1Z06A

Gppnhp-bound rab33 gtpase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
RIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-33B
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 51
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z06A00
4NBSA 1TUIA 2NO0A 1D5CA 3L2OB 4OI1A 5DYIA 4JSTA 1FNMA 3IDQA 1HA3A 2HLDD 5JMTA 3FMOB 3CKLA 1MO6A 2HXYA 2O52A 3K0FB 4Q4HA 1YVDA 4LZZA 3LXRA 1DAHA 1M6NA 1Z0KA 3SJCA 1G19A 2GTPA 1P61B 1H8HA 4CEJB 1NBMA 1GILA 2BM1A 1Z6YA 2J46A 1DAEA 1ESNA 1NSTA 2CMKA 2ODBA 2V1UA 2DR3A 3B8HA 3CW2A 1F2UB 1TQ6A 2O0HA 3TJZA 4R71A 4JIMA 3EIQA 4LBVA 2I1VB 4C0KA 2OBMA 3AF1A 4Q47A 4IOLA 1XEXA 2OAQ1 1KKLA 1UKEA 3T1OA 1E9SA 1GSIA 3Q85A 4G5GA 2J41A 1NVXQ 4HAWA 5AUOB 4C0QC 1Q3TA 1W5TA 3BGWA 4TSFD 5KUTA 2PH1A 3C7KA 3OE7A 2O8FA 1XXHE 4Q4LA 4KO8A 1TNDA 2ZE7A 4O2LA 3O8CA 2C95A 3WRYC 4DCUA 1ETUA 4B73A 1XMVA 3CRVA 2ZITA 2NZ8A 3AF0A 4US2R 4JLMA 4B33A 3A4LA 2ZI6A 3TRFA 1E99A 2ZRFA 3G82C 1EWRA 3K0AA 1OXUA 4TL9A 3H4MA 4KVAA 1GM5A 2IHYA 4PHTA 2GEDA 2ZRDA 3T06B 1H8ED 3FMPB 5TDHA 1DAIA 4D25A 3KFXA 3A1TA 4F38A 4C0LA 3MG9A 4FCVA 3CF0A 3U44A 3RHFA 1Q1QA 2QM8A 4URVR 3THXB 4B76A 1W2GA 2GXSA 2JAQA 4UQOA 4CVNA 2CXXA 4DLSA 3IO3A 2ZJBA 3KXLA 1NL3A 5LDDC 1XD2B 3AQ4A 1GIAA 4GOXA 3OIYA 1W0JA 2WM9B 4QHYA 3A8TA 4DLVA 2FA9A 3EPHA 4AURA 1D2MA 5BQ5A 2WSSA 2DY1A 2ECKA 1DG1G 3ZVRA 4I1UA 4ARZB 5JHHB 3QEJA 5AK0A 2J5XA 5CLQA 5B2ZA 4UNPA 2OFOA 4KBGA 4ZI3A 4FMBB 2O8BB 1Z3IX 2W2VA 2HCBA 2X2FA 5TVKA 5JS8A 2ZRCA 2ZU6A 2JJ2A 2DYKA 1U2RA 5FR1A 1WBBA 2G1KA 1UBCA 2P6UA 1GAJA 3QBVA 1G3MA 1XEWX 5FBVB 5FTLA 4HZUB 2ANBA 2GK6A 1EFTA 4ON9A 2IYRA 2D2EA 1QHSA 1EK0A 4MKHA 4GT1A 4JYCA 2AN9A 1CXZA 5JLJA 4IEEA 3U6BA 1Z83A 5FBQB 3NBYC 4EPWA 4I1VA 1G20E 4EFNA 821PA 3OHMA 4M1SA 2VSFA 1ZJ6A 2IYVA 2F1RA 2IF2A 1SXJE 1KI6B 4POAA 2RMKA 3GP8A 1KSHA 1KDTA 1M2OB 3OF5A 5G53C 1E2KA 2QMEA 1ESMA 1ZW6A 2CK3D 2WZQA 1OT3A 4QGAA 3QXJA 1Q44A 4JLNA 2D62A 3P4YA 4LYJA 4FD2A 3GLGB 2Q3MA 4YMWA 3PEWA 2QSYA 3JVUA 5DGXA 2GJ8A 3U3MA 2K5UA 4NCNA 5CJPA 3U4QB 1UM8A 5HKKA 4K81B 1T8UA 1ZINA 4ZKDA 2VHCA 2NO9A 2IYWA 2B21A 2O8DB 1N0UA 1UDWA 1JR3A 2FSFA 5C1BA 4UXHA 1UBGA 3ZZTA 4CF7A 5F9FA 1N2CE 1U0LA 4CZ2A 3EPKA 1YR8A 3LV8A 4M1TA 5FI1B 2DWOA 3SEAA 3W3AA 1JBKA 4MYUA 4F92B 1WRBA 1SVIA 1ZD9A 4QRHA 1OHHA 4DIEA 2GJSA 1B23P 3U60B 4FCTA 1L8QA 2PLRA 2C9OA 5B58C 1FZQA 5B57C 2BJVA 1IAQA 2FZLA 3FKSD 4Q4HB 3G0HA 3ZZUA 5EXTA 3AV0B 2XOKD 2OXRA 3K9HA 1Q3HA 1R10A 4G01B 3AP2A 4PC7A 4TMZA 1HT2E 3Q72A 5L8VA 5B30A 5IK2D 3K70C 3FFBA 1ZNWA 3W5JA 1ZYUA 2CVHA 3QXHA 3TW4A 2ZRKA 1LS6A 3UANA 4CYMA 3GLIA 3BC1A 3G5UA 3T5DA 3W6NA 1J2JA 1JPJA 1OXSC 2B7BA 4E5UA 1YZGA 3SDZA 2AKYA 1LF0A 1GZSA 2R8RA 2VL7A 1G64A 1L4UA 2W0SA 4WXPA 4C9BA 4C2UA 4FMCB 3RC8A 3PUYA 2O8FB 1G8FA 3AVYA 2ZEJA 2OBNA 4JBYA 4JJZA 2XNDD 2QY9A 1CS4C 2GNOA 4Q4AA 2DHRA 4XIGS 3CB4A 4IOMA 4PQYA 4XWKA 3ZLJA 4RD0A 1ZM3A 2VIIA 1Z5ZA 5C46F 3SQWA 1MV5A 3AF4A 2B7CA 3W8RA 4BZQA 1OH6A 1D9ZA 2V6IA 3HDTA 3K0AB 1NSFA 4BUJA 2IXEA 5G41A 3SFVA 2LWIA 5BW8A 5B64A 3RYTC 2P5SA 2WV9A 3DM5A 4LHYA 4KVGA 4NP6A 2A5GA 5AJVB 4B2LA 1YU9A 1P9WA 2ODNA 1TF2A 4A4DA 1NG9A 1XTRA 3QXXA 4ZDKA 3U44B 1W5SA 2F1IA 2IC5A 4LJ8A 1S3SA 2IHBA 3I8SA 3QXCA 1D2EA 4P4TA 1E9DA 1AIPA 3ZVMA 2G6BA 3V00A 3BD9A 3WMEA 8OHMA 4TLCA 3ADCA 2JLZA 2WBLC 2AXPA 3KJEA 4PPNA 5JRZA 2LKDA 4TYNA 3EIHA 2QP4A 2P0EA 3EZ2A 2R6FA 1JJ7A 2D74A 2O8CA 2WJGA 5EP1A 4Q5IA 4NCJA 3B9QA 1IY0A 5DLQC 2QPAA 3WYGA 2REOA 1Y63A 2XB4A 3K8YA 5A0FA 5JEEA 4YQFA 4N1AA 2GETA 2V4ZA 2EFEB 1Q1EA 1E0JA 2ZSDA 4KJZA 1S4QA 2NO7A 4M21A 5UKDA 2QP9X 3H86A 5FTNA 3NBZC 1E2JA 1XEFA 2C5LA 4MKFA 3LLUA 5C2JB 2PL3A 3BE4A 1YR9A 3GJ6A 2KWIA 5CB8A 4RD1A 4N0EA 2A9KA 4D6PA 4OK3A 2Q9AA 1COWD 3L0IB 2J87A 1ZCAA 5IK2A 1BS1A 2ZRMA 1NRJB 1WBDA 1E9EA 1Y3AA 4LI0A 4BRWA 3NHBA 3WYFA 1NY5A 2QROA 5E7MA 1R0ZA 2IK8A 3L43A 1LB1B 1VMAA 3PXGA 4D0LB 2FWRA 4DKXA 4KAXA 2BCJQ 5AWFC 2WAXA 4W7SA 1XCPA 4YXWD 3IKJA 4DSUA 1KO7A 2AKAB 2GAAA 1MRSA 3GLFA 3BH0A 3I62A 4PANA 2I4IA 3OIVA 1KI4A 2ZUBA 5FOSA 5KHOC 3FE2A 1KO1A 4US1R 3ZDQA 4BLPA 1OE0A 1GNQA 3SYNA 3TSZA 4PZZA 2EFDB 4LSGA 4OQLA 4LWZA 3CX8A 3FMFA 3NWJA 3RWOA 1I4DD 1AKYA 3ZQJA 1KY2A 2DPXA 3GMTA 3W9YA 3FFAA 4Q18A 1Z8FA 3BRWD 4GZLA 2OO7A 4BLSA 5JECA 1FTSA 3I1FA 1G9XA 1IONA 1KAOA 1WE2A 1NN5A 2HEIA 5GJBA 4L9SA 1EGAA 5G40A 3GEEA 3LFUA 2VHTA 4RFSA 5DI9A 1T9HA 4X8MA 5J40A 3RRMA 2ZI3A 4DC9A 1A2BA 4QC2A 2VLIA 2XZLA 3DZ8A 3WY9A 4M9ZA 3LX5A 1CJVC 1GNPA 4TLBA 2CL0X 2JJ1A 2OUKA 4QHSA 5BN5A 4DCTA 1E69A 1TMKA 2R65A 3BWDD 2AWNA 1Z0DA 4MDFA 4PPFA 4AKEA 1VCMA 3U61B 4HUQA 4US0R 4OHWA 4Q7LA 4CGZA 3CX6A 1P60A 2QRZA 3EXAA 3GFTA 1KI3A 2JJ8A 2UZIR 2V54A 4JSYA 2C9CA 1YZLA 4U5XA 3X1XA 5DISB 1DAGA 5FUWA 1FX0A 1F48A 2DFNA 2GDJA 4OQXA 1N6KA 1G8GA 1S9DA 3ASYA 2QQ0A 4JLKA 5FI0B 4Q4AB 1COWA 4DLWA 1C4OA 5JEDA 2ZETA 4RCZA 3UIEA 4OJKA 1J70A 5A5GA 3BFXA 1IM2A 5CDFA 1V43A 3MMPA 3TMKA 1YZUA 1CKEA 1KHTA 1ZM9A 4Y0VA 5JHGB 1SVOA 1I2MA 3EPLA 1WB9A 1KSFX 1IXSB 2YOFA 2O8EA 4MA4A 2CNWD 1P4SA 1VCNA 5AJXA 4G0NA 4YXWA 3EX7C 2NQ2C 3Q8XB 3RRZA 4GNKA 5SZIA 1VHTA 1Z6AA 4HSEA 3KL4A 4MKGA 4OQMA 4RD2A 1R0WA 3RS2A 2R6DA 2PLFA 1W36C 4HDQB 4Q1CA 2G88A 1W47A 3B13B 3CPHA 5SZHB 5KYKA 4URUR 3UMSA 1II0A 4GMXA 1VDZA 1GG2A 4FMCF 1G3RA 1W36D 4W5JA 2O0KA 1E4YA 1PLKA 4LV5B 1E2EA 4NCKA 5K8UA 3KFVA 2VF7A 3AUXA 3AGPA 3TQCA 3GLHA 4U7DA 1N5IA 1I4LD 4RZ2A 4BFTA 1N0WA 2OAP1 4MRPA 4E09A 4GSYA 2O8CB 2PEYA 4XWOA 3WBJA 2VP6A 5FUVA 2Z6VA 3MWLA 4FI3C 4TTPA 3Q5DA 2BKEA 3MSXA 3I72A 3OEEA 4LHWA 4UNNA 5EE9A 5EQTA 5EZ6B 1AZSC 2IUTA 4U00A 4V0OA 3AUYA 3QXSA 4TMVA 5EXSA 4ZCLA 2V55B 1DELA 1R5NA 1XZQA 3I4LA 521PA 2ZANA 4TMTA 3B5JA 1RIFA 3KKMA 2ORIA 1P72A 4NYJQ 3UKDA 1J7KA 1VTKA 3TUZC 3VHXA 1AGPA 4JLDA 3VX3A 3KQKA 4FMDB 3WRXC 1G7SA 5G3ZA 4OQNA 4HB4A 4JMPA 5FPTA 4HAVA 3R9XA 3C16C 5EP3A 4RFVA 2QT0A 1UF9A 4XH9B 3K70B 1E9BA 1HUQA 1N3BA 4HLDA 5JWHA 1QG2A 1FMLA 2CLSA 2YV5A 1KYIA 2RGXA 3ZS9A 2FPMA 2RCNA 3GLFB 2HF8A 1E79D 1JXOA 4PC2A 2WJHA 1I2DA 3WBKA 2VA8A 1NIPA 2RGGA 4JVNA 1OXTA 1JAIA 4D4KA 5HZHA 5JJKA 5KTYA 5AJZA 5FBWB 4Z1MD 4GRAA 2UKDA 2XB2A 2EQBA 3OFNA 1IN5A 4TYPA 4MITA 1KO8A 3OESA 4DXAA 4D0NA 1X8LA 4HZIA 4JKIA 5LB4A 4WAUA 1E2GA 2X8AA 1E1QD 1P75A 3SJAA 2WWHA 5C18A 5L3QA 4D4JA 1HQCA 2OCAA 4L8GA 4YC7A 4JYBA 1S8FA 4JJKA 2QRNA 1K6MA 2C8VA 2YOHA 2JEOA 3GJ3A 1OFHA 2BBWA 3RS3A 2A5JA 4URXR 2NO1A 2ZRNA 3PV0A 5JWOA 3CRW1 1AK2A 4BPBA 4M53A 2W00A 1W4CA 4EKDA 1BH2A 1H8HD 3AVTA 1NBMD 2PT5A 1GOTA 4G1UC 2QORA 4LBYA 5CLLA 1R2QA 3A4NA 4ARZA 2PJRA 4OHYA 4Q7JB 3WMGA 1VIAA 2VQSA 1NKSA 2FX3A 3LQRA 4GDFA 3EWSA 4LJ5A 4R7ZA 2A5FA 2NG1A 5AUPB 5KSOA 4JBXA 3CPEA 4DLYA 3ZS8A 1YRAA 2OV2A 4TMKA 5KU1A 5FPYA 3OE7D 2ZJ5A 4HUQB 1VECA 1TL7C 2ZS7A 5DYGA 3TIFA 5DO9A 1Q1ZA 5E95A 1NN1A 1EXMA 2HF9A 2BOVA 5CIWA 2NGRA 5SZJA 2IT1A 3QG1A 4Z51A 2REXB 3SC3A 1RZ3A 1PJRA 4I4LA 4CEIA 5HE9A 2YWHA 5AJYA 5GVRA 1AA9A 1FX0B 3TGPA 3TAUA 2QAGC 1ZMXA 5HZKA 3MGCA 4NZYA 2BBTA 2YINC 1DG3A 1U8YA 4S2EA 2QT1A 2BMFA 3A1SA 3KUDA 1GUAA 1KI6A 4V0LA 1W2HA 4UXIA 1QVRA 5JI2E 3A37A 3OIWA 2CE2X 4HLUC 5BYJA 2PX0A 3L8YA 1PUJA 2J9RA 3SR0A 2O8EB 1NVUQ 2YVUA 4LK2A 1UBFA 1TQ2A 2QI9C 3IHLA 1X3SA 3ZZ0A 5KNDA 5LPNA 1HH4A 1NY6A 2IYLD 2JDIA 4FXPA 5DI3A 2F9MA 1OH7A 1RW4A 3B82A 5C4GB 2PT7A 1TUEA 3Q3JB 1LTQA 3BFVA 2GA8A 1RKBA 3GFPA 3KB2A 3B85A 4B32A 5AUNB 3NC1C 4A36A 2WSSD 5CB6A 1NKTA 1DPFA 1KGDA 3LLMA 3UPUA 1E2NA 2IS1A 3VKGA 1KI9A 4LYAA 2W83A 2SHKA 4LBZA 1OSNA 3ONWA 4CT4B 1OJLA 4IVRA 3P1JA 1IN4A 2OCPA 3GQBA 3GLHB 3X1ZA 5AUQA 1SZPA 1F2TA 5HR5A 2XZPA 2ZJAA 3HU2A 5CJ2A 1ZM2A 3VKWA 3CH5A 4QNMA 2JJ2D 2FU5C 2XNSA 4V03A 3KJIA 3PUZA 2GESA 2HYIC 4V0ME 4MRRA 3TR5A 3TVDA 4TL8A 3QF7A 2J0SA 4R9UC 2ZAOA 4Q1DA 3I73A 2IS6A 1ZNYA 5BYKA 3T61A 2NPIA 4C0HA 5K8IA 4JZKA 3REGA 2ZSBA 1AQUA 2WMNB 1DOAA 3ZGXA 1ZUIA 1GTVA 3C15C 2D06A 3HR8A 4I99A 4D26A 2KSQA 1E9AA 2EYQA 2WIBA 2WJIA 3PUVA 3T12A 1G4UR 2IYSA 2QE7A 2IX3A 2QUZA 4AKHA 3CZQA 1W48A 3R20A 4RJLA 1OW3B 1XX6A 2ZSAA 4LJYA 3AEZA 4A1FA 2ANCA 4UKDA 2AK2A 5HKKD 1DTSA 1ZRHA 4ACBA 2WWYA 4DSOA 3B1YA 3ADKA 3SU8A 1JR3D 2AD5A 2OLJA 2QAGA 4HEJA 1XRJA 1H65A 3X1WA 4BFWA 4NONA 3T35A 2I1QA 1OIXA 1T0HB 4BQSA 4JLBA 1IJFA 4F7WA 1W0KD 4F93B 3DHWC 1G1MA 2AR7A 1PV4A 2CBZA 4PC6A 2B92A 5L3QB 4CIDA 2BEKA 2PBRA 3FMIA 2Z0MA 2AK3A 5F9HA 1OHHD 2KB0A 1SGWA 1KDOA 4HLUA 2MMCA 2ONJA 4BFXA 3GLGE 1C1YA 4EDHA 1U81A 3RDPA 1HYQA 2GJKA 2WVJA 3PITA 4DB4A 1S96A 5BXQC 1J99A 2YNMA 3A1VA 1E6CA 4IRUB 4NL4H 5E7IA 5FBRB 1M7BA 3LW7A 1G18A 4XJXA 3EAQA 3LO5A 4DZZA 4JL5A 1W36B 4M1OA 4A2QA 5G3YA 4P33A 5DH9A 1S1CA 1T6NA 1T0JB 1VIYA 1GL9B 5F3WB 5EZ5A 1TAGA 2JA1A 2B6HA 3ZD7A 2N46A 3EA0A 1XTQA 2D7CA 4PC3A 5HTKA 3U3JA 4WZ6A 3AVPA 3EG5A 4MYHA 2P65A 3TW8B 4PSVA 1KMQA 4MDEA 4KLNA 3EC2A 2V9PA 3SYKA 1N6HA 2I3BA 2RGNA 4YMVA 3UWOA 4IDHA 2NMVA 3IGFA 2WKPA 3TSOA 4M4SA 2FOLA 1E2MA 1G8HA 5CK5A 3LXXA 3NXSA 3P4XA 4CEIB 4DVGA 1NBME 4XSHA 3NBFA 3NH6A 1DBSA 1HY3A 4DLUA 3CM0A 4LDJA 5FTKA 4MH0R 2KI5A 4W5HA 3C5HA 4TMXA 3W6PA 1IHUA 3DDCA 4BGDA 1CF4A 1XXHB 3ADDA 1AKEA 3LX8A 1G3IA 3AH8A 4M9XA 4LJ4A 5FPSA 2FPLA 1N6IA 2IW3A 1X1SA 1LW7A 2VSXA 3P26A 4HAXA 1WA5A 2V6JA 2ZROA 2QBYA 5KNBA 2FSHA 1M34E 4QM7A 4QBHA 4A82A 1YRBA 3BJIC 3CR7A 2H92A 2D3WA 4XD7A 1FFHA 1PUIA 4YMUA 2DWQA 5DI3B 1DEKA 4JVSB 1P6XA 1OF1A 1VG1A 3AKDA 5EUQB 4EFLA 3K9GA 1G17A 1IXZA 4WZAE 4NDZA 5FUXA 1Z28A 1EFCA 3UXMA 1UEIA 1CRQA 2GRJA 1KI2A 5J4HA 2WKQA 2FSIA 1KJWA 2AX4A 1TX4B 1W0KA 2JGNA 4C0SA 1U94A 2OFXA 2F1HA 4NE2A 1BKDR 1OPXA 4IDQA 3AVOA 1XFAA 2ZUCA 3MJHA 1F2TB 2GZHA 3PG5A 3K09C 2GEUA 1KZGB 3NDPA 1ZBDA 1EX7A 1VCIA 3M6AA 1Z6TA 2GK7A 2QG6A 4IXMA 4LJAA 2J7KA 4OI2A 1FOEB 4P4SA 1E1RD 2AXNA 5FOUA 3RANA 2A5YB 2JIZA 2GHIA 2F3TA 1KZ7B 2GCPA 3B7GA 2QTHA 3TH5A 1K5GA 1OB2A 5JJLA 1OXVA 2R6AA 4M9QA 4O0MA 3V9PA 2CCJA 1NVVR 3NC0C 2FPKA 1ZNZA 4LRWA 4G3XA 3T34A 3FVQA 3UWKA 4TTRA 3ZVNA 2Z4SA 3C8UA 5FBLB 1EWQA 3CWQA 3I5YA 1NMYA 3K70D 4EQ6A 4JVMA 5FH9A 3A1UA 3J81k 4MGYR 2ZRGA 2OFWA 3NEJA 1M1YE 1KNXA 2WOOA 2C03A 3O8BA 3LBIA 1VYUA 1XMIA 3VR6A 4MRSA 2IS2A 4TLAA 4LJ9A 1HTWA 2A30A 4DLRA 2BDTA 2OBLA 4A6XA 5HCNA 4RVCA 4DCSA 4M1YA 2UZ3A 3VHLB 1WCV1 1Z07A 3LA6A 2H8KA 3SBDA 4DUGD 1N5LA 2FFHA 4NYMR 2QAGB 1W4BA 1TTTA 1JB1A 1P2TA 4M22A 3QPWA 3K9NA 4DJTA 3VR5A 1JALA 4IOKA 1KJZA 1CLUA 4ZDJA 2QPTA 5KNCA 1PLLA 5FL3A 1WP9A 4OKSA 3A4MA 5H68A 1EG7A 4QGHA 2ZUDA 4O2RA 1QRAA 3NVAA 3OAAA 5IHPA 4DB2A 3H84A 2ODEA 2DFKB 1KI1A 4DT1A 1VPLA 2W0MA 4O3MA 3VNUA 1OIWA 4MGIR 1AZTA 1KI8A 1MR3F 3D8BA 4KFRA 5DNYB 2HDNB 2BVNA 2JJ1D 4URZR 2G9NA 3TUIC 1N6OA 1JR3E 2FE4A 1YKSA 5J47A 3VTKA 4ABYA 4JLOA 5TB5A 4DEYA 5AJWA 4EAQA 2NOAA 1E2LA 1A7JA 3LBHA 2WPDA 3JZAA 3PEVA 3THOA 3TE6A 4EPYA 3BOSA 5TMPA 3LAWA 2OT3B 1BOFA 2CEAA 1AS2A 1FL9A 1Z0FA 2OEPA 4Q48A 4KSBA 3EZFA 3U7HB 2P3SA 2VHJA 1E1RA 2XITA 5KSYA 4M9SA 1SHZA 2NO6A 5JRJA 4UNSA 4Q1EA 3D31A 3K09A 3ETLA 2IXFA 1E2FA 1RYHA 2BCGY 1Z0AA 1SVKA 4IDOA 1G21E 2EFGA 4Q02A 4BASA 3AVQA 4AG5A 5FOXA 1A2KC 1X86B 4Q1FA 3GLIE 4UNRA 2C2HA 1XD8A 2IA5A 2WJJA 5CK4A 1G41A 5KDLA 3RAPR 1E0KA 5FL7A 3EW9A 3K0CA 1NLZA 2G0NA 4M0LA 5IDVA 1DVRA 1MO5A 3ZIAA 4PTLA 1IOZA 4QJ3A 3QPVA 2ZJ8A 1R7RA 4FWIB 4CRWB 1E9RA 2QBYB 3Q5EA 5LD2C 2VF8A 2ZPTX 1U8AA 2ZI9A 3REFA 1KSJA 1T8TA 3T1TA 1QHXA 4A8JC 3QBTA 2RB4A 1T4GA 1SVSA 4I1SA 3Q9LA 5E4FA 2PCJA 1TADA 4A2PA 2A5DA 2YOGA 4E22A 2C77A 2DB3A 5KOYA 2BKUA 2BHRA 4DUGA 5BWMA 1TQDA 4OI4A 5EE3A 2GVZC 3BB3A 3FKQA 5EXPA 5DHAA 3MWJA 4MKIA 4NPHA 2ZREA 3RS7A 3GFOA 4E07A 2PCLA 5K8TA 1KK3A 3TLXA 2QGZA 1SKYB 1BIFA 3OEED 4WIAA 3LY5A 5LB2A 2W2TA 3HJNA 1XJCA 3TR0A 1Z47A 4HB0A 4F91B 2ORWA 1OXXK 3CF6R 4P32A 4TLDA 4A0RA 3ND8A 4U02A 4P4SB 5FR2A 3NH9A 3WMFA 4BFUA 2H1LA 2FZ4A 1GRNA 4EPXA 3JVVA 1UADA 2P5TB 1G3QA 2R62A 2XJ4A 2Y8EA 4X8HA 4GFDA 3VR1A 1FUKA 2GEVA 2ZI7A 3TUJC 3IBYA 2BC9A 3VMFA 3WHLA 2WOJA 2YJTD 1OFUX 1HURA 3FHTA 2QSZA 2VP2A 5JS7A 1K8RA 4ACAA 1OB5A 2H57A 1BYIA 2MSDB 1DO0A 2YWGA 4TWZA 1QVAA 3DM9B 1RYFA 1F60A 1VYTA 2ZTSA 2RGBA 4A0HA 4EQ6B 2Z4RA 3MAAC 2FMXA 3M0EA 2D2FA 3ZD6A 2IL1A 1UKVY 1ZP6A 1EFRD 3PCRB 1JI0A 1R8SA 4MQBA 1C9KA 2VYFA 1AGRA 4JL8A 4PSKA 2CCKA 4KV9A 3TBKA 3H2YA 2XEXA 3NKVA 3ND9A 3ZYCA 3BH6A 1YJ5A 3GJ4A 4OBEA 4PR0A 1ELOA 2ERXA 2W6ID 2ZIAA 5KPJA 4WBSA 2ZYVX 3L8ZA 2GJ9A 1PZNA 1D8TA 2QN6A 2ZRAA 3OFND 4EFMA 3DOFA 4Z8XA 2ZVQX 1ZCBA 3ZVLA 2WKRA 3PR1A 3BORA 2IEZA 1XTKA 3CNLA 3FHOA 4IDPA 1CIPA 1NNEA 4HB2A 3TK1A 4OHZA 3EC1A 1SHKA 2VBCA 1EX6A 1JEEA 3GJXC 2AWOA 1CP2A 1Q0UA 3UMFA 4A6PA 3GLFE 1XZPA 2OZEA 3C5CA 2BMEA 1Q22A 3FGNA 4D0GA 2AHOA 1JR6A 1EESA 1IY2A 1HT1E 2DFLA 2QL6A 3QG5A 4HDCA 2E9SA 1O87A 2YYZA 3U3RA 3V4RA 1KDPA 4IHQA 4DT1B 1MOZA 3NHAA 4OQFA 4A8JA 4DDVA 2FFQA 3W6OA 4Q03A 2JLSA 4UNQA 4PPQA 5JZVA 3VX4A 2OESA 1QHIA 5EE1A 1QZXA 3EARA 3MWYW 4PHFA 4NMMA 1YZNA 3P27A 2V7QD 4EPVA 1E0AA 2QMUA 1CR1A 2RGCA 5KO2A 2OSBA 2ZR7A 5L3SA 1AM4D 3IEUA 2FEMA 5EJEA 1JQLB 1UKYA 2FEOA 2BMDA 2O5VA 1SQ5A 5JSZA 3VAAA 2FV8A 1VCOA 4IVPA 1E3MA 4H9GA 1SKQA 1YZKA 3QPUA 1XMJA 5L3VA 1Q20A 4UXJA 1G7CA 1NN3A 3AB3A 2GILA 1CR0A 1HE1C 3QQ5A 2RGAA 1QHHA 3U6KA 2HV8A 1NMZA 2XAUA 4AI6A 2CHGA 2RHDA 2C04A 1G7TA 1O3YA 3B78A 1D6JA 3LDAA 3M4YA 2A78A 3IHWA 2X1VA 3PUWA 3RRNA 2MSEB 3KB1A 4NCIA 2ZRIA 1E32A 3OZXA 3SQXA 4RZ3A 3WXMA 2CLCX 4MRVA 4AYTA 2ATXA 3D3QA 4II7A 4V0NA 4TZ0A 1EFRA 3WNBA 2OHFA 5JCZA 1TQ4A 1T3SA 4UJ5A 2JDID 4M2LA 2D4HA 4BZPA 2F6RA 1GFIA 1IN8A 4PPGA 4WZBE 1CBUA 4Q9LA 2F43B 3PVSA 2W6IA 3PUXA 1ZM7A 2VP4A 4ASUD 3LVRE 2WTUA 2DCUA 1NMXA 2IYZA 3DMNA 2Q9BA 4PC1A 4YONB 4D82A 1KK1A 3QI2A 1WDTA 4HDOB 4DSNA 4DHEA 5CDFE 1JNYA 4HUTA 2VO1A 1T5IA 2MSCB 2WWWA 3DOEA 5A4JA 3SJBA 4D4LA 4KFSA 221PA 2KBEA 3MJRA 3X2SA 4MGZR 1R6BX 1RVDA 3CUEF 2W6JA 5FOTA 2YKGA 1MKYA 3A58B 2Q3FA 1Q12A 3GD7A 1BYUA 3IQXA 3VKHA 2Q9CA 4IW3B 1VYVA 4S35A 5D3MA 5DSZA 1CEEA 2H17A 2C96A 2J45A 2ASEA 2QGNA 1JEDA 1LS1A 2G77B 2ZYWX 4URWR 1FW6A 2FJUA 1MH1A 4O25A 2IUSA 4QG7A 5CIQA 5J4YA 4BLTA 3GLHE 1OKKA 3MUFA 4G5OA 4GL2A 3RVBA 4IVQA 4TQ9A 1VKJA 2V7QA 3K53A 3B1XA 4TQAA 5DHFA 2BWJA 2XSZA 4AG6A 2J0QA 4GP7A 2VP9A 1WF3A 1Q57A 2BM0A 4NCHA 2PJZA 1GP2A 2BBSA 2R6GA 3EIEA 4BLOA 5E3HA 2QE7D 3HYRA 2IS4A 1U0JA 1CJTC 3HR7A 4AKGA 2QMHA 1P2VA 2EFCB 1Z63A 2QNRA 1SXJC 3QY0A 5DN6A 5C4MA 2JCSA 4IEIA 1GL6A 4LV8B 4PQRA 4C4PA 2ZR9A 4PO9A 4EJSB 2EFHB 4KI0A 4Q9JA 4OI0A 1XXHA 4Q66C 1LV7A 4BZXA 3FDIA 4TYQA 4NH0A 5DE3A 3KJHA 2XZOA 5P21A 1Z06A 2QEQA 3LQQA 4B2IA 4KXFB 3OEHA 2AFIE 4C3ZA 1E98A 3RABA 1RPZA 1QF9A 2ZI4A 4MUBA 5FFMA 1MT0A 2RKOA 2AD1A 2VHQA 5FPKA 3M1IA 5FUYA 3AP1A 1W4RA 1YE8A 4DEXA 1G7RA 1GL7A 3EWAA 4LC1A 2JASA 2GXUA 1KSGA 3SN6A 4GZMA 5H8WA 2F3RA 2OCBA 5CM9C 2NPFA 4PO1A 3JZMA 1KOFA 3ICQB 4WA7A 4ASUA 2VRWA 5TY0A 2EYUA 1XMSA 4R2HA 1ODFA 3IBGA 1T3HA 5LD2B 3IUYA 2IEYA 4PZLA 1EFHA 3K1JA 3W8NA 4A8JB 1XF9A 4TYWA 3D6TB 4DWJA 1S3GA 3GJ5A 3KX2A 2RGNC 2X19A 3HWSA 3SE0A 4OL0A 5EP2A 1S0UA 3HU3A 2RGDA 3DVLA 2TMKA 2W2XA 1J8YF 2BMJA 4A0GA 4BWYA 2G3YA 2PMKA 4TZ6A 1XJ0A 1CR4A 3LD9A 3IILA 1KIMA 5L3SB 4GMDA 3T15A 4Q21A 2R6CA 3B6EA 4LUCA 5H1YA 4QM6A 1UAAA 2ONKA 2J59A 6Q21A 1N6LA 3PEUA 5CYPA 4ZI2A 4XSGA 5JSZB 4LHXA 5KPDA 3IPYA 4BLRA 4TYYA 4I1OA 1XJQA 2X77A 4B3XA 3RSLA 4FIDA 1W7AA 4ZCIA 1ZVQA 1L7VC 1IN6A 5EUMA 4B34A 3EA5A 5F98A 3QF4A 2GWHA 1QHHB 2ZS9A 1D9XA 3THYA 1JJVA 1DAFA 3MWKA 3T1VA 4PXAA 4DLTA 3ADBA 2J1LA 3N2IA 3KKQA 4IDNA 4V02A 3LH5A 1LF5A 4Q19A 1KJYA 1MABA 3I3SR 1RRPA 4B35A 4AWXA 4ZO4A 3H1TA 1N6NA 4XD7D 1FMJA 2AL7A 3GEHA 1XPRA 1PLJA 2ZRBA 5JCPA 1WQ1R 1E2IA 5BN3A 1UFQA 4V0KA 4NTZA 4DIDA 5L3RA 3QNUA 1IJEA 4MYCA 1SXJA 4YMSA 2ZR0A 3UMRA 1BMFA 5CITA 4C7OA 4DCVA 2FF7A 1OFIA 2GAOA 3BAFA 2NIPA 3D7MA 3LW8A 4RZXA 3TSWA 1DADA 2ERYA 3TNFA 1FNNA 3WP0A 4YLGA 2OILA 4RKEA 2QENA 4LYFA 2EVWX 3EZ7A 1OV4A 5E7JA 4B3DA 1KTVA 4ITRC 2IF0A 3VR4A 2J0UA 4PQFA 1XPUA 3IQWA 4FMDF 1R0YA 2PZFA 4PSAA 5JWRA 1RRGA 3EPJA 1P62B 2CL7X 2BBOA 1WMSA 2ZJ2A 1A5TA 3QKRA 3Q7PA 1NLFA 2JIZD 3AVUA 2FGKA 3I5XA 4KFTA 1R5BA 3HYTA 5D3MB 3CO5A 3PEYA 3QKTA 1YZTA 3TKLA 4RY2A 1L2TA 1ZD1A 4KSCA 1Q21A 1HEIA 2GVDC 4F4IA 3IIMA 1E9CA 3O47A 3VR3A 4ZPXA 3HPQA 4DLXA 5J4LA 1GRRA 1Z2CA 3FWYA 2DBYA 3ECCA 1FTNA 4B3FX 1PVOA 4G5SA 3BBPA 3DMDA 3K9LA 4HAUA 4D81A 2HT6A 4LGMA 1BO6A 1WXQA 2N1BA 3PFIA 2WWXA 3DO6A 2OLKA 1NJGA 3QKSB 1K5DA 2JLRA 4WW0A 2GCOA 5JBQA 3W3ZB 2PEZA 3BS4A 1W1WA 1ANKA 4B2PA 2WAYA 1RRCA 3U2QA 2WWGA 4MGKR 1G5PA 3CZPA 2CHVA 1LVGA 1S9HA 5H70A 1GDDA 2CE7A 4KODA 3SHWA 2GF0A 1XTIA 1ZNXA 4P31A 5TV2A 2P2LA 2GBLA 4TL6A 4PZYA 2LKCA 3IIKA 4QOSA 4QHTA 1G6HA 3C14C 2HLDA 4E03A 4OK6A 4Q1AA 3QJYA 1IBRA 1G5TA 4M1MA 1VHLA 3BH7A 4F4JA 5GADl 2ATVA 1E96A 1LFDB 1G6OA 1QG4A 3KUCA 1G8YA 1N6RA 5EE0A 1F6BA 3S1AA 4DCNA 2H16A 2JLUA 3CR8A 4LPKA 1TEVA 2B8TA 2XTNA 1G8PA 1TEXA 3VFDA 1XB2A 2XX3A 3O8DA 4EPRA 3CWZA 4GI7A 3X1YA 3ASZA 3OAAD 1M7HA 3CIOA 4XTCS 4ILEA 4P4UA 4WVFA 3V4FA 1OYYA 4TSFA 1UDXA 3QUSA 4W9MC 2HXSA 3ICEA 4B43A 4N3NA 2JLQA 2ZM5A 4JL6A 1TPZA 4AYXA 3N5CA 2DFTA 4XVUA 3AP3A 3A6PC 2IYUA 2OG2A 1ZU5A 2F1JA 3BXZA 1RFLA 3NG1A 1NG1A 3BB1A 5FPHA 2WPDD 1JQJC 1VG9B 4TMWA 2GZDA 3EZ9A 1TF7A 2E1RA 1XWIA 3B1WA 3IO5A 3GCGA 1H8EA 2CHQA 2Q6TA 2Z43A 4Q4JA 4FW9A 2KBFA 1G5RA 5AR1A 2HJVA 4AC9A 5GJVC 5ELXA 1UEJA 2QPOA 3B2EA 1RC8A 1KI7A 4NHOA 4L15A 1II9A 2WWFA 1NF3A 4XVRA 3UG6A 4EUNA 2ZU0C 3I8XA 1G4AE 1Z6GA 3K0CC 2JLVA 4JLJA 3CONA 4Q7MB 3VQTA 3NEYA 4BLQA 3QF4B 4PAOA 3SHFA 1P2SA 3KTAA 1LNZA 1T91A 1JECA 1F5NA 3THYB 1QHGA 5FL7D 1OLOA 4BFSA 3ZIAD 1E2PA 1NVVQ 5GJCA 4DRZA 2XTMA 1I4TD 2ZJOA 3AM1A 5KDOA 3B1ZA 1ZUHA 1DAMA 2VTKA 4BRUA 1G291 2ZVPX 2ZSFA 1NJFA 1SVWA 1MABB 2Q21A 3CNOA 1W4AA 3L0OA 1SULA 4ESHA 1ZC3A 2FGJA 4L9WA 1XDBA 5JI3E 1XEXB 1MO4A 2HUPA 4B6FA 1KO5A 2YHSA 4R2IA 1CJKC 4LHVA 1SXJB 4BEJA 1D2NA 1ONBA 1U8ZA 3SJZA 4C7OB 1ZAKA 1ZIPA 2R2AA 2XTZA 4L16A 1E2HA 1U99A 3E1SA 3KQLA 5JJIA 4R98A 1CJMA 3T1QA 2WICA 3KXKA 3U5ZB 4LX0A 4ZDWA 3R8CA 1M74A 3AKCA 2E87A 3N70A 2J0UB 2MMGA 3PQCA 4BE7B 5GVSA 3MD0A 3RSOA 1E4VA 4L5BA 1V5WA 3FOZA 2OM2A 1G3UA 3RLFA 1FQJA 1CTQA 4NYMQ 4XVQA 1KAGA 2X2EA 4K46A 4KBFA 3SNHA 1QHNA 1XNJA 4QFMA 3AVWA 2CLDX 2G1JA 2VSOA 2QU8A 3QKRB 3SYLA 1QHYA 2OXCA 4GOKA 4HLCA 1Z2AA 4DSTA 2CJWA 2OE2A 4ZIRA 1OH5A 4QXAA 2CDNA 2FNAA 1DARA 2CK3A 3EZ6A 1RJ9A 2PZGA 2J7PD 1GKUB 4IJMA 4CEHA 3SS8A 2G83A 1ZD8A 3CRRA 3CF2A 2QTVB 4JT4A 1SKYE 4LV6A 1Z0JA 1ZC4A 4BFVA 3BK7A 4LJ6A 4N0DA 4EJSC 2H7VA 2HJGA 4LCBA 1E2DA 4LYHA 4B47A 2FFBA 1ZM4A 3VNVA 2ZJYA 4JBWA 3KJGA 1A82A 2FSGA 3VR2A 2N42A 1G16A 2GCOB 2C9YA 2BEJA 4KLZA 2IYXA 4JLPA 4OK5A 4QBFA 1B0UA 2GJAA 4LJ7A 4QNRA 1YR7A 4JLAA 1YR6A 1MO3A 1US8A 4B71A 4AK9A 2A3RA 4JVLA 1Z22A 3HU1A 5CYOA 4C0JA 2JLYA 1KNQA 3P20A 3QOFA 3EASA 4Q01A 1AJEA 1MRNA 5TARA 2IYYA 4MRNA 1ZUNB 4KFUA 4TT3D 5KSPA 2W58A 3A1WA 3DL0A 3FKSA 2ZXUA 3BFKA 3GPLA 1A1VA 4ZKEA 3K0SA 1XD9A 2XOKA 2QQEA 2GXAA 1S1MA 3AF2A 4W5WA 3CX7A 4Q9HA 4D2IA 2ZI5A 2YC4C 1KMHA 3S1AB 3IEVA 2HYDA 2HT1A 2F43A 5D3QA 4DBLC 4OJQA 2GF9A 4K8OA 2ORVA 2QM7A 2REBA 1CU1A 3AKYA 5J4VA 4AKIA 2FG5A 4RZUA 1GKIA 4BFYA 3IPXA 3F0TA 2Z5FA 3KDSE 4A15A 2BIFA 4C30A 3B60A 3WNDA 2WJVA 4PX9A 1XPOA 4A0FA 1IQPA 2B8WA 4LOAA 2WIAA 1E9FA 1II8A 2XNDA 2ZRPA 1NIJA 3I92A 4DLZA 3SZRA 1F3OA 5JFGA 2J3EA 4AD8A 2ZYUX 2EWVA 3KKNA 4G5RA 2VP0A 2F7SA 3W5IA 4AYWA 2R44A 3CH4B 1HE8B 1TU3A 4OHVA 4PHGA 1XU4A 4WXRA 4OHXA 3DKVA 4AIIA 2EW1A 1P2UA 2KJQA 3RS4A 4LC0A 1P9RA 2EU8A 2JLWA 4B6EA 1CR2A 2P67A 3MLEA 1ZIOA 5FTJA 4TL7A 1AS0A 4ERNA 4TTQA 3GEIA 3RS5A 4GBMA 4Q4JB 2RGEA 1JXMA 5F2EA 1VG8A 1R0XA 4JKYA 4MUAA 1AQYA 2C98A 3R8FA 3E2IA 3QSYA 4KITB 2CCGA 4RCYA 2J7PA 3U3KA 4P0TA 5BN4A 1YHNA 2IYTA 4EIWA 3OIUA 4I81A 1YZQA 2XGJA 1FUUA 2ZJZA 2RHMA 1GRQA 1UPTA 1JAHA 2ODWA 2H18A 2QA5A 3QENA 3RWMB 2HCJB 4QBIA 3DPUA 4B48A 5HCIA 3W34A 3UG7A 3KTAB 2P6RA 3B1VA 2IYQA 1U90A 4PAQA 3LVQE 3U7EB 1TF5A 3Q7QA 3K0EA 3THWA 1NI3A 1U9IC 4EJSA 1N0VC 1AN0A 4RSGA 3LBNA 4QBGB 5DIFA 5EP4A 2AFHE 4IXNA 1XCMA 1KK0A 1P5ZB 3RC3A 4CW7A 1S2MA 2GZAA 4RKFA 4RD4A 2ZQ5A 1R8QA 3TAHA 2QAJA 3GLIB 4Z54A 2ZSEA 4LY6A 1CRPA 5IT5A 4B75A 2QZ4A 1FQKA 3AKEA 3W90A 3U7FB 2XJ9A 4TT3A 4FWTA 4RD3A 4XWAA 3LRPA 4JLVA 1QBKC 2XXAA 4IKEA 2QMOA 4HB3A 2W6JD 3PIRA 2ZAMA 3KXIA 4ZDIA 1NLYA 1Z29A 4QL3A 2V3CC 2DWPA 4Z8YA 1GNRA 5FOWA 4H1VA 4YDSA 3L0PA 3F5FA 3B9PA 2IWHA 3DKPA 5HPYB 3VU9A 2ZE8A 3U3OA 1U0HC 2V1XA 4ZIRB 1FPMA 3FB4A 4HI0E 2CJWB 4QJ5A 4P3YA 5KDDA 3RNLA 4TQUS 3RRYA 1Z08A 2FH5B 4Q7KA 1OKKD 3I32A 4B3BA 2C99A 4Q1BA 4C0BA 4M1WA 1RJ9B 3KQNA 4CEHB 1E94E 2XSZD 3R7WA 3SBEA 1N25A 3A36A 421PA 3L82B 1XCGB 1QDEA 2OCYC 5IF9A 3FPAA 4PO8A 1CJUC 4MYTA 3CNNA 2J0VA 4HYYA 3MFYA 4A9AA 2H5EA 2NTYC 4NYIR 2QP3A 2WMOB 4URYR 5DN6D 1E2QA 4Y0AA 5J4KA 1JPNA 4B3GA 1UKZA 4LHZA 3C4JA 3F8TA 3GJ8A 3I61A 2F55A 1U98A 1A4RA 1ZU4A 3K0FA 3NIBA 4M8NE 4NYJR 1R4AA 3LNCA 3QVUA 5TXGA 5CM8B 4ESVA 1US8B 4GP6A 3IIJA 4DDTA 3SI7A 2VP5A 1T5LA 4RD6A 4NYIQ 1OH8A 3E5HA 1IN7A 4LPSA 1GVNB 4CEJA 1X8KA 1RRFA 2JATA 3OEHD 2WWIA 1Z0IA 1W44A 4G5QA 1P7CA 4HATA 5EE5B 1F2UA 2FN4A 3BIFA 4KHZA 3WHKA 1GWNA 1UBEA 5HE8A 2Z83A 4DDUA 1XBTA 1T3LA 2PX3A 1OFTA 1M7GA 4QGFA 4PHHA 1KMHB 3QVVA 3ZQ6A 4CDGA 5KSZA 2IXGA 1KDRA 1U9IA 4HAYA 1VG0B 4OYHA 1J90A 4B3CA 4FN5A 1X6VA 1L4YA 3NTUA 2CL6X 4FCWA 4HAZA 1AS3A 1P73A 4NKRA 3P32A 4KYIB 2D7DA 2YWFA 3X1DA 1GKYA 2VH5R 4D80A 1P9NA 4KCGA 3C41J 3PJRA 1II8B 2FFAA 3F3YA 4IFBA 4LBWA 5IRCD 1IXRC 3AF3A 2IUUA 3WP1B 1XTSA 2ZS8A 1CULC 2F9LA 2PMDA 3ZH9B 2ZRHA 3NDBB 1P3JA 1IY1A 1W46A 4QKQA 4QGGA 4X8LA 2KE5A 2RH5A 3CRMA 1E0SA 4A2WA 2ZE5A 3BERA 3MCAA 5ANRB 3FTQA 3QIAA 5FOVA 1DAKA 3CPJB 1OYWA 5SZKB 4QJ4A 2A2ZA 3UK6A 3KQUA 2CNWA 3THXA 1HV8A 4A92A 3HP1A 3WNCA 4M1KA 1XD2A 1J8MF 2EWWA 1X8JA 5K8LA 4J0QA 1TU4A 3TVTA 2GCNA 4V0MA 3L0SA 2VPPA 2YWEA 2L0XA 2VHUA 1X1RA 3DZDA 3KKPA 3RS0A 3SOPA 4RFSB 3QEOA 1XTJA 2C78A 1GITA 3ZJYA 1SVMA 3MRSA 3QKSA 2FDCA 2Q0HA 3FYHA 1DE0A 1FP7A 1OIVA 4L4UA 4XTRA 2O0JA 3H0KA 3KQHA 621PA 1Z6XA 1KY3A 2WJYA 2JLXA 4UJ3A 5GJWC 4IOJA 4TN1A 5EXXA 5LBIA 3THWB 2O8BA 3KZ1E 3QE0A 4FINA 5J5CA 4C2TA 3PENA 3AVXA 2QTFA 4H1UA 2IBMA 3O8RA 1SXJD 1UJ2A 2CVFA 4CT5A 1R5OA 3KKOA 1BMFD 2GXQA 3CLVA 3NBXX 4PFSA 3BB4A 4B74A 2UVQA 1N6PA 4HLQB 4ZV4A 4JT2A 4BECA 2BV3A 4HZUA 4BFZA 3N2EA 1RE0A 3LWNA 4BEBA 4IFEA 721PA 2NZJA 2P6NA 3TQFA 4B44A 2PZEA 3CRQA 1NVWQ 2GKSA 3QKUA 3R9WA 3AGQA 4JS0A 4GOJA 2BJWA 4WOPA 4F4CA 2ZRJA 2XXAB 4Q9KA 4X8OA 2VEDA 121PA 2ZRLA 4YMTA 5M04A 1KK2A 2ZYTX 4KYUA 2G0TA 3E70C 4NU0A 2ZE6A 3FHCB 2WSMA 1KO4A 2YZ2A 2Q3HA 3HPRA 4ZCMA 4PAMA 2IWRA 1M8PA 2RAPA 1DO2A 3VU9B 3AVVA 3R9IA 4DDWA 1FP6A 2WHXA 3CBQA 3GJ7A 1LY1A 3GLGA 4Q9IA 4EPTA 3WYAA 4Q00A 1DS6A 1E79A 4TLEA 3U4QA 1Q1BA 4KU4A 2A7QA 3DEFA 1W0JD 2LCFA 2YC2C 3T5GA 2V8OA 4YDHB 2O8DA 1KKMA 1EFUA 1W49A 1NP6A 1N5KA 4Z1MA 3R7WB 1XEWY 4D4MA 1HQYE 4AY2A 1XP8A 1N5JA 3GJ0A 4C0AC 4GPTA 2R9VA 3SFZA 2GBLC 1NN0A 1SVLA 1YQTA 1E1QA 3UATA 4XOIA 3U7GA 5FTMA
chains in the Genus database with same CATH superfamily
4NBSA 2PPVA 1D5CA 3BJRA 2I3ZA 4U2CA 2D8AA 2F90A 4WDQA 3TRJA 3L2OB 4OI1A 2BEVA 1RLOA 1W6RA 4OOFA 3OLXA 3F49S 4G4JA 2E48A 3RTEA 1HA3A 5DKFA 3VNSA 3D5EA 3VPGA 3K0FB 1DLIA 2DEUA 1PT7A 3USCS 4D99A 3WAGA 1DAHA 4BC0A 1Z0KA 3HKCB 4LX8A 4GPBA 3GDGA 3WKCA 1KE1A 3PPYA 4U9HS 2Z1NA 3QBJA 2CMKA 4E4YA 2C2XA 3HRKA 3DLBA 3CKMA 4NK5A 3EXIB 2V1UA 1F2UB 1WKVA 1X15A 1ZGJA 3K15A 1A72A 2YVKA 1MJNA 4JIMA 2I1VB 4OAOA 3HXPA 3DS8A 3U48A 4C0KA 4EMTA 4ZYUA 1PNRA 4IOLA 2HKIA 1LDNA 4N65A 1XVLA 1Y82A 1G8AA 2A0YA 1LV8A 2LIPA 2WSYB 3LUKA 4IYJA 2HIGA 2WP8J 3WB2A 4BNMA 4BVBA 5ITZB 2J41A 1HF3A 4C0QC 1Q3TA 3TAXA 4IFIA 2PH1A 3OE7A 1Y1TA 4Z0NA 3BWBA 3HBNA 1P3DA 2ZE7A 4U3JA 1U1FA 4UZFA 1J20A 1M34A 2EDAA 4UBMA 5AK5A 4P7BA 3ANMA 3FDJA 1Q0TA 1ETUA 3BCRA 4XEHA 4US2R 2ZITA 3AJ8A 1P7ZA 2W2QA 1W73A 1G6Q1 4I55F 1CDDA 4ZAWA 2OVBA 5GONF 4XPIA 2YCBA 2EKZA 2RC6A 2Z8XA 4JUAA 1E99A 2ZRFA 3G82C 3K7EA 4NY1A 3RU2A 5AVZA 4WCFB 1A8IA 1BROA 1Y8RB 3K0AA 4B6JA 5DTRA 2IHYA 2FPPB 3BD8A 1DC3A 3QMPA 4DL9A 3CJTA 2R68A 5TDHA 1OYVA 3UT6A 3NW9A 4BWFB 2C0PA 2P7HA 5KTKA 5AKIA 5JVDF 3A1TA 4HVTA 4C0LA 4ICIA 3TCKA 3V9AA 3MG9A 1IOWA 2XT0A 4REQB 3RHFA 3FZGA 2BGRA 2QM8A 1EDZA 1W2GA 1TT5A 1X80B 2J8ZA 4UQOA 4CVNA 1ISMA 3CF4A 3ELUA 3LA8A 1UIMA 3IO3A 3C1TA 3DE3X 2ZJBA 3PE3A 1KYYA 2K7ZA 1NL3A 2C82A 3PCXA 2Q3EA 3EIFA 3RFCA 3E9CA 3H2GA 4BIIA 3ZHZA 2X58A 3IOMA 1G38A 5CFLA 3CUKA 4HNQA 4H35A 2EW8A 2O07A 4BNGA 4QHYA 3A8TA 4DLVA 1DKLA 5CT8A 2IPOA 3LPNA 3BD6A 3WL3A 5IAOA 4P3KA 4TXLA 1RXYA 1JMYA 2WSSA 1UDAA 3SE7A 3HUTA 1RTKA 4HDSB 3PHJA 1TJPB 3PYXA 3MXOA 2B25A 1E3IA 2RE8A 1SQFA 3C7DB 1A04A 2J5XA 4F3NA 4B6OA 4RH1A 2OGZA 1JLRA 2YJGA 5F52A 3VU3A 2GN1A 2J4DA 2X22A 5DSTA 2W2VA 4BE4A 1KERA 1TO1E 2X2FA 3V34A 4CV0A 5TVKA 2Y1DA 4HP8A 5JH7A 1GAEO 1AUXA 3JQFC 5DCUA 2ZU6A 4ZEOA 3LT1A 1Q0PA 1U2RA 3ORRA 2OFFA 4EHBA 7REQA 4J07A 1UBCA 4FSXA 2QLNA 1ZMBA 1GAJA 1LK0A 3DV0B 1GCGA 5J1SB 1LBTA 1Y5LA 2Q4TA 1XEWX 3PGJA 1AK9A 3ORYA 3HUUA 1RC0A 3EZGA 4MR8A 3JQEA 3ZCQA 1RWNA 4W5OA 5F9MA 5KHLB 1NNLA 5K99A 1RQLA 4PCAA 1U7TA 1C41A 1EJ0A 1K7EB 2QVYX 1UC9A 5CIYA 4CXMA 2OZKA 1GCAA 3HB5X 4IEEA 4TRJA 3U6BA 2HFKA 2EDCA 4EPWA 3PNSA 4I1VA 1TCBA 3H6GA 5BT8A 5CFQA 3SZ3A 4BUCA 5TQ0A 821PA 3OHMA 3R0ZA 2IJGX 2OZLB 5B1IA 2IYVA 5JY1A 2F1RA 1YIOA 3KBBA 4DUPA 5C4IA 1SXJE 2VJCA 4NZZA 4J2HA 3GP8A 1KSHA 3PT9A 2VDPB 7ADHA 6NULA 3AHEA 5J43A 3DE6X 4HH4A 1ESMA 1ZW6A 3ELYA 4QGAA 1OT3A 1CY1A 2JJYA 3GFRA 4MWCA 4NXNB 3AG6A 1T6XA 5IYZF 1Z34A 3GLGB 4QO8A 3C48A 4QFBA 3PEWA 1ENYA 4RA9B 3BICA 3A6DA 4NBWA 3U3MA 2K5UA 2H7XA 2B35A 2BFNA 2INGX 5CJPA 3WJ2A 3GXBA 1PZHA 1ZINA 3K30A 4ZKDA 2Q7XA 1GA1A 1ZEMA 2R1TB 3FTNA 1F9AA 3QWAA 4KN6A 4LMPA 5DM2A 2O8DB 2B8NA 4ZVKA 2FSFA 1X0XA 3MLAA 1O03A 2V45A 1TKAA 4YAOA 3ROPA 5K0EA 3ZZTA 3D3WA 2PU5A 4CF7A 2FR1A 1RXVA 5F9FA 1XQ1A 4YYZA 1ZJWA 4F4HA 4R3WA 4B3RB 2WP0A 2DWOA 3PD7A 4WKBA 3MUOA 3U0VA 3U7RA 2MIIA 3OOSA 1F4VA 1WRBA 5JAOA 1H69A 2J32A 4FCTA 1RM0A 3HCAA 4BVKA 1MAUA 4BX3A 4ZCQA 3QWIA 1BJTA 2OV4A 2AZMA 1SC9A 4WXEA 5JQGF 4Q4HB 1T0IA 3KWLA 3W8DA 1UFVA 5A4AA 4IDAA 4R8SA 3STYA 3WGNA 2DLNA 5EXTA 3EQ7A 3LBFA 1B2LA 1KORA 4KWCA 1EVJA 3E23A 1G21A 3K9HA 5HRCA 4YRAA 4BQIA 1A2OA 3FI0A 2WT8A 1N4DA 1FNSA 1VL1A 3EDOA 3DLIA 3WLSA 3FFBA 1ZNWA 3K70C 3W5JA 2CVHA 1BFUA 2D1SA 2ZRKA 1LS6A 1T3ZA 2ZYHA 4CG1A 4F5WA 1IOLA 4KQGA 2PNJA 3O93A 2WEKA 2W22A 3MJCA 1QLHA 4P7JA 4NMWA 1O89A 3SDZA 2AKYA 4FFMA 1BFDA 2VL7A 5G0WA 1L4UA 4QGBA 5HFNA 4BX0A 4C9BA 5JPDA 4C2UA 1USGA 2I22A 4GX1A 3AVYA 1UPFA 4JR0A 2F4NA 1ZN7A 3MC1A 1JHQA 1P1IA 1Z15A 3QOXA 2GNOA 2V9ZA 4MUMA 2HHLA 2D1FA 4IOMA 4PQYA 4XIGS 4EX7A 3FOFC 3DNPA 3DP7A 3GN2A 4XWKA 4RD0A 1J1IA 2VFAA 1ZM3A 2VIIA 3ZD9A 1Z6QA 3FLAA 3CKKA 3IMCA 3OQIA 5C46F 2IVZA 5HQTA 2PKXA 3JQAB 2VDKB 2ZCJA 2YJ6A 1VPVA 3EPPA 2XMSA 1D9ZA 3W8RA 2JHFA 2V6IA 3DG9A 3H9JA 3QFRA 5SZKB 3W2IA 4Z4HA 2PX8A 1BVRA 5JDCC 3TTUA 4F2GA 4F9TA 1E5XA 2KYRA 1XWFA 5BW8A 3ZKWA 5DGDA 1GQOA 2C59A 2WUDA 3L46A 5AJVB 3H8JA 1YL5A 2A5GA 5DLPA 1YU9A 3V2GA 1UPAA 1I14A 2MCFA 4OQQA 4Y8VA 4JI1B 1PHRA 4ISBA 3V3TA 4RVDA 1U0OC 1MHPA 4MLDA 4LWQA 3B2QA 4E0BA 2X8WA 3ZTYA 3DFZA 4EB6B 2Y9PB 3QXCA 1D2EA 3RARA 5DGIA 4MPRA 1ZCFA 2P2CA 3ZVMA 1ML4A 2H4XA 5HK8A 3V00A 5L4SA 3BD9A 1Y4UA 1J06A 4ZT4A 2X2PA 5BQOA 3TX6A 4G1BA 2UUCB 2F8MA 4PPNA 1J0XO 3WLHA 1SOAA 3IC5A 2WB4A 3ZU6A 1N2OA 4TYNA 1B8OA 4W7HA 1PI3A 2P91A 5AI6A 3T3GA 4RJKA 1JILA 4BMNA 3L1KA 2VSYA 3W9BA 2NSYA 3JQ8B 2RJOA 1X7HA 3DHVA 4L4XA 4QUDA 1F0KA 2D74A 4Z4CA 4L85A 2I7DA 3ZIUA 3K96A 4YAJA 4XQ9A 1EVQA 2YMLA 4IIJF 2HBQA 5DLQC 5BQPA 2OLEA 2REOA 5A0FA 3KOZA 3U81A 1X8XA 4AX4A 3T9CA 3IQHX 1RHUA 3C24A 4N1AA 3FTFA 3UYKA 5DW3A 1JLLB 4FU0A 4Y2VA 1FYXA 1S4QA 2B4YA 1XV5A 4QEDA 4M21A 4F3RA 1M1YB 3GQVA 1DB3A 1SB8A 2DLDA 3H86A 4L75A 5JASA 1E2JA 1U2TA 3G79A 3JPYA 4MKFA 4ZAXA 2OQVA 2PL3A 4H1TA 1YR9A 3GJ6A 2KWIA 4JJ8A 4Z4EA 1ECLA 3DMTC 4L57A 5B7GA 2A9KA 1JKXA 4Y1RB 2IZZA 4OK3A 2A0KA 1TA9A 2C2YA 3F6YA 5CX4A 3K35A 1NRJB 4PG8A 4RK0A 1JLMA 2E18A 3H83A 4S05A 3OD5A 5ADHA 2X0DA 1JB9A 1Z7EA 2Q4OA 1MMFB 2XHZA 5BV8A 1VMAA 3PXGA 5JARA 4WK4B 2BGTA 1GGVA 2WAXA 1XCPA 1SQSA 2NUBA 3IKJA 1KO7A 3FUWA 2GAAA 4IEFB 3BDAA 4L0QA 3GLFA 3I62A 1EP9A 2I4IA 1PGPA 4Q4CA 3NGXA 1M2VA 2YBEA 2FKNA 1JKFA 4US1R 3D4LA 4BLPA 1R00A 3I8OA 4FZJA 3RQSA 4C4YA 1OE0A 2ON6A 3ROFA 1GNQA 3AY6A 3SEFA 3SYNA 4YV0A 4MARA 3C3DA 3CVWA 4PZZA 5CXSA 1GPDG 2AE1A 3DULA 4LSGA 3OEWA 4LWZA 5GGXA 3RWOA 4EJ6A 3BRSA 3ZQJA 3HYCA 2H31A 1ESDA 5DN9A 3DVRX 5DHQA 3T3OA 4QWMA 2O3SA 4CI0B 3OSZA 4BLSA 4YRZA 2FFRA 2VBIA 1FTSA 1ESZA 2LW7A 4FI3F 4QULA 4YT2A 2C7GA 3UTDA 5JDCA 2FRDC 1O8CA 2NXCA 4YUXA 4C5BA 5ALWA 4QWWA 5G40A 1BQ4A 2VHTA 1PFQA 5SYNA 3EOAI 4J2TA 1BVHA 1SEPA 1D2RA 1T5HX 1T9HA 2QW0X 4PBRA 1ISPA 2BSAA 1KVTA 4EBBA 2YASA 4JUBA 1SXGA 5K09A 4CF3A 3FYSA 4QXMA 4XASA 2XZLA 2BM9A 3WY9A 4TKLA 3V4ZA 3EK2A 3WG9A 3F5SA 3REQB 1W5EA 4Y0NA 5P8WA 4V39A 4PYRA 1IHXA 2J4CA 3OFKA 5SICE 3ZKAA 2JJ1A 2DQZA 4DCTA 1C1XB 4KOAA 1E69A 1E7WA 2JAHA 4G0OA 4LAFA 2HK8A 10MHA 2R65A 4JH0A 4LEIA 4RZIA 3BWDD 4RV4A 3DVSX 5LDGA 2PGDA 5L4LA 4J2OA 4PPFA 3LU1A 1V8BA 3ZBPA 1DC7A 1VCMA 2GPBA 2JARA 4DJ5X 5EJ7A 1BXKA 1T9GR 2UZAA 4G97A 4HUQA 3EVEA 1DV2A 1KS2A 4MVJP 1X14A 4L9AA 4CGZA 3D6JA 3E6AA 1YNSA 1V11A 2DFPA 1N5MA 2WR8A 1K86A 1XA0A 2QRZA 2YMPA 4U63A 4DSZA 5IBRA 4CCYB 3TBHA 1YZLA 4M87A 1HDRA 3IEVA 1H2XA 5IH7A 4U5XA 2XNHA 3PQEA 5DISB 4JP5A 1DAGA 3R3HA 3RIEA 3B70A 1H4QA 1F48A 2O14A 4EGAA 3M5PA 4NPCA 4DLBA 1NX6A 4OQXA 3HL0A 1S9DA 4GOMD 1NVKA 3MGBA 4Q4AB 1COWA 2GASA 3SSOA 4CPDA 1TECE 2DPLA 2XA1A 4RE6A 4OJKA 2CZGA 5BNZA 1YKGA 4B4OA 2X2OA 5KTRA 4MUJA 1LH0A 4ZQCB 2YN2A 1EWYA 5CA0A 1P80A 5LMCA 1R8XA 3HL4A 3T7CA 1DC8A 4YGYA 4D9FA 4CM7A 1P1JA 2WNIA 1VCNA 4ZHQB 5AJXA 3TF5A 3Q8XB 2OSVA 3BMOB 4INOA 1CZNA 1PHPA 2GN8A 2QE6A 5SZIA 4RX1A 1Z6AA 4HSEA 4MKGA 4RD2A 4W8HA 1R0WA 2IE8A 2W70A 2R6DA 4H16A 3JD0A 3NUZA 3U49A 2G88A 2QL5A 4ZRDA 5JAPA 3IMEA 5EZYF 1ZBQA 4N5DA 4PLGA 5SZHB 1YMVA 4BFCA 2DH6A 2YIDA 1WP4A 4RVGA 3O8LA 4FMCF 5ALMA 4B79A 5JJCA 1W36D 2O0KA 3QMWA 5G1PA 4LQCA 3UMJA 1N2EA 5CCEA 5BWNA 1JQBA 3BMXA 1KC1A 4CE6A 2FVXA 4GR5A 1K8XB 5DV9A 3C98A 1THZA 4NLLA 3E7WA 2E4WA 5I47A 1SCDA 4YJKA 1U6IA 3HXOA 3DHYA 3KYCB 4E09A 3NHFA 3BMQB 4RIGA 2AQ8A 5HWSA 2VHEA 4IIYA 4XWOA 2O8CB 2CVPA 3T4EA 2VP6A 2OCDA 4FUQA 5JMWA 3VAYA 1ZD2P 2OCXA 3UMMA 1C4XA 4TRNA 3JD1A 5EZ6B 1YDFA 3L5KA 4U00A 2A1UB 4QECA 4BCCA 2BEWA 2ZT7A 4G8JA 1PSWA 5EXSA 4ZCLA 4MWOA 1L1EA 2NP6A 5ECGC 3A28A 2V3VA 521PA 5K0TA 3W5DA 5EIAA 3VR0A 5I7AA 3HCNA 4YJ3F 2WA2A 4QOIA 3KKMA 4OPMA 3Q8LA 1GKKA 1J7KA 1VTKA 4X20A 4Y2QA 3TUZC 1L4LA 1AGPA 4J1SA 5EEHA 3VX3A 3RW9A 3MTBA 2HEGA 4LF9B 1Z8NA 5G3ZA 1K63A 1WQ3A 5AIBA 1NR7A 3TQSA 3I01M 3LWBA 5H83A 4KW7A 2FG7C 4HAVA 2BCEA 5E2BA 2JI9A 3R9XA 2GD1O 3CR3C 4NDAA 1FMTA 2VOEA 4R68A 4EVSA 2D5AA 5CVVA 1WCWA 3VR4H 1HUQA 5BMVA 1N1EA 4QOHA 3W0LB 2PQ6A 2I7CA 1EXDA 1O8BA 2FRVA 2R8BA 4GBED 4NCXA 5EJFA 1EZ1A 1GU1A 1LQUA 1U1EA 4GW3A 5LM3A 2FPMA 4WH0A 2A8YA 3II6X 5BQ3A 1RJGA 1FE8A 4L3VA 1P19A 3WBKA 1VE5A 1NIPA 2Q49A 1JPUA 4RMNA 2YQ5A 3TDNA 2IBTA 1U0RA 1FXSA 2MJLA 3HEBA 5AJZA 3JYNA 3WWOA 4U5QA 4GRAA 3KOYA 4HQRA 4BLWA 4IICA 3KLMX 2QYSA 4MITA 3HABA 4IZIA 4DXAA 1OX4B 2QVGA 2BFOA 2W4MA 3B3AA 3PK0A 2PYDA 4Y7CA 2Z1MA 3BEDA 2QL9A 2PPLA 1ONPA 1FSSA 4CG2A 3DFUA 3L01A 5KYWA 4NV3A 5E6RA 2WQZA 2P4UA 1HQCA 2P69A 4XOUA 1JW9B 2P1RA 4PLVA 3NVKI 1URPA 1PZEA 4AF8A 1EUYA 3K16A 1VMEA 1GPNA 1S8FA 4CLRB 4IINA 1TYCA 1QUEA 3COZA 4X97A 1P4RA 5AW2A 3ZLUA 5LQMA 1OFHA 5T67A 3RS3A 4URXR 2FW9A 1CY2A 1XHLA 3PV0A 1RQ2A 5F7XA 2AF4C 3EODA 3GELA 1KXZA 5I8ZA 1OA1A 1FP4B 4BPBA 4JV5B 4M53A 2W00A 4X1YA 5KJEA 3HV0A 1QE3A 3LPCA 5LP6F 4QLAA 1BH2A 1H8HD 1H2HA 1IIBA 1NBMD 1QZTA 2PT5A 1BZYA 2WF5A 4GLLA 4YRCA 2W48A 5BR8B 2CXHA 4G1UC 3O4JA 2XDWA 3A4NA 1WPRA 5ADUS 4ZCSA 4OHYA 1BRMA 2HJRA 1VIAA 4E2WA 5FA5A 3KVRA 3GH1A 3LQRA 3LGSA 4R7ZA 2OY0A 3DAFA 4QTUB 2FLVA 4UPVA 2RG7A 4V3CA 1P0CA 2JHGA 3NWBA 4Y6OA 5BW6B 3WK4A 3X1KA 1Z4OA 4D9GA 2XUHA 3LX6A 2A88A 3O03A 4QPJC 5DM0A 1KYWA 3TFWA 5KU1A 5FPYA 4LGYA 1KIAA 2PWPA 5AW1A 1VECA 2ZS7A 4UTVA 5DO9A 5K0BA 3P0RA 4R1TA 1NN1A 2F59A 3L3BA 5HIMA 3UBTA 3CE6A 2NGRA 3KELA 2HRCA 3QG1A 4Z51A 3JWPA 4JI4B 4H17A 1XZMA 3KRTA 2X14A 2G4LA 1Q3KA 3T4PA 4HJXA 5HE9A 5IT0A 1IMOA 4IHKA 1IN1A 2W6CX 1FX0B 3TGPA 2CSUA 4IUCS 3TLGA 1JG7A 3JQAD 3BIOA 4R69A 4YAWA 5JLAA 2FPWA 1CB0A 1YGPA 2W37A 4P93A 3E8SA 3BEOA 4DUYB 1WCXA 1U4NA 3PPVA 1SH7A 3VKUA 2BBTA 4FB4A 4YAKA 1TTPB 1KRHA 1DTEA 1DG3A 3IV9A 1U8YA 2ZZKA 3ENZA 3PNVA 3Q87B 3QA9A 4UOEA 1ENOA 4HZGA 1EJ2A 1SIBE 4RHTA 3AI7A 3KB6A 4V0LA 4YO7A 1M2OA 1QVRA 2AYXA 4UXIA 4DIMA 5LFAA 5JE8A 2Z6AA 5BSKA 3RC2A 3SR0A 2O8EB 3VTZA 1NVUQ 3IP8A 1KY4A 1PQYA 2JEZA 2PSSA 4LK2A 3QWBA 4UEKA 3IHLA 2HD4A 3ZZ0A 1BE1A 2IYLD 1NY6A 3TLEA 1LJLA 1UMBA 5H3HA 2PBFA 3GARA 4GUAA 1OH7A 3GVXA 5C4GB 3LDGA 4RYLA 5DCYA 4ENVA 2EZUA 1TUEA 2Q5OA 3BFVA 2GA8A 1W93A 4P22A 3OU7A 5DYNA 4WKPA 5C1OA 3FWKA 5FHRA 4R8KA 2EL7A 1S2NA 3FUCA 2Z2IA 1YBVA 1NKTA 1V9CA 1E2NA 3KSMA 1Z0ZA 3PQ8A 1KI9A 3Q0IA 3COWA 2SHKA 4KGZA 1MGOA 4GXTA 4LBZA 3RG8A 4CTNA 3ONWA 4GAEA 4GD3Q 3USZA 1YQXA 3P1JA 4CU5A 5FFFA 3GQBA 5HQ3A 4F45A 5L45A 5AUQA 1SZPA 1KRWA 1MC8A 1O2DA 4JB0A 1CSEE 1YR3A 2P78A 4LNUB 1K4MA 3PJGA 3RSCA 2K4MA 3UYLA 4K7JA 3QVGA 3S1SA 1W19A 3VKWA 3U4MA 2R2GA 1MD9A 2UYYA 2JJ2D 3OKCA 3IYLW 3KJIA 3PUZA 3Q1KA 3D3KA 2OC9A 4XGNA 4LWPA 2DSTA 3FWNA 1H2BA 3TVDA 3JQ7A 1P1KA 1JHUA 3QF7A 4PAGA 1U9JA 3F67A 4ZI5A 5BN1A 1NTRA 2CJPA 3PXEA 3E5RA 3NIFB 4MWEA 4QUKA 2MR5A 2Y4OA 1ESEA 3K6JA 2PRKA 3LC0A 5K8IA 3EAGA 2GCGA 1U6KA 1YE3A 3GJTA 2VI5A 3REGA 2VA9A 2I34A 2ZSBA 3AHHA 4WSOA 2ZIGA 3RAJA 1AQUA 2F3PA 3GJZA 4JXXA 2RJNA 1EBBA 5JALA 3WGMA 4RDXA 3DXYA 4EI8A 1C4WA 1FS4A 2AE2A 2Z6UA 1T6BY 4R2KA 1AUQA 3ZGXA 1QONA 2AFIB 4I14A 5CXXA 3ZCPA 2A7XA 1MTZA 3KM0A 2EYQA 2DP4E 3MLBA 1N9KA 3PUVA 5J2TF 4BQPA 4UTPA 1BD3A 4M1QA 3TPCA 1G4UR 2IYSA 2ZTVA 3OPYB 2IX3A 5FPQA 1WSWA 3JX9A 3A3YA 4ZC8A 3WO1A 1X1TA 3CZQA 2PUFA 4L5JA 3ETCA 4AY6A 1N1DA 2NSJA 3L7CA 2R4UA 3T5BA 1U0FA 3NHMA 3IBTA 3P5SA 4LJYA 2NV6A 4G63A 4C6TB 3N0TA 5CGZA 1JEYA 3PUIA 4L0CA 3GI1A 3D2AA 2AK2A 2WKSA 4HBGA 4KQIA 4ACBA 4AKSA 4JP2A 5HKKD 3IAS1 4DSOA 2M98A 1RJFA 2GWRA 5JBIA 3Q98A 3SKXA 3HCBA 4YAGA 5A5VA 2AD5A 2DG2A 4TMYA 1H65A 4RGQA 4BFWA 4NONA 2FKAA 2QRHA 4NMXB 4S2UA 3T35A 3MJFA 4HQOA 4QARA 2Y0EA 3NZEA 2WUVA 4BQSA 1XI2A 5KQRA 1IJFA 2H5LA 2PQ0A 4IG4A 1W0KD 3Q12A 2XVAA 5F5LA 2AR7A 2DSNA 3E03A 4P5DA 3KETA 4RBNA 2B92A 1LPAB 5L3QB 1VQ1A 2EJUA 2PBRA 1WUIS 2QLFA 1ZOOA 1OXBB 1ULTA 2KB0A 3FMIA 3MJVA 3OTQA 4IS2A 4OH1A 4WQMA 1UBUS 2YVAA 3HVUA 1LPMA 1WSBA 4BFXA 1C1YA 3CZMA 4S1VA 4EDHA 4EO9A 2WVJA 2AN5A 4RESA 4G0VA 3W2FA 3LT5A 1P1RA 2IYEA 3KQSA 4IRUB 4NL4H 4ZYYA 1RJWA 3ZW9A 1G18A 2WD7B 3WIVA 1U80A 2G82A 2G5TA 1U2EA 2I80A 3ZHTA 3G7NA 1R0BA 4M1OA 1A9YA 2VCEA 5DH9A 1S1CA 4OHCA 1T6NA 1SCBA 1VIYA 2H54A 4WLOA 4MMYB 1D7AA 4I9HA 1YB2A 1A0OA 1LLCA 1USVA 3AW8A 4RPHA 5HJEA 2N46A 3EA0A 1XTQA 3GGSA 1BU5A 1DXYA 4JQZA 3L7YA 4WZ6A 5GQSA 4QG3A 3QE9Y 2HLHA 4O0LA 5K0SA 2P65A 5EIHA 5DGHA 3TW8B 1KMQA 1N7IA 1RYZA 2WIDA 4IMRA 3TNJA 1ZGCA 2V9PA 5IH3A 2JCVA 2RGNA 3I52A 3K1AB 4EKYA 3UWOA 2QZSA 1MTOA 3SZGA 3P97A 2R6R1 4GPIB 1J6UA 5CEEA 1TC1A 3FCSB 1TK9A 5DBHX 3PFKA 4PLCA 1A9SA 1LTKA 1TIPA 1WD5A 3UC5A 3WJ1A 3NBMA 4BUZA 3C8ZA 1E2MA 1G8HA 2QMZA 5CK5A 1X42A 5CX1B 1NUSA 3OLWA 1BEEA 1M6VA 4OQPA 1TOAA 3EVCA 2P4SA 1M75A 4NI5A 3BSFA 4X6YA 4MH0R 1TVEA 1YFJA 1I2AA 1GYPA 2NAPA 1K8QA 4CKEB 3A14A 4BGDA 4HYEA 2CDBA 2X9GA 3VVCA 1YIDA 4MB2A 2V7PA 1I7NA 4LDAA 1HYGA 5LKRA 1QTRA 3ER9A 1F14A 2ID8A 3P26A 1YUBA 3OKAA 1K2WA 3WWZA 5KNBA 2FZVA 1Y1RA 1Y6QA 3S2GA 1AKMA 1WABA 4E5NA 1PQUA 3ZHRA 3SZMA 4A82A 1CUAA 1D0VA 2V6FA 3A04A 3FI9A 3HKBA 3BJIC 4F6CA 2D3WA 4DJJA 3QPCA 2ZM6B 2UAGA 4Z9XA 4JVSB 4NU6A 1W35A 2JIPA 3K5PA 2UU9B 1G55A 2G17A 4MVJI 2RCYA 4XYMA 2CV1A 2ZBEA 4I5FA 2BZ1A 4NDZA 4G0XA 1Y80A 5LXTF 4QDUA 4A5SA 2REQA 3HB4X 1WXGA 2WKQA 2FSIA 2AX4A 2O05A 4L2IA 2EJWA 3P9NA 1DHTA 2VCHA 1X0VA 1BWRA 2QTAA 4C0SA 2WKWA 3VGPA 3C6MA 4JB3A 1QFMA 4C76A 3PE6A 1TDJA 1BKDR 3AIOA 3H97A 2BGLA 4D4HA 2ZGVA 2GZHA 3PG5A 2VK4A 3K09C 1I0LA 3ZGLA 1VLLA 1QGDA 5KYUB 1RPTA 4G09A 1EX7A 4X84A 4CI9A 1YI0A 1J7JA 2PYZA 2GK7A 4LJAA 4JC0A 9GPBA 1M1XB 4RLHA 3UJ6A 3M6IA 1VLVA 2HIHA 2AXNA 2EJTA 2A5YB 4KWEA 1FSFA 3MYYA 1KZ7B 2BEUB 1H9AA 2GCPA 2QTHA 3Q7SA 3TH5A 2I3DA 3PTLA 5I9TA 5B12A 5DX0A 3ST7A 4KG7A 5JJLA 3NALA 3V97A 2LCIA 2DWUA 4RKWA 2CCJA 3WIOA 5JBNA 1I6MA 2QDKA 1EVIA 4QVGA 2H1WA 1ZNZA 1J33A 4RZHA 1DQPA 4FR2A 2UYQA 4N03A 3T34A 3FVQA 1MENA 2GCIA 3F6PA 3P2IA 3UWKA 1MQAA 3E3LA 2IU0A 1DZ3A 3O1HB 3C8UA 4ND5A 3TLCA 4UD6A 3VYTB 3CWQA 4EI7A 1EWQA 4FFRA 4QT4A 1EXVA 2O1SA 3RVKA 3LS2A 2X9LA 3A1UA 3NHYA 4K6MA 1TQHA 3FYCA 4YCCA 3FUTA 4RF5A 1CCWA 1ECGA 1UUFA 2PKQP 4A6EA 2YN0A 4YP7A 3EVBA 3LBIA 4YRGA 1Q0ZA 1Q7GA 1XMIA 3U4DA 3N3BC 5BQFA 1RQRA 3M6LA 1CP3A 1M1NA 1VGRA 5IAKA 3T0IA 3CLKA 3IRUA 1ZGGA 2R00C 1P1BA 5CBPB 1V96A 5T4HA 2A30A 1IB0A 5HZMA 2BDTA 3O3NB 3ZXUB 1U3TA 1QG0A 1HFKA 1UMCA 1GSOA 2H4YA 2UZ3A 2HK9A 1IBLB 2PH3A 1RZUA 3Q7EA 3UHAA 5B3JC 4HDNB 3ME5A 1HRKA 2VDWB 4KK4A 5HJ5A 1EUCA 5F7OA 1N2BA 5ES3A 3JARB 1N5LA 2FFHA 2Y4NA 2QAGB 3PRYA 1WXWA 3V80A 3VSCA 4WNYA 1JB1A 1P2TA 4M22A 3IUQA 4DJTA 4P7GA 5CDUA 4PU0A 1DTWB 3A9CA 5EIBC 4E5YA 2GR9A 1CY6A 1KJZA 2OBFA 2XZTA 5KYTA 3GMDA 4D45A 4YT5A 5HGJA 1KQOA 4R8MA 2V7GA 4R2JA 3A4MA 3R8XA 3RKSA 2IE0A 5H68A 2DUMA 4QGHA 2X86A 2VZLA 2ZPUA 1PX2A 3CBGA 4L27A 4MB0A 4O2RA 4BJ1A 3QMMA 4G25A 4MUFA 5J63A 2FYTA 4YO8A 3ZGOA 1KI1A 5FO0A 4DT1A 1UT5A 2WG1A 1CFJA 4BRUA 1OIWA 3LCCA 1PT6A 1MR3F 1W96A 2RHBA 5H82A 4M6WA 4JD5A 3SHOA 4E6EA 5JOQA 5DNYB 5K8JB 5DBEX 1N77A 1QRTA 1AKNA 3EXHB 1CS0B 5FCDA 1YKSA 3WWPA 3HA7A 3M7IA 3AEKB 1HFJA 3O2SB 2ZIZA 1YWGO 4JLOA 2O54A 4C1NA 5AJWA 1T9ZA 2COUA 2CW5A 1E2LA 1O95D 1QVZA 2VRCA 4C06A 4KQXA 4EY8A 3JZAA 4DV1B 1X7DA 1GPYA 1EEXB 1DRWA 5I9SA 1UBRS 5CA1A 1UK9A 1Q7CA 3GHHA 1P4GA 4OUKX 5JCJA 1KH2A 3KT3A 1BOFA 1TEZA 1Z0FA 4Q48A 4KSBA 3EZFA 2IDMA 2VHJA 4RIIA 5KSYA 1TEHA 4K03A 1F2VA 3FFTA 4KQ9A 3K09A 4XLLA 1XLVA 4AMUA 1SUCA 3ESQA 2H2FA 1C4KA 3A4YA 3RE1A 1E2FA 3PWKA 1QIDA 4YRDA 1CQJB 5KKNB 1AXRA 3KLBA 4G8CA 1CG6A 5D84A 1Z0AA 3OJFA 3I39X 1B6GA 2EFGA 3OLYA 4Q02A 4BASA 1T1RA 4TMFA 1DEHA 8MHTA 3BFPA 3QVMA 1GEGA 5IVIA 2G07A 2JG3A 2BMVA 5FF9A 3U0BA 4BV2A 2HK6A 2QV0A 5F78A 2OOKA 2WI8A 5KDLA 4C7XA 4DREA 1E0KA 3EW9A 4RFLA 1NLZA 3QU5A 3LHDA 1DVRA 1MO5A 3W04A 2WT4A 3K6RA 1QAMA 4QJ3A 5AESA 1R7RA 2I8LA 3TQOA 2GO1A 3FAZA 1E9RA 2Q5LA 2QBYB 4B6PA 3FTEA 1JHMA 4HNHA 4IKPA 1SBCA 3BXPA 2E0IA 3IMKA 2FE1A 4YGXB 2CV0A 4RY0A 4FB5A 3ELWA 3COSA 4I36A 3Q9LA 2PCJA 2FW0A 1JYEA 1NMSA 4EY6A 1ORDA 3KEQA 2ILVA 3IVRA 5KOYA 2R00A 4NQZA 4AP6A 3T5TA 1VZ3A 1AF7A 3A26A 4NQRA 3NIGB 2Q62A 2OZVA 2PQ2A 5DZSA 4CL0A 4OI4A 2Z9CA 2H0QA 1E3JA 1AURA 5EE3A 1XDGA 1Q0LA 5DHAA 5KBYA 2ZREA 2ZBGA 4LY0A 3UMCA 1TUGA 1DIBA 1NUTA 3TEJA 3NWOA 3TLXA 4B81A 4WIAA 5AOCA 2J5BA 1DFHA 3SMQA 3UH1A 1XVUA 4GPAA 4HNAB 5LB2A 4HQNA 4JLWA 2W2TA 4QATA 1IULA 2GCEA 4LNAA 1KJ9A 1WW8A 1XJCA 3DBVO 3TR0A 4C4ZA 4BE9A 2RIRA 3FYUC 1SC1A 3J80A 1O9GA 2J33A 1ADJA 3SYTA 1F0PA 1N33B 2FZ4A 3WKAA 3PUHA 1AMUA 1WZCA 1A2QA 3JVVA 1RBMA 3SJ7A 1G3QA 4RS3A 2Y8EA 3RB8A 5I4KA 1SU4A 1QBGA 3LUAA 1FUKA 3O3OB 2EC5A 2NUPB 3RTCA 3TUJC 3VMFA 4I50B 3UV3A 2ZUSA 4R40A 2O3JA 2Y67A 1LX6A 4C2BA 4X9XA 1DFGA 1ONOA 5CCBA 1Z5UA 1BWSA 4U2GA 5JS7A 2PBZA 4DZTA 1RQXA 2W8BB 3ZWMA 2R8YA 3CLRC 4ACAA 1BYIA 3R40A 3K32A 1GUBA 3G6WA 3M6UA 1PNOA 1VSUA 3PC6A 2ZTSA 3EBLA 5CU7A 4EQ6B 1XA3A 1FW8A 2JRCA 2R79A 2RGBA 2Z4RA 3G3EA 1USIA 4WOBA 2FMXA 3PWSA 5CPBA 2KHZA 3T3NA 1KFJB 1ZP6A 1D5WA 1EFRD 1P5FA 3LNTA 4KQEA 2UZ1A 4MQBA 5IDYA 1AGRA 3PJDA 1CZHA 1Z2PX 2CCKA 2O2JA 2QXUA 1FB5A 2XEXA 3NKVA 3ND9A 3BH6A 3RRFA 1YJ5A 3ZTTA 2R96A 4CR7A 4OX9Y 4EUFA 3AF6A 1AHHA 2O2CA 2A4KA 3HA2A 4GHWA 5AXBA 1SN7A 2ERXA 2OHVA 2ZIAA 4WBSA 3L8ZA 3G1TA 4B7ZA 4EKGA 2B78A 2QN6A 2QIPA 3CH7A 2LXNA 3MJEA 3OFND 3INYA 1J24A 1K97A 2ZVQX 3DOFA 3PA6A 4KEAA 4Z8XA 2YZMA 1YVRA 3DQPA 3V1MA 2FXIA 1XLWA 4IDPA 1YUMA 3CNLA 4CMEC 5CLIA 4HB2A 3AR2A 1LPOA 4G1EB 4TTVA 3TK1A 5JQWA 3V7UA 4LXGA 3D7KA 1W30A 1JEEA 1UPCA 3WBFA 2AWOA 2XH8A 3WK8A 2ODPA 4A6PA 3OZDA 1H2ZA 4TKVA 2ZCVA 2G25A 4JGGA 4I19A 4I0WB 1T43A 3DNFA 1Q22A 4RPCA 2RHWA 3S4YA 4TZTA 4D0GA 4D56A 4FJ2A 3STTA 1QMGA 3DL2A 4IP0A 1DDIA 2QL6A 2ZDHA 3PGLA 3QG5A 3E3NA 4JOBA 4M83A 1JZQA 3LX4A 5FBHA 1WUYA 2YYZA 3V4RA 1SXIA 3P9YA 2FMUA 3EIXA 3NHAA 5DFAA 4Z9BA 5LOVF 2OKGA 2VH2A 1L5YA 3ISJA 3W6OA 4CM3A 4EY5A 4Q03A 3UNXA 2IIBA 1UXKA 1Y1LA 1BA2A 1NW5A 2HMTA 2I29A 3LUPA 3NTXA 1TQ8A 1JIIA 1R6AA 5K9ZA 2RGWA 2P9QA 4PHFA 4JT9A 1QGYA 3OI7A 1GTZA 1QO0D 3P27A 2WM2A 3EULA 1L9XA 4GVPA 5M7EA 4FD3A 1JEQA 1R8JA 2RGCA 2O06A 5KO2A 4G9GA 4BX8A 3N58A 3UT5B 2XUIA 3HYLA 2FWJA 2O4CA 2ZR7A 1AM4D 4BLUA 5AXDA 4XD2A 1VFNA 3V1LA 1JLKA 2EGUA 5JS2A 2BMDA 3VZBA 4B84A 3SK0A 2RAVA 4M89A 4R1OA 2F62A 2IDKA 4YJ2B 4NNJA 3AQIA 4IVPA 1RHQA <