4XA5A 3CP8A 1X42A 2G06A 3PR4A 4J9NA 3PX4A 4EENA 7ICJA 4Y2UA 4OO1J 4J9QA 5ALRA 3MR5A 1KKXA 3V7KA 7ICUA 2H3IA 5ALUA 3G6YA 1DGSA 1T8EA 4I2DA 5DQHA 4FBUA 4O9MA 4R64A 3RRHA 5KFAA 4QIWF 4QWAA 5ALOA 1UT8A 4O3QA 3V6KA 7ICEA 3ZDBA 2DKXA 2C22A 4UBCA 1OXJA 2IHNA 5IIIA 4C4SA 4FO6A 3PNCA 1SL2A 2OYYA 8ICAA 3HW8A 2Z7JA 5L1IA 3BS5B 2IOHA 2BKEA 1TK5A 3V7JA 2I6XA 3M9MB 1SXDA 2MUTB 3UXOA 2ZJ8A 3NVZA 2KFNA 3FYHA 1CI4A 2KV2A 2DPIA 4FFDA 3GV8B 1ZQWA 4DL4A 1ZQTA 1PZNA 3MFHA 3MBYA 5ALPA 2LHTA 3KD3A 5KFUA 2VJ5A 1JXEA 1RXWA 3NVWA 5DQIA 4Z6FA 4NLZA 8ICXA 5KFYA 9ICJA 3M1YA 4KITB 2ASJA 3VCBA 2UVRA 2KN7A 1KEJA 1O03A 5J2HA 4GIBA 1S9FA 2LKYA 3ZI4A 2JGAA 5KNIA 4JV0A 3BZCA 2BPCA 1WYGA 4F2SA 1FO4A 1TAMA 2KE7A 4EZ6A 4F92B 4PGXA 3ZD8A 2AU0A 3I76A 2EAMA 4CNQA 5AKHA 4I2CA 1TFRA 2KZMA 4EX7A 2PFNA 3PSIA 1BPXA 4KLSA 1N62A 2GLEA 3MGIA 5KT5A 3KBBA 3N7PD 5J2IA 9ICRA 2QB1A 4DQRA 4KLIA 3PR5B 2NRWA 7ICRA 3EWAA 2ZJ5A 5KFVA 2Y1IA 1ZQMA 3GIJA 1XSPA 4DLEA 4I28A 3N7RC 2QARB 1ZQBA 5JTIA 9ICKA 1TV9A 2BGWA 4NLBA 5F9LA 5J0XA 3EZ5A 3H4DA 2XGQA 4E0DA 4ECWA 3PW2A 1TK8A 1L7OA 4RPZA 1KN5A 2ZIUA 4RQNA 4B9SA 1SXEA 5DGBA 9ICMA 4NLCA 1KBUA 3PMLA 3AU6A 3H0LB 2YB1A 1V38A 4MF8A 3IDWA 1NZPA 1RQNA
chains in the Genus database with same CATH topology
2A1JB 4M47A 1ZQKA 4F2RA 9ICNA 2HHQA 2KFZA 1RZTA 3MABA 4DO9A 5KFPA 3H40A 1SKWA 1B22A 1Z00B 3MFIA 5TZVA 4ED2A 4NM2A 4TUQA 3BJYA 3LWMA 1B43A 5J29A 4KN4A 5KG1A 4TQSA 4QZ8A 4QWDA 5D4BA 5DB6A 3V6JA 5DB7A 4DFKA 2ISPA 4M9LA 4YR2A 1BGXT 5J2JA 1C7YA 3H8WA 1HUOA 5J2CA 4RUCA 1ZQHA 4ELUA 5KFHA 4YD1A 5BOMA 1MQ3A 4DF4A 2BCRA 4PHPA 3MR6A 1X2IA 2R8IA 5DDYA 2XO7A 2VA8A 4RQ8A 4J9PA 1ZQOA 4EYHB 3TFRA 3GQCA 5DLFA 4NLKA 2ZTEA 4O3NA 2AQ0A 4ECQA 4GC7A 3T5HA 5IINA 3QE9Y 2KTQA 1NKEA 2HVIA 1K1SA 4RNOA 2XCAA 5DBBA 2W9MA 5EWGA 4DEZA 1ZQSA 4ELTA 2F1HA 9ICEA 8ICUA 4NM1A 4B9UA 4DSLA 3GV5B 9ICAA 4RQ2A 4Z6EA 4DL6A 4R65A 4QZBA 1ZQNA 9ICTA 2C2EA 3HP6A 5KT6A 1Z3EB 1CEZA 3GV7B 2P6UA 4ED1A 2H5XA 2IA6A 5KTQA 3IHQB 5IIOA 3HPOA 3GIIA 1NOMA 2RDIA 3PMNA 3JPSA 4DS4A 4I2BA 7ICLA 3PW7A 1UA0A 8ICFA 2XY5A 8ICLA 4YG2A 5DKWA 5CHGA 1TK0A 2R8GA 4KLEA 7ICFA 1L3UA 1U48A 3B0XA 4Q8FA 5DB9A 2AGOA 1ZQUA 5KG3A 5J0QA 3MDAA 4BWMA 4Q44A 5J2AA 1XC9A 4F5QA 2I1QA 3JPPA 4EEYA 1ZYQA 5J2KA 1NK7A 4KTQA 5CWRA 4EBDA 2KZZA 4F5RA 3MDCA 4DF8A 1ZJNA 4YN4A 5KFJA 2FMSA 4R8UB 9ICFA 2BQ3A 4O0IA 3TFSA 1U4BA 5L1LA 4DSEA 4YQWA 4JWNA 4QW8A 4IR9A 2ZUBA 5KG6A 2ZUDA 3KHRA 4F8RA 5KFZA 2W9CA 8ICKA 1D9FA 4K4GA 5KG7A 3OSNA 5KT4A 2FMQA 1BPZA 9ICGA 4YMMA 2AQ4A 2V9WA 2BPGA 4RQ5A 2OWOA 1QLNA 4RU9A 4JUZA 2ZUCA 8ICHA 4Q43A 1S0VA 4J9KA 3THVA 5IIJA 4FS1A 3IM1A 1Z00A 5KFNA 4RQ0A 1JIHA 4UAWA 1QTMA 2XY7A 4QZ9A 4DSIA 3T5JA 4QZCA 3LWLA 4KLTA 3K75D 2W9AA 1SL0A 2MAXA 5KT7A 1QSSA 9ICBA 2XC9A 4J9RA 1S77D 3ISCA 4MFAA 2IMWP 4ECRA 8ICBA 3T5KA 5DBCA 3RB4A 3JPRA 3GFKB 4ECZA 1KFTA 3RJFA 4C8OA 4IQTA 1UA1A 1S0MA 3PO4A 4BXOB 7ICOA 1LB2B 4YR3A 1NK8A 2P6RA 1KFDA 5KG5A 4IRKA 4MFFA 4IQUA 3MR2A 3QZ8A 4YMOA 3SZ2A 5KFKA 4Q8EA 3PY8A 4ZH4A 4RT2A 1ZQPA 2JEGA 9ICLA 2ZTCA 5CJ7A 2R8JA 3NGDA 3TAQA 2HHWA 1BPYA 1ZQLA 3M8SA 4C8KA 2W8KA 9ICWA 4QW9A 4O3OA 4MFCA 5KT3A 3RH6A 5CA7A 2I9GA 5IILA 2FPMA 4CCHA 4M9JA 4DQIA 4NY8A 5KG4A 1QSLA 4ELVA 2BCVA 4I2GA 4XQ8A 4KLHA 1JN3A 4PGQA 3H4BA 1S10A 3H7IA 5CB1A 4DL5A 4MEXA 4YFKA 4C8LA 4QZHA 1N48A 4NLGA 4RPXA 4RZRA 3GIKA 5L1JA 3RR8A 8ICIA 3EYZA 3PW0A 5BPCA 3C2LA 1XS9D 2KZ3A 4DSFA 3ZDDA 3TI0A 3FDSA 5HMMA 4LZGA 3ISDA 4C8NA 5DG8A 3MR3A 4UQGA 4KLMA 1NKBA 4DFPA 3Q8KA 3C21A 3K4GA 1ZJMA 4ED0A 4RT3A 3KHGA 2FPLA 4QZIA 5DG9A 4UB5A 3EPGA 4R63A 5DB8A 9ICUA 4B9MA 5CR0A 7ICHA 2PFPA 5F9NA 4DOBA 4DOAA 5J2GA 2BR0A 4M6WB 4RQ7A 3OJSA 1L3TA 4M9NA 3UPQA 4YXJA 5DLGA 3EW9A 3ZDAA 3QEBZ 3PO5A 3PVXA 2BQUA 5D46A 7ICMA 4QWCA 1ZETA 4TURA 9ICIA 3RRGA 2UVUA 1ZQYA 1S0OA 5J0PA 1KSPA 8ICJA 1XWLA 4KN7A 8ICPA 4LZDA 2B21A 5EWEA 5KG0A 1ZQCA 4O5EA 1MC8A 3BDPA 7ICTA 2W9BB 1L3VA 1IXRA 3RB6A 1V9PA 5DDMA 4ED7A 4K4IA 4YMNA 4F91B 4Q45A 3EPIA 4I2JA 2C2RA 3KTQA 4O3RA 2HHTA 9ICSA 7ICSA 3GDXA 3RJGA 3RTVA 8ICWA 2BCQA 1ZQZA 2ASLA 3TANA 4M9HA 1BPDA 4YR0A 4I2EA 2W8LA 4M04A 4O5KA 1HUZA 5KFEA 3SV4A 1ZQQA 4R66A 4GLXA 1U45A 4TUSA 3M9OB 1T7PA 4BXOA 4I29A 5J0OA 3Q8SB 2UVVA 4KLGA 2AJQA 3C5GA 2JEFA 1HJPA 3ETLA 4BWJA 1DOQA 4P4MA 2DFLA 3ZD9A 3MGHA 3OJUA 4DQQA 1H38A 2ISOA 1KLNA 2BPFA 2ZJAA 5HHIA 3C23A 4FBTA 2HHUA 4DS5A 4I27A 2NRXA 5L1KA 4QWBA 4IQVA 4QZGA 3Q8RB 3H8JA 1SL1A 3ZDCA 8ICQA 9ICXA 5KFFA 5KFMA 5KFBA 2FLLA 2XY6A 1NJZA 1N56A 5J0YA 5J0RA 4RNMA 4ED3A 1TKDA 5J0WA 4I2AA 4TQRA 5KFCA 4RQ1A 3N4MB 9ICQA 4O3SA 8ICTA 4F4ZA 3LK9A 4EYIB 3E2EA 4DFJA 2A1JA 1ZQJA 4UB3A 1TAUA 3HT3A 3RAQA 4XA5A 3RJKA 3Q8MA 1MQ2A 4UB4A 5J0TA 2V4RA 3BQ2A 3T3FA 3PR4A 7ICGA 4J9NA 3RB3A 4MEYA 3PX4A 4B9TA 2V4QA 7ICJA 3Q8PB 2NRVA 5J2FA 3JPTA 4F5PA 4J9QA 4GXKA 2F1JA 5KFXA 1COOA 1TAQA 3V6HA 3MR5A 2FLPA 3N97B 3RB0A 2JZBB 3V7KA 7ICUA 7ICNA 1RXVA 5EWFA 3G6YA 4B9VA 1DGSA 1T8EA 4I2IA 4PHAA 4TUPA 3JPOA 1ZQRA 2HHSA 1NJWA 4ED6A 4IRDA 3UQ0A 4EBEA 4UAYA 2PFQA 8ICZA 3BQTA 4ED8A 5J2DA 1JMSA 3G6XA 4EZ9A 4I2DA 5DQHA 3TAPA 4FBUA 4F4WA 4F5OA 4O9MA 5HNKA 4Z6CA 1ZQDA 4R64A 3RRHA 1SKSA 1NK9A 1EXNA 2NRZA 4YVZA 5KFAA 3RBEA 4JK1A 4QWAA 3RJIA 1UT8A 2J6TA 4O3QA 3V6KA 7ICEA 3ZDBA 5HP4A 3RR7A 2C22A 4UBCA 2IHNA 5IIIA 1D9DA 4FO6A 3PNCA 1SL2A 7ICKA 8ICNA 8ICCA 8ICRA 8ICSA 4ECTA 3RH5A 4YXMA 8ICAA 5J2EA 3JPNA 3C1ZA 2RDJA 5KFWA 4X5VA 2VA2A 4O5CA 4DL2A 2HW3A 1NK5A 1WCNA 2PI4A 3HW8A 3PX6A 5L1IA 2BKEA 5C5JA 1TK5A 2HVHA 3V7JA 3T5LA 4P4PA 7ICIA 3M9MB 2C28A 2MUTB 4I2FA 4IR1A 4EBCA 3UXOA 2ZJ8A 5KFIA 3UQ2A 1KRPA 2HHXA 1Y88A 4XRHA 3PW4A 5KFRA 4DQSA 2KFNA 3FYHA 5KFTA 4R8UA 2W9CB 1T3NA 8ICYA 4FS2A 2DPIA 2FPKA 4YP3A 4QWEA 3PX0A 3QEAZ 8ICGA 1A77A 4DWIA 2ASDA 4QZAA 3GV8B 1ZQWA 4DL4A 3C2MA 3PW5A 1NJXA 3SYZA 1ZQTA 3H8SA 4DL7A 1PZNA 1JX4A 1NK0A 3MFHA 5KFLA 5J0UA 3UXNA 3MBYA 4BGDA 4B9LA 2WTFA 4J9MA 3KHLA 4F5NA 5KFUA 5HMLA 3QZ7A 4NXZA 4F4YA 1ZQIA 1ZQEA 1JXEA 1RXWA 5BOLA 2Q0ZX 1D8LA 2XCPA 2BCUA 5DQIA 4RNNA 2DPJA 4Z6FA 3GILA 1ZQVA 4NLZA 1NK6A 8ICXA 5EOZA 4IRCA 2PFOA 5KFYA 1L3SA 4QZFA 2R8HA 4GXIA 4UB1A 2R8KA 8ICOA 9ICVA 3OHAA 3RAXA 4KLOA 2AGPA 1RYRA 9ICJA 4KITB 2ASJA 2UVRA 2BQRA 2KN7A 1KEJA 5DG7A 4JV2A 5J2HA 4DOCA 4IQWA 1S9FA 4RQ3A 5KFQA 2JEIA 2BHNA 2JZBA 4DSKA 9ICPA 3OSPA 3ORYA 1S97A 4JV0A 2JEJA 9ICCA 3Q8QB 2BPCA 5KFOA 3AU2A 3OGUA 1SKRA 4GXJA 4F2SA 5L9XA 2VANA 3C1YA 4PPXA 4EZ6A 4F92B 2PI5A 3V7LA 4QZDA 4PGXA 8ICMA 3UXPA 3ZD8A 2AU0A 4BDPA 1S76D 3JPQA 4F3OA 1CUKA 8ICVA 1K1QA 2GWSA 2FMPA 4ECSA 1QSYA 4RQ6A 4PHDA 1ZQFA 2C2DA 4DQPA 3SI8A 3ISBA 4I2CA 4M0AA 1TFRA 4JV1A 1U9LA 1NK4A 2KZMA 4UBBA 3SV3A 5HHHA 3ZDEA 1NJYA 1KFSA 9ICOA 4Z6DA 4DL3A 4JWMA 1XSNA 2PFNA 5DBAA 4KMUA 1BPXA 4G3IA 1UT5A 4KLSA 2VA3A 5KFGA 1L5UA 7ICQA 4F93B 4I2HA 3PV8A 3HX0A 3MGIA 2ATLA 2P66A 4PH5A 5KT5A 1JXLA 7ICVA 2IBKA 1IM4A 4KLUA 2HHVA 5KT2A 2AGQA 1XSLA 2MUTA 3C2KA 1U49A 2F1IA 1KDHA 4F4KA 9ICHA 3RH4A 3BQ1A 4KLDA 3LDAA 4C8MA 5J2IA 3RJJA 4NLNA 2Y1JA 8ICEA 9ICRA 1T4GA 1XO1A 3Q8LA 4KLLA 4M2YA 4DQRA 5KFDA 4RPYA 4KLIA 3PR5B 2NRWA 1ZQGA 4M6WA 7ICRA 5D49A 3TQ1A 1S0NA 3EWAA 3HWTA 1ZQAA 2BCSA 3BQ0A 1D8YA 2ZJ5A 5KFVA 4UB2A 2BDPA 5DQGA 2Y1IA 1X9WA 1ZQMA 3GIJA 4HYKA 1XSPA 1XU4A 1RYSA 5IIKA 1NKCA 1WCLA 1SZPA 1X9SA 2XGPA 4DLEA 5J0SA 4J9SA 4I28A 1U47A 3TARA 1BVSA 4DFMA 5J2BA 3KHHA 1RPLA 1ZQBA 2W9BA 3AUOA 4ECUA 9ICKA 4GC6A 4F4XA 4P2HA 2LYHA 4P4OA 1TV9A 2BGWA 3RBDA 5J0XA 1KTQA 1ZQXA 5F9LA 3EZ5A 3GIMA 3H4DA 1X9MA 2XGQA 4K4HA 4MF2A 2M9NA 4F50A 1LV5A 2J6SA 4ECXA 3RJHA 4E0DA 4YD2A 2UVWA 4O3PA 3B0YA 3RJEA 2PXIA 4ECWA 3PW2A 1TK8A 4PHEA 2NRTA 3G6VA 4B9NA 1BPBA 2IHMA 4RPZA 5JUMA 4XUSA 5IIMA 4KLJA 1BPEA 7ICPA 3C5FA 1AROP 4B9SA 5DGBA 4DSJA 4ECYA 4LVSA 4RUAA 1A76A 3M9NB 2ZTDA 9ICMA 1MSWD 5CP2A 4J9LA 4KLFA 4QZEA 1TVAA 3PMLA 2FLNA 3M8RA 5KG2A 4ECVA 3AU6A 5KFSA 3NTUA 2J6UA 4RQ4A 4UAZA 4MF8A 2ALZA 3V72A 4PGYA 4J9OA 4KLQA 4YCXA 4DLGA 3OHBA 4M9GA 5DGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1J B;  4M47 A;  1ZQK A;  4F2R A;  9ICN A;  2HHQ A;  2KFZ A;  1RZT A;  3MAB A;  4DO9 A;  5KFP A;  3H40 A;  1SKW A;  1B22 A;  1Z00 B;  3MFI A;  5TZV A;  4ED2 A;  4NM2 A;  4TUQ A;  3BJY A;  3LWM A;  1B43 A;  5J29 A;  4KN4 A;  5KG1 A;  4TQS A;  4QZ8 A;  4QWD A;  5D4B A;  5DB6 A;  3V6J A;  5DB7 A;  4DFK A;  2ISP A;  4M9L A;  4YR2 A;  1BGX T;  5J2J A;  1C7Y A;  3H8W A;  1HUO A;  5J2C A;  4RUC A;  1ZQH A;  4ELU A;  5KFH A;  4YD1 A;  5BOM A;  1MQ3 A;  4DF4 A;  2BCR A;  4PHP A;  3MR6 A;  1X2I A;  2R8I A;  5DDY A;  2XO7 A;  2VA8 A;  4RQ8 A;  4J9P A;  1ZQO A;  4EYH B;  3TFR A;  3GQC A;  5DLF A;  4NLK A;  2ZTE A;  4O3N A;  2AQ0 A;  4ECQ A;  4GC7 A;  3T5H A;  5IIN A;  3QE9 Y;  2KTQ A;  1NKE A;  2HVI A;  1K1S A;  4RNO A;  2XCA A;  5DBB A;  2W9M A;  5EWG A;  4DEZ A;  1ZQS A;  4ELT A;  2F1H A;  9ICE A;  8ICU A;  4NM1 A;  4B9U A;  4DSL A;  3GV5 B;  9ICA A;  4RQ2 A;  4Z6E A;  4DL6 A;  4R65 A;  4QZB A;  1ZQN A;  9ICT A;  2C2E A;  3HP6 A;  5KT6 A;  1Z3E B;  1CEZ A;  3GV7 B;  2P6U A;  4ED1 A;  2H5X A;  2IA6 A;  5KTQ A;  3IHQ B;  5IIO A;  3HPO A;  3GII A;  1NOM A;  2RDI A;  3PMN A;  3JPS A;  4DS4 A;  4I2B A;  7ICL A;  3PW7 A;  1UA0 A;  8ICF A;  2XY5 A;  8ICL A;  4YG2 A;  5DKW A;  5CHG A;  1TK0 A;  2R8G A;  4KLE A;  7ICF A;  1L3U A;  1U48 A;  3B0X A;  4Q8F A;  5DB9 A;  2AGO A;  1ZQU A;  5KG3 A;  5J0Q A;  3MDA A;  4BWM A;  4Q44 A;  5J2A A;  1XC9 A;  4F5Q A;  2I1Q A;  3JPP A;  4EEY A;  1ZYQ A;  5J2K A;  1NK7 A;  4KTQ A;  5CWR A;  4EBD A;  2KZZ A;  4F5R A;  3MDC A;  4DF8 A;  1ZJN A;  4YN4 A;  5KFJ A;  2FMS A;  4R8U B;  9ICF A;  2BQ3 A;  4O0I A;  3TFS A;  1U4B A;  5L1L A;  4DSE A;  4YQW A;  4JWN A;  4QW8 A;  4IR9 A;  2ZUB A;  5KG6 A;  2ZUD A;  3KHR A;  4F8R A;  5KFZ A;  2W9C A;  8ICK A;  1D9F A;  4K4G A;  5KG7 A;  3OSN A;  5KT4 A;  2FMQ A;  1BPZ A;  9ICG A;  4YMM A;  2AQ4 A;  2V9W A;  2BPG A;  4RQ5 A;  2OWO A;  1QLN A;  4RU9 A;  4JUZ A;  2ZUC A;  8ICH A;  4Q43 A;  1S0V A;  4J9K A;  3THV A;  5IIJ A;  4FS1 A;  3IM1 A;  1Z00 A;  5KFN A;  4RQ0 A;  1JIH A;  4UAW A;  1QTM A;  2XY7 A;  4QZ9 A;  4DSI A;  3T5J A;  4QZC A;  3LWL A;  4KLT A;  3K75 D;  2W9A A;  1SL0 A;  2MAX A;  5KT7 A;  1QSS A;  9ICB A;  2XC9 A;  4J9R A;  1S77 D;  3ISC A;  4MFA A;  2IMW P;  4ECR A;  8ICB A;  3T5K A;  5DBC A;  3RB4 A;  3JPR A;  3GFK B;  4ECZ A;  1KFT A;  3RJF A;  4C8O A;  4IQT A;  1UA1 A;  1S0M A;  3PO4 A;  4BXO B;  7ICO A;  1LB2 B;  4YR3 A;  1NK8 A;  2P6R A;  1KFD A;  5KG5 A;  4IRK A;  4MFF A;  4IQU A;  3MR2 A;  3QZ8 A;  4YMO A;  3SZ2 A;  5KFK A;  4Q8E A;  3PY8 A;  4ZH4 A;  4RT2 A;  1ZQP A;  2JEG A;  9ICL A;  2ZTC A;  5CJ7 A;  2R8J A;  3NGD A;  3TAQ A;  2HHW A;  1BPY A;  1ZQL A;  3M8S A;  4C8K A;  2W8K A;  9ICW A;  4QW9 A;  4O3O A;  4MFC A;  5KT3 A;  3RH6 A;  5CA7 A;  2I9G A;  5IIL A;  2FPM A;  4CCH A;  4M9J A;  4DQI A;  4NY8 A;  5KG4 A;  1QSL A;  4ELV A;  2BCV A;  4I2G A;  4XQ8 A;  4KLH A;  1JN3 A;  4PGQ A;  3H4B A;  1S10 A;  3H7I A;  5CB1 A;  4DL5 A;  4MEX A;  4YFK A;  4C8L A;  4QZH A;  1N48 A;  4NLG A;  4RPX A;  4RZR A;  3GIK A;  5L1J A;  3RR8 A;  8ICI A;  3EYZ A;  3PW0 A;  5BPC A;  3C2L A;  1XS9 D;  2KZ3 A;  4DSF A;  3ZDD A;  3TI0 A;  3FDS A;  5HMM A;  4LZG A;  3ISD A;  4C8N A;  5DG8 A;  3MR3 A;  4UQG A;  4KLM A;  1NKB A;  4DFP A;  3Q8K A;  3C21 A;  3K4G A;  1ZJM A;  4ED0 A;  4RT3 A;  3KHG A;  2FPL A;  4QZI A;  5DG9 A;  4UB5 A;  3EPG A;  4R63 A;  5DB8 A;  9ICU A;  4B9M A;  5CR0 A;  7ICH A;  2PFP A;  5F9N A;  4DOB A;  4DOA A;  5J2G A;  2BR0 A;  4M6W B;  4RQ7 A;  3OJS A;  1L3T A;  4M9N A;  3UPQ A;  4YXJ A;  5DLG A;  3EW9 A;  3ZDA A;  3QEB Z;  3PO5 A;  3PVX A;  2BQU A;  5D46 A;  7ICM A;  4QWC A;  1ZET A;  4TUR A;  9ICI A;  3RRG A;  2UVU A;  1ZQY A;  1S0O A;  5J0P A;  1KSP A;  8ICJ A;  1XWL A;  4KN7 A;  8ICP A;  4LZD A;  2B21 A;  5EWE A;  5KG0 A;  1ZQC A;  4O5E A;  1MC8 A;  3BDP A;  7ICT A;  2W9B B;  1L3V A;  1IXR A;  3RB6 A;  1V9P A;  5DDM A;  4ED7 A;  4K4I A;  4YMN A;  4F91 B;  4Q45 A;  3EPI A;  4I2J A;  2C2R A;  3KTQ A;  4O3R A;  2HHT A;  9ICS A;  7ICS A;  3GDX A;  3RJG A;  3RTV A;  8ICW A;  2BCQ A;  1ZQZ A;  2ASL A;  3TAN A;  4M9H A;  1BPD A;  4YR0 A;  4I2E A;  2W8L A;  4M04 A;  4O5K A;  1HUZ A;  5KFE A;  3SV4 A;  1ZQQ A;  4R66 A;  4GLX A;  1U45 A;  4TUS A;  3M9O B;  1T7P A;  4BXO A;  4I29 A;  5J0O A;  3Q8S B;  2UVV A;  4KLG A;  2AJQ A;  3C5G A;  2JEF A;  1HJP A;  3ETL A;  4BWJ A;  1DOQ A;  4P4M A;  2DFL A;  3ZD9 A;  3MGH A;  3OJU A;  4DQQ A;  1H38 A;  2ISO A;  1KLN A;  2BPF A;  2ZJA A;  5HHI A;  3C23 A;  4FBT A;  2HHU A;  4DS5 A;  4I27 A;  2NRX A;  5L1K A;  4QWB A;  4IQV A;  4QZG A;  3Q8R B;  3H8J A;  1SL1 A;  3ZDC A;  8ICQ A;  9ICX A;  5KFF A;  5KFM A;  5KFB A;  2FLL A;  2XY6 A;  1NJZ A;  1N56 A;  5J0Y A;  5J0R A;  4RNM A;  4ED3 A;  1TKD A;  5J0W A;  4I2A A;  4TQR A;  5KFC A;  4RQ1 A;  3N4M B;  9ICQ A;  4O3S A;  8ICT A;  4F4Z A;  3LK9 A;  4EYI B;  3E2E A;  4DFJ A;  2A1J A;  1ZQJ A;  4UB3 A;  1TAU A;  3HT3 A;  3RAQ A;  4XA5 A;  3RJK A;  3Q8M A;  1MQ2 A;  4UB4 A;  5J0T A;  2V4R A;  3BQ2 A;  3T3F A;  3PR4 A;  7ICG A;  4J9N A;  3RB3 A;  4MEY A;  3PX4 A;  4B9T A;  2V4Q A;  7ICJ A;  3Q8P B;  2NRV A;  5J2F A;  3JPT A;  4F5P A;  4J9Q A;  4GXK A;  2F1J A;  5KFX A;  1COO A;  1TAQ A;  3V6H A;  3MR5 A;  2FLP A;  3N97 B;  3RB0 A;  2JZB B;  3V7K A;  7ICU A;  7ICN A;  1RXV A;  5EWF A;  3G6Y A;  4B9V A;  1DGS A;  1T8E A;  4I2I A;  4PHA A;  4TUP A;  3JPO A;  1ZQR A;  2HHS A;  1NJW A;  4ED6 A;  4IRD A;  3UQ0 A;  4EBE A;  4UAY A;  2PFQ A;  8ICZ A;  3BQT A;  4ED8 A;  5J2D A;  1JMS A;  3G6X A;  4EZ9 A;  4I2D A;  5DQH A;  3TAP A;  4FBU A;  4F4W A;  4F5O A;  4O9M A;  5HNK A;  4Z6C A;  1ZQD A;  4R64 A;  3RRH A;  1SKS A;  1NK9 A;  1EXN A;  2NRZ A;  4YVZ A;  5KFA A;  3RBE A;  4JK1 A;  4QWA A;  3RJI A;  1UT8 A;  2J6T A;  4O3Q A;  3V6K A;  7ICE A;  3ZDB A;  5HP4 A;  3RR7 A;  2C22 A;  4UBC A;  2IHN A;  5III A;  1D9D A;  4FO6 A;  3PNC A;  1SL2 A;  7ICK A;  8ICN A;  8ICC A;  8ICR A;  8ICS A;  4ECT A;  3RH5 A;  4YXM A;  8ICA A;  5J2E A;  3JPN A;  3C1Z A;  2RDJ A;  5KFW A;  4X5V A;  2VA2 A;  4O5C A;  4DL2 A;  2HW3 A;  1NK5 A;  1WCN A;  2PI4 A;  3HW8 A;  3PX6 A;  5L1I A;  2BKE A;  5C5J A;  1TK5 A;  2HVH A;  3V7J A;  3T5L A;  4P4P A;  7ICI A;  3M9M B;  2C28 A;  2MUT B;  4I2F A;  4IR1 A;  4EBC A;  3UXO A;  2ZJ8 A;  5KFI A;  3UQ2 A;  1KRP A;  2HHX A;  1Y88 A;  4XRH A;  3PW4 A;  5KFR A;  4DQS A;  2KFN A;  3FYH A;  5KFT A;  4R8U A;  2W9C B;  1T3N A;  8ICY A;  4FS2 A;  2DPI A;  2FPK A;  4YP3 A;  4QWE A;  3PX0 A;  3QEA Z;  8ICG A;  1A77 A;  4DWI A;  2ASD A;  4QZA A;  3GV8 B;  1ZQW A;  4DL4 A;  3C2M A;  3PW5 A;  1NJX A;  3SYZ A;  1ZQT A;  3H8S A;  4DL7 A;  1PZN A;  1JX4 A;  1NK0 A;  3MFH A;  5KFL A;  5J0U A;  3UXN A;  3MBY A;  4BGD A;  4B9L A;  2WTF A;  4J9M A;  3KHL A;  4F5N A;  5KFU A;  5HML A;  3QZ7 A;  4NXZ A;  4F4Y A;  1ZQI A;  1ZQE A;  1JXE A;  1RXW A;  5BOL A;  2Q0Z X;  1D8L A;  2XCP A;  2BCU A;  5DQI A;  4RNN A;  2DPJ A;  4Z6F A;  3GIL A;  1ZQV A;  4NLZ A;  1NK6 A;  8ICX A;  5EOZ A;  4IRC A;  2PFO A;  5KFY A;  1L3S A;  4QZF A;  2R8H A;  4GXI A;  4UB1 A;  2R8K A;  8ICO A;  9ICV A;  3OHA A;  3RAX A;  4KLO A;  2AGP A;  1RYR A;  9ICJ A;  4KIT B;  2ASJ A;  2UVR A;  2BQR A;  2KN7 A;  1KEJ A;  5DG7 A;  4JV2 A;  5J2H A;  4DOC A;  4IQW A;  1S9F A;  4RQ3 A;  5KFQ A;  2JEI A;  2BHN A;  2JZB A;  4DSK A;  9ICP A;  3OSP A;  3ORY A;  1S97 A;  4JV0 A;  2JEJ A;  9ICC A;  3Q8Q B;  2BPC A;  5KFO A;  3AU2 A;  3OGU A;  1SKR A;  4GXJ A;  4F2S A;  5L9X A;  2VAN A;  3C1Y A;  4PPX A;  4EZ6 A;  4F92 B;  2PI5 A;  3V7L A;  4QZD A;  4PGX A;  8ICM A;  3UXP A;  3ZD8 A;  2AU0 A;  4BDP A;  1S76 D;  3JPQ A;  4F3O A;  1CUK A;  8ICV A;  1K1Q A;  2GWS A;  2FMP A;  4ECS A;  1QSY A;  4RQ6 A;  4PHD A;  1ZQF A;  2C2D A;  4DQP A;  3SI8 A;  3ISB A;  4I2C A;  4M0A A;  1TFR A;  4JV1 A;  1U9L A;  1NK4 A;  2KZM A;  4UBB A;  3SV3 A;  5HHH A;  3ZDE A;  1NJY A;  1KFS A;  9ICO A;  4Z6D A;  4DL3 A;  4JWM A;  1XSN A;  2PFN A;  5DBA A;  4KMU A;  1BPX A;  4G3I A;  1UT5 A;  4KLS A;  2VA3 A;  5KFG A;  1L5U A;  7ICQ A;  4F93 B;  4I2H A;  3PV8 A;  3HX0 A;  3MGI A;  2ATL A;  2P66 A;  4PH5 A;  5KT5 A;  1JXL A;  7ICV A;  2IBK A;  1IM4 A;  4KLU A;  2HHV A;  5KT2 A;  2AGQ A;  1XSL A;  2MUT A;  3C2K A;  1U49 A;  2F1I A;  1KDH A;  4F4K A;  9ICH A;  3RH4 A;  3BQ1 A;  4KLD A;  3LDA A;  4C8M A;  5J2I A;  3RJJ A;  4NLN A;  2Y1J A;  8ICE A;  9ICR A;  1T4G A;  1XO1 A;  3Q8L A;  4KLL A;  4M2Y A;  4DQR A;  5KFD A;  4RPY A;  4KLI A;  3PR5 B;  2NRW A;  1ZQG A;  4M6W A;  7ICR A;  5D49 A;  3TQ1 A;  1S0N A;  3EWA A;  3HWT A;  1ZQA A;  2BCS A;  3BQ0 A;  1D8Y A;  2ZJ5 A;  5KFV A;  4UB2 A;  2BDP A;  5DQG A;  2Y1I A;  1X9W A;  1ZQM A;  3GIJ A;  4HYK A;  1XSP A;  1XU4 A;  1RYS A;  5IIK A;  1NKC A;  1WCL A;  1SZP A;  1X9S A;  2XGP A;  4DLE A;  5J0S A;  4J9S A;  4I28 A;  1U47 A;  3TAR A;  1BVS A;  4DFM A;  5J2B A;  3KHH A;  1RPL A;  1ZQB A;  2W9B A;  3AUO A;  4ECU A;  9ICK A;  4GC6 A;  4F4X A;  4P2H A;  2LYH A;  4P4O A;  1TV9 A;  2BGW A;  3RBD A;  5J0X A;  1KTQ A;  1ZQX A;  5F9L A;  3EZ5 A;  3GIM A;  3H4D A;  1X9M A;  2XGQ A;  4K4H A;  4MF2 A;  2M9N A;  4F50 A;  1LV5 A;  2J6S A;  4ECX A;  3RJH A;  4E0D A;  4YD2 A;  2UVW A;  4O3P A;  3B0Y A;  3RJE A;  2PXI A;  4ECW A;  3PW2 A;  1TK8 A;  4PHE A;  2NRT A;  3G6V A;  4B9N A;  1BPB A;  2IHM A;  4RPZ A;  5JUM A;  4XUS A;  5IIM A;  4KLJ A;  1BPE A;  7ICP A;  3C5F A;  1ARO P;  4B9S A;  5DGB A;  4DSJ A;  4ECY A;  4LVS A;  4RUA A;  1A76 A;  3M9N B;  2ZTD A;  9ICM A;  1MSW D;  5CP2 A;  4J9L A;  4KLF A;  4QZE A;  1TVA A;  3PML A;  2FLN A;  3M8R A;  5KG2 A;  4ECV A;  3AU6 A;  5KFS A;  3NTU A;  2J6U A;  4RQ4 A;  4UAZ A;  4MF8 A;  2ALZ A;  3V72 A;  4PGY A;  4J9O A;  4KLQ A;  4YCX A;  4DLG A;  3OHB A;  4M9G A;  5DGA A; 
#chains in the Genus database with same CATH topology
 4UAT A;  4M47 A;  1ZQK A;  2HHQ A;  1SKW A;  1ED1 A;  3BJY A;  1VLB A;  4KN4 A;  4QZ8 A;  2W43 A;  5J2J A;  4EEK A;  5AM2 A;  1F44 A;  1C7Y A;  1ZQH A;  5J2C A;  5KFH A;  4YD1 A;  5BOM A;  5ALM A;  2CRX A;  3SAG A;  4RQ8 A;  4J9P A;  1ZQO A;  4Y2S A;  4USA A;  3T5H A;  2AQ0 A;  3WK6 A;  2NO4 A;  1X6I A;  1NKE A;  2JH7 A;  1K1S A;  2W9M A;  4GFJ A;  4B9U A;  1NZB A;  2E8N A;  4DL6 A;  4R65 A;  5E79 U;  2EAN A;  5KT6 A;  3K1R B;  2KOB A;  3GZF A;  2P6U A;  4PJ0 U;  3QNM A;  2MRL A;  3IHQ B;  1IIP A;  3JPS A;  3A0B U;  2RRD A;  1U48 A;  3B0X A;  4Q8F A;  4ACO A;  3MDA A;  2LI6 A;  4OD0 A;  4F5Q A;  3JPP A;  2NO5 A;  3NRZ A;  5AK4 A;  2YQE A;  9ICF A;  4O0I A;  1Z19 A;  3KHR A;  4UW9 A;  3AEV A;  2D3D A;  2DUY A;  3NVV A;  2AQ4 A;  2BPG A;  4RQ5 A;  2KVC A;  5K4L A;  1S0V A;  3VC8 A;  3THV A;  5KFN A;  2KG5 A;  2Q4T A;  1JIH A;  5ALI A;  4UAW A;  4UAR A;  1SL0 A;  2M0N A;  4J9R A;  1S77 D;  3ISC A;  4ECR A;  5DBC A;  3JPR A;  4ECZ A;  3QUT A;  1UA1 A;  3TAD A;  2WF7 A;  4YR3 A;  4MFF A;  3WKE A;  4YMO A;  2ZXH A;  2ZXI A;  4ZH4 A;  2VKQ A;  4RT2 A;  2ZTC A;  3NGD A;  2QLT A;  2LPE A;  4MFC A;  5KT3 A;  5CA7 A;  4M9J A;  4DQI A;  2HOQ A;  4XQ8 A;  4CF3 A;  5CB1 A;  1J2N A;  1OUQ A;  4YFK A;  3CRX A;  4RZR A;  5L1J A;  2WB1 C;  3WK5 A;  1XS9 D;  2XI9 A;  2W54 A;  3ZDD A;  3TI0 A;  1LKY B;  3NUQ A;  4C8N A;  2RLT A;  1NKB A;  4QJF B;  2K4I A;  3Q8K A;  4ED0 A;  2ZIV A;  4LJX A;  3KOO A;  7ICH A;  2A19 A;  2G0A A;  3UPQ A;  1QQ7 A;  5DLG A;  3ZDA A;  2YN4 A;  3PO5 A;  3PSF A;  3PVX A;  4QWC A;  9ICI A;  3RRG A;  2UVU A;  5ALZ A;  1KSP A;  3HRD D;  5CEH A;  1ZQC A;  1MC8 A;  7ICT A;  5AKI A;  2W9B B;  1IXR A;  4ED7 A;  4YMN A;  3DDH A;  3SAF A;  3ALR A;  3L5K A;  1N5X A;  8ICW A;  4M9H A;  2ASL A;  4I2E A;  2FE9 A;  4PZN A;  2K8C B;  4M04 A;  5KFE A;  3SV4 A;  4O5K A;  4R66 A;  4GLX A;  3M9O B;  4C4R A;  4I29 A;  3Q8S B;  2UVV A;  4KLG A;  2Y9U A;  4C80 A;  3F5E A;  4P4M A;  3ZD9 A;  1H38 A;  2F2A B;  2HI0 A;  5AK5 A;  2VIX A;  3H0R B;  3KZI U;  2XY6 A;  1N56 A;  5J0Y A;  5KFC A;  1FFU A;  4CDG A;  4UAV A;  1ZRM A;  1MQ2 A;  4Y2Q A;  3D2S A;  1SGG A;  1DK3 A;  4OCZ A;  4MEY A;  1MA7 A;  1T94 A;  2HBL A;  1ZD3 A;  2JRZ A;  2K89 A;  3JPT A;  4F5P A;  4GXK A;  2F1J A;  1COO A;  3H0M B;  2QB0 A;  1RXV A;  5EWF A;  4CF4 A;  2PKE A;  2G08 A;  3FAH A;  4CE6 A;  5J8Y C;  4EBE A;  2JHD A;  3WK4 A;  5AKY A;  4UAY A;  8ICZ A;  3BQT A;  1JMS A;  4F4W A;  1ZQD A;  1NK9 A;  1EXN A;  2NRZ A;  3H8M A;  5H2F U;  3RJI A;  3UMG A;  3RR7 A;  2ZIW B;  4ECT A;  2HW3 A;  2B0C A;  3C1Z A;  4X5V A;  2PI4 A;  3PX6 A;  2MU2 A;  5ALW A;  1KRP A;  2HHX A;  4XRH A;  3PW4 A;  4A8E A;  2W9C B;  8ICY A;  3PX0 A;  4DWI A;  2W3S A;  3PW5 A;  1NJX A;  1RYU A;  3H8S A;  1JX4 A;  1NK0 A;  3MC1 A;  4J9M A;  5HML A;  3WU2 U;  1ZQE A;  1ZQI A;  2E3T A;  3SMV A;  2DPJ A;  7ICQ A;  3CYM A;  3GIL A;  3EUB 2;  4UB1 A;  1N63 A;  2AGP A;  2YY6 A;  3NRW A;  4DOC A;  1Z1V A;  5KFQ A;  2JEI A;  5AIB A;  1S97 A;  3QYP A;  3AU2 A;  3SAH A;  1SKR A;  2G07 A;  4JB3 A;  5L9X A;  2PI5 A;  3UMC A;  3UXP A;  1X40 A;  4F3O A;  1K1Q A;  1L7P A;  1JI7 A;  1QSY A;  4RQ6 A;  4PHD A;  2C2D A;  4DQP A;  3SI8 A;  3ISB A;  4CGZ A;  2BDU A;  4UBB A;  5HHH A;  1XSN A;  5DBA A;  4KMU A;  2HSZ A;  3WKD A;  5KFG A;  1L5U A;  3HX0 A;  7ICV A;  4KLU A;  3QX7 A;  5KT2 A;  2AGQ A;  2MUT A;  9ICH A;  2KMD A;  8ICE A;  5KFD A;  4HAI A;  1Q3V A;  3HIL A;  4M6W A;  3TQ1 A;  5DQG A;  1X9W A;  5IIK A;  1WCL A;  1X9S A;  3NVY A;  5ALJ A;  4DFM A;  5J2B A;  3KHH A;  3E0F A;  1KTQ A;  1ZQX A;  2RP5 A;  1L6N A;  4MF2 A;  2WFA A;  1LV5 A;  4ECX A;  4O3P A;  3B0Y A;  4EEL A;  4B9N A;  2DBY A;  2EAO A;  2WF9 A;  4DSJ A;  4ECY A;  3M9N B;  2ZTD A;  5CP2 A;  4J9L A;  4KLF A;  5AKX A;  4QZE A;  1J2M A;  5KFS A;  1PK1 A;  1ZQ1 C;  3V72 A;  4PGY A;  5AM4 A;  1Z4N A;  3OHB A;  5DGA A;  2A1J B;  4F2R A;  1N5W A;  9ICN A;  1B22 A;  2KFZ A;  3MFI A;  5TZV A;  3M7D A;  4NM2 A;  3MGV A;  3LWM A;  4TQS A;  5DB6 A;  4OJL A;  4M9L A;  1V97 A;  2Y0S C;  5T14 A;  2K8B B;  3B9J A;  7ICN A;  3RJE A;  4NLG A;  4DF4 A;  3ONN A;  1FFV A;  3GQC A;  2ZTE A;  4O3N A;  1Z1B A;  3QE9 Y;  4F72 A;  9ICO A;  4ELT A;  2F1H A;  2A3V A;  3QU5 A;  1ZQN A;  5ALX A;  2C2E A;  2H5X A;  5KTQ A;  5IIO A;  3GII A;  1NOM A;  2RDI A;  2PMZ C;  8ICF A;  2F3N A;  2DL0 A;  1ZQU A;  2O6K A;  5B5E U;  4Q44 A;  1YT3 A;  1ZYQ A;  5J2K A;  4KTQ A;  1KQQ A;  2KVS A;  5KFJ A;  1UHU A;  5AKZ A;  5ALY A;  3TFS A;  1U4B A;  5L1L A;  4DSE A;  4YQW A;  5KL8 B;  4IR9 A;  8ICK A;  1D9F A;  3PZP A;  5KT4 A;  2FMQ A;  1BPZ A;  4YMM A;  2OWO A;  4RU9 A;  2ZUC A;  5FP0 A;  5AI4 A;  4P0Q A;  5AHX A;  4DSI A;  4QZC A;  5ALF A;  4DCC A;  3T79 A;  1A0P A;  2MAX A;  4MHV A;  9ICB A;  2F8L A;  3IG5 A;  1B0X A;  3PSP A;  2HDO A;  2AXT U;  4KMO B;  4C8O A;  4BXO B;  2HOI A;  4QIW C;  4FZN A;  5AM0 A;  3AL0 B;  3SR6 A;  2P6R A;  4IC9 A;  3MR2 A;  3QZ8 A;  5C0Y A;  3PY8 A;  4QNL A;  2JEG A;  2R8J A;  2HHW A;  1ZQL A;  4AYB F;  3M8S A;  4C8K A;  1YZ7 A;  1HEK A;  2W8K A;  1IV8 A;  3J81 j;  4QW9 A;  5IIL A;  2FPM A;  4C7Y A;  5EE0 A;  4KLH A;  5KG4 A;  4PGQ A;  1QCK A;  4C8L A;  4QZH A;  5JU5 A;  4RPX A;  2WAQ F;  4DSF A;  4UQG A;  1F5S A;  2W04 A;  3LVV A;  3C21 A;  1SIJ A;  2FPL A;  4UB5 A;  5DG9 A;  4R63 A;  5DB8 A;  4FZL A;  2PFP A;  2BR0 A;  4RQ7 A;  4M9N A;  2E8P A;  1L3T A;  2KD1 A;  3EW9 A;  3NS1 A;  4ICA A;  5AKJ A;  1S0O A;  3IN5 A;  8ICJ A;  4KN7 A;  4LZD A;  3ETR A;  5KG0 A;  5F3X B;  2OCE A;  2W7O A;  4O3R A;  3EPI A;  3KTQ A;  5AK6 A;  2HHT A;  3GDX A;  2BCQ A;  1BPD A;  2KKV A;  2W8L A;  3D2N A;  1ZQQ A;  1U45 A;  5J0O A;  2AJQ A;  1HJP A;  3SD7 A;  4J03 A;  4BWJ A;  2ISO A;  3OJU A;  2ZJA A;  3WK8 A;  1SV0 A;  5EE1 A;  4I27 A;  2NRX A;  4QZG A;  3QU4 A;  8ICQ A;  1A6S A;  3H8J A;  1JRP A;  9ICX A;  3AQF A;  5KFB A;  5EE3 A;  2FLL A;  1NJZ A;  1TKD A;  4TQR A;  4OJP A;  4O3S A;  5HR6 A;  1L8L A;  4PL2 A;  1BNO A;  3RJK A;  3IV6 A;  5J0T A;  1M6Y A;  2V4R A;  7ICG A;  2DF4 B;  5L1M A;  4B9T A;  3Q8P B;  1L8O A;  5KFX A;  1KW4 A;  2FLP A;  2G09 A;  2JZB B;  4UB8 U;  4PHA A;  4TUP A;  5JRT A;  3JPO A;  3KKA A;  1NJW A;  4ED6 A;  3I28 A;  3UQ0 A;  3O0F A;  4ED8 A;  5J2D A;  3TAP A;  5HNK A;  4Z6C A;  5G5H A;  4YVZ A;  1X6J A;  4JK1 A;  3RBE A;  2J6T A;  4Y2T A;  3IG8 A;  5HP4 A;  1Z4O A;  1D9D A;  8ICC A;  5J2E A;  2RDJ A;  2VA2 A;  5KFW A;  1WWU A;  4DL2 A;  1WCN A;  3SEI A;  4P4P A;  4WJ3 B;  1SB3 C;  3UMB A;  1LVH A;  4EBC A;  4BJQ A;  1RQL A;  2EZY A;  3QUQ A;  4DQS A;  5KFT A;  4R8U A;  1T3N A;  3BZK A;  4FS2 A;  1SWV A;  4YP3 A;  4QWE A;  3QEA Z;  1FIQ A;  2ZIX A;  1A77 A;  8ICG A;  4QZA A;  1X9X A;  3C2M A;  3SYZ A;  4DL7 A;  5KFL A;  4BGD A;  2DGZ A;  2H3F A;  1WUD A;  1CEZ A;  2JH1 A;  2K4H A;  2BCU A;  1ZQV A;  2KSO B;  1NK6 A;  5EOZ A;  2PFO A;  1KL9 A;  2E1E A;  1L3S A;  4QZF A;  4GXI A;  3RAX A;  4KLO A;  1RM6 C;  4JV2 A;  4Y2P A;  4EX6 A;  4RQ3 A;  2FI1 A;  4DSK A;  5AI5 A;  2IOF A;  3OGU A;  3WK9 A;  2VAN A;  1XNS A;  2KIV A;  4PPX A;  1COK A;  3V7L A;  4QZD A;  2H3Q A;  3TAD C;  8ICM A;  1S76 D;  1VJ5 A;  4BDP A;  3WK7 A;  2FJ6 A;  2FMP A;  3KKA C;  2EAP A;  2EZX A;  2HBJ A;  1T3Q A;  1SZH A;  4JV1 A;  1NK4 A;  1WWV A;  3ICX A;  3SV3 A;  1NJY A;  3ZDE A;  1HIW A;  4Z6D A;  4DL3 A;  4G3I A;  1UT5 A;  3PV8 A;  2W11 A;  4PZO A;  3F53 A;  4PH5 A;  2W03 A;  1IM4 A;  3F2D A;  3OPX A;  1U49 A;  4F4K A;  2F1I A;  3RH4 A;  4NLN A;  3RJJ A;  1X66 A;  1T4G A;  3Q8L A;  4KLL A;  4M2Y A;  1ZQG A;  1S0N A;  5ALN A;  3HWT A;  2BCS A;  3RFA A;  1XU4 A;  1RYS A;  4ZOH C;  4FE3 A;  2XGP A;  4J9S A;  3TAR A;  4F4X A;  4P0P A;  4P4O A;  3RBD A;  3IP4 B;  3GIM A;  1PK3 A;  1RDF A;  3SQI A;  1X9M A;  2JXJ A;  5ALV A;  2M9N A;  4F50 A;  2J6S A;  3QXG A;  2PXI A;  4B6J A;  3G6V A;  3F5A A;  1QQ6 A;  7ICP A;  2G5I B;  1SV4 A;  4OJ6 A;  4LVS A;  4RUA A;  1ZXI A;  4O3M A;  1MSW D;  2FLN A;  3M8R A;  4RQ4 A;  2ALZ A;  4IL6 U;  5ALE A;  1DXS A;  4J9O A;  2HOF A;  4M9G A;  5ALG A;  4BUG A;  3D2Q A;  3U26 A;  5G5G A;  3MAB A;  4DO9 A;  5KFP A;  1Z00 B;  5HR7 A;  4TUQ A;  1B43 A;  5AM5 A;  5D4B A;  3HKZ C;  4UB6 U;  4QWD A;  1ECW A;  4DFK A;  5DB7 A;  3D6J A;  4YR2 A;  1BGX T;  2LYB A;  2EQY A;  2QB0 B;  4UAU A;  1HUO A;  4ELU A;  2XVT A;  1MQ3 A;  2BCR A;  4PHP A;  3MR6 A;  2R8I A;  5DDY A;  3LVW A;  4EYH B;  5DLF A;  4NLK A;  3PST A;  4F71 A;  4GC7 A;  2HVI A;  1QQ5 A;  2XCA A;  9ICE A;  5EWG A;  4DEZ A;  1FEZ A;  1S8O A;  1ZD5 A;  4NM1 A;  4DSL A;  4RQ2 A;  1WG8 A;  9ICT A;  3FM9 A;  3HP6 A;  1L7N A;  3GV7 B;  4ED1 A;  3K1Z A;  2IA6 A;  2DKZ A;  2E8O A;  3HPO A;  3PMN A;  4DS4 A;  7ICL A;  3PW7 A;  1UA0 A;  2XY5 A;  4YG2 A;  2R8G A;  3BS5 A;  2I1Q A;  1NK7 A;  4F5R A;  3MDC A;  2KIC A;  4JWN A;  2ZUB A;  4F8R A;  2ZUD A;  5KFZ A;  9ICG A;  4Y2R A;  3A0H U;  4Q43 A;  4J9K A;  4FS1 A;  3IM1 A;  4QZ9 A;  5AKE A;  3I1Y A;  4KX3 A;  4KLT A;  2VJ4 A;  3K75 D;  2W9A A;  1DK2 A;  5KT7 A;  2WF5 A;  2XIC A;  4UAS A;  4MFA A;  2IMW P;  3RB4 A;  4IQT A;  7ICO A;  5CRX A;  1NK8 A;  1Q8K A;  2RQ5 A;  1C20 A;  3SZ2 A;  2RHF A;  3TAQ A;  4Y2V A;  1BPY A;  1AQ6 A;  5AM3 A;  2EZZ A;  5ALD A;  2OXO A;  4O3O A;  9ICC A;  3RH6 A;  4CCH A;  4US8 A;  2BCV A;  1UQV A;  1JN3 A;  1MN8 A;  1S10 A;  3H7I A;  4MEX A;  2B6G A;  5KAF U;  3L3F X;  3RR8 A;  3EYZ A;  3TAC B;  2E5S A;  5BPC A;  3C2L A;  5A0L A;  2JMG A;  1ZRN A;  3ISD A;  3MR3 A;  4DFP A;  1NI3 A;  4AP9 A;  2MSN A;  4FZM A;  4RT3 A;  1PVP A;  4QZI A;  3EPG A;  3OTQ A;  2KJ8 A;  1XO0 A;  4B9M A;  5CR0 A;  5F9N A;  4DOB A;  4M6W B;  3OJS A;  1N61 A;  7ICM A;  2BQU A;  2KHQ A;  1ZET A;  4NV0 A;  2KKP A;  1ZQY A;  1B4F A;  5J0P A;  1XWL A;  5AIC A;  5AIA A;  4O5E A;  3BDP A;  3QU7 A;  4K4I A;  5DDM A;  1L7M A;  4IS7 A;  2QAR A;  1DGJ A;  4F91 B;  4I2J A;  4RQM A;  9ICS A;  3RJG A;  3RTV A;  1ZQZ A;  3TAN A;  4YR0 A;  1HUZ A;  1GO3 F;  5KL1 B;  1T7P A;  4BXO A;  2WF6 A;  2JEF A;  3CNH A;  2W3R A;  3AM9 A;  2YMM A;  2DFL A;  3MGH A;  5AI0 A;  3LYS A;  2AHO B;  3C23 A;  2F8K A;  3AQE A;  2OH2 A;  4IQV A;  3Q8R B;  1SL1 A;  2HMX A;  3CW2 C;  1QH9 A;  3C28 A;  1PK1 B;  3F2C A;  3TKA A;  4ED3 A;  2D8C A;  1PUZ A;  2P35 A;  4PL1 A;  1SWW A;  9ICQ A;  8ICT A;  4F4Z A;  4US9 A;  3E2E A;  4DFJ A;  2LYA A;  1TAU A;  3HT3 A;  3RAQ A;  3Q8M A;  3BQ2 A;  4UB4 A;  2FDR A;  5GTH U;  3T3F A;  3RB3 A;  2YX8 A;  1V85 A;  2V4Q A;  1ZD2 P;  2LM1 A;  2NRV A;  5J2F A;  1TAQ A;  3V6H A;  3N97 B;  3RB0 A;  2OEH A;  5KAI U;  4B9V A;  3FC4 A;  4I2I A;  1J97 A;  2H3Z A;  1ZQR A;  2HHS A;  4IRD A;  2PFQ A;  3N7S C;  1Q46 A;  1ZOL A;  1S5L U;  2F76 X;  3G6X A;  4EZ9 A;  2HBK A;  2KIW A;  4F5O A;  2YMP A;  3S6J A;  1SKS A;  2K60 A;  3R9K A;  5EE9 A;  5GTI U;  5AI6 A;  1JAL A;  7ICK A;  8ICN A;  4BX9 C;  8ICS A;  8ICR A;  2W7P A;  1PVR A;  3RH5 A;  4YXM A;  3JPN A;  4O5C A;  3QU9 A;  1NK5 A;  5C5J A;  2HVH A;  1K5O A;  3T5L A;  7ICI A;  2C28 A;  1NNL A;  4I2F A;  4IR1 A;  2KP7 A;  3UQ2 A;  5KFI A;  3UM9 A;  2EDU A;  5AI9 A;  1Y88 A;  3M6Z A;  5KFR A;  1CRX A;  2FPK A;  3ED5 A;  2WB1 F;  5ALK A;  2ASD A;  1ZD4 A;  4KX5 A;  5J0U A;  3UXN A;  3HJE A;  2KNJ A;  4B9L A;  4P0Q B;  2WTF A;  3KZX A;  4F5N A;  3KHL A;  3QZ7 A;  4NXZ A;  4F4Y A;  5BOL A;  4G9B A;  2Q0Z X;  1D8L A;  2XCP A;  7ICF A;  4RNN A;  2GH1 A;  4IRC A;  2R8H A;  2R8K A;  3OHA A;  4NL9 A;  1RYR A;  4Y2Y A;  2BQR A;  5DG7 A;  4IQW A;  2BHN A;  2JZB A;  9ICP A;  3OSP A;  3ORY A;  2N1R A;  2JEJ A;  3Q8Q B;  5KFO A;  2F77 X;  2K8A A;  4GXJ A;  2OM6 A;  2ZIU B;  3C1Y A;  3JPQ A;  8ICV A;  1CUK A;  1N60 A;  2GWS A;  4ECS A;  5AKK A;  4C7Z A;  2DQN B;  1ZQF A;  4M0A A;  1U9L A;  2CN1 A;  1KFS A;  3L4P A;  4C0Z A;  4JWM A;  2ESE A;  2VA3 A;  4F93 B;  4I2H A;  2P66 A;  2ATL A;  1JXL A;  2IBK A;  2E1F A;  2HHV A;  1Q3U A;  1LKY A;  1XSL A;  3C2K A;  1KDH A;  2HBM A;  3IRU A;  3BQ1 A;  3BQ7 A;  4KLD A;  3E58 A;  3LDA A;  4C8M A;  2ZG6 A;  2Y1J A;  2JR5 A;  1XO1 A;  4NJ8 A;  4RPY A;  3QUC A;  5D49 A;  4DFD A;  1ZQA A;  3BQ0 A;  2JV3 A;  1D8Y A;  2NYV A;  4UB2 A;  3WKB A;  2BDP A;  2KJ5 A;  1O08 A;  4HYK A;  1NKC A;  1SZP A;  3AMZ A;  4CRX A;  5J0S A;  1U47 A;  2KSO A;  1BVS A;  3QU2 A;  1RPL A;  2W9B A;  3AUO A;  2YB4 A;  4ECU A;  4GC6 A;  4P2H A;  2LYH A;  4AYB C;  2KJ9 A;  4K4H A;  3RJH A;  4YD2 A;  2UVW A;  4NL9 C;  4PHE A;  2NRT A;  1BPB A;  5AI8 A;  2IHM A;  5JUM A;  4XUS A;  5IIM A;  4KLJ A;  1BPE A;  2WAQ C;  3C5F A;  1ARO P;  1URJ A;  1A76 A;  1YZ6 A;  1TVA A;  5KG2 A;  4ECV A;  3NTU A;  2J6U A;  2H3V A;  5AKL A;  4UAZ A;  3SEN A;  4KLQ A;  4YCX A;  4DLG A;  1SV0 C;  2XID A;  1JRO A;  2E8M A;  5ALL A;  1RZT A;  3H40 A;  4ED2 A;  2K4E A;  5J29 A;  5KG1 A;  2YTU A;  2F44 A;  2QKQ A;  3V6J A;  2ISP A;  3WKC A;  2DWQ A;  5J8Y A;  2AH5 A;  3H8W A;  1VDV A;  4RUC A;  1DRG A;  1X2I A;  2XO7 A;  2VA8 A;  3TFR A;  1BNP A;  3HKZ F;  2KTQ A;  1JUD A;  4ECQ A;  5IIN A;  4RNO A;  5DBB A;  1ZQS A;  8ICU A;  3GV5 B;  5ALQ A;  9ICA A;  4Z6E A;  4QZB A;  1N2X A;  2GOL A;  1Z3E B;  3RF9 A;  4U7C A;  3NAS A;  2EH9 A;  4I2B A;  8ICL A;  2ZIW A;  5DKW A;  5CHG A;  1TK0 A;  4KLE A;  1L3U A;  2KHV A;  5ALS A;  5DB9 A;  2AGO A;  5KG3 A;  5J0Q A;  4BWM A;  5J2A A;  1XC9 A;  9ICV A;  4EEY A;  2KZZ A;  5CWR A;  4EBD A;  4DF8 A;  1ZJN A;  2ZIV B;  4YN4 A;  2FMS A;  4R8U B;  4C4T A;  2BQ3 A;  2YMQ A;  4QW8 A;  5KG6 A;  2ZIX B;  2W9C A;  4K4G A;  5KG7 A;  2W55 A;  3OSN A;  2V9W A;  1QLN A;  4JUZ A;  1UPH A;  8ICH A;  4NWI A;  5IIJ A;  3M6K A;  1Z00 A;  1QTM A;  4RQ0 A;  2XY7 A;  3T5J A;  3LWL A;  2MA1 A;  1QSS A;  2XC9 A;  8ICB A;  2A1A A;  5AK3 A;  2OHF A;  5AM1 A;  3T5K A;  3GFK B;  2NV3 A;  1KFT A;  3RJF A;  1S0M A;  3PO4 A;  2BZF A;  1LB2 B;  4U6P A;  1KFD A;  2I5H A;  5KG5 A;  4IRK A;  4IQU A;  2LMR A;  5KFK A;  4Q8E A;  1ZQP A;  9ICL A;  2WF8 A;  5CJ7 A;  2KK0 A;  4JMU A;  9ICW A;  2I9G A;  4Y2J A;  4NY8 A;  2KEY A;  4I2G A;  1QSL A;  4ELV A;  3H4B A;  4DL5 A;  4OJO A;  1N48 A;  3GIK A;  1F0M A;  8ICI A;  2WHE A;  5B66 U;  3PW0 A;  2KZ3 A;  3C29 A;  3N28 A;  3FDS A;  5HMM A;  2D6F C;  4LZG A;  5DG8 A;  2ODG A;  1P7D A;  4KLM A;  4OJ5 A;  5ALH A;  3K4G A;  1ZJM A;  3F2B A;  3KHG A;  2ES6 A;  5ALT A;  2GO7 A;  9ICU A;  1PVQ A;  3AN1 A;  2LM4 A;  1UCV A;  2LBO A;  4CF5 A;  2YML A;  5J2G A;  4DOA A;  4Y2X A;  4YXJ A;  3QEB Z;  5D46 A;  1D8B A;  2Y9T A;  4TUR A;  1OW5 A;  3DV9 A;  2HCF A;  3BS7 A;  2R18 A;  8ICP A;  2B21 A;  3WKA A;  5EWE A;  1RG6 A;  2L5Y A;  1L3V A;  3RB6 A;  1V9P A;  2Y0S F;  4P0P B;  4Q45 A;  2C2R A;  7ICS A;  3KFU F;  5AKG A;  4TUS A;  2CXY A;  3C5G A;  2G5H B;  3GU3 A;  3ETL A;  1DOQ A;  3DEE A;  4DQQ A;  2IOF K;  1KLN A;  2CPR A;  2BPF A;  5HHI A;  4FBT A;  2HHU A;  2K4P A;  4DS5 A;  5TIS U;  8ICO A;  5L1K A;  4QWB A;  3ZDC A;  1TE2 A;  2PMZ F;  5KFF A;  5KFM A;  5J0R A;  4RNM A;  5J0W A;  4I2A A;  3QUB A;  4RQ1 A;  3N4M B;  1IG6 A;  3LK9 A;  4EYI B;  2A1J A;  1ZQJ A;  4UB3 A;  4XA5 A;  3CP8 A;  1X42 A;  2G06 A;  3PR4 A;  4J9N A;  3PX4 A;  4EEN A;  7ICJ A;  4Y2U A;  4OO1 J;  4J9Q A;  5ALR A;  3MR5 A;  1KKX A;  3V7K A;  7ICU A;  2H3I A;  5ALU A;  3G6Y A;  1DGS A;  1T8E A;  4I2D A;  5DQH A;  4FBU A;  4O9M A;  4R64 A;  3RRH A;  5KFA A;  4QIW F;  4QWA A;  5ALO A;  1UT8 A;  4O3Q A;  3V6K A;  7ICE A;  3ZDB A;  2DKX A;  2C22 A;  4UBC A;  1OXJ A;  2IHN A;  5III A;  4C4S A;  4FO6 A;  3PNC A;  1SL2 A;  2OYY A;  8ICA A;  3HW8 A;  2Z7J A;  5L1I A;  3BS5 B;  2IOH A;  2BKE A;  1TK5 A;  3V7J A;  2I6X A;  3M9M B;  1SXD A;  2MUT B;  3UXO A;  2ZJ8 A;  3NVZ A;  2KFN A;  3FYH A;  1CI4 A;  2KV2 A;  2DPI A;  4FFD A;  3GV8 B;  1ZQW A;  4DL4 A;  1ZQT A;  1PZN A;  3MFH A;  3MBY A;  5ALP A;  2LHT A;  3KD3 A;  5KFU A;  2VJ5 A;  1JXE A;  1RXW A;  3NVW A;  5DQI A;  4Z6F A;  4NLZ A;  8ICX A;  5KFY A;  9ICJ A;  3M1Y A;  4KIT B;  2ASJ A;  3VCB A;  2UVR A;  2KN7 A;  1KEJ A;  1O03 A;  5J2H A;  4GIB A;  1S9F A;  2LKY A;  3ZI4 A;  2JGA A;  5KNI A;  4JV0 A;  3BZC A;  2BPC A;  1WYG A;  4F2S A;  1FO4 A;  1TAM A;  2KE7 A;  4EZ6 A;  4F92 B;  4PGX A;  3ZD8 A;  2AU0 A;  3I76 A;  2EAM A;  4CNQ A;  5AKH A;  4I2C A;  1TFR A;  2KZM A;  4EX7 A;  2PFN A;  3PSI A;  1BPX A;  4KLS A;  1N62 A;  2GLE A;  3MGI A;  5KT5 A;  3KBB A;  3N7P D;  5J2I A;  9ICR A;  2QB1 A;  4DQR A;  4KLI A;  3PR5 B;  2NRW A;  7ICR A;  3EWA A;  2ZJ5 A;  5KFV A;  2Y1I A;  1ZQM A;  3GIJ A;  1XSP A;  4DLE A;  4I28 A;  3N7R C;  2QAR B;  1ZQB A;  5JTI A;  9ICK A;  1TV9 A;  2BGW A;  4NLB A;  5F9L A;  5J0X A;  3EZ5 A;  3H4D A;  2XGQ A;  4E0D A;  4ECW A;  3PW2 A;  1TK8 A;  1L7O A;  4RPZ A;  1KN5 A;  2ZIU A;  4RQN A;  4B9S A;  1SXE A;  5DGB A;  9ICM A;  4NLC A;  1KBU A;  3PML A;  3AU6 A;  3H0L B;  2YB1 A;  1V38 A;  4MF8 A;  3IDW A;  1NZP A;  1RQN A; 
#chains in the Genus database with same CATH homology
 2A1J B;  4M47 A;  1ZQK A;  4F2R A;  9ICN A;  2HHQ A;  2KFZ A;  1RZT A;  3MAB A;  4DO9 A;  5KFP A;  3H40 A;  1SKW A;  1B22 A;  1Z00 B;  3MFI A;  5TZV A;  4ED2 A;  4NM2 A;  4TUQ A;  3BJY A;  3LWM A;  1B43 A;  5J29 A;  4KN4 A;  5KG1 A;  4TQS A;  4QZ8 A;  4QWD A;  5D4B A;  5DB6 A;  3V6J A;  5DB7 A;  4DFK A;  2ISP A;  4M9L A;  4YR2 A;  1BGX T;  5J2J A;  1C7Y A;  3H8W A;  1HUO A;  5J2C A;  4RUC A;  1ZQH A;  4ELU A;  5KFH A;  4YD1 A;  5BOM A;  1MQ3 A;  4DF4 A;  2BCR A;  4PHP A;  3MR6 A;  1X2I A;  2R8I A;  5DDY A;  2XO7 A;  2VA8 A;  4RQ8 A;  4J9P A;  1ZQO A;  4EYH B;  3TFR A;  3GQC A;  5DLF A;  4NLK A;  2ZTE A;  4O3N A;  2AQ0 A;  4ECQ A;  4GC7 A;  3T5H A;  5IIN A;  3QE9 Y;  2KTQ A;  1NKE A;  2HVI A;  1K1S A;  4RNO A;  2XCA A;  5DBB A;  2W9M A;  5EWG A;  4DEZ A;  1ZQS A;  4ELT A;  2F1H A;  9ICE A;  8ICU A;  4NM1 A;  4B9U A;  4DSL A;  3GV5 B;  9ICA A;  4RQ2 A;  4Z6E A;  4DL6 A;  4R65 A;  4QZB A;  1ZQN A;  9ICT A;  2C2E A;  3HP6 A;  5KT6 A;  1Z3E B;  1CEZ A;  3GV7 B;  2P6U A;  4ED1 A;  2H5X A;  2IA6 A;  5KTQ A;  3IHQ B;  5IIO A;  3HPO A;  3GII A;  1NOM A;  2RDI A;  3PMN A;  3JPS A;  4DS4 A;  4I2B A;  7ICL A;  3PW7 A;  1UA0 A;  8ICF A;  2XY5 A;  8ICL A;  4YG2 A;  5DKW A;  5CHG A;  1TK0 A;  2R8G A;  4KLE A;  7ICF A;  1L3U A;  1U48 A;  3B0X A;  4Q8F A;  5DB9 A;  2AGO A;  1ZQU A;  5KG3 A;  5J0Q A;  3MDA A;  4BWM A;  4Q44 A;  5J2A A;  1XC9 A;  4F5Q A;  2I1Q A;  3JPP A;  4EEY A;  1ZYQ A;  5J2K A;  1NK7 A;  4KTQ A;  5CWR A;  4EBD A;  2KZZ A;  4F5R A;  3MDC A;  4DF8 A;  1ZJN A;  4YN4 A;  5KFJ A;  2FMS A;  4R8U B;  9ICF A;  2BQ3 A;  4O0I A;  3TFS A;  1U4B A;  5L1L A;  4DSE A;  4YQW A;  4JWN A;  4QW8 A;  4IR9 A;  2ZUB A;  5KG6 A;  2ZUD A;  3KHR A;  4F8R A;  5KFZ A;  2W9C A;  8ICK A;  1D9F A;  4K4G A;  5KG7 A;  3OSN A;  5KT4 A;  2FMQ A;  1BPZ A;  9ICG A;  4YMM A;  2AQ4 A;  2V9W A;  2BPG A;  4RQ5 A;  2OWO A;  1QLN A;  4RU9 A;  4JUZ A;  2ZUC A;  8ICH A;  4Q43 A;  1S0V A;  4J9K A;  3THV A;  5IIJ A;  4FS1 A;  3IM1 A;  1Z00 A;  5KFN A;  4RQ0 A;  1JIH A;  4UAW A;  1QTM A;  2XY7 A;  4QZ9 A;  4DSI A;  3T5J A;  4QZC A;  3LWL A;  4KLT A;  3K75 D;  2W9A A;  1SL0 A;  2MAX A;  5KT7 A;  1QSS A;  9ICB A;  2XC9 A;  4J9R A;  1S77 D;  3ISC A;  4MFA A;  2IMW P;  4ECR A;  8ICB A;  3T5K A;  5DBC A;  3RB4 A;  3JPR A;  3GFK B;  4ECZ A;  1KFT A;  3RJF A;  4C8O A;  4IQT A;  1UA1 A;  1S0M A;  3PO4 A;  4BXO B;  7ICO A;  1LB2 B;  4YR3 A;  1NK8 A;  2P6R A;  1KFD A;  5KG5 A;  4IRK A;  4MFF A;  4IQU A;  3MR2 A;  3QZ8 A;  4YMO A;  3SZ2 A;  5KFK A;  4Q8E A;  3PY8 A;  4ZH4 A;  4RT2 A;  1ZQP A;  2JEG A;  9ICL A;  2ZTC A;  5CJ7 A;  2R8J A;  3NGD A;  3TAQ A;  2HHW A;  1BPY A;  1ZQL A;  3M8S A;  4C8K A;  2W8K A;  9ICW A;  4QW9 A;  4O3O A;  4MFC A;  5KT3 A;  3RH6 A;  5CA7 A;  2I9G A;  5IIL A;  2FPM A;  4CCH A;  4M9J A;  4DQI A;  4NY8 A;  5KG4 A;  1QSL A;  4ELV A;  2BCV A;  4I2G A;  4XQ8 A;  4KLH A;  1JN3 A;  4PGQ A;  3H4B A;  1S10 A;  3H7I A;  5CB1 A;  4DL5 A;  4MEX A;  4YFK A;  4C8L A;  4QZH A;  1N48 A;  4NLG A;  4RPX A;  4RZR A;  3GIK A;  5L1J A;  3RR8 A;  8ICI A;  3EYZ A;  3PW0 A;  5BPC A;  3C2L A;  1XS9 D;  2KZ3 A;  4DSF A;  3ZDD A;  3TI0 A;  3FDS A;  5HMM A;  4LZG A;  3ISD A;  4C8N A;  5DG8 A;  3MR3 A;  4UQG A;  4KLM A;  1NKB A;  4DFP A;  3Q8K A;  3C21 A;  3K4G A;  1ZJM A;  4ED0 A;  4RT3 A;  3KHG A;  2FPL A;  4QZI A;  5DG9 A;  4UB5 A;  3EPG A;  4R63 A;  5DB8 A;  9ICU A;  4B9M A;  5CR0 A;  7ICH A;  2PFP A;  5F9N A;  4DOB A;  4DOA A;  5J2G A;  2BR0 A;  4M6W B;  4RQ7 A;  3OJS A;  1L3T A;  4M9N A;  3UPQ A;  4YXJ A;  5DLG A;  3EW9 A;  3ZDA A;  3QEB Z;  3PO5 A;  3PVX A;  2BQU A;  5D46 A;  7ICM A;  4QWC A;  1ZET A;  4TUR A;  9ICI A;  3RRG A;  2UVU A;  1ZQY A;  1S0O A;  5J0P A;  1KSP A;  8ICJ A;  1XWL A;  4KN7 A;  8ICP A;  4LZD A;  2B21 A;  5EWE A;  5KG0 A;  1ZQC A;  4O5E A;  1MC8 A;  3BDP A;  7ICT A;  2W9B B;  1L3V A;  1IXR A;  3RB6 A;  1V9P A;  5DDM A;  4ED7 A;  4K4I A;  4YMN A;  4F91 B;  4Q45 A;  3EPI A;  4I2J A;  2C2R A;  3KTQ A;  4O3R A;  2HHT A;  9ICS A;  7ICS A;  3GDX A;  3RJG A;  3RTV A;  8ICW A;  2BCQ A;  1ZQZ A;  2ASL A;  3TAN A;  4M9H A;  1BPD A;  4YR0 A;  4I2E A;  2W8L A;  4M04 A;  4O5K A;  1HUZ A;  5KFE A;  3SV4 A;  1ZQQ A;  4R66 A;  4GLX A;  1U45 A;  4TUS A;  3M9O B;  1T7P A;  4BXO A;  4I29 A;  5J0O A;  3Q8S B;  2UVV A;  4KLG A;  2AJQ A;  3C5G A;  2JEF A;  1HJP A;  3ETL A;  4BWJ A;  1DOQ A;  4P4M A;  2DFL A;  3ZD9 A;  3MGH A;  3OJU A;  4DQQ A;  1H38 A;  2ISO A;  1KLN A;  2BPF A;  2ZJA A;  5HHI A;  3C23 A;  4FBT A;  2HHU A;  4DS5 A;  4I27 A;  2NRX A;  5L1K A;  4QWB A;  4IQV A;  4QZG A;  3Q8R B;  3H8J A;  1SL1 A;  3ZDC A;  8ICQ A;  9ICX A;  5KFF A;  5KFM A;  5KFB A;  2FLL A;  2XY6 A;  1NJZ A;  1N56 A;  5J0Y A;  5J0R A;  4RNM A;  4ED3 A;  1TKD A;  5J0W A;  4I2A A;  4TQR A;  5KFC A;  4RQ1 A;  3N4M B;  9ICQ A;  4O3S A;  8ICT A;  4F4Z A;  3LK9 A;  4EYI B;  3E2E A;  4DFJ A;  2A1J A;  1ZQJ A;  4UB3 A;  1TAU A;  3HT3 A;  3RAQ A;  4XA5 A;  3RJK A;  3Q8M A;  1MQ2 A;  4UB4 A;  5J0T A;  2V4R A;  3BQ2 A;  3T3F A;  3PR4 A;  7ICG A;  4J9N A;  3RB3 A;  4MEY A;  3PX4 A;  4B9T A;  2V4Q A;  7ICJ A;  3Q8P B;  2NRV A;  5J2F A;  3JPT A;  4F5P A;  4J9Q A;  4GXK A;  2F1J A;  5KFX A;  1COO A;  1TAQ A;  3V6H A;  3MR5 A;  2FLP A;  3N97 B;  3RB0 A;  2JZB B;  3V7K A;  7ICU A;  7ICN A;  1RXV A;  5EWF A;  3G6Y A;  4B9V A;  1DGS A;  1T8E A;  4I2I A;  4PHA A;  4TUP A;  3JPO A;  1ZQR A;  2HHS A;  1NJW A;  4ED6 A;  4IRD A;  3UQ0 A;  4EBE A;  4UAY A;  2PFQ A;  8ICZ A;  3BQT A;  4ED8 A;  5J2D A;  1JMS A;  3G6X A;  4EZ9 A;  4I2D A;  5DQH A;  3TAP A;  4FBU A;  4F4W A;  4F5O A;  4O9M A;  5HNK A;  4Z6C A;  1ZQD A;  4R64 A;  3RRH A;  1SKS A;  1NK9 A;  1EXN A;  2NRZ A;  4YVZ A;  5KFA A;  3RBE A;  4JK1 A;  4QWA A;  3RJI A;  1UT8 A;  2J6T A;  4O3Q A;  3V6K A;  7ICE A;  3ZDB A;  5HP4 A;  3RR7 A;  2C22 A;  4UBC A;  2IHN A;  5III A;  1D9D A;  4FO6 A;  3PNC A;  1SL2 A;  7ICK A;  8ICN A;  8ICC A;  8ICR A;  8ICS A;  4ECT A;  3RH5 A;  4YXM A;  8ICA A;  5J2E A;  3JPN A;  3C1Z A;  2RDJ A;  5KFW A;  4X5V A;  2VA2 A;  4O5C A;  4DL2 A;  2HW3 A;  1NK5 A;  1WCN A;  2PI4 A;  3HW8 A;  3PX6 A;  5L1I A;  2BKE A;  5C5J A;  1TK5 A;  2HVH A;  3V7J A;  3T5L A;  4P4P A;  7ICI A;  3M9M B;  2C28 A;  2MUT B;  4I2F A;  4IR1 A;  4EBC A;  3UXO A;  2ZJ8 A;  5KFI A;  3UQ2 A;  1KRP A;  2HHX A;  1Y88 A;  4XRH A;  3PW4 A;  5KFR A;  4DQS A;  2KFN A;  3FYH A;  5KFT A;  4R8U A;  2W9C B;  1T3N A;  8ICY A;  4FS2 A;  2DPI A;  2FPK A;  4YP3 A;  4QWE A;  3PX0 A;  3QEA Z;  8ICG A;  1A77 A;  4DWI A;  2ASD A;  4QZA A;  3GV8 B;  1ZQW A;  4DL4 A;  3C2M A;  3PW5 A;  1NJX A;  3SYZ A;  1ZQT A;  3H8S A;  4DL7 A;  1PZN A;  1JX4 A;  1NK0 A;  3MFH A;  5KFL A;  5J0U A;  3UXN A;  3MBY A;  4BGD A;  4B9L A;  2WTF A;  4J9M A;  3KHL A;  4F5N A;  5KFU A;  5HML A;  3QZ7 A;  4NXZ A;  4F4Y A;  1ZQI A;  1ZQE A;  1JXE A;  1RXW A;  5BOL A;  2Q0Z X;  1D8L A;  2XCP A;  2BCU A;  5DQI A;  4RNN A;  2DPJ A;  4Z6F A;  3GIL A;  1ZQV A;  4NLZ A;  1NK6 A;  8ICX A;  5EOZ A;  4IRC A;  2PFO A;  5KFY A;  1L3S A;  4QZF A;  2R8H A;  4GXI A;  4UB1 A;  2R8K A;  8ICO A;  9ICV A;  3OHA A;  3RAX A;  4KLO A;  2AGP A;  1RYR A;  9ICJ A;  4KIT B;  2ASJ A;  2UVR A;  2BQR A;  2KN7 A;  1KEJ A;  5DG7 A;  4JV2 A;  5J2H A;  4DOC A;  4IQW A;  1S9F A;  4RQ3 A;  5KFQ A;  2JEI A;  2BHN A;  2JZB A;  4DSK A;  9ICP A;  3OSP A;  3ORY A;  1S97 A;  4JV0 A;  2JEJ A;  9ICC A;  3Q8Q B;  2BPC A;  5KFO A;  3AU2 A;  3OGU A;  1SKR A;  4GXJ A;  4F2S A;  5L9X A;  2VAN A;  3C1Y A;  4PPX A;  4EZ6 A;  4F92 B;  2PI5 A;  3V7L A;  4QZD A;  4PGX A;  8ICM A;  3UXP A;  3ZD8 A;  2AU0 A;  4BDP A;  1S76 D;  3JPQ A;  4F3O A;  1CUK A;  8ICV A;  1K1Q A;  2GWS A;  2FMP A;  4ECS A;  1QSY A;  4RQ6 A;  4PHD A;  1ZQF A;  2C2D A;  4DQP A;  3SI8 A;  3ISB A;  4I2C A;  4M0A A;  1TFR A;  4JV1 A;  1U9L A;  1NK4 A;  2KZM A;  4UBB A;  3SV3 A;  5HHH A;  3ZDE A;  1NJY A;  1KFS A;  9ICO A;  4Z6D A;  4DL3 A;  4JWM A;  1XSN A;  2PFN A;  5DBA A;  4KMU A;  1BPX A;  4G3I A;  1UT5 A;  4KLS A;  2VA3 A;  5KFG A;  1L5U A;  7ICQ A;  4F93 B;  4I2H A;  3PV8 A;  3HX0 A;  3MGI A;  2ATL A;  2P66 A;  4PH5 A;  5KT5 A;  1JXL A;  7ICV A;  2IBK A;  1IM4 A;  4KLU A;  2HHV A;  5KT2 A;  2AGQ A;  1XSL A;  2MUT A;  3C2K A;  1U49 A;  2F1I A;  1KDH A;  4F4K A;  9ICH A;  3RH4 A;  3BQ1 A;  4KLD A;  3LDA A;  4C8M A;  5J2I A;  3RJJ A;  4NLN A;  2Y1J A;  8ICE A;  9ICR A;  1T4G A;  1XO1 A;  3Q8L A;  4KLL A;  4M2Y A;  4DQR A;  5KFD A;  4RPY A;  4KLI A;  3PR5 B;  2NRW A;  1ZQG A;  4M6W A;  7ICR A;  5D49 A;  3TQ1 A;  1S0N A;  3EWA A;  3HWT A;  1ZQA A;  2BCS A;  3BQ0 A;  1D8Y A;  2ZJ5 A;  5KFV A;  4UB2 A;  2BDP A;  5DQG A;  2Y1I A;  1X9W A;  1ZQM A;  3GIJ A;  4HYK A;  1XSP A;  1XU4 A;  1RYS A;  5IIK A;  1NKC A;  1WCL A;  1SZP A;  1X9S A;  2XGP A;  4DLE A;  5J0S A;  4J9S A;  4I28 A;  1U47 A;  3TAR A;  1BVS A;  4DFM A;  5J2B A;  3KHH A;  1RPL A;  1ZQB A;  2W9B A;  3AUO A;  4ECU A;  9ICK A;  4GC6 A;  4F4X A;  4P2H A;  2LYH A;  4P4O A;  1TV9 A;  2BGW A;  3RBD A;  5J0X A;  1KTQ A;  1ZQX A;  5F9L A;  3EZ5 A;  3GIM A;  3H4D A;  1X9M A;  2XGQ A;  4K4H A;  4MF2 A;  2M9N A;  4F50 A;  1LV5 A;  2J6S A;  4ECX A;  3RJH A;  4E0D A;  4YD2 A;  2UVW A;  4O3P A;  3B0Y A;  3RJE A;  2PXI A;  4ECW A;  3PW2 A;  1TK8 A;  4PHE A;  2NRT A;  3G6V A;  4B9N A;  1BPB A;  2IHM A;  4RPZ A;  5JUM A;  4XUS A;  5IIM A;  4KLJ A;  1BPE A;  7ICP A;  3C5F A;  1ARO P;  4B9S A;  5DGB A;  4DSJ A;  4ECY A;  4LVS A;  4RUA A;  1A76 A;  3M9N B;  2ZTD A;  9ICM A;  1MSW D;  5CP2 A;  4J9L A;  4KLF A;  4QZE A;  1TVA A;  3PML A;  2FLN A;  3M8R A;  5KG2 A;  4ECV A;  3AU6 A;  5KFS A;  3NTU A;  2J6U A;  4RQ4 A;  4UAZ A;  4MF8 A;  2ALZ A;  3V72 A;  4PGY A;  4J9O A;  4KLQ A;  4YCX A;  4DLG A;  3OHB A;  4M9G A;  5DGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...