1Z00B

Solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
84
structure length
84
Chain Sequence
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 22
structure length 84
sequence length 84
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1z00B00
1SL0A 1T8EA 9ICKA 4PHDA 1KLNA 4PGXA 3EYZA 4KLEA 1BPDA 2JEIA 1RYSA 1V9PA 1Z00B 4IQUA 2IHNA 4QW8A 5CHGA 4O3SA 1ZQMA 1JXEA 4PH5A 5J0PA 1ZQGA 2ZUDA 4UAYA 3PW0A 5HP4A 9ICJA 1UA0A 5D49A 3JPQA 1S0MA 3K4GA 4RQ2A 1NK5A 1L3VA 4MEYA 8ICVA 8ICLA 8ICZA 3FDSA 3GILA 3K75D 4FS2A 5IIJA 3RBEA 4IQWA 4F2RA 3JPRA 7ICRA 3C2LA 2HW3A 2BPCA 5IIKA 4JV2A 2NRZA 3T3FA 5KFNA 4KLJA 9ICWA 1ZQBA 3GIJA 1N56A 2ZJ5A 4PHAA 2AGQA 4F5NA 3PNCA 4NM1A 5BPCA 8ICMA 5KFMA 5L9XA 3ISBA 1ZQZA 1X9MA 3UXNA 5KT7A 1ZQDA 4K4HA 1HUOA 1RYRA 5J2EA 5IIMA 1ZYQA 2UVUA 3RJIA 4YR2A 3ZDAA 4B9NA 4B9TA 3RR8A 1XC9A 5J2BA 2UVVA 4NLGA 3NGDA 2HHWA 4DLEA 3TANA 7ICUA 4JV1A 7ICPA 3GV7B 2ASDA 3LK9A 3ZDEA 2UVRA 4QWEA 3M8RA 3H8WA 1S10A 3PX4A 5HNKA 1TV9A 1TK5A 5BOMA 1TK8A 2P6UA 2FLNA 4QWDA 4I2BA 1HJPA 2B21A 7ICIA 3UQ2A 2Y1JA 9ICCA 1WCLA 4LZDA 2BQRA 7ICHA 5KFLA 2WTFA 8ICSA 4Q8EA 4FS1A 9ICHA 2VA3A 4XRHA 4RU9A 3Q8SB 4DOBA 4O5CA 4QWBA 4RPXA 1D8YA 4R64A 1MQ3A 4LZGA 4M9HA 4J9LA 4QZ9A 1BPBA 3MDAA 3EWAA 1NKEA 4I2GA 4F5QA 1COOA 1NJYA 4EZ6A 3MFHA 4P4MA 4JWNA 1SL1A 5J0TA 4DL7A 4Z6EA 3RRHA 4QWAA 3M9OB 5KFGA 2RDIA 1BPEA 4F4KA 1BVSA 4ECXA 2DPJA 3ZDCA 5BOLA 4UB4A 4UQGA 5J0WA 1DGSA 4M9JA 3Q8RB 2BPFA 4DWIA 3RB0A 3M8SA 2XO7A 5CP2A 5L1LA 3HPOA 2R8KA 5IIOA 4RQ5A 9ICPA 3PR4A 2AGPA 3GQCA 5DQGA 4ED7A 2IMWP 1SKRA 1L5UA 4QZAA 2AQ0A 1NK0A 4KLFA 1KEJA 4YXMA 5J0OA 9ICQA 5J0YA 3C21A 4F92B 4YN4A 1S97A 1X2IA 4Q44A 9ICLA 4ECTA 7ICJA 2XGQA 1TAQA 4ED6A 1PZNA 2V4RA 5J0QA 3G6XA 2HVIA 4RZRA 4Z6DA 3TQ1A 2MUTB 3TAQA 3HP6A 4DLGA 4JV0A 2XCAA 1DOQA 4DQSA 2P66A 5J2FA 4YQWA 3QEAZ 1T7PA 3PW2A 1NK9A 1L3UA 5KT6A 5DB9A 5KFUA 1TKDA 5HHIA 3Q8PB 2DFLA 3M9MB 3V7JA 1XWLA 4M2YA 1NK7A 5DBCA 3IM1A 3GIKA 4J9KA 5KT4A 9ICXA 2PFPA 5KT3A 1KFSA 5J2DA 2ATLA 8ICAA 4O9MA 2W9BA 2BCVA 4GXKA 4Q8FA 1IM4A 3PV8A 3UXPA 2KFZA 4KN7A 1C7YA 4R8UB 4RUCA 4NM2A 2XY6A 5DKWA 3GIIA 2ZTEA 2KZZA 5KFHA 3ORYA 4QZEA 1NJXA 2HHXA 2JZBA 5KFXA 5KT5A 4DQPA 3EZ5A 1IXRA 4M6WA 3PMNA 4ECUA 2W9AA 1KRPA 1WCNA 2JEFA 2BQ3A 2PI5A 2JEJA 3RR7A 3SI8A 9ICGA 2AGOA 3PR5B 4PHPA 4F4XA 2Y1IA 3PW7A 8ICHA 4XA5A 1XS9D 5KFDA 1U9LA 4DL2A 3PO4A 5EOZA 1CUKA 4MF8A 5L1JA 1KDHA 1S77D 5KFOA 1HUZA 1RZTA 4XQ8A 3Q8MA 4EBEA 4KN4A 3RB3A 5J0XA 3GFKB 5KFIA 4F91B 4FO6A 4YXJA 2FMSA 4M9NA 2J6UA 2BCQA 1JXLA 3TFSA 1U45A 1MQ2A 1L3SA 1JX4A 2FPMA 5J2JA 4B9MA 5F9NA 8ICXA 1B43A 3OGUA 4B9UA 4NXZA 3N97B 1JIHA 1H38A 5KG5A 9ICUA 3MGHA 2BGWA 4TUQA 3T5JA 3RJFA 5CR0A 4I28A 2A1JB 1XO1A 5DB6A 4DL4A 3PX6A 3QE9Y 4DL6A 5IINA 4YG2A 3EPIA 4M04A 2R8GA 2F1IA 2VA2A 2PFQA 4NLNA 9ICAA 4UAWA 3JPOA 4J9RA 4DF8A 8ICPA 2ZUCA 1NKCA 1D9FA 3V6KA 1X9WA 1ZQKA 3ZDBA 2DPIA 2BPGA 5DQIA 2KTQA 2H5XA 4TQRA 2KZMA 5KFRA 8ICOA 2W9CB 3JPNA 2BCRA 7ICSA 4Q43A 3BDPA 2FMPA 1RXWA 8ICWA 7ICOA 3FYHA 2FLPA 2FPLA 4KMUA 3OHBA 5IIIA 2PFOA 4BWJA 1NKBA 4IRDA 3ZD9A 1T3NA 4MFCA 4RNOA 5F9LA 4UAZA 3OJSA 4I27A 5KTQA 4J9NA 4DL3A 4J9QA 3OJUA 5DGBA 3JPPA 5CWRA 4GXJA 2HHQA 5EWFA 5HHHA 4DFMA 1QSLA 4Q45A 3GIMA 4KLTA 3M9NB 2R8IA 4UB2A 3BQ2A 1JMSA 3TARA 4C8NA 5DG7A 1A77A 4JUZA 4O3QA 4PGYA 3KHRA 1ZQQA 3PY8A 3MR3A 3SZ2A 2W8LA 2J6SA 2PXIA 3EPGA 4FBTA 4YMNA 3C2KA 8ICEA 1XSNA 3RTVA 4BWMA 4O5EA 4P2HA 8ICIA 3KHGA 3V6HA 5J0RA 5KFJA 1SZPA 5J2KA 2R8HA 2I1QA 1S9FA 2NRVA 1NJWA 4UBCA 3C1ZA 5DB7A 2P6RA 2JEGA 3C5FA 4ECSA 1ZQUA 2IA6A 4PPXA 4B9LA 4R63A 4KLMA 5KFFA 4IRCA 5DQHA 2KN7A 1XSPA 3BQ0A 4BXOB 5DLGA 4RQ3A 3QZ8A 4ECQA 1ZQWA 4RQ7A 1ZQCA 5EWEA 4LVSA 2AJQA 1CEZA 3QEBZ 4M9GA 3AU6A 4KTQA 4DQIA 1BPXA 4KLDA 3HWTA 1X9SA 8ICBA 5CB1A 5EWGA 4J9SA 1KTQA 3PW5A 2C2RA 4I2HA 4I2AA 3JPSA 2HHTA 8ICJA 3V72A 1ZETA 8ICTA 3PX0A 3GDXA 4F4YA 9ICMA 3ZDDA 3KHLA 4HYKA 3BJYA 9ICEA 5KG7A 4K4IA 4ECYA 1S0OA 5DLFA 4RQ4A 4F4ZA 9ICNA 5J2CA 3H8SA 3RAQA 3H7IA 5CA7A 7ICGA 5KFEA 4DQRA 2F1HA 2ASLA 3V7LA 3ISCA 5J0SA 4EBDA 4O3RA 4RT3A 2KFNA 3ZD8A 4YD1A 3G6YA 2BDPA 1UT5A 4DSLA 3C5GA 1U4BA 3C1YA 7ICFA 9ICRA 1ZQOA 4C8LA 3UXOA 3QZ7A 3ISDA 2ZTDA 1MC8A 4RQ8A 4M6WB 4KITB 4J9PA 3AU2A 3SYZA 5IILA 4O5KA 2NRTA 1ZJNA 4PGQA 1KSPA 3RB4A 1S0NA 1RPLA 2NRXA 8ICYA 3LDAA 4IQTA 3MBYA 2C2EA 1U48A 2GWSA 9ICBA 4F5RA 1AROP 5DBAA 5KFYA 1ZQNA 5J29A 2MUTA 4CCHA 3HX0A 4I2CA 4ED1A 3IHQB 4YFKA 4QW9A 5J2IA 4I2EA 4DS4A 3PMLA 4G3IA 4TURA 4I29A 4RQ0A 5TZVA 4DO9A 3THVA 7ICTA 3B0XA 3LWLA 3MR5A 3Q8LA 7ICQA 4C8MA 4ED2A 3MGIA 3KHHA 4IR9A 3KTQA 1ZJMA 3OSNA 4YMMA 4EYIB 3TI0A 1LV5A 4F4WA 2XCPA 4YR0A 1BPYA 2I9GA 3GV8B 2V9WA 4NY8A 4KLSA 5KG6A 1NOMA 5J2AA 4J9MA 4IRKA 4DF4A 4R8UA 4QZFA 2PI4A 1ZQSA 2NRWA 4E0DA 3PVXA 1ZQJA 1QLNA 4O3OA 3TFRA 4I2FA 2W8KA 4ELTA 1A76A 8ICKA 1Z3EB 4RQ6A 2J6TA 2HVHA 1ZQEA 3MR6A 3ETLA 3JPTA 2BHNA 5HMMA 4ZH4A 4DFKA 4F5PA 4BGDA 8ICNA 4P4PA 1ZQLA 1NJZA 4B9VA 5KFKA 3Q8QB 4F93B 2XC9A 4QZHA 4X5VA 4EYHB 1ZQIA 5J0UA 4I2DA 4KLUA 1D8LA 1U49A 1TFRA 4FBUA 1Z00A 4YCXA 3MFIA 4C8OA 4GLXA 4MFAA 3OHAA 1NK4A 2FLLA 1BGXT 1SKSA 2VA8A 4B9SA 2AQ4A 1KFTA 5KFVA 4QZIA 5KFBA 2R8JA 5KFSA 3MDCA 4DL5A 2ISOA 5HMLA 2A1JA 5KFQA 2XY7A 4O3NA 3OSPA 3BQ1A 5D4BA 3N4MB 2ASJA 1NK6A 1QSSA 5DGAA 4I2JA 4GC7A 4KLIA 4KLHA 4DSEA 1EXNA 4QZBA 9ICTA 4PHEA 4IQVA 3EW9A 4ELVA 4EBCA 5KG4A 3RJEA 5DB8A 3RJJA 4ECWA 2W9CA 4DOAA 4MEXA 4IR1A 4XUSA 4JWMA 2ZTCA 3LWMA 3UQ0A 4TUSA 1SL2A 1ZQAA 4UBBA 4GXIA 2AU0A 8ICUA 1ZQHA 4DSFA 1ZQFA 3RBDA 9ICVA 2KZ3A 4RT2A 4GC6A 1ZQXA 4UB1A 1XU4A 5J2GA 4KLLA 3HT3A 7ICLA 1D9DA 4DFJA 7ICEA 4QZDA 2XGPA 1RXVA 1XSLA 4Z6FA 3T5KA 7ICVA 3RH4A 4DS5A 2PFNA 4DSKA 3AUOA 3RB6A 2C28A 4RUAA 2V4QA 3SV4A 1NK8A 2BR0A 1LB2B 2BQUA 1MSWD 5KG3A 4O0IA 1S0VA 7ICKA 4ECVA 2ZJAA 3GV5B 2ALZA 4RNNA 4M9LA 4KLOA 4EEYA 4RPZA 4QZ8A 2MAXA 2BKEA 4YMOA 5CJ7A 9ICFA 3SV3A 5DG9A 4F5OA 4F3OA 2UVWA 5L1KA 4TQSA 2VANA 4P4OA 3TAPA 2BCUA 3MABA 4KLGA 4RQ1A 2W9MA 3B0YA 1TK0A 4YVZA 1N48A 1T4GA 4QZCA 4KLQA 1ZQYA 1SKWA 4F8RA 5KFAA 2W9BB 1ZQPA 9ICOA 3RAXA 4MFFA 3H8JA 2ZJ8A 4EZ9A 1S76D 1K1SA 4DEZA 4YR3A 4BXOA 1Y88A 3RJKA 3BQTA 2ZUBA 4R66A 3MR2A 2F1JA 1TVAA 5KG1A 4UB3A 2JZBB 4MF2A 3T5LA 5DDYA 4NLKA 4ELUA 4DOCA 3H4DA 4O3PA 5L1IA 2XY5A 5KG2A 4J9OA 4YP3A 1UA1A 1TAUA 3C23A 8ICRA 1UT8A 5D46A 4DSJA 2IBKA 5DG8A 2HHVA 1U47A 3NTUA 4ED8A 3T5HA 3RH6A 1L3TA 4I2IA 1ZQTA 5KFWA 2FMQA 4C8KA 4F50A 1JN3A 2FPKA 2HHSA 8ICCA 3PO5A 4DSIA 1ZQVA 4ECRA 3V7KA 4ED3A 3E2EA 1ZQRA 1KFDA 3H4BA 2OWOA 4M0AA 9ICIA 4RPYA 3H40A 2RDJA 4K4GA 4DFPA 4YD2A 3V6JA 9ICSA 5C5JA 3PW4A 4R65A 3G6VA 2M9NA 5KG0A 5JUMA 5DDMA 1BPZA 3RJGA 4QZGA 5KFZA 5KT2A 4NLZA 8ICGA 2HHUA 8ICQA 5KFPA 2C22A 2IHMA 4TUPA 4M47A 4Z6CA 4UB5A 8ICFA 3Q8KA 3C2MA 4DQQA 2BCSA 2LYHA 5KFTA 3RH5A 2ISPA 4BDPA 5J2HA 7ICNA 1B22A 3RJHA 4JK1A 4F2SA 2C2DA 4ECZA 7ICMA 3RRGA 2Q0ZX 1K1QA 1QTMA 4QWCA 4ED0A 3UPQA 5DBBA 4RNMA 5KFCA 3HW8A 1QSYA
chains in the Genus database with same CATH superfamily
1T8EA 5CEHA 3LVVA 4RQMA 1BPDA 1RYSA 2IHNA 4QW8A 3SAHA 1J97A 4UAYA 5HP4A 1UA0A 4RQ2A 1OUQA 5KNIA 3FDSA 3JPRA 3C2LA 2BPCA 5KFNA 4KLJA 3GIJA 2ZJ5A 8ICMA 3UXNA 1HUOA 1RYRA 5IIMA 2QB0A 4YR2A 3WK8A 2I5HA 3C28A 3RR8A 2LI6A 2H3VA 4JV1A 7ICPA 3ZDEA 3C29A 2FLNA 4U6PA 4I2BA 3UQ2A 2BQRA 3KBBA 3VCBA 4USAA 9ICHA 4RU9A 1D8YA 3EWAA 5ALYA 2JR5A 3NVYA 4DL7A 4F4KA 2XICA 1BVSA 3Q8RB 4DWIA 3RB0A 3M8SA 2WF6A 5CP2A 3HPOA 2AGPA 5DQGA 2K8CB 1SKRA 2ZIUB 4U7CA 3HILA 5J0OA 5J0YA 4F92B 1RYUA 1X2IA 4ECTA 1ZD5A 2XGQA 1HEKA 1PZNA 3M6ZA 5EE1A 2V4RA 3NRWA 1KL9A 3TQ1A 3TAQA 3HP6A 4Y2VA 3SEIA 1NK9A 1TKDA 3Q8PB 1XWLA 1NK7A 1D8BA 5KT4A 2PFPA 2F2AB 4O9MA 4GXKA 4Y2RA 4ICAA 4QIWF 1C7YA 2Y9UA 4NM2A 5AIAA 5KFHA 2K60A 2HHXA 1NJXA 5AK4A 5KFXA 1COKA 1RQLA 4Y2UA 3EZ5A 1IXRA 2W9AA 1KRPA 9ICGA 3ALRA 4PHPA 8ICHA 2KVSA 5AM4A 4KX3A 5L1JA 3N7RC 3B9JA 1HUZA 3RB3A 3OTQA 1BNOA 5J2JA 3MGHA 3RJFA 4TUQA 3T5JA 5CR0A 1XO1A 2LPEA 3KKAC 3SENA 4DL6A 4M04A 2F1IA 3ZDBA 3V6KA 2D8CA 3BS7A 5KFRA 2BCRA 4Q43A 1FO4A 4C4RA 4KMUA 2PFOA 1NKBA 4MFCA 4BUGA 4UAZA 2LM4A 2ZIWB 3U26A 4GXJA 5HHHA 3GIMA 4QNLA 3M7DA 4KLTA 4F71A 5DG7A 2ZIXB 4PGYA 3MR3A 1TE2A 1VJ5A 3EPGA 3AEVA 2MRLA 3KHGA 5J0RA 5KFJA 1JALA 2WF8A 1S9FA 4PL1A 1Q46A 3QX7A 2IA6A 4B9LA 1X66A 2XIDA 4KLMA 5DQHA 1X6JA 5AI4A 4RQ3A 4LVSA 2W03A 3QEBZ 5EE9A 1UQVA 4M9GA 1P7DA 1X9SA 8ICBA 5EWGA 2C2RA 3JPSA 3QU2A 3V72A 2DF4B 1ZETA 1NZPA 2VKQA 3DEEA 5AI8A 4F4YA 2W11A 5K4LA 5ALGA 1N61A 5AI9A 4F4ZA 1UHUA 5CA7A 5KFEA 2GH1A 2Y9TA 1UT5A 2G0AA 4NJ8A 4US9A 3H0RB 1ZQOA 3UXOA 3CW2C 3QZ7A 1MC8A 3TKAA 4J9PA 3AU2A 3SYZA 4LJXA 4O5KA 1ZJNA 5H2FU 1S0NA 2NRXA 3QU7A 3MBYA 2C2EA 2RHFA 5KFYA 2VJ4A 4ED1A 5E79U 4Y2JA 4I2EA 4G3IA 4RQ0A 3THVA 3CP8A 3MR5A 5ALKA 4ED2A 3KHHA 3OSNA 3NVWA 5ALIA 5J2AA 4QZFA 2PI4A 1ZQSA 2YX8A 2K4HA 5AKKA 3PVXA 3UMBA 1QLNA 3AL0B 3TFRA 4ELTA 2HVHA 2J6TA 2BHNA 3L3FX 4F5PA 2G08A 4BGDA 4P4PA 4B9VA 1NJZA 4MHVA 4EYHB 5J0UA 1U49A 3CRXA 1BGXT 1SKSA 2VA8A 4B9SA 1KFTA 4QZIA 3MDCA 5HMLA 2EANA 2XY7A 2LYBA 5KAFU 4J03A 1FIQA 4KLHA 1EXNA 4PHEA 4IQVA 2OHFA 4ELVA 2OH2A 4ECWA 4IR1A 4XUSA 4JWMA 1SL2A 1ZQAA 1ZQHA 2IOFK 3QNMA 2KZ3A 4GC6A 4UB1A 5J2GA 2E1EA 1D9DA 2XGPA 1RXVA 1J2MA 1LB2B 3PZPA 4RUAA 5KL8B 4F72A 4O3MA 4M9LA 4RNNA 4EEYA 4RPZA 3SV3A 2OEHA 4DCCA 4F3OA 3TACB 2OYYA 2UVWA 4TQSA 3D2NA 4KLGA 4RQ1A 2HBKA 4YVZA 1N48A 2ES6A 1ZQYA 3QU5A 4UATA 1WYGA 3QYPA 4MFFA 3MGVA 3QUTA 4EZ9A 1K1SA 4DEZA 4BXOA 1ZD2P 5F3XB 4UB3A 2JZBB 4NLKA 4DOCA 5L1IA 3OPXA 4J9OA 4NLBA 2R18A 5DG8A 3RH6A 2FMQA 2FPKA 3NS1A 2E8PA 2LHTA 4C0ZA 3F2CA 1KFDA 4M0AA 2OWOA 3F5AA 2RDJA 5AKGA 5EE3A 9ICSA 3G6VA 5JUMA 1Q3VA 1BPZA 2DKZA 2IHMA 4M47A 4Z6CA 2HOIA 3RH5A 1DGJA 7ICNA 3K1RB 1B22A 3RJHA 2Q0ZX 1KKXA 4ED0A 1CRXA 3EYZA 3BS5B 1SWVA 2JEIA 1V9PA 1ZQMA 1JXEA 2WAQF 3JPQA 2K8BB 3K4GA 2PMZC 1L3VA 2OXOA 4QJFB 2PKEA 3K75D 4FS2A 4IQWA 2JH1A 2LKYA 2YY6A 2E5SA 1N56A 3WK6A 4F5NA 3SMVA 5BPCA 4NM1A 5KFMA 5L9XA 2WFAA 1ZQZA 1X9MA 5J2EA 3RJIA 1XC9A 5J2BA 3NGDA 7ICUA 3GV7B 4AP9A 2UVRA 1S10A 1TV9A 2Y0SF 2B21A 2Y1JA 4LZDA 4US8A 2WTFA 2AH5A 1UPHA 2VA3A 4XRHA 2F77X 4DOBA 4R64A 4LZGA 4M9HA 2CN1A 3MDAA 1NKEA 5ALPA 5J0TA 2WF5A 3RRHA 2KOBA 3M9OB 1DXSA 3ZDCA 5BOLA 3N28A 4M9JA 3WKEA 1DGSA 1O03A 2KHVA 4UB8U 2XO7A 5L1LA 1Q3UA 3PR4A 3GQCA 4ED7A 2H3IA 1V97A 5G5GA 2DBYA 2AQ0A 4KLFA 1A0PA 9ICQA 2H3ZA 3C21A 3QU4A 1S97A 1TAQA 2HVIA 4RZRA 2IOHA 4Z6DA 2MUTB 4JV0A 5J2FA 4YQWA 2CXYA 2EZYA 5KT6A 2DFLA 3I76A 4M2YA 5DBCA 2MSNA 5J2DA 2ATLA 1SIJA 2W9BA 2BCVA 3PV8A 1WWUA 2OCEA 3UXPA 2KFZA 4A8EA 4R8UB 2DQNB 4OJ6A 4BX9C 5KT5A 3PMNA 4ECUA 1WCNA 2F8KA 2AGOA 3KFUF 1XS9D 5EOZA 1CUKA 2W7OA 1KDHA 4P0QB 1MN8A 5J0XA 5KFIA 2FMSA 3WK7A 4M9NA 1JX4A 8ICXA 1MQ2A 1L3SA 1B43A 3N97B 1PVPA 3BZCA 1SV0A 5DB6A 4DL4A 2ESEA 4YG2A 4CNQA 4DF8A 2ZUCA 1ZQKA 2BPGA 4UAVA 2H5XA 2QB0B 5A0LA 3JPNA 2RP5A 7ICSA 2FMPA 2G07A 1ZRMA 8ICWA 2KIVA 1QQ7A 3FM9A 1T3NA 4RNOA 3OJSA 1NZBA 4J9QA 2VIXA 3QU9A 3SD7A 5DGBA 1RQNA 1PVQA 1T3QA 2JHDA 4DFMA 4Q45A 1QSLA 2R8IA 4UB2A 1JI7A 3BQ2A 4C8NA 4JUZA 4O3QA 3SQIA 3PY8A 3SZ2A 2W8LA 1GO3F 3C2KA 3RTVA 4BWMA 8ICIA 4CDGA 1PUZA 1ZD3A 5DB7A 4PPXA 1ZQUA 2EH9A 1N62A 2JRZA 5KFFA 3QZ8A 4ECQA 1BPXA 4KLDA 4CRXA 4I2HA 4I2AA 5J8YA 4NL9A 3GDXA 4P0PA 4JB3A 3BJYA 5KG7A 1MA7A 4K4IA 1S0OA 5DLFA 2E1FA 1Z1BA 2G09A 5ALUA 9ICNA 3H7IA 3T79A 7ICGA 2F1HA 2ASLA 1N60A 4O3RA 3O0FA 3G6YA 3PSFA 1U4BA 3C1YA 9ICRA 4AYBF 4KITB 2B0CA 2ZIUA 2NRTA 4PGQA 1KSPA 3RB4A 5AKLA 2ZIVB 2JV3A 3F5EA 2LMRA 1U48A 9ICBA 2KNJA 5J29A 4CCHA 3HX0A 4PZNA 4YFKA 1ZD4A 4FZLA 4I29A 4DO9A 5ALDA 3LWLA 4C8MA 3MGIA 4IR9A 4EYIB 3TI0A 2YMLA 4F4WA 4KLSA 4YR0A 3NUQA 2D6FC 2F8LA 4DF4A 1XO0A 2NRWA 4E0DA 2FE9A 4OJ5A 5AKIA 1ZQJA 4I2FA 2W8KA 1L7OA 1DRGA 1ZQEA 3JPTA 3IRUA 5HMMA 1OXJA 1FFVA 4C4TA 4DFKA 2EQYA 2YQEA 1VLBA 1ZQLA 1ZXIA 3D2SA 3Q8QB 4KLUA 1D8LA 1TFRA 1Z00A 4GLXA 3OHAA 2QLTA 1S5LU 1HIWA 2EZXA 5KFVA 2AHOB 2ISOA 1SXEA 4O3NA 3OSPA 3BQ1A 3N4MB 1QSSA 1NK6A 5DGAA 4I2JA 4GC7A 4DSEA 2JXJA 3EW9A 5ALMA 5KG4A 2ZTCA 2DWQA 4JMUA 5AM1A 4DSFA 9ICVA 2W3RA 4RT2A 1ZQXA 3CYMA 2QARA 1XU4A 3HT3A 2KSOB 7ICLA 5G5HA 2KKVA 3T5KA 2ZIWA 2KD1A 2PFNA 4DSKA 2V4QA 3SV4A 1MSWD 1S0VA 2ZJAA 2ALZA 4HAIA 4FE3A 4KLOA 2WB1F 1LKYB 3J81j 3TAPA 4IL6U 4P4OA 4FZMA 4FFDA 2HDOA 3B0YA 1T4GA 1J2NA 3WKAA 1SXDA 9ICOA 3RAXA 2ZJ8A 3BQTA 1UCVA 2ZUBA 1C20A 3MR2A 2KG5A 1TVAA 4DFDA 2E8MA 3PSTA 5KG2A 1QQ5A 5D46A 2F76X 4ED8A 3T5HA 1U47A 1L3TA 1ZQTA 3I1YA 5KFWA 4C8KA 4F50A 8ICCA 2HHSA 3PO5A 4DSIA 1ZQVA 5HR6A 4UAUA 4ED3A 9ICIA 4K4GA 2D3DA 3PSIA 4R65A 4B6JA 5KFZA 4EX7A 2C22A 3C2MA 4DQQA 2BCSA 4BDPA 5TISU 5J2HA 5ALTA 4F2SA 2C2DA 1QTMA 2NYVA 1X40A 2KICA 5DBBA 3HW8A 2GLEA 1QSYA 1SL0A 4PHDA 1KLNA 4IQUA 3E58A 3TADC 5CHGA 4O3SA 5AM3A 4PH5A 5J0PA 1O08A 2ZUDA 9ICJA 5D49A 1S0MA 8ICVA 3IDWA 3RBEA 2XI9A 3KOOA 5IIKA 2NRZA 3SAGA 2W04A 5EE0A 1ZQBA 2AGQA 3PNCA 1ECWA 3ISBA 2NO5A 4K4HA 3VC8A 4B9NA 1ZYQA 5ALSA 4BJQA 4CF4A 4NLGA 3TANA 4CGZA 3LK9A 1ZRNA 2DUYA 3M8RA 3H8WA 5HNKA 5BOMA 2DGZA 7ICHA 5KFLA 8ICSA 4O5CA 4QWBA 4RPXA 1MQ3A 4UW9A 5AIBA 4J9LA 4QZ9A 4F5QA 1NJYA 3WKDA 2RRDA 4P4MA 4JWNA 4Y2XA 1SL1A 4Z6EA 4CE6A 5KFGA 4UB4A 2JMGA 2O6KA 2H3QA 4KMOB 5IIOA 4RQ5A 2K4EA 3FAHA 3NVZA 2OM6A 4QZAA 3R9KA 3F2BA 3AM9A 1KEJA 4YXMA 2DKXA 4YN4A 4Q44A 9ICLA 5L1MA 2KK0A 7ICJA 2HMXA 2FJ6A 4DLGA 2XCAA 2P66A 1DOQA 4DQSA 2YB1A 1KN5A 2B6GA 1JRPA 3QEAZ 1T7PA 2EZZA 1L3UA 2XVTA 4EEKA 2GOLA 1N63A 3M9MB 3V7JA 3KKAA 3GIKA 4J9KA 5ALOA 1KFSA 8ICAA 4Q8FA 1IM4A 2WF7A 4RUCA 5ALJA 5DKWA 2XY6A 2ZTEA 2KZZA 4QZEA 2JZBA 1PK1A 4DQPA 4ACOA 4WJ3B 4M6WA 2JEFA 3QUBA 2BQ3A 3RR7A 3E0FA 2WF9A 1B0XA 4NV0A 4F4XA 3PW7A 3PO4A 5KFDA 2KJ8A 2AXTU 1RZTA 4XQ8A 3Q8MA 4EBEA 2YN4A 3GFKB 4FO6A 2BCQA 1JXLA 1U45A 2FPMA 3WK4A 1SV4A 4B9UA 4NXZA 2M0NA 2CPRA 1H38A 9ICUA 3LVWA 1IV8A 2BGWA 2A1JB 2EAMA 4Y2SA 3QE9Y 2ZXHA 1FEZA 5IINA 2R8GA 9ICAA 4UAWA 3JPOA 8ICPA 2KTQA 4EENA 4UB6U 2W9CB 1RM6C 4CF3A 1Z4OA 2G5HB 3FYHA 3HKZF 2FPLA 3OHBA 3D2QA 3QUCA 5IIIA 3BS5A 4BWJA 2FLPA 4IRDA 3ZD9A 2F44A 4ZOHC 4J9NA 3KD3A 1X42A 3BQ7A 3OJUA 3WK5A 1OW5A 3JPPA 5CWRA 1A77A 1ZQQA 1SWWA 3H0MB 2J6SA 2PXIA 4FBTA 4YMNA 8ICEA 4O5EA 4P2HA 4OCZA 4PL2A 2R8HA 2NRVA 1NJWA 4UBCA 2JEGA 3C5FA 4ECSA 3A0HU 1XSPA 2NV3A 5DLGA 4RQ7A 1ZQCA 5EWEA 1CEZA 2YMQA 3AU6A 4KTQA 3HWTA 2HOFA 3PW5A 2HHTA 2A1AA 4OD0A 3ZDDA 3KHLA 4HYKA 9ICEA 4ECYA 1NNLA 5J2CA 3RAQA 4DQRA 3V7LA 3DDHA 3ISCA 1V85A 1VDVA 4YD1A 2BDPA 4DSLA 3C5GA 5IILA 4PJ0U 3LDAA 1F0MA 5HR7A 4Y2YA 1AROP 2P35A 2WAQC 3SAFA 5DBAA 2MUTA 4I2CA 5J2IA 3PMLA 2KMDA 4TURA 7ICTA 3BZKA 3B0XA 5AHXA 1IG6A 1URJA 1ZJMA 1LV5A 2XCPA 2V9WA 2I9GA 1B4FA 1NOMA 4J9MA 4R8UA 5ALEA 3IP4B 1A76A 3H8MA 3AQEA 1Z3EB 4RQ6A 4ZH4A 2Y0SC 4OJPA 5C0YA 2XC9A 4QZHA 5AKJA 4P0QA 4YCXA 1NK4A 2R8JA 5KFSA 4DL5A 1JUDA 1Z4NA 1BNPA 2BZFA 1NI3A 2ASJA 2WHEA 1Z19A 4QZBA 5ALZA 1LVHA 4EBCA 3RJEA 3RJJA 4DOAA 4MEXA 4TUSA 4GXIA 8ICUA 2H3FA 4KLLA 4C7ZA 1QCKA 7ICEA 2HBLA 4Z6FA 3AUOA 8ICKA 5AICA 4P0PB 7ICKA 4ECVA 3GV5B 2BKEA 4YMOA 5CJ7A 3IN5A 5DG9A 4F5OA 2K4PA 2VANA 2FI1A 2W9MA 1TK0A 4QZCA 2RLTA 1KBUA 4F8RA 3WKCA 3LYSA 1ZQPA 3H8JA 4GIBA 2Z7JA 3RJKA 2KKPA 2F1JA 2VJ5A 3QXGA 2LYAA 1PVRA 4NLCA 4OO1J 1Z1VA 3NVVA 2Q4TA 2KHQA 4YP3A 1UA1A 1QH9A 2IBKA 1A6SA 2HHVA 3ICXA 2HBJA 5ALNA 3HJEA 1JN3A 3WU2U 1YZ6A 4ECRA 1ZQRA 3H4BA 4DFPA 1WUDA 2BDUA 5KG0A 5DDMA 5JU5A 2HI0A 5KT2A 4NLZA 2HHUA 4TUPA 4UB5A 3Q8KA 2F3NA 1L7NA 2LYHA 4JK1A 4ECZA 5AI0A 1K1QA 5AKEA 2ZIVA 4QWCA 5AKHA 4RNMA 2KE7A 1L7PA 9ICKA 4PGXA 1QQ6A 4KLEA 1Z00B 1ZQGA 3PW0A 1NK5A 4MEYA 8ICLA 8ICZA 3GILA 2LM1A 2W3SA 5IIJA 4F2RA 4PZOA 1N2XA 3NRZA 5ALFA 7ICRA 2HW3A 4JV2A 3T3FA 9ICWA 3AN1A 1N5WA 4PHAA 1ZQDA 5KL1B 5KT7A 2ODGA 3KZIU 1WG8A 2L5YA 3ZDAA 2UVUA 4B9TA 2QARB 5FP0A 2UVVA 2W43A 2HHWA 4DLEA 2JGAA 2YB4A 2ASDA 1L6NA 4QWEA 1TK8A 3PX4A 3L5KA 1TK5A 1KW4A 2P6UA 3KZXA 4QWDA 1HJPA 7ICIA 3UMCA 4Y2QA 1RDFA 1WCLA 1X9XA 9ICCA 4Q8EA 4FS1A 3Q8SB 2EDUA 1BPBA 3CNHA 4I2GA 1COOA 2YMPA 4EZ6A 2ZIXA 3MFHA 5AK6A 1FFUA 4QWAA 2RDIA 1BPEA 1K5OA 4QIWC 4AYBC 5B66U 4ECXA 2DPJA 4UQGA 5J0WA 2BPFA 2R8KA 2KSOA 4C7YA 2ZG6A 9ICPA 2GO7A 2IMWP 1L5UA 1NK0A 3IG8A 2HBMA 4G9BA 5JTIA 1ED1A 2W55A 2K89A 4ED6A 3G6XA 5J0QA 3F53A 1LKYA 3PW2A 2NO4A 1YT3A 5KFUA 5DB9A 5HHIA 9ICXA 3IM1A 5KT3A 3RF9A 5T14A 3D6JA 4KN7A 1KQQA 3UMGA 4GFJA 3GIIA 3ORYA 2RQ5A 1DK2A 2PI5A 2JEJA 3SI8A 5AK5A 3PR5B 2EAPA 2Y1IA 4XA5A 3ZI4A 4DL2A 1U9LA 4Y2PA 4MF8A 2IOFA 1S77D 5KFOA 1SB3C 4KN4A 3EUB2 4F91B 4EX6A 4YXJA 5CRXA 2J6UA 3TFSA 4B9MA 5F9NA 3OGUA 1JIHA 5KG5A 4I28A 4C80A 3PX6A 3EPIA 4NLNA 2VA2A 2PFQA 3I28A 4KX5A 4J9RA 1NKCA 2E8OA 1D9FA 1X9WA 1Q8KA 8ICQA 3L4PA 2DPIA 5DQIA 8ICOA 2KZMA 4TQRA 2E8NA 3BDPA 1RXWA 2A3VA 2HSZA 7ICOA 1CI4A 3H0LB 1XNSA 5F9LA 4I27A 5KTQA 4DL3A 5AK3A 1TAMA 4EELA 2WB1C 3M6KA 2HHQA 5EWFA 2ZXIA 2DL0A 1DK3A 3M9NB 1JMSA 3TARA 2PMZF 4RQNA 1SV0C 3KHRA 3DV9A 1XSNA 2W7PA 2YMMA 3V6HA 1SZPA 5J2KA 1V38A 2I1QA 3C1ZA 3M1YA 5AKYA 2P6RA 4R63A 3ETRA 4IRCA 3ONNA 2KN7A 4BXOB 3BQ0A 5ALHA 1ZQWA 1YZ7A 4OJOA 2E3TA 4DQIA 5JRTA 5CB1A 4J9SA 1KTQA 3WKBA 1N5XA 8ICJA 4OJLA 8ICTA 3PX0A 2HCFA 9ICMA 1AQ6A 3HRDD 3A0BU 4RQ4A 3H8SA 2MA1A 1WWVA 3IV6A 5J0SA 4EBDA 4RT3A 2KFNA 3ZD8A 3N7PD 7ICFA 4C8LA 1PK1B 5AKZA 3ISDA 2ZTDA 4RQ8A 2CRXA 4M6WB 5ALWA 2K8AA 4CF5A 1S8OA 2KV2A 1RPLA 2N1RA 8ICYA 4IQTA 2GWSA 4F5RA 5AM0A 5AKXA 1ZQNA 4IC9A 3MC1A 4C4SA 2FDRA 3IHQB 4QW9A 5J8YC 2G06A 4NL9C 4DS4A 1L7MA 5TZVA 4FZNA 3Q8LA 7ICQA 3F2DA 2KP7A 2JH7A 3KTQA 4YMMA 2AJQA 4NY8A 1BPYA 3PSPA 3GV8B 5KG6A 1PK3A 1L8OA 4IRKA 4O3OA 1F44A 3FC4A 3MR6A 3ETLA 1F5SA 8ICNA 5KFKA 4F93B 3WK9A 4X5VA 1ZQIA 4I2DA 4FBUA 3MFIA 4C8OA 1ZOLA 5AI5A 4MFAA 2FLLA 3N7SC 2AQ4A 5KFBA 2KJ5A 2A1JA 5ALQA 5KFQA 5B5EU 4UARA 1ZQ1C 5D4BA 4KLIA 1IIPA 9ICTA 5DB8A 3GU3A 2W9CA 2EAOA 1SZHA 3LWMA 3UQ0A 1SGGA 5GTHU 4UBBA 2AU0A 2W54A 1ZQFA 3RBDA 2QKQA 2I6XA 2LBOA 1L8LA 4DFJA 3QUQA 4QZDA 3IG5A 5ALRA 1XSLA 5AM5A 3RH4A 7ICVA 4DS5A 3GZFA 3NASA 3RB6A 2C28A 4Y2TA 1NK8A 2BR0A 2BQUA 5KG3A 4O0IA 5ALXA 4QZ8A 2MAXA 9ICFA 3SR6A 2A19A 4IS7A 5L1KA 2BCUA 3MABA 2KVCA 1T94A 1M6YA 4KLQA 2KIWA 3UM9A 3AQFA 1SKWA 5KFAA 2W9BB 1S76D 4YR3A 1Y88A 4R66A 5KG1A 4MF2A 3T5LA 5DDYA 2YTUA 4ELUA 5ALVA 3H4DA 4O3PA 3K1ZA 2XY5A 3AMZA 2K4IA 3TADA 1TAUA 3C23A 8ICRA 1UT8A 4DSJA 3NTUA 5KAIU 2KJ9A 4I2IA 2G5IB 5AI6A 2HOQA 1RG6A 3V7KA 3E2EA 2MU2A 4RPYA 3H40A 3S6JA 4YD2A 5ALLA 3V6JA 5C5JA 3PW4A 2M9NA 4UASA 1JROA 3RJGA 2KEYA 4QZGA 8ICGA 5KFPA 5GTIU 8ICFA 1X6IA 5KFTA 2ISPA 3HKZC 5AM2A 3ED5A 7ICMA 3RRGA 3RFAA 4NWIA 2QB1A 3UPQA 5KFCA
chains in the Genus database with same CATH topology
1SL0A 1T8EA 9ICKA 4PHDA 1KLNA 4PGXA 3EYZA 4KLEA 1BPDA 2JEIA 1RYSA 1V9PA 1Z00B 4IQUA 2IHNA 4QW8A 5CHGA 4O3SA 1ZQMA 1JXEA 4PH5A 5J0PA 1ZQGA 2ZUDA 4UAYA 3PW0A 5HP4A 9ICJA 1UA0A 5D49A 3JPQA 1S0MA 3K4GA 4RQ2A 1NK5A 1L3VA 4MEYA 8ICVA 8ICLA 8ICZA 3FDSA 3GILA 3K75D 4FS2A 5IIJA 3RBEA 4IQWA 4F2RA 3JPRA 7ICRA 3C2LA 2HW3A 2BPCA 5IIKA 4JV2A 2NRZA 3T3FA 5KFNA 4KLJA 9ICWA 1ZQBA 3GIJA 1N56A 2ZJ5A 4PHAA 2AGQA 4F5NA 3PNCA 4NM1A 5BPCA 8ICMA 5KFMA 5L9XA 3ISBA 1ZQZA 1X9MA 3UXNA 5KT7A 1ZQDA 4K4HA 1HUOA 1RYRA 5J2EA 5IIMA 1ZYQA 2UVUA 3RJIA 4YR2A 3ZDAA 4B9NA 4B9TA 3RR8A 1XC9A 5J2BA 2UVVA 4NLGA 3NGDA 2HHWA 4DLEA 3TANA 7ICUA 4JV1A 7ICPA 3GV7B 2ASDA 3LK9A 3ZDEA 2UVRA 4QWEA 3M8RA 3H8WA 1S10A 3PX4A 5HNKA 1TV9A 1TK5A 5BOMA 1TK8A 2P6UA 2FLNA 4QWDA 4I2BA 1HJPA 2B21A 7ICIA 3UQ2A 2Y1JA 9ICCA 1WCLA 4LZDA 2BQRA 7ICHA 5KFLA 2WTFA 8ICSA 4Q8EA 4FS1A 9ICHA 2VA3A 4XRHA 4RU9A 3Q8SB 4DOBA 4O5CA 4QWBA 4RPXA 1D8YA 4R64A 1MQ3A 4LZGA 4M9HA 4J9LA 4QZ9A 1BPBA 3MDAA 3EWAA 1NKEA 4I2GA 4F5QA 1COOA 1NJYA 4EZ6A 3MFHA 4P4MA 4JWNA 1SL1A 5J0TA 4DL7A 4Z6EA 3RRHA 4QWAA 3M9OB 5KFGA 2RDIA 1BPEA 4F4KA 1BVSA 4ECXA 2DPJA 3ZDCA 5BOLA 4UB4A 4UQGA 5J0WA 1DGSA 4M9JA 3Q8RB 2BPFA 4DWIA 3RB0A 3M8SA 2XO7A 5CP2A 5L1LA 3HPOA 2R8KA 5IIOA 4RQ5A 9ICPA 3PR4A 2AGPA 3GQCA 5DQGA 4ED7A 2IMWP 1SKRA 1L5UA 4QZAA 2AQ0A 1NK0A 4KLFA 1KEJA 4YXMA 5J0OA 9ICQA 5J0YA 3C21A 4F92B 4YN4A 1S97A 1X2IA 4Q44A 9ICLA 4ECTA 7ICJA 2XGQA 1TAQA 4ED6A 1PZNA 2V4RA 5J0QA 3G6XA 2HVIA 4RZRA 4Z6DA 3TQ1A 2MUTB 3TAQA 3HP6A 4DLGA 4JV0A 2XCAA 1DOQA 4DQSA 2P66A 5J2FA 4YQWA 3QEAZ 1T7PA 3PW2A 1NK9A 1L3UA 5KT6A 5DB9A 5KFUA 1TKDA 5HHIA 3Q8PB 2DFLA 3M9MB 3V7JA 1XWLA 4M2YA 1NK7A 5DBCA 3IM1A 3GIKA 4J9KA 5KT4A 9ICXA 2PFPA 5KT3A 1KFSA 5J2DA 2ATLA 8ICAA 4O9MA 2W9BA 2BCVA 4GXKA 4Q8FA 1IM4A 3PV8A 3UXPA 2KFZA 4KN7A 1C7YA 4R8UB 4RUCA 4NM2A 2XY6A 5DKWA 3GIIA 2ZTEA 2KZZA 5KFHA 3ORYA 4QZEA 1NJXA 2HHXA 2JZBA 5KFXA 5KT5A 4DQPA 3EZ5A 1IXRA 4M6WA 3PMNA 4ECUA 2W9AA 1KRPA 1WCNA 2JEFA 2BQ3A 2PI5A 2JEJA 3RR7A 3SI8A 9ICGA 2AGOA 3PR5B 4PHPA 4F4XA 2Y1IA 3PW7A 8ICHA 4XA5A 1XS9D 5KFDA 1U9LA 4DL2A 3PO4A 5EOZA 1CUKA 4MF8A 5L1JA 1KDHA 1S77D 5KFOA 1HUZA 1RZTA 4XQ8A 3Q8MA 4EBEA 4KN4A 3RB3A 5J0XA 3GFKB 5KFIA 4F91B 4FO6A 4YXJA 2FMSA 4M9NA 2J6UA 2BCQA 1JXLA 3TFSA 1U45A 1MQ2A 1L3SA 1JX4A 2FPMA 5J2JA 4B9MA 5F9NA 8ICXA 1B43A 3OGUA 4B9UA 4NXZA 3N97B 1JIHA 1H38A 5KG5A 9ICUA 3MGHA 2BGWA 4TUQA 3T5JA 3RJFA 5CR0A 4I28A 2A1JB 1XO1A 5DB6A 4DL4A 3PX6A 3QE9Y 4DL6A 5IINA 4YG2A 3EPIA 4M04A 2R8GA 2F1IA 2VA2A 2PFQA 4NLNA 9ICAA 4UAWA 3JPOA 4J9RA 4DF8A 8ICPA 2ZUCA 1NKCA 1D9FA 3V6KA 1X9WA 1ZQKA 3ZDBA 2DPIA 2BPGA 5DQIA 2KTQA 2H5XA 4TQRA 2KZMA 5KFRA 8ICOA 2W9CB 3JPNA 2BCRA 7ICSA 4Q43A 3BDPA 2FMPA 1RXWA 8ICWA 7ICOA 3FYHA 2FLPA 2FPLA 4KMUA 3OHBA 5IIIA 2PFOA 4BWJA 1NKBA 4IRDA 3ZD9A 1T3NA 4MFCA 4RNOA 5F9LA 4UAZA 3OJSA 4I27A 5KTQA 4J9NA 4DL3A 4J9QA 3OJUA 5DGBA 3JPPA 5CWRA 4GXJA 2HHQA 5EWFA 5HHHA 4DFMA 1QSLA 4Q45A 3GIMA 4KLTA 3M9NB 2R8IA 4UB2A 3BQ2A 1JMSA 3TARA 4C8NA 5DG7A 1A77A 4JUZA 4O3QA 4PGYA 3KHRA 1ZQQA 3PY8A 3MR3A 3SZ2A 2W8LA 2J6SA 2PXIA 3EPGA 4FBTA 4YMNA 3C2KA 8ICEA 1XSNA 3RTVA 4BWMA 4O5EA 4P2HA 8ICIA 3KHGA 3V6HA 5J0RA 5KFJA 1SZPA 5J2KA 2R8HA 2I1QA 1S9FA 2NRVA 1NJWA 4UBCA 3C1ZA 5DB7A 2P6RA 2JEGA 3C5FA 4ECSA 1ZQUA 2IA6A 4PPXA 4B9LA 4R63A 4KLMA 5KFFA 4IRCA 5DQHA 2KN7A 1XSPA 3BQ0A 4BXOB 5DLGA 4RQ3A 3QZ8A 4ECQA 1ZQWA 4RQ7A 1ZQCA 5EWEA 4LVSA 2AJQA 1CEZA 3QEBZ 4M9GA 3AU6A 4KTQA 4DQIA 1BPXA 4KLDA 3HWTA 1X9SA 8ICBA 5CB1A 5EWGA 4J9SA 1KTQA 3PW5A 2C2RA 4I2HA 4I2AA 3JPSA 2HHTA 8ICJA 3V72A 1ZETA 8ICTA 3PX0A 3GDXA 4F4YA 9ICMA 3ZDDA 3KHLA 4HYKA 3BJYA 9ICEA 5KG7A 4K4IA 4ECYA 1S0OA 5DLFA 4RQ4A 4F4ZA 9ICNA 5J2CA 3H8SA 3RAQA 3H7IA 5CA7A 7ICGA 5KFEA 4DQRA 2F1HA 2ASLA 3V7LA 3ISCA 5J0SA 4EBDA 4O3RA 4RT3A 2KFNA 3ZD8A 4YD1A 3G6YA 2BDPA 1UT5A 4DSLA 3C5GA 1U4BA 3C1YA 7ICFA 9ICRA 1ZQOA 4C8LA 3UXOA 3QZ7A 3ISDA 2ZTDA 1MC8A 4RQ8A 4M6WB 4KITB 4J9PA 3AU2A 3SYZA 5IILA 4O5KA 2NRTA 1ZJNA 4PGQA 1KSPA 3RB4A 1S0NA 1RPLA 2NRXA 8ICYA 3LDAA 4IQTA 3MBYA 2C2EA 1U48A 2GWSA 9ICBA 4F5RA 1AROP 5DBAA 5KFYA 1ZQNA 5J29A 2MUTA 4CCHA 3HX0A 4I2CA 4ED1A 3IHQB 4YFKA 4QW9A 5J2IA 4I2EA 4DS4A 3PMLA 4G3IA 4TURA 4I29A 4RQ0A 5TZVA 4DO9A 3THVA 7ICTA 3B0XA 3LWLA 3MR5A 3Q8LA 7ICQA 4C8MA 4ED2A 3MGIA 3KHHA 4IR9A 3KTQA 1ZJMA 3OSNA 4YMMA 4EYIB 3TI0A 1LV5A 4F4WA 2XCPA 4YR0A 1BPYA 2I9GA 3GV8B 2V9WA 4NY8A 4KLSA 5KG6A 1NOMA 5J2AA 4J9MA 4IRKA 4DF4A 4R8UA 4QZFA 2PI4A 1ZQSA 2NRWA 4E0DA 3PVXA 1ZQJA 1QLNA 4O3OA 3TFRA 4I2FA 2W8KA 4ELTA 1A76A 8ICKA 1Z3EB 4RQ6A 2J6TA 2HVHA 1ZQEA 3MR6A 3ETLA 3JPTA 2BHNA 5HMMA 4ZH4A 4DFKA 4F5PA 4BGDA 8ICNA 4P4PA 1ZQLA 1NJZA 4B9VA 5KFKA 3Q8QB 4F93B 2XC9A 4QZHA 4X5VA 4EYHB 1ZQIA 5J0UA 4I2DA 4KLUA 1D8LA 1U49A 1TFRA 4FBUA 1Z00A 4YCXA 3MFIA 4C8OA 4GLXA 4MFAA 3OHAA 1NK4A 2FLLA 1BGXT 1SKSA 2VA8A 4B9SA 2AQ4A 1KFTA 5KFVA 4QZIA 5KFBA 2R8JA 5KFSA 3MDCA 4DL5A 2ISOA 5HMLA 2A1JA 5KFQA 2XY7A 4O3NA 3OSPA 3BQ1A 5D4BA 3N4MB 2ASJA 1NK6A 1QSSA 5DGAA 4I2JA 4GC7A 4KLIA 4KLHA 4DSEA 1EXNA 4QZBA 9ICTA 4PHEA 4IQVA 3EW9A 4ELVA 4EBCA 5KG4A 3RJEA 5DB8A 3RJJA 4ECWA 2W9CA 4DOAA 4MEXA 4IR1A 4XUSA 4JWMA 2ZTCA 3LWMA 3UQ0A 4TUSA 1SL2A 1ZQAA 4UBBA 4GXIA 2AU0A 8ICUA 1ZQHA 4DSFA 1ZQFA 3RBDA 9ICVA 2KZ3A 4RT2A 4GC6A 1ZQXA 4UB1A 1XU4A 5J2GA 4KLLA 3HT3A 7ICLA 1D9DA 4DFJA 7ICEA 4QZDA 2XGPA 1RXVA 1XSLA 4Z6FA 3T5KA 7ICVA 3RH4A 4DS5A 2PFNA 4DSKA 3AUOA 3RB6A 2C28A 4RUAA 2V4QA 3SV4A 1NK8A 2BR0A 1LB2B 2BQUA 1MSWD 5KG3A 4O0IA 1S0VA 7ICKA 4ECVA 2ZJAA 3GV5B 2ALZA 4RNNA 4M9LA 4KLOA 4EEYA 4RPZA 4QZ8A 2MAXA 2BKEA 4YMOA 5CJ7A 9ICFA 3SV3A 5DG9A 4F5OA 4F3OA 2UVWA 5L1KA 4TQSA 2VANA 4P4OA 3TAPA 2BCUA 3MABA 4KLGA 4RQ1A 2W9MA 3B0YA 1TK0A 4YVZA 1N48A 1T4GA 4QZCA 4KLQA 1ZQYA 1SKWA 4F8RA 5KFAA 2W9BB 1ZQPA 9ICOA 3RAXA 4MFFA 3H8JA 2ZJ8A 4EZ9A 1S76D 1K1SA 4DEZA 4YR3A 4BXOA 1Y88A 3RJKA 3BQTA 2ZUBA 4R66A 3MR2A 2F1JA 1TVAA 5KG1A 4UB3A 2JZBB 4MF2A 3T5LA 5DDYA 4NLKA 4ELUA 4DOCA 3H4DA 4O3PA 5L1IA 2XY5A 5KG2A 4J9OA 4YP3A 1UA1A 1TAUA 3C23A 8ICRA 1UT8A 5D46A 4DSJA 2IBKA 5DG8A 2HHVA 1U47A 3NTUA 4ED8A 3T5HA 3RH6A 1L3TA 4I2IA 1ZQTA 5KFWA 2FMQA 4C8KA 4F50A 1JN3A 2FPKA 2HHSA 8ICCA 3PO5A 4DSIA 1ZQVA 4ECRA 3V7KA 4ED3A 3E2EA 1ZQRA 1KFDA 3H4BA 2OWOA 4M0AA 9ICIA 4RPYA 3H40A 2RDJA 4K4GA 4DFPA 4YD2A 3V6JA 9ICSA 5C5JA 3PW4A 4R65A 3G6VA 2M9NA 5KG0A 5JUMA 5DDMA 1BPZA 3RJGA 4QZGA 5KFZA 5KT2A 4NLZA 8ICGA 2HHUA 8ICQA 5KFPA 2C22A 2IHMA 4TUPA 4M47A 4Z6CA 4UB5A 8ICFA 3Q8KA 3C2MA 4DQQA 2BCSA 2LYHA 5KFTA 3RH5A 2ISPA 4BDPA 5J2HA 7ICNA 1B22A 3RJHA 4JK1A 4F2SA 2C2DA 4ECZA 7ICMA 3RRGA 2Q0ZX 1K1QA 1QTMA 4QWCA 4ED0A 3UPQA 5DBBA 4RNMA 5KFCA 3HW8A 1QSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL0 A;  1T8E A;  9ICK A;  4PHD A;  1KLN A;  4PGX A;  3EYZ A;  4KLE A;  1BPD A;  2JEI A;  1RYS A;  1V9P A;  1Z00 B;  4IQU A;  2IHN A;  4QW8 A;  5CHG A;  4O3S A;  1ZQM A;  1JXE A;  4PH5 A;  5J0P A;  1ZQG A;  2ZUD A;  4UAY A;  3PW0 A;  5HP4 A;  9ICJ A;  1UA0 A;  5D49 A;  3JPQ A;  1S0M A;  3K4G A;  4RQ2 A;  1NK5 A;  1L3V A;  4MEY A;  8ICV A;  8ICL A;  8ICZ A;  3FDS A;  3GIL A;  3K75 D;  4FS2 A;  5IIJ A;  3RBE A;  4IQW A;  4F2R A;  3JPR A;  7ICR A;  3C2L A;  2HW3 A;  2BPC A;  5IIK A;  4JV2 A;  2NRZ A;  3T3F A;  5KFN A;  4KLJ A;  9ICW A;  1ZQB A;  3GIJ A;  1N56 A;  2ZJ5 A;  4PHA A;  2AGQ A;  4F5N A;  3PNC A;  4NM1 A;  5BPC A;  8ICM A;  5KFM A;  5L9X A;  3ISB A;  1ZQZ A;  1X9M A;  3UXN A;  5KT7 A;  1ZQD A;  4K4H A;  1HUO A;  1RYR A;  5J2E A;  5IIM A;  1ZYQ A;  2UVU A;  3RJI A;  4YR2 A;  3ZDA A;  4B9N A;  4B9T A;  3RR8 A;  1XC9 A;  5J2B A;  2UVV A;  4NLG A;  3NGD A;  2HHW A;  4DLE A;  3TAN A;  7ICU A;  4JV1 A;  7ICP A;  3GV7 B;  2ASD A;  3LK9 A;  3ZDE A;  2UVR A;  4QWE A;  3M8R A;  3H8W A;  1S10 A;  3PX4 A;  5HNK A;  1TV9 A;  1TK5 A;  5BOM A;  1TK8 A;  2P6U A;  2FLN A;  4QWD A;  4I2B A;  1HJP A;  2B21 A;  7ICI A;  3UQ2 A;  2Y1J A;  9ICC A;  1WCL A;  4LZD A;  2BQR A;  7ICH A;  5KFL A;  2WTF A;  8ICS A;  4Q8E A;  4FS1 A;  9ICH A;  2VA3 A;  4XRH A;  4RU9 A;  3Q8S B;  4DOB A;  4O5C A;  4QWB A;  4RPX A;  1D8Y A;  4R64 A;  1MQ3 A;  4LZG A;  4M9H A;  4J9L A;  4QZ9 A;  1BPB A;  3MDA A;  3EWA A;  1NKE A;  4I2G A;  4F5Q A;  1COO A;  1NJY A;  4EZ6 A;  3MFH A;  4P4M A;  4JWN A;  1SL1 A;  5J0T A;  4DL7 A;  4Z6E A;  3RRH A;  4QWA A;  3M9O B;  5KFG A;  2RDI A;  1BPE A;  4F4K A;  1BVS A;  4ECX A;  2DPJ A;  3ZDC A;  5BOL A;  4UB4 A;  4UQG A;  5J0W A;  1DGS A;  4M9J A;  3Q8R B;  2BPF A;  4DWI A;  3RB0 A;  3M8S A;  2XO7 A;  5CP2 A;  5L1L A;  3HPO A;  2R8K A;  5IIO A;  4RQ5 A;  9ICP A;  3PR4 A;  2AGP A;  3GQC A;  5DQG A;  4ED7 A;  2IMW P;  1SKR A;  1L5U A;  4QZA A;  2AQ0 A;  1NK0 A;  4KLF A;  1KEJ A;  4YXM A;  5J0O A;  9ICQ A;  5J0Y A;  3C21 A;  4F92 B;  4YN4 A;  1S97 A;  1X2I A;  4Q44 A;  9ICL A;  4ECT A;  7ICJ A;  2XGQ A;  1TAQ A;  4ED6 A;  1PZN A;  2V4R A;  5J0Q A;  3G6X A;  2HVI A;  4RZR A;  4Z6D A;  3TQ1 A;  2MUT B;  3TAQ A;  3HP6 A;  4DLG A;  4JV0 A;  2XCA A;  1DOQ A;  4DQS A;  2P66 A;  5J2F A;  4YQW A;  3QEA Z;  1T7P A;  3PW2 A;  1NK9 A;  1L3U A;  5KT6 A;  5DB9 A;  5KFU A;  1TKD A;  5HHI A;  3Q8P B;  2DFL A;  3M9M B;  3V7J A;  1XWL A;  4M2Y A;  1NK7 A;  5DBC A;  3IM1 A;  3GIK A;  4J9K A;  5KT4 A;  9ICX A;  2PFP A;  5KT3 A;  1KFS A;  5J2D A;  2ATL A;  8ICA A;  4O9M A;  2W9B A;  2BCV A;  4GXK A;  4Q8F A;  1IM4 A;  3PV8 A;  3UXP A;  2KFZ A;  4KN7 A;  1C7Y A;  4R8U B;  4RUC A;  4NM2 A;  2XY6 A;  5DKW A;  3GII A;  2ZTE A;  2KZZ A;  5KFH A;  3ORY A;  4QZE A;  1NJX A;  2HHX A;  2JZB A;  5KFX A;  5KT5 A;  4DQP A;  3EZ5 A;  1IXR A;  4M6W A;  3PMN A;  4ECU A;  2W9A A;  1KRP A;  1WCN A;  2JEF A;  2BQ3 A;  2PI5 A;  2JEJ A;  3RR7 A;  3SI8 A;  9ICG A;  2AGO A;  3PR5 B;  4PHP A;  4F4X A;  2Y1I A;  3PW7 A;  8ICH A;  4XA5 A;  1XS9 D;  5KFD A;  1U9L A;  4DL2 A;  3PO4 A;  5EOZ A;  1CUK A;  4MF8 A;  5L1J A;  1KDH A;  1S77 D;  5KFO A;  1HUZ A;  1RZT A;  4XQ8 A;  3Q8M A;  4EBE A;  4KN4 A;  3RB3 A;  5J0X A;  3GFK B;  5KFI A;  4F91 B;  4FO6 A;  4YXJ A;  2FMS A;  4M9N A;  2J6U A;  2BCQ A;  1JXL A;  3TFS A;  1U45 A;  1MQ2 A;  1L3S A;  1JX4 A;  2FPM A;  5J2J A;  4B9M A;  5F9N A;  8ICX A;  1B43 A;  3OGU A;  4B9U A;  4NXZ A;  3N97 B;  1JIH A;  1H38 A;  5KG5 A;  9ICU A;  3MGH A;  2BGW A;  4TUQ A;  3T5J A;  3RJF A;  5CR0 A;  4I28 A;  2A1J B;  1XO1 A;  5DB6 A;  4DL4 A;  3PX6 A;  3QE9 Y;  4DL6 A;  5IIN A;  4YG2 A;  3EPI A;  4M04 A;  2R8G A;  2F1I A;  2VA2 A;  2PFQ A;  4NLN A;  9ICA A;  4UAW A;  3JPO A;  4J9R A;  4DF8 A;  8ICP A;  2ZUC A;  1NKC A;  1D9F A;  3V6K A;  1X9W A;  1ZQK A;  3ZDB A;  2DPI A;  2BPG A;  5DQI A;  2KTQ A;  2H5X A;  4TQR A;  2KZM A;  5KFR A;  8ICO A;  2W9C B;  3JPN A;  2BCR A;  7ICS A;  4Q43 A;  3BDP A;  2FMP A;  1RXW A;  8ICW A;  7ICO A;  3FYH A;  2FLP A;  2FPL A;  4KMU A;  3OHB A;  5III A;  2PFO A;  4BWJ A;  1NKB A;  4IRD A;  3ZD9 A;  1T3N A;  4MFC A;  4RNO A;  5F9L A;  4UAZ A;  3OJS A;  4I27 A;  5KTQ A;  4J9N A;  4DL3 A;  4J9Q A;  3OJU A;  5DGB A;  3JPP A;  5CWR A;  4GXJ A;  2HHQ A;  5EWF A;  5HHH A;  4DFM A;  1QSL A;  4Q45 A;  3GIM A;  4KLT A;  3M9N B;  2R8I A;  4UB2 A;  3BQ2 A;  1JMS A;  3TAR A;  4C8N A;  5DG7 A;  1A77 A;  4JUZ A;  4O3Q A;  4PGY A;  3KHR A;  1ZQQ A;  3PY8 A;  3MR3 A;  3SZ2 A;  2W8L A;  2J6S A;  2PXI A;  3EPG A;  4FBT A;  4YMN A;  3C2K A;  8ICE A;  1XSN A;  3RTV A;  4BWM A;  4O5E A;  4P2H A;  8ICI A;  3KHG A;  3V6H A;  5J0R A;  5KFJ A;  1SZP A;  5J2K A;  2R8H A;  2I1Q A;  1S9F A;  2NRV A;  1NJW A;  4UBC A;  3C1Z A;  5DB7 A;  2P6R A;  2JEG A;  3C5F A;  4ECS A;  1ZQU A;  2IA6 A;  4PPX A;  4B9L A;  4R63 A;  4KLM A;  5KFF A;  4IRC A;  5DQH A;  2KN7 A;  1XSP A;  3BQ0 A;  4BXO B;  5DLG A;  4RQ3 A;  3QZ8 A;  4ECQ A;  1ZQW A;  4RQ7 A;  1ZQC A;  5EWE A;  4LVS A;  2AJQ A;  1CEZ A;  3QEB Z;  4M9G A;  3AU6 A;  4KTQ A;  4DQI A;  1BPX A;  4KLD A;  3HWT A;  1X9S A;  8ICB A;  5CB1 A;  5EWG A;  4J9S A;  1KTQ A;  3PW5 A;  2C2R A;  4I2H A;  4I2A A;  3JPS A;  2HHT A;  8ICJ A;  3V72 A;  1ZET A;  8ICT A;  3PX0 A;  3GDX A;  4F4Y A;  9ICM A;  3ZDD A;  3KHL A;  4HYK A;  3BJY A;  9ICE A;  5KG7 A;  4K4I A;  4ECY A;  1S0O A;  5DLF A;  4RQ4 A;  4F4Z A;  9ICN A;  5J2C A;  3H8S A;  3RAQ A;  3H7I A;  5CA7 A;  7ICG A;  5KFE A;  4DQR A;  2F1H A;  2ASL A;  3V7L A;  3ISC A;  5J0S A;  4EBD A;  4O3R A;  4RT3 A;  2KFN A;  3ZD8 A;  4YD1 A;  3G6Y A;  2BDP A;  1UT5 A;  4DSL A;  3C5G A;  1U4B A;  3C1Y A;  7ICF A;  9ICR A;  1ZQO A;  4C8L A;  3UXO A;  3QZ7 A;  3ISD A;  2ZTD A;  1MC8 A;  4RQ8 A;  4M6W B;  4KIT B;  4J9P A;  3AU2 A;  3SYZ A;  5IIL A;  4O5K A;  2NRT A;  1ZJN A;  4PGQ A;  1KSP A;  3RB4 A;  1S0N A;  1RPL A;  2NRX A;  8ICY A;  3LDA A;  4IQT A;  3MBY A;  2C2E A;  1U48 A;  2GWS A;  9ICB A;  4F5R A;  1ARO P;  5DBA A;  5KFY A;  1ZQN A;  5J29 A;  2MUT A;  4CCH A;  3HX0 A;  4I2C A;  4ED1 A;  3IHQ B;  4YFK A;  4QW9 A;  5J2I A;  4I2E A;  4DS4 A;  3PML A;  4G3I A;  4TUR A;  4I29 A;  4RQ0 A;  5TZV A;  4DO9 A;  3THV A;  7ICT A;  3B0X A;  3LWL A;  3MR5 A;  3Q8L A;  7ICQ A;  4C8M A;  4ED2 A;  3MGI A;  3KHH A;  4IR9 A;  3KTQ A;  1ZJM A;  3OSN A;  4YMM A;  4EYI B;  3TI0 A;  1LV5 A;  4F4W A;  2XCP A;  4YR0 A;  1BPY A;  2I9G A;  3GV8 B;  2V9W A;  4NY8 A;  4KLS A;  5KG6 A;  1NOM A;  5J2A A;  4J9M A;  4IRK A;  4DF4 A;  4R8U A;  4QZF A;  2PI4 A;  1ZQS A;  2NRW A;  4E0D A;  3PVX A;  1ZQJ A;  1QLN A;  4O3O A;  3TFR A;  4I2F A;  2W8K A;  4ELT A;  1A76 A;  8ICK A;  1Z3E B;  4RQ6 A;  2J6T A;  2HVH A;  1ZQE A;  3MR6 A;  3ETL A;  3JPT A;  2BHN A;  5HMM A;  4ZH4 A;  4DFK A;  4F5P A;  4BGD A;  8ICN A;  4P4P A;  1ZQL A;  1NJZ A;  4B9V A;  5KFK A;  3Q8Q B;  4F93 B;  2XC9 A;  4QZH A;  4X5V A;  4EYH B;  1ZQI A;  5J0U A;  4I2D A;  4KLU A;  1D8L A;  1U49 A;  1TFR A;  4FBU A;  1Z00 A;  4YCX A;  3MFI A;  4C8O A;  4GLX A;  4MFA A;  3OHA A;  1NK4 A;  2FLL A;  1BGX T;  1SKS A;  2VA8 A;  4B9S A;  2AQ4 A;  1KFT A;  5KFV A;  4QZI A;  5KFB A;  2R8J A;  5KFS A;  3MDC A;  4DL5 A;  2ISO A;  5HML A;  2A1J A;  5KFQ A;  2XY7 A;  4O3N A;  3OSP A;  3BQ1 A;  5D4B A;  3N4M B;  2ASJ A;  1NK6 A;  1QSS A;  5DGA A;  4I2J A;  4GC7 A;  4KLI A;  4KLH A;  4DSE A;  1EXN A;  4QZB A;  9ICT A;  4PHE A;  4IQV A;  3EW9 A;  4ELV A;  4EBC A;  5KG4 A;  3RJE A;  5DB8 A;  3RJJ A;  4ECW A;  2W9C A;  4DOA A;  4MEX A;  4IR1 A;  4XUS A;  4JWM A;  2ZTC A;  3LWM A;  3UQ0 A;  4TUS A;  1SL2 A;  1ZQA A;  4UBB A;  4GXI A;  2AU0 A;  8ICU A;  1ZQH A;  4DSF A;  1ZQF A;  3RBD A;  9ICV A;  2KZ3 A;  4RT2 A;  4GC6 A;  1ZQX A;  4UB1 A;  1XU4 A;  5J2G A;  4KLL A;  3HT3 A;  7ICL A;  1D9D A;  4DFJ A;  7ICE A;  4QZD A;  2XGP A;  1RXV A;  1XSL A;  4Z6F A;  3T5K A;  7ICV A;  3RH4 A;  4DS5 A;  2PFN A;  4DSK A;  3AUO A;  3RB6 A;  2C28 A;  4RUA A;  2V4Q A;  3SV4 A;  1NK8 A;  2BR0 A;  1LB2 B;  2BQU A;  1MSW D;  5KG3 A;  4O0I A;  1S0V A;  7ICK A;  4ECV A;  2ZJA A;  3GV5 B;  2ALZ A;  4RNN A;  4M9L A;  4KLO A;  4EEY A;  4RPZ A;  4QZ8 A;  2MAX A;  2BKE A;  4YMO A;  5CJ7 A;  9ICF A;  3SV3 A;  5DG9 A;  4F5O A;  4F3O A;  2UVW A;  5L1K A;  4TQS A;  2VAN A;  4P4O A;  3TAP A;  2BCU A;  3MAB A;  4KLG A;  4RQ1 A;  2W9M A;  3B0Y A;  1TK0 A;  4YVZ A;  1N48 A;  1T4G A;  4QZC A;  4KLQ A;  1ZQY A;  1SKW A;  4F8R A;  5KFA A;  2W9B B;  1ZQP A;  9ICO A;  3RAX A;  4MFF A;  3H8J A;  2ZJ8 A;  4EZ9 A;  1S76 D;  1K1S A;  4DEZ A;  4YR3 A;  4BXO A;  1Y88 A;  3RJK A;  3BQT A;  2ZUB A;  4R66 A;  3MR2 A;  2F1J A;  1TVA A;  5KG1 A;  4UB3 A;  2JZB B;  4MF2 A;  3T5L A;  5DDY A;  4NLK A;  4ELU A;  4DOC A;  3H4D A;  4O3P A;  5L1I A;  2XY5 A;  5KG2 A;  4J9O A;  4YP3 A;  1UA1 A;  1TAU A;  3C23 A;  8ICR A;  1UT8 A;  5D46 A;  4DSJ A;  2IBK A;  5DG8 A;  2HHV A;  1U47 A;  3NTU A;  4ED8 A;  3T5H A;  3RH6 A;  1L3T A;  4I2I A;  1ZQT A;  5KFW A;  2FMQ A;  4C8K A;  4F50 A;  1JN3 A;  2FPK A;  2HHS A;  8ICC A;  3PO5 A;  4DSI A;  1ZQV A;  4ECR A;  3V7K A;  4ED3 A;  3E2E A;  1ZQR A;  1KFD A;  3H4B A;  2OWO A;  4M0A A;  9ICI A;  4RPY A;  3H40 A;  2RDJ A;  4K4G A;  4DFP A;  4YD2 A;  3V6J A;  9ICS A;  5C5J A;  3PW4 A;  4R65 A;  3G6V A;  2M9N A;  5KG0 A;  5JUM A;  5DDM A;  1BPZ A;  3RJG A;  4QZG A;  5KFZ A;  5KT2 A;  4NLZ A;  8ICG A;  2HHU A;  8ICQ A;  5KFP A;  2C22 A;  2IHM A;  4TUP A;  4M47 A;  4Z6C A;  4UB5 A;  8ICF A;  3Q8K A;  3C2M A;  4DQQ A;  2BCS A;  2LYH A;  5KFT A;  3RH5 A;  2ISP A;  4BDP A;  5J2H A;  7ICN A;  1B22 A;  3RJH A;  4JK1 A;  4F2S A;  2C2D A;  4ECZ A;  7ICM A;  3RRG A;  2Q0Z X;  1K1Q A;  1QTM A;  4QWC A;  4ED0 A;  3UPQ A;  5DBB A;  4RNM A;  5KFC A;  3HW8 A;  1QSY A; 
#chains in the Genus database with same CATH topology
 1T8E A;  5CEH A;  3LVV A;  4RQM A;  1BPD A;  1RYS A;  2IHN A;  4QW8 A;  3SAH A;  1J97 A;  4UAY A;  5HP4 A;  1UA0 A;  4RQ2 A;  1OUQ A;  5KNI A;  3FDS A;  3JPR A;  3C2L A;  2BPC A;  5KFN A;  4KLJ A;  3GIJ A;  2ZJ5 A;  8ICM A;  3UXN A;  1HUO A;  1RYR A;  5IIM A;  2QB0 A;  4YR2 A;  3WK8 A;  2I5H A;  3C28 A;  3RR8 A;  2LI6 A;  2H3V A;  4JV1 A;  7ICP A;  3ZDE A;  3C29 A;  2FLN A;  4U6P A;  4I2B A;  3UQ2 A;  2BQR A;  3KBB A;  3VCB A;  4USA A;  9ICH A;  4RU9 A;  1D8Y A;  3EWA A;  5ALY A;  2JR5 A;  3NVY A;  4DL7 A;  4F4K A;  2XIC A;  1BVS A;  3Q8R B;  4DWI A;  3RB0 A;  3M8S A;  2WF6 A;  5CP2 A;  3HPO A;  2AGP A;  5DQG A;  2K8C B;  1SKR A;  2ZIU B;  4U7C A;  3HIL A;  5J0O A;  5J0Y A;  4F92 B;  1RYU A;  1X2I A;  4ECT A;  1ZD5 A;  2XGQ A;  1HEK A;  1PZN A;  3M6Z A;  5EE1 A;  2V4R A;  3NRW A;  1KL9 A;  3TQ1 A;  3TAQ A;  3HP6 A;  4Y2V A;  3SEI A;  1NK9 A;  1TKD A;  3Q8P B;  1XWL A;  1NK7 A;  1D8B A;  5KT4 A;  2PFP A;  2F2A B;  4O9M A;  4GXK A;  4Y2R A;  4ICA A;  4QIW F;  1C7Y A;  2Y9U A;  4NM2 A;  5AIA A;  5KFH A;  2K60 A;  2HHX A;  1NJX A;  5AK4 A;  5KFX A;  1COK A;  1RQL A;  4Y2U A;  3EZ5 A;  1IXR A;  2W9A A;  1KRP A;  9ICG A;  3ALR A;  4PHP A;  8ICH A;  2KVS A;  5AM4 A;  4KX3 A;  5L1J A;  3N7R C;  3B9J A;  1HUZ A;  3RB3 A;  3OTQ A;  1BNO A;  5J2J A;  3MGH A;  3RJF A;  4TUQ A;  3T5J A;  5CR0 A;  1XO1 A;  2LPE A;  3KKA C;  3SEN A;  4DL6 A;  4M04 A;  2F1I A;  3ZDB A;  3V6K A;  2D8C A;  3BS7 A;  5KFR A;  2BCR A;  4Q43 A;  1FO4 A;  4C4R A;  4KMU A;  2PFO A;  1NKB A;  4MFC A;  4BUG A;  4UAZ A;  2LM4 A;  2ZIW B;  3U26 A;  4GXJ A;  5HHH A;  3GIM A;  4QNL A;  3M7D A;  4KLT A;  4F71 A;  5DG7 A;  2ZIX B;  4PGY A;  3MR3 A;  1TE2 A;  1VJ5 A;  3EPG A;  3AEV A;  2MRL A;  3KHG A;  5J0R A;  5KFJ A;  1JAL A;  2WF8 A;  1S9F A;  4PL1 A;  1Q46 A;  3QX7 A;  2IA6 A;  4B9L A;  1X66 A;  2XID A;  4KLM A;  5DQH A;  1X6J A;  5AI4 A;  4RQ3 A;  4LVS A;  2W03 A;  3QEB Z;  5EE9 A;  1UQV A;  4M9G A;  1P7D A;  1X9S A;  8ICB A;  5EWG A;  2C2R A;  3JPS A;  3QU2 A;  3V72 A;  2DF4 B;  1ZET A;  1NZP A;  2VKQ A;  3DEE A;  5AI8 A;  4F4Y A;  2W11 A;  5K4L A;  5ALG A;  1N61 A;  5AI9 A;  4F4Z A;  1UHU A;  5CA7 A;  5KFE A;  2GH1 A;  2Y9T A;  1UT5 A;  2G0A A;  4NJ8 A;  4US9 A;  3H0R B;  1ZQO A;  3UXO A;  3CW2 C;  3QZ7 A;  1MC8 A;  3TKA A;  4J9P A;  3AU2 A;  3SYZ A;  4LJX A;  4O5K A;  1ZJN A;  5H2F U;  1S0N A;  2NRX A;  3QU7 A;  3MBY A;  2C2E A;  2RHF A;  5KFY A;  2VJ4 A;  4ED1 A;  5E79 U;  4Y2J A;  4I2E A;  4G3I A;  4RQ0 A;  3THV A;  3CP8 A;  3MR5 A;  5ALK A;  4ED2 A;  3KHH A;  3OSN A;  3NVW A;  5ALI A;  5J2A A;  4QZF A;  2PI4 A;  1ZQS A;  2YX8 A;  2K4H A;  5AKK A;  3PVX A;  3UMB A;  1QLN A;  3AL0 B;  3TFR A;  4ELT A;  2HVH A;  2J6T A;  2BHN A;  3L3F X;  4F5P A;  2G08 A;  4BGD A;  4P4P A;  4B9V A;  1NJZ A;  4MHV A;  4EYH B;  5J0U A;  1U49 A;  3CRX A;  1BGX T;  1SKS A;  2VA8 A;  4B9S A;  1KFT A;  4QZI A;  3MDC A;  5HML A;  2EAN A;  2XY7 A;  2LYB A;  5KAF U;  4J03 A;  1FIQ A;  4KLH A;  1EXN A;  4PHE A;  4IQV A;  2OHF A;  4ELV A;  2OH2 A;  4ECW A;  4IR1 A;  4XUS A;  4JWM A;  1SL2 A;  1ZQA A;  1ZQH A;  2IOF K;  3QNM A;  2KZ3 A;  4GC6 A;  4UB1 A;  5J2G A;  2E1E A;  1D9D A;  2XGP A;  1RXV A;  1J2M A;  1LB2 B;  3PZP A;  4RUA A;  5KL8 B;  4F72 A;  4O3M A;  4M9L A;  4RNN A;  4EEY A;  4RPZ A;  3SV3 A;  2OEH A;  4DCC A;  4F3O A;  3TAC B;  2OYY A;  2UVW A;  4TQS A;  3D2N A;  4KLG A;  4RQ1 A;  2HBK A;  4YVZ A;  1N48 A;  2ES6 A;  1ZQY A;  3QU5 A;  4UAT A;  1WYG A;  3QYP A;  4MFF A;  3MGV A;  3QUT A;  4EZ9 A;  1K1S A;  4DEZ A;  4BXO A;  1ZD2 P;  5F3X B;  4UB3 A;  2JZB B;  4NLK A;  4DOC A;  5L1I A;  3OPX A;  4J9O A;  4NLB A;  2R18 A;  5DG8 A;  3RH6 A;  2FMQ A;  2FPK A;  3NS1 A;  2E8P A;  2LHT A;  4C0Z A;  3F2C A;  1KFD A;  4M0A A;  2OWO A;  3F5A A;  2RDJ A;  5AKG A;  5EE3 A;  9ICS A;  3G6V A;  5JUM A;  1Q3V A;  1BPZ A;  2DKZ A;  2IHM A;  4M47 A;  4Z6C A;  2HOI A;  3RH5 A;  1DGJ A;  7ICN A;  3K1R B;  1B22 A;  3RJH A;  2Q0Z X;  1KKX A;  4ED0 A;  1CRX A;  3EYZ A;  3BS5 B;  1SWV A;  2JEI A;  1V9P A;  1ZQM A;  1JXE A;  2WAQ F;  3JPQ A;  2K8B B;  3K4G A;  2PMZ C;  1L3V A;  2OXO A;  4QJF B;  2PKE A;  3K75 D;  4FS2 A;  4IQW A;  2JH1 A;  2LKY A;  2YY6 A;  2E5S A;  1N56 A;  3WK6 A;  4F5N A;  3SMV A;  5BPC A;  4NM1 A;  5KFM A;  5L9X A;  2WFA A;  1ZQZ A;  1X9M A;  5J2E A;  3RJI A;  1XC9 A;  5J2B A;  3NGD A;  7ICU A;  3GV7 B;  4AP9 A;  2UVR A;  1S10 A;  1TV9 A;  2Y0S F;  2B21 A;  2Y1J A;  4LZD A;  4US8 A;  2WTF A;  2AH5 A;  1UPH A;  2VA3 A;  4XRH A;  2F77 X;  4DOB A;  4R64 A;  4LZG A;  4M9H A;  2CN1 A;  3MDA A;  1NKE A;  5ALP A;  5J0T A;  2WF5 A;  3RRH A;  2KOB A;  3M9O B;  1DXS A;  3ZDC A;  5BOL A;  3N28 A;  4M9J A;  3WKE A;  1DGS A;  1O03 A;  2KHV A;  4UB8 U;  2XO7 A;  5L1L A;  1Q3U A;  3PR4 A;  3GQC A;  4ED7 A;  2H3I A;  1V97 A;  5G5G A;  2DBY A;  2AQ0 A;  4KLF A;  1A0P A;  9ICQ A;  2H3Z A;  3C21 A;  3QU4 A;  1S97 A;  1TAQ A;  2HVI A;  4RZR A;  2IOH A;  4Z6D A;  2MUT B;  4JV0 A;  5J2F A;  4YQW A;  2CXY A;  2EZY A;  5KT6 A;  2DFL A;  3I76 A;  4M2Y A;  5DBC A;  2MSN A;  5J2D A;  2ATL A;  1SIJ A;  2W9B A;  2BCV A;  3PV8 A;  1WWU A;  2OCE A;  3UXP A;  2KFZ A;  4A8E A;  4R8U B;  2DQN B;  4OJ6 A;  4BX9 C;  5KT5 A;  3PMN A;  4ECU A;  1WCN A;  2F8K A;  2AGO A;  3KFU F;  1XS9 D;  5EOZ A;  1CUK A;  2W7O A;  1KDH A;  4P0Q B;  1MN8 A;  5J0X A;  5KFI A;  2FMS A;  3WK7 A;  4M9N A;  1JX4 A;  8ICX A;  1MQ2 A;  1L3S A;  1B43 A;  3N97 B;  1PVP A;  3BZC A;  1SV0 A;  5DB6 A;  4DL4 A;  2ESE A;  4YG2 A;  4CNQ A;  4DF8 A;  2ZUC A;  1ZQK A;  2BPG A;  4UAV A;  2H5X A;  2QB0 B;  5A0L A;  3JPN A;  2RP5 A;  7ICS A;  2FMP A;  2G07 A;  1ZRM A;  8ICW A;  2KIV A;  1QQ7 A;  3FM9 A;  1T3N A;  4RNO A;  3OJS A;  1NZB A;  4J9Q A;  2VIX A;  3QU9 A;  3SD7 A;  5DGB A;  1RQN A;  1PVQ A;  1T3Q A;  2JHD A;  4DFM A;  4Q45 A;  1QSL A;  2R8I A;  4UB2 A;  1JI7 A;  3BQ2 A;  4C8N A;  4JUZ A;  4O3Q A;  3SQI A;  3PY8 A;  3SZ2 A;  2W8L A;  1GO3 F;  3C2K A;  3RTV A;  4BWM A;  8ICI A;  4CDG A;  1PUZ A;  1ZD3 A;  5DB7 A;  4PPX A;  1ZQU A;  2EH9 A;  1N62 A;  2JRZ A;  5KFF A;  3QZ8 A;  4ECQ A;  1BPX A;  4KLD A;  4CRX A;  4I2H A;  4I2A A;  5J8Y A;  4NL9 A;  3GDX A;  4P0P A;  4JB3 A;  3BJY A;  5KG7 A;  1MA7 A;  4K4I A;  1S0O A;  5DLF A;  2E1F A;  1Z1B A;  2G09 A;  5ALU A;  9ICN A;  3H7I A;  3T79 A;  7ICG A;  2F1H A;  2ASL A;  1N60 A;  4O3R A;  3O0F A;  3G6Y A;  3PSF A;  1U4B A;  3C1Y A;  9ICR A;  4AYB F;  4KIT B;  2B0C A;  2ZIU A;  2NRT A;  4PGQ A;  1KSP A;  3RB4 A;  5AKL A;  2ZIV B;  2JV3 A;  3F5E A;  2LMR A;  1U48 A;  9ICB A;  2KNJ A;  5J29 A;  4CCH A;  3HX0 A;  4PZN A;  4YFK A;  1ZD4 A;  4FZL A;  4I29 A;  4DO9 A;  5ALD A;  3LWL A;  4C8M A;  3MGI A;  4IR9 A;  4EYI B;  3TI0 A;  2YML A;  4F4W A;  4KLS A;  4YR0 A;  3NUQ A;  2D6F C;  2F8L A;  4DF4 A;  1XO0 A;  2NRW A;  4E0D A;  2FE9 A;  4OJ5 A;  5AKI A;  1ZQJ A;  4I2F A;  2W8K A;  1L7O A;  1DRG A;  1ZQE A;  3JPT A;  3IRU A;  5HMM A;  1OXJ A;  1FFV A;  4C4T A;  4DFK A;  2EQY A;  2YQE A;  1VLB A;  1ZQL A;  1ZXI A;  3D2S A;  3Q8Q B;  4KLU A;  1D8L A;  1TFR A;  1Z00 A;  4GLX A;  3OHA A;  2QLT A;  1S5L U;  1HIW A;  2EZX A;  5KFV A;  2AHO B;  2ISO A;  1SXE A;  4O3N A;  3OSP A;  3BQ1 A;  3N4M B;  1QSS A;  1NK6 A;  5DGA A;  4I2J A;  4GC7 A;  4DSE A;  2JXJ A;  3EW9 A;  5ALM A;  5KG4 A;  2ZTC A;  2DWQ A;  4JMU A;  5AM1 A;  4DSF A;  9ICV A;  2W3R A;  4RT2 A;  1ZQX A;  3CYM A;  2QAR A;  1XU4 A;  3HT3 A;  2KSO B;  7ICL A;  5G5H A;  2KKV A;  3T5K A;  2ZIW A;  2KD1 A;  2PFN A;  4DSK A;  2V4Q A;  3SV4 A;  1MSW D;  1S0V A;  2ZJA A;  2ALZ A;  4HAI A;  4FE3 A;  4KLO A;  2WB1 F;  1LKY B;  3J81 j;  3TAP A;  4IL6 U;  4P4O A;  4FZM A;  4FFD A;  2HDO A;  3B0Y A;  1T4G A;  1J2N A;  3WKA A;  1SXD A;  9ICO A;  3RAX A;  2ZJ8 A;  3BQT A;  1UCV A;  2ZUB A;  1C20 A;  3MR2 A;  2KG5 A;  1TVA A;  4DFD A;  2E8M A;  3PST A;  5KG2 A;  1QQ5 A;  5D46 A;  2F76 X;  4ED8 A;  3T5H A;  1U47 A;  1L3T A;  1ZQT A;  3I1Y A;  5KFW A;  4C8K A;  4F50 A;  8ICC A;  2HHS A;  3PO5 A;  4DSI A;  1ZQV A;  5HR6 A;  4UAU A;  4ED3 A;  9ICI A;  4K4G A;  2D3D A;  3PSI A;  4R65 A;  4B6J A;  5KFZ A;  4EX7 A;  2C22 A;  3C2M A;  4DQQ A;  2BCS A;  4BDP A;  5TIS U;  5J2H A;  5ALT A;  4F2S A;  2C2D A;  1QTM A;  2NYV A;  1X40 A;  2KIC A;  5DBB A;  3HW8 A;  2GLE A;  1QSY A;  1SL0 A;  4PHD A;  1KLN A;  4IQU A;  3E58 A;  3TAD C;  5CHG A;  4O3S A;  5AM3 A;  4PH5 A;  5J0P A;  1O08 A;  2ZUD A;  9ICJ A;  5D49 A;  1S0M A;  8ICV A;  3IDW A;  3RBE A;  2XI9 A;  3KOO A;  5IIK A;  2NRZ A;  3SAG A;  2W04 A;  5EE0 A;  1ZQB A;  2AGQ A;  3PNC A;  1ECW A;  3ISB A;  2NO5 A;  4K4H A;  3VC8 A;  4B9N A;  1ZYQ A;  5ALS A;  4BJQ A;  4CF4 A;  4NLG A;  3TAN A;  4CGZ A;  3LK9 A;  1ZRN A;  2DUY A;  3M8R A;  3H8W A;  5HNK A;  5BOM A;  2DGZ A;  7ICH A;  5KFL A;  8ICS A;  4O5C A;  4QWB A;  4RPX A;  1MQ3 A;  4UW9 A;  5AIB A;  4J9L A;  4QZ9 A;  4F5Q A;  1NJY A;  3WKD A;  2RRD A;  4P4M A;  4JWN A;  4Y2X A;  1SL1 A;  4Z6E A;  4CE6 A;  5KFG A;  4UB4 A;  2JMG A;  2O6K A;  2H3Q A;  4KMO B;  5IIO A;  4RQ5 A;  2K4E A;  3FAH A;  3NVZ A;  2OM6 A;  4QZA A;  3R9K A;  3F2B A;  3AM9 A;  1KEJ A;  4YXM A;  2DKX A;  4YN4 A;  4Q44 A;  9ICL A;  5L1M A;  2KK0 A;  7ICJ A;  2HMX A;  2FJ6 A;  4DLG A;  2XCA A;  2P66 A;  1DOQ A;  4DQS A;  2YB1 A;  1KN5 A;  2B6G A;  1JRP A;  3QEA Z;  1T7P A;  2EZZ A;  1L3U A;  2XVT A;  4EEK A;  2GOL A;  1N63 A;  3M9M B;  3V7J A;  3KKA A;  3GIK A;  4J9K A;  5ALO A;  1KFS A;  8ICA A;  4Q8F A;  1IM4 A;  2WF7 A;  4RUC A;  5ALJ A;  5DKW A;  2XY6 A;  2ZTE A;  2KZZ A;  4QZE A;  2JZB A;  1PK1 A;  4DQP A;  4ACO A;  4WJ3 B;  4M6W A;  2JEF A;  3QUB A;  2BQ3 A;  3RR7 A;  3E0F A;  2WF9 A;  1B0X A;  4NV0 A;  4F4X A;  3PW7 A;  3PO4 A;  5KFD A;  2KJ8 A;  2AXT U;  1RZT A;  4XQ8 A;  3Q8M A;  4EBE A;  2YN4 A;  3GFK B;  4FO6 A;  2BCQ A;  1JXL A;  1U45 A;  2FPM A;  3WK4 A;  1SV4 A;  4B9U A;  4NXZ A;  2M0N A;  2CPR A;  1H38 A;  9ICU A;  3LVW A;  1IV8 A;  2BGW A;  2A1J B;  2EAM A;  4Y2S A;  3QE9 Y;  2ZXH A;  1FEZ A;  5IIN A;  2R8G A;  9ICA A;  4UAW A;  3JPO A;  8ICP A;  2KTQ A;  4EEN A;  4UB6 U;  2W9C B;  1RM6 C;  4CF3 A;  1Z4O A;  2G5H B;  3FYH A;  3HKZ F;  2FPL A;  3OHB A;  3D2Q A;  3QUC A;  5III A;  3BS5 A;  4BWJ A;  2FLP A;  4IRD A;  3ZD9 A;  2F44 A;  4ZOH C;  4J9N A;  3KD3 A;  1X42 A;  3BQ7 A;  3OJU A;  3WK5 A;  1OW5 A;  3JPP A;  5CWR A;  1A77 A;  1ZQQ A;  1SWW A;  3H0M B;  2J6S A;  2PXI A;  4FBT A;  4YMN A;  8ICE A;  4O5E A;  4P2H A;  4OCZ A;  4PL2 A;  2R8H A;  2NRV A;  1NJW A;  4UBC A;  2JEG A;  3C5F A;  4ECS A;  3A0H U;  1XSP A;  2NV3 A;  5DLG A;  4RQ7 A;  1ZQC A;  5EWE A;  1CEZ A;  2YMQ A;  3AU6 A;  4KTQ A;  3HWT A;  2HOF A;  3PW5 A;  2HHT A;  2A1A A;  4OD0 A;  3ZDD A;  3KHL A;  4HYK A;  9ICE A;  4ECY A;  1NNL A;  5J2C A;  3RAQ A;  4DQR A;  3V7L A;  3DDH A;  3ISC A;  1V85 A;  1VDV A;  4YD1 A;  2BDP A;  4DSL A;  3C5G A;  5IIL A;  4PJ0 U;  3LDA A;  1F0M A;  5HR7 A;  4Y2Y A;  1ARO P;  2P35 A;  2WAQ C;  3SAF A;  5DBA A;  2MUT A;  4I2C A;  5J2I A;  3PML A;  2KMD A;  4TUR A;  7ICT A;  3BZK A;  3B0X A;  5AHX A;  1IG6 A;  1URJ A;  1ZJM A;  1LV5 A;  2XCP A;  2V9W A;  2I9G A;  1B4F A;  1NOM A;  4J9M A;  4R8U A;  5ALE A;  3IP4 B;  1A76 A;  3H8M A;  3AQE A;  1Z3E B;  4RQ6 A;  4ZH4 A;  2Y0S C;  4OJP A;  5C0Y A;  2XC9 A;  4QZH A;  5AKJ A;  4P0Q A;  4YCX A;  1NK4 A;  2R8J A;  5KFS A;  4DL5 A;  1JUD A;  1Z4N A;  1BNP A;  2BZF A;  1NI3 A;  2ASJ A;  2WHE A;  1Z19 A;  4QZB A;  5ALZ A;  1LVH A;  4EBC A;  3RJE A;  3RJJ A;  4DOA A;  4MEX A;  4TUS A;  4GXI A;  8ICU A;  2H3F A;  4KLL A;  4C7Z A;  1QCK A;  7ICE A;  2HBL A;  4Z6F A;  3AUO A;  8ICK A;  5AIC A;  4P0P B;  7ICK A;  4ECV A;  3GV5 B;  2BKE A;  4YMO A;  5CJ7 A;  3IN5 A;  5DG9 A;  4F5O A;  2K4P A;  2VAN A;  2FI1 A;  2W9M A;  1TK0 A;  4QZC A;  2RLT A;  1KBU A;  4F8R A;  3WKC A;  3LYS A;  1ZQP A;  3H8J A;  4GIB A;  2Z7J A;  3RJK A;  2KKP A;  2F1J A;  2VJ5 A;  3QXG A;  2LYA A;  1PVR A;  4NLC A;  4OO1 J;  1Z1V A;  3NVV A;  2Q4T A;  2KHQ A;  4YP3 A;  1UA1 A;  1QH9 A;  2IBK A;  1A6S A;  2HHV A;  3ICX A;  2HBJ A;  5ALN A;  3HJE A;  1JN3 A;  3WU2 U;  1YZ6 A;  4ECR A;  1ZQR A;  3H4B A;  4DFP A;  1WUD A;  2BDU A;  5KG0 A;  5DDM A;  5JU5 A;  2HI0 A;  5KT2 A;  4NLZ A;  2HHU A;  4TUP A;  4UB5 A;  3Q8K A;  2F3N A;  1L7N A;  2LYH A;  4JK1 A;  4ECZ A;  5AI0 A;  1K1Q A;  5AKE A;  2ZIV A;  4QWC A;  5AKH A;  4RNM A;  2KE7 A;  1L7P A;  9ICK A;  4PGX A;  1QQ6 A;  4KLE A;  1Z00 B;  1ZQG A;  3PW0 A;  1NK5 A;  4MEY A;  8ICL A;  8ICZ A;  3GIL A;  2LM1 A;  2W3S A;  5IIJ A;  4F2R A;  4PZO A;  1N2X A;  3NRZ A;  5ALF A;  7ICR A;  2HW3 A;  4JV2 A;  3T3F A;  9ICW A;  3AN1 A;  1N5W A;  4PHA A;  1ZQD A;  5KL1 B;  5KT7 A;  2ODG A;  3KZI U;  1WG8 A;  2L5Y A;  3ZDA A;  2UVU A;  4B9T A;  2QAR B;  5FP0 A;  2UVV A;  2W43 A;  2HHW A;  4DLE A;  2JGA A;  2YB4 A;  2ASD A;  1L6N A;  4QWE A;  1TK8 A;  3PX4 A;  3L5K A;  1TK5 A;  1KW4 A;  2P6U A;  3KZX A;  4QWD A;  1HJP A;  7ICI A;  3UMC A;  4Y2Q A;  1RDF A;  1WCL A;  1X9X A;  9ICC A;  4Q8E A;  4FS1 A;  3Q8S B;  2EDU A;  1BPB A;  3CNH A;  4I2G A;  1COO A;  2YMP A;  4EZ6 A;  2ZIX A;  3MFH A;  5AK6 A;  1FFU A;  4QWA A;  2RDI A;  1BPE A;  1K5O A;  4QIW C;  4AYB C;  5B66 U;  4ECX A;  2DPJ A;  4UQG A;  5J0W A;  2BPF A;  2R8K A;  2KSO A;  4C7Y A;  2ZG6 A;  9ICP A;  2GO7 A;  2IMW P;  1L5U A;  1NK0 A;  3IG8 A;  2HBM A;  4G9B A;  5JTI A;  1ED1 A;  2W55 A;  2K89 A;  4ED6 A;  3G6X A;  5J0Q A;  3F53 A;  1LKY A;  3PW2 A;  2NO4 A;  1YT3 A;  5KFU A;  5DB9 A;  5HHI A;  9ICX A;  3IM1 A;  5KT3 A;  3RF9 A;  5T14 A;  3D6J A;  4KN7 A;  1KQQ A;  3UMG A;  4GFJ A;  3GII A;  3ORY A;  2RQ5 A;  1DK2 A;  2PI5 A;  2JEJ A;  3SI8 A;  5AK5 A;  3PR5 B;  2EAP A;  2Y1I A;  4XA5 A;  3ZI4 A;  4DL2 A;  1U9L A;  4Y2P A;  4MF8 A;  2IOF A;  1S77 D;  5KFO A;  1SB3 C;  4KN4 A;  3EUB 2;  4F91 B;  4EX6 A;  4YXJ A;  5CRX A;  2J6U A;  3TFS A;  4B9M A;  5F9N A;  3OGU A;  1JIH A;  5KG5 A;  4I28 A;  4C80 A;  3PX6 A;  3EPI A;  4NLN A;  2VA2 A;  2PFQ A;  3I28 A;  4KX5 A;  4J9R A;  1NKC A;  2E8O A;  1D9F A;  1X9W A;  1Q8K A;  8ICQ A;  3L4P A;  2DPI A;  5DQI A;  8ICO A;  2KZM A;  4TQR A;  2E8N A;  3BDP A;  1RXW A;  2A3V A;  2HSZ A;  7ICO A;  1CI4 A;  3H0L B;  1XNS A;  5F9L A;  4I27 A;  5KTQ A;  4DL3 A;  5AK3 A;  1TAM A;  4EEL A;  2WB1 C;  3M6K A;  2HHQ A;  5EWF A;  2ZXI A;  2DL0 A;  1DK3 A;  3M9N B;  1JMS A;  3TAR A;  2PMZ F;  4RQN A;  1SV0 C;  3KHR A;  3DV9 A;  1XSN A;  2W7P A;  2YMM A;  3V6H A;  1SZP A;  5J2K A;  1V38 A;  2I1Q A;  3C1Z A;  3M1Y A;  5AKY A;  2P6R A;  4R63 A;  3ETR A;  4IRC A;  3ONN A;  2KN7 A;  4BXO B;  3BQ0 A;  5ALH A;  1ZQW A;  1YZ7 A;  4OJO A;  2E3T A;  4DQI A;  5JRT A;  5CB1 A;  4J9S A;  1KTQ A;  3WKB A;  1N5X A;  8ICJ A;  4OJL A;  8ICT A;  3PX0 A;  2HCF A;  9ICM A;  1AQ6 A;  3HRD D;  3A0B U;  4RQ4 A;  3H8S A;  2MA1 A;  1WWV A;  3IV6 A;  5J0S A;  4EBD A;  4RT3 A;  2KFN A;  3ZD8 A;  3N7P D;  7ICF A;  4C8L A;  1PK1 B;  5AKZ A;  3ISD A;  2ZTD A;  4RQ8 A;  2CRX A;  4M6W B;  5ALW A;  2K8A A;  4CF5 A;  1S8O A;  2KV2 A;  1RPL A;  2N1R A;  8ICY A;  4IQT A;  2GWS A;  4F5R A;  5AM0 A;  5AKX A;  1ZQN A;  4IC9 A;  3MC1 A;  4C4S A;  2FDR A;  3IHQ B;  4QW9 A;  5J8Y C;  2G06 A;  4NL9 C;  4DS4 A;  1L7M A;  5TZV A;  4FZN A;  3Q8L A;  7ICQ A;  3F2D A;  2KP7 A;  2JH7 A;  3KTQ A;  4YMM A;  2AJQ A;  4NY8 A;  1BPY A;  3PSP A;  3GV8 B;  5KG6 A;  1PK3 A;  1L8O A;  4IRK A;  4O3O A;  1F44 A;  3FC4 A;  3MR6 A;  3ETL A;  1F5S A;  8ICN A;  5KFK A;  4F93 B;  3WK9 A;  4X5V A;  1ZQI A;  4I2D A;  4FBU A;  3MFI A;  4C8O A;  1ZOL A;  5AI5 A;  4MFA A;  2FLL A;  3N7S C;  2AQ4 A;  5KFB A;  2KJ5 A;  2A1J A;  5ALQ A;  5KFQ A;  5B5E U;  4UAR A;  1ZQ1 C;  5D4B A;  4KLI A;  1IIP A;  9ICT A;  5DB8 A;  3GU3 A;  2W9C A;  2EAO A;  1SZH A;  3LWM A;  3UQ0 A;  1SGG A;  5GTH U;  4UBB A;  2AU0 A;  2W54 A;  1ZQF A;  3RBD A;  2QKQ A;  2I6X A;  2LBO A;  1L8L A;  4DFJ A;  3QUQ A;  4QZD A;  3IG5 A;  5ALR A;  1XSL A;  5AM5 A;  3RH4 A;  7ICV A;  4DS5 A;  3GZF A;  3NAS A;  3RB6 A;  2C28 A;  4Y2T A;  1NK8 A;  2BR0 A;  2BQU A;  5KG3 A;  4O0I A;  5ALX A;  4QZ8 A;  2MAX A;  9ICF A;  3SR6 A;  2A19 A;  4IS7 A;  5L1K A;  2BCU A;  3MAB A;  2KVC A;  1T94 A;  1M6Y A;  4KLQ A;  2KIW A;  3UM9 A;  3AQF A;  1SKW A;  5KFA A;  2W9B B;  1S76 D;  4YR3 A;  1Y88 A;  4R66 A;  5KG1 A;  4MF2 A;  3T5L A;  5DDY A;  2YTU A;  4ELU A;  5ALV A;  3H4D A;  4O3P A;  3K1Z A;  2XY5 A;  3AMZ A;  2K4I A;  3TAD A;  1TAU A;  3C23 A;  8ICR A;  1UT8 A;  4DSJ A;  3NTU A;  5KAI U;  2KJ9 A;  4I2I A;  2G5I B;  5AI6 A;  2HOQ A;  1RG6 A;  3V7K A;  3E2E A;  2MU2 A;  4RPY A;  3H40 A;  3S6J A;  4YD2 A;  5ALL A;  3V6J A;  5C5J A;  3PW4 A;  2M9N A;  4UAS A;  1JRO A;  3RJG A;  2KEY A;  4QZG A;  8ICG A;  5KFP A;  5GTI U;  8ICF A;  1X6I A;  5KFT A;  2ISP A;  3HKZ C;  5AM2 A;  3ED5 A;  7ICM A;  3RRG A;  3RFA A;  4NWI A;  2QB1 A;  3UPQ A;  5KFC A; 
#chains in the Genus database with same CATH homology
 1SL0 A;  1T8E A;  9ICK A;  4PHD A;  1KLN A;  4PGX A;  3EYZ A;  4KLE A;  1BPD A;  2JEI A;  1RYS A;  1V9P A;  1Z00 B;  4IQU A;  2IHN A;  4QW8 A;  5CHG A;  4O3S A;  1ZQM A;  1JXE A;  4PH5 A;  5J0P A;  1ZQG A;  2ZUD A;  4UAY A;  3PW0 A;  5HP4 A;  9ICJ A;  1UA0 A;  5D49 A;  3JPQ A;  1S0M A;  3K4G A;  4RQ2 A;  1NK5 A;  1L3V A;  4MEY A;  8ICV A;  8ICL A;  8ICZ A;  3FDS A;  3GIL A;  3K75 D;  4FS2 A;  5IIJ A;  3RBE A;  4IQW A;  4F2R A;  3JPR A;  7ICR A;  3C2L A;  2HW3 A;  2BPC A;  5IIK A;  4JV2 A;  2NRZ A;  3T3F A;  5KFN A;  4KLJ A;  9ICW A;  1ZQB A;  3GIJ A;  1N56 A;  2ZJ5 A;  4PHA A;  2AGQ A;  4F5N A;  3PNC A;  4NM1 A;  5BPC A;  8ICM A;  5KFM A;  5L9X A;  3ISB A;  1ZQZ A;  1X9M A;  3UXN A;  5KT7 A;  1ZQD A;  4K4H A;  1HUO A;  1RYR A;  5J2E A;  5IIM A;  1ZYQ A;  2UVU A;  3RJI A;  4YR2 A;  3ZDA A;  4B9N A;  4B9T A;  3RR8 A;  1XC9 A;  5J2B A;  2UVV A;  4NLG A;  3NGD A;  2HHW A;  4DLE A;  3TAN A;  7ICU A;  4JV1 A;  7ICP A;  3GV7 B;  2ASD A;  3LK9 A;  3ZDE A;  2UVR A;  4QWE A;  3M8R A;  3H8W A;  1S10 A;  3PX4 A;  5HNK A;  1TV9 A;  1TK5 A;  5BOM A;  1TK8 A;  2P6U A;  2FLN A;  4QWD A;  4I2B A;  1HJP A;  2B21 A;  7ICI A;  3UQ2 A;  2Y1J A;  9ICC A;  1WCL A;  4LZD A;  2BQR A;  7ICH A;  5KFL A;  2WTF A;  8ICS A;  4Q8E A;  4FS1 A;  9ICH A;  2VA3 A;  4XRH A;  4RU9 A;  3Q8S B;  4DOB A;  4O5C A;  4QWB A;  4RPX A;  1D8Y A;  4R64 A;  1MQ3 A;  4LZG A;  4M9H A;  4J9L A;  4QZ9 A;  1BPB A;  3MDA A;  3EWA A;  1NKE A;  4I2G A;  4F5Q A;  1COO A;  1NJY A;  4EZ6 A;  3MFH A;  4P4M A;  4JWN A;  1SL1 A;  5J0T A;  4DL7 A;  4Z6E A;  3RRH A;  4QWA A;  3M9O B;  5KFG A;  2RDI A;  1BPE A;  4F4K A;  1BVS A;  4ECX A;  2DPJ A;  3ZDC A;  5BOL A;  4UB4 A;  4UQG A;  5J0W A;  1DGS A;  4M9J A;  3Q8R B;  2BPF A;  4DWI A;  3RB0 A;  3M8S A;  2XO7 A;  5CP2 A;  5L1L A;  3HPO A;  2R8K A;  5IIO A;  4RQ5 A;  9ICP A;  3PR4 A;  2AGP A;  3GQC A;  5DQG A;  4ED7 A;  2IMW P;  1SKR A;  1L5U A;  4QZA A;  2AQ0 A;  1NK0 A;  4KLF A;  1KEJ A;  4YXM A;  5J0O A;  9ICQ A;  5J0Y A;  3C21 A;  4F92 B;  4YN4 A;  1S97 A;  1X2I A;  4Q44 A;  9ICL A;  4ECT A;  7ICJ A;  2XGQ A;  1TAQ A;  4ED6 A;  1PZN A;  2V4R A;  5J0Q A;  3G6X A;  2HVI A;  4RZR A;  4Z6D A;  3TQ1 A;  2MUT B;  3TAQ A;  3HP6 A;  4DLG A;  4JV0 A;  2XCA A;  1DOQ A;  4DQS A;  2P66 A;  5J2F A;  4YQW A;  3QEA Z;  1T7P A;  3PW2 A;  1NK9 A;  1L3U A;  5KT6 A;  5DB9 A;  5KFU A;  1TKD A;  5HHI A;  3Q8P B;  2DFL A;  3M9M B;  3V7J A;  1XWL A;  4M2Y A;  1NK7 A;  5DBC A;  3IM1 A;  3GIK A;  4J9K A;  5KT4 A;  9ICX A;  2PFP A;  5KT3 A;  1KFS A;  5J2D A;  2ATL A;  8ICA A;  4O9M A;  2W9B A;  2BCV A;  4GXK A;  4Q8F A;  1IM4 A;  3PV8 A;  3UXP A;  2KFZ A;  4KN7 A;  1C7Y A;  4R8U B;  4RUC A;  4NM2 A;  2XY6 A;  5DKW A;  3GII A;  2ZTE A;  2KZZ A;  5KFH A;  3ORY A;  4QZE A;  1NJX A;  2HHX A;  2JZB A;  5KFX A;  5KT5 A;  4DQP A;  3EZ5 A;  1IXR A;  4M6W A;  3PMN A;  4ECU A;  2W9A A;  1KRP A;  1WCN A;  2JEF A;  2BQ3 A;  2PI5 A;  2JEJ A;  3RR7 A;  3SI8 A;  9ICG A;  2AGO A;  3PR5 B;  4PHP A;  4F4X A;  2Y1I A;  3PW7 A;  8ICH A;  4XA5 A;  1XS9 D;  5KFD A;  1U9L A;  4DL2 A;  3PO4 A;  5EOZ A;  1CUK A;  4MF8 A;  5L1J A;  1KDH A;  1S77 D;  5KFO A;  1HUZ A;  1RZT A;  4XQ8 A;  3Q8M A;  4EBE A;  4KN4 A;  3RB3 A;  5J0X A;  3GFK B;  5KFI A;  4F91 B;  4FO6 A;  4YXJ A;  2FMS A;  4M9N A;  2J6U A;  2BCQ A;  1JXL A;  3TFS A;  1U45 A;  1MQ2 A;  1L3S A;  1JX4 A;  2FPM A;  5J2J A;  4B9M A;  5F9N A;  8ICX A;  1B43 A;  3OGU A;  4B9U A;  4NXZ A;  3N97 B;  1JIH A;  1H38 A;  5KG5 A;  9ICU A;  3MGH A;  2BGW A;  4TUQ A;  3T5J A;  3RJF A;  5CR0 A;  4I28 A;  2A1J B;  1XO1 A;  5DB6 A;  4DL4 A;  3PX6 A;  3QE9 Y;  4DL6 A;  5IIN A;  4YG2 A;  3EPI A;  4M04 A;  2R8G A;  2F1I A;  2VA2 A;  2PFQ A;  4NLN A;  9ICA A;  4UAW A;  3JPO A;  4J9R A;  4DF8 A;  8ICP A;  2ZUC A;  1NKC A;  1D9F A;  3V6K A;  1X9W A;  1ZQK A;  3ZDB A;  2DPI A;  2BPG A;  5DQI A;  2KTQ A;  2H5X A;  4TQR A;  2KZM A;  5KFR A;  8ICO A;  2W9C B;  3JPN A;  2BCR A;  7ICS A;  4Q43 A;  3BDP A;  2FMP A;  1RXW A;  8ICW A;  7ICO A;  3FYH A;  2FLP A;  2FPL A;  4KMU A;  3OHB A;  5III A;  2PFO A;  4BWJ A;  1NKB A;  4IRD A;  3ZD9 A;  1T3N A;  4MFC A;  4RNO A;  5F9L A;  4UAZ A;  3OJS A;  4I27 A;  5KTQ A;  4J9N A;  4DL3 A;  4J9Q A;  3OJU A;  5DGB A;  3JPP A;  5CWR A;  4GXJ A;  2HHQ A;  5EWF A;  5HHH A;  4DFM A;  1QSL A;  4Q45 A;  3GIM A;  4KLT A;  3M9N B;  2R8I A;  4UB2 A;  3BQ2 A;  1JMS A;  3TAR A;  4C8N A;  5DG7 A;  1A77 A;  4JUZ A;  4O3Q A;  4PGY A;  3KHR A;  1ZQQ A;  3PY8 A;  3MR3 A;  3SZ2 A;  2W8L A;  2J6S A;  2PXI A;  3EPG A;  4FBT A;  4YMN A;  3C2K A;  8ICE A;  1XSN A;  3RTV A;  4BWM A;  4O5E A;  4P2H A;  8ICI A;  3KHG A;  3V6H A;  5J0R A;  5KFJ A;  1SZP A;  5J2K A;  2R8H A;  2I1Q A;  1S9F A;  2NRV A;  1NJW A;  4UBC A;  3C1Z A;  5DB7 A;  2P6R A;  2JEG A;  3C5F A;  4ECS A;  1ZQU A;  2IA6 A;  4PPX A;  4B9L A;  4R63 A;  4KLM A;  5KFF A;  4IRC A;  5DQH A;  2KN7 A;  1XSP A;  3BQ0 A;  4BXO B;  5DLG A;  4RQ3 A;  3QZ8 A;  4ECQ A;  1ZQW A;  4RQ7 A;  1ZQC A;  5EWE A;  4LVS A;  2AJQ A;  1CEZ A;  3QEB Z;  4M9G A;  3AU6 A;  4KTQ A;  4DQI A;  1BPX A;  4KLD A;  3HWT A;  1X9S A;  8ICB A;  5CB1 A;  5EWG A;  4J9S A;  1KTQ A;  3PW5 A;  2C2R A;  4I2H A;  4I2A A;  3JPS A;  2HHT A;  8ICJ A;  3V72 A;  1ZET A;  8ICT A;  3PX0 A;  3GDX A;  4F4Y A;  9ICM A;  3ZDD A;  3KHL A;  4HYK A;  3BJY A;  9ICE A;  5KG7 A;  4K4I A;  4ECY A;  1S0O A;  5DLF A;  4RQ4 A;  4F4Z A;  9ICN A;  5J2C A;  3H8S A;  3RAQ A;  3H7I A;  5CA7 A;  7ICG A;  5KFE A;  4DQR A;  2F1H A;  2ASL A;  3V7L A;  3ISC A;  5J0S A;  4EBD A;  4O3R A;  4RT3 A;  2KFN A;  3ZD8 A;  4YD1 A;  3G6Y A;  2BDP A;  1UT5 A;  4DSL A;  3C5G A;  1U4B A;  3C1Y A;  7ICF A;  9ICR A;  1ZQO A;  4C8L A;  3UXO A;  3QZ7 A;  3ISD A;  2ZTD A;  1MC8 A;  4RQ8 A;  4M6W B;  4KIT B;  4J9P A;  3AU2 A;  3SYZ A;  5IIL A;  4O5K A;  2NRT A;  1ZJN A;  4PGQ A;  1KSP A;  3RB4 A;  1S0N A;  1RPL A;  2NRX A;  8ICY A;  3LDA A;  4IQT A;  3MBY A;  2C2E A;  1U48 A;  2GWS A;  9ICB A;  4F5R A;  1ARO P;  5DBA A;  5KFY A;  1ZQN A;  5J29 A;  2MUT A;  4CCH A;  3HX0 A;  4I2C A;  4ED1 A;  3IHQ B;  4YFK A;  4QW9 A;  5J2I A;  4I2E A;  4DS4 A;  3PML A;  4G3I A;  4TUR A;  4I29 A;  4RQ0 A;  5TZV A;  4DO9 A;  3THV A;  7ICT A;  3B0X A;  3LWL A;  3MR5 A;  3Q8L A;  7ICQ A;  4C8M A;  4ED2 A;  3MGI A;  3KHH A;  4IR9 A;  3KTQ A;  1ZJM A;  3OSN A;  4YMM A;  4EYI B;  3TI0 A;  1LV5 A;  4F4W A;  2XCP A;  4YR0 A;  1BPY A;  2I9G A;  3GV8 B;  2V9W A;  4NY8 A;  4KLS A;  5KG6 A;  1NOM A;  5J2A A;  4J9M A;  4IRK A;  4DF4 A;  4R8U A;  4QZF A;  2PI4 A;  1ZQS A;  2NRW A;  4E0D A;  3PVX A;  1ZQJ A;  1QLN A;  4O3O A;  3TFR A;  4I2F A;  2W8K A;  4ELT A;  1A76 A;  8ICK A;  1Z3E B;  4RQ6 A;  2J6T A;  2HVH A;  1ZQE A;  3MR6 A;  3ETL A;  3JPT A;  2BHN A;  5HMM A;  4ZH4 A;  4DFK A;  4F5P A;  4BGD A;  8ICN A;  4P4P A;  1ZQL A;  1NJZ A;  4B9V A;  5KFK A;  3Q8Q B;  4F93 B;  2XC9 A;  4QZH A;  4X5V A;  4EYH B;  1ZQI A;  5J0U A;  4I2D A;  4KLU A;  1D8L A;  1U49 A;  1TFR A;  4FBU A;  1Z00 A;  4YCX A;  3MFI A;  4C8O A;  4GLX A;  4MFA A;  3OHA A;  1NK4 A;  2FLL A;  1BGX T;  1SKS A;  2VA8 A;  4B9S A;  2AQ4 A;  1KFT A;  5KFV A;  4QZI A;  5KFB A;  2R8J A;  5KFS A;  3MDC A;  4DL5 A;  2ISO A;  5HML A;  2A1J A;  5KFQ A;  2XY7 A;  4O3N A;  3OSP A;  3BQ1 A;  5D4B A;  3N4M B;  2ASJ A;  1NK6 A;  1QSS A;  5DGA A;  4I2J A;  4GC7 A;  4KLI A;  4KLH A;  4DSE A;  1EXN A;  4QZB A;  9ICT A;  4PHE A;  4IQV A;  3EW9 A;  4ELV A;  4EBC A;  5KG4 A;  3RJE A;  5DB8 A;  3RJJ A;  4ECW A;  2W9C A;  4DOA A;  4MEX A;  4IR1 A;  4XUS A;  4JWM A;  2ZTC A;  3LWM A;  3UQ0 A;  4TUS A;  1SL2 A;  1ZQA A;  4UBB A;  4GXI A;  2AU0 A;  8ICU A;  1ZQH A;  4DSF A;  1ZQF A;  3RBD A;  9ICV A;  2KZ3 A;  4RT2 A;  4GC6 A;  1ZQX A;  4UB1 A;  1XU4 A;  5J2G A;  4KLL A;  3HT3 A;  7ICL A;  1D9D A;  4DFJ A;  7ICE A;  4QZD A;  2XGP A;  1RXV A;  1XSL A;  4Z6F A;  3T5K A;  7ICV A;  3RH4 A;  4DS5 A;  2PFN A;  4DSK A;  3AUO A;  3RB6 A;  2C28 A;  4RUA A;  2V4Q A;  3SV4 A;  1NK8 A;  2BR0 A;  1LB2 B;  2BQU A;  1MSW D;  5KG3 A;  4O0I A;  1S0V A;  7ICK A;  4ECV A;  2ZJA A;  3GV5 B;  2ALZ A;  4RNN A;  4M9L A;  4KLO A;  4EEY A;  4RPZ A;  4QZ8 A;  2MAX A;  2BKE A;  4YMO A;  5CJ7 A;  9ICF A;  3SV3 A;  5DG9 A;  4F5O A;  4F3O A;  2UVW A;  5L1K A;  4TQS A;  2VAN A;  4P4O A;  3TAP A;  2BCU A;  3MAB A;  4KLG A;  4RQ1 A;  2W9M A;  3B0Y A;  1TK0 A;  4YVZ A;  1N48 A;  1T4G A;  4QZC A;  4KLQ A;  1ZQY A;  1SKW A;  4F8R A;  5KFA A;  2W9B B;  1ZQP A;  9ICO A;  3RAX A;  4MFF A;  3H8J A;  2ZJ8 A;  4EZ9 A;  1S76 D;  1K1S A;  4DEZ A;  4YR3 A;  4BXO A;  1Y88 A;  3RJK A;  3BQT A;  2ZUB A;  4R66 A;  3MR2 A;  2F1J A;  1TVA A;  5KG1 A;  4UB3 A;  2JZB B;  4MF2 A;  3T5L A;  5DDY A;  4NLK A;  4ELU A;  4DOC A;  3H4D A;  4O3P A;  5L1I A;  2XY5 A;  5KG2 A;  4J9O A;  4YP3 A;  1UA1 A;  1TAU A;  3C23 A;  8ICR A;  1UT8 A;  5D46 A;  4DSJ A;  2IBK A;  5DG8 A;  2HHV A;  1U47 A;  3NTU A;  4ED8 A;  3T5H A;  3RH6 A;  1L3T A;  4I2I A;  1ZQT A;  5KFW A;  2FMQ A;  4C8K A;  4F50 A;  1JN3 A;  2FPK A;  2HHS A;  8ICC A;  3PO5 A;  4DSI A;  1ZQV A;  4ECR A;  3V7K A;  4ED3 A;  3E2E A;  1ZQR A;  1KFD A;  3H4B A;  2OWO A;  4M0A A;  9ICI A;  4RPY A;  3H40 A;  2RDJ A;  4K4G A;  4DFP A;  4YD2 A;  3V6J A;  9ICS A;  5C5J A;  3PW4 A;  4R65 A;  3G6V A;  2M9N A;  5KG0 A;  5JUM A;  5DDM A;  1BPZ A;  3RJG A;  4QZG A;  5KFZ A;  5KT2 A;  4NLZ A;  8ICG A;  2HHU A;  8ICQ A;  5KFP A;  2C22 A;  2IHM A;  4TUP A;  4M47 A;  4Z6C A;  4UB5 A;  8ICF A;  3Q8K A;  3C2M A;  4DQQ A;  2BCS A;  2LYH A;  5KFT A;  3RH5 A;  2ISP A;  4BDP A;  5J2H A;  7ICN A;  1B22 A;  3RJH A;  4JK1 A;  4F2S A;  2C2D A;  4ECZ A;  7ICM A;  3RRG A;  2Q0Z X;  1K1Q A;  1QTM A;  4QWC A;  4ED0 A;  3UPQ A;  5DBB A;  4RNM A;  5KFC A;  3HW8 A;  1QSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...