1Z06A

Gppnhp-bound rab33 gtpase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
RIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-33B
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 51
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z06A00
4P33A 4M2LA 4D80A 3SEAA 4URXR 4RFSB 5CLLA 3RS4A 1TF7A 3AF3A 3T1QA 3R8FA 4JL8A 2JLUA 1SVKA 2CLDX 3W6PA 2NZ8A 1JEDA 1OH6A 1SHZA 5EXXA 3SZRA 2MMGA 3MJHA 3WYGA 3CZPA 4IJMA 3MWYW 3RC8A 2AHOA 5FPTA 2XB2A 1N25A 1Z0JA 2OXCA 1E2FA 3N5CA 3REGA 1ZCBA 4HEJA 3MWKA 1DAHA 1GKIA 4B2PA 2ZSAA 1E0JA 4LYJA 2ZI9A 3UG6A 1MO4A 3HYTA 1G7RA 3R7WA 1D2EA 1RKBA 1U2RA 2BKEA 3B5JA 2IWHA 3SC3A 1G8FA 1UBFA 3EW9A 3VX3A 4Q4HB 1JNYA 3E1SA 1N5IA 1PLKA 1AQYA 3HR8A 2E9SA 4WXRA 4ACAA 4RD6A 4RJLA 4DLWA 4L9WA 3RRZA 3KJIA 4PAMA 1OH5A 4NCIA 2YNMA 4PPNA 5TARA 2BHRA 1GNRA 3W5IA 3C4JA 4B32A 1G6OA 1KAOA 4BUJA 1JECA 4Q9KA 5KDOA 1IN8A 2WBLC 3SOPA 4DUGA 3R9XA 1U8YA 4BEJA 4IFEA 3CNOA 2OFOA 1QBKC 3CNNA 4HSEA 4LDJA 2IUUA 1HYQA 1C9KA 3AVXA 3CH5A 3EZ6A 1KO7A 1Q1EA 3GFOA 1HQYE 4GZLA 4I1VA 4D82A 4M9XA 4Z51A 1GRRA 4GMDA 1UEJA 3T34A 4C0SA 1SVWA 1VG1A 1UKEA 2W6JA 3FMFA 4TT3D 1NBMD 3I92A 2CL6X 2QL6A 4B43A 1E96A 3RRMA 2V6JA 5FI0B 1OKKD 2BVNA 2PT7A 3OIVA 4QJ3A 4B33A 3SFZA 1G7CA 4X8OA 5FBWB 1XTQA 1XZPA 1KJWA 1NMYA 4OYHA 3SN6A 5J4HA 3B6EA 1ZC3A 3SBDA 2BCGY 2H18A 2KI5A 4YQFA 1ZW6A 721PA 4KBGA 3P26A 1E0AA 4MYTA 3U44A 3QOFA 2BC9A 4O3MA 2IYYA 2ZRKA 4DLYA 5DIFA 5IF9A 2ODEA 1JI0A 3L0IB 1GZSA 3AP3A 4W5WA 1KKMA 1MT0A 2HT1A 1P9RA 4V03A 3B78A 3L0OA 4QL3A 3SE0A 3DOEA 3OFNA 5J40A 3EPLA 1OT3A 2BBSA 4QNMA 2EFGA 5DISB 3HU1A 1W4BA 1Z8FA 5DLQC 4B74A 2H1LA 2IUTA 1UKZA 3T12A 1ZM7A 4YLGA 2AX4A 2Q21A 2DWQA 3PITA 1V43A 3JZMA 5JWRA 3SJBA 4BFUA 4EJSB 3PENA 2R6DA 5EUQB 1MH1A 3CUEF 3AF0A 1E69A 1W5SA 2CE2X 4MRVA 1E4VA 1KJZA 3SJCA 1ZIOA 4A6XA 4I1OA 1YZTA 1ZCAA 3LBNA 4JLNA 1KSGA 2QBYB 2GBLA 1BYIA 4JS0A 1BMFD 4RKEA 1DAGA 3KDSE 2CK3D 3GJ3A 4WVFA 4ZV4A 4HB4A 2ZTSA 2IYSA 2PH1A 1HY3A 3GJ0A 3CONA 3RS0A 1DELA 2OBMA 2WOOA 1E9CA 1IBRA 3X1YA 1JAIA 3LBIA 1E2LA 2RMKA 2WPDD 3KKNA 2QZ4A 2J5XA 1DAMA 1A2BA 4NYIQ 1KI9A 4TTPA 3RNLA 4BFYA 4EIWA 1TPZA 2D7CA 2Q3MA 1C4OA 4ZPXA 1S8FA 2Z4RA 3WMFA 3MCAA 3PXGA 3CPEA 3GLHE 2OM2A 2GDJA 4P4SB 3U7EB 2I3BA 1WF3A 2PT5A 3K70D 4EPWA 4DEXA 4IXMA 3KKPA 4S35A 2XGJA 1BIFA 2W2TA 1TAGA 2R6CA 1EX7A 2ZI6A 3QENA 5KSOA 3NG1A 4H9GA 3EPKA 5H68A 4EQ6A 1ZM9A 1J8YF 1SXJA 3AH8A 3RS7A 3L8YA 3QF4A 3RLFA 4BECA 2D74A 3KJEA 2P5TB 3L2OB 3LY5A 4JYBA 4IVQA 2IUSA 2W0MA 3VAAA 4D0GA 2QU8A 2Z6VA 5ELXA 4M1MA 1ZP6A 2HCJB 1EFRA 3LQRA 2H7VA 4M9QA 1XX6A 4UNNA 4DSOA 1WP9A 5KTYA 4LK2A 1XCMA 3B9QA 4QKQA 1IQPA 1E2HA 5TB5A 1CR0A 1E9DA 5DI9A 5CB8A 1S96A 1UBGA 1X8LA 2IT1A 4EPYA 3QIAA 3GLIA 1COWD 1ZJ6A 1KI1A 2GEVA 3MWLA 4FWTA 3TVTA 1EGAA 1G5TA 3BGWA 1KMHB 4MH0R 4QG7A 1E4YA 1N6OA 1ZUHA 1RYFA 1G291 2GXQA 3G5UA 1NG1A 1G3IA 2E87A 3SS8A 4PSVA 2FSHA 4WZ6A 1YZKA 3QXCA 2ZITA 3PEUA 1G3UA 2R2AA 3V00A 1J90A 2QMEA 1CS4C 1DG3A 1T8UA 3WP0A 4BLQA 5HZKA 3THWB 2FSIA 3HU3A 2OFXA 4UJ3A 4MA4A 3LRPA 3IBGA 4AY2A 4YONB 4TMKA 2BBTA 1HT1E 1UDXA 4I1UA 1F2UB 3DM9B 1XMSA 2C99A 2X19A 2FF7A 3ECCA 3FVQA 2PZGA 2J0SA 4LBWA 3I32A 1CU1A 1XBTA 4BLRA 3ZH9B 5BW8A 5DHFA 3UKDA 4C7OA 5EJEA 1YU9A 3B2EA 2ZEJA 4TLAA 1UAAA 3AP1A 2V4ZA 4L15A 4XWKA 2A5DA 2OHFA 4JBYA 4M1OA 3IKJA 4TYNA 2IA5A 4C0BA 1SKYB 4RSGA 4D26A 5J5CA 1AK2A 5KPJA 4XSHA 1Q44A 4V0OA 3L0SA 1F60A 3CW2A 4CZ2A 4AKHA 2D7DA 221PA 5JJLA 1TQ6A 2ZROA 5AUQA 5FPSA 5IHPA 5LDDC 5KPDA 1ESNA 1R0YA 2ZRPA 3SNHA 1XJQA 4K46A 3EX7C 3K70C 2I4IA 2R6AA 5FBVB 5JJKA 3NC1C 1HT2E 4A0FA 4MDEA 2GCOB 1KJYA 5D3MA 2MMCA 2G0TA 3K0FA 4ZIRB 2VLIA 4B3XA 2QAGC 3VKHA 3MFYA 4NYMR 3GLFE 1PLJA 4FCWA 4G1UC 2VPPA 2OZEA 3TQFA 5TV2A 3X1DA 3SBEA 2ZU6A 5JECA 2J9RA 4ZCIA 1NLFA 4YMSA 4B76A 1NN1A 3RYTC 3KQKA 4PZLA 1XD2A 4E03A 1QDEA 1R8SA 3QKRB 4V0KA 1TU4A 1KSJA 1SHKA 2QT0A 3C7KA 3GPLA 1OH8A 3ZQ6A 1CJMA 1X6VA 3LW8A 2B21A 1XNJA 2FPMA 3T35A 1GIAA 2D2EA 4EPTA 3QJYA 4NKRA 4NMMA 2IYLD 4DDVA 3K0CA 5AJVB 4QFMA 2C03A 1NKTA 1F5NA 3CNLA 2ZRFA 1OXSC 5JLJA 3AF4A 1Z2CA 3VR1A 1T91A 2GAOA 3UANA 2I1QA 4LC1A 3AVTA 3K9GA 3OFND 4HDCA 5L3QB 3RS2A 4B73A 3M0EA 3EWSA 4HYYA 2ZYWX 1IN7A 1F3OA 3VX4A 4FN5A 4WOPA 4LBVA 4Q1DA 2OCPA 2GEDA 2NIPA 5BXQC 3MD0A 4L4UA 5JSZB 3ONWA 4JJKA 3NIBA 5BQ5A 2OUKA 4EPVA 1ANKA 3FHCB 3C16C 3BRWD 5C18A 3PG5A 5KSPA 1H8HD 1IJEA 1KGDA 2ERYA 1RJ9B 4LJ7A 3B85A 3GLGE 4CEIB 2ZI5A 3GFPA 2IF2A 4IDQA 1XDBA 2QT1A 4N0EA 4B6FA 4DDTA 5DYIA 2IXFA 1CR1A 5EZ5A 1JR3E 5CITA 3TR5A 4B34A 1FNNA 3BFXA 4NU0A 1T3SA 2OT3B 4XIGS 1R6BX 3ZVNA 4LX0A 1UBEA 4KLNA 2IXEA 1Q1ZA 2KBFA 4TZ0A 1RE0A 2C98A 4HUQB 1VCOA 2GCPA 4J0QA 4NCHA 3UMFA 1FMJA 4RZ3A 2MSCB 1DO0A 3CM0A 3LA6A 2GJ9A 3UXMA 4U7DA 4ABYA 3ADDA 2YWEA 3HP1A 1DOAA 1NVVQ 4JLJA 2EFDB 3W5JA 1A7JA 4LJ5A 3BH7A 1YHNA 4PHGA 5CDFE 1AJEA 5DN6A 3FGNA 5FOVA 3PEVA 5FFMA 1E2DA 3CBQA 3RC3A 3B1VA 3CF6R 2PL3A 3VMFA 4ARZB 1NL3A 2RGXA 2R62A 3NDBB 2FPLA 3DZ8A 1T5LA 2B8TA 2NQ2C 2YJTD 4YDHB 5JHGB 2DFKB 1VPLA 3R20A 4OBEA 4DBLC 5E7JA 1OXXK 2ONJA 3K0SA 1W4CA 4DCVA 4HDOB 2H16A 4KVGA 2VHCA 2KE5A 1EFRD 3U3KA 3U3OA 4BFTA 5A5GA 3OEHA 4OQXA 2Q3FA 1Z6TA 1YR9A 2OE2A 2V7QD 4L9SA 1GVNB 1MRNA 4M1TA 5DNYB 1KTVA 1XPOA 1G6HA 2YOFA 1GP2A 2PJRA 4C2TA 4Q7MB 1ZYUA 4Q66C 4V0MA 1II9A 3LO5A 1GTVA 1OYWA 5CB6A 3S1AA 4KYUA 2VA8A 1M8PA 4DHEA 1D8TA 1VHLA 4LJ4A 1MABB 1Z83A 4GSYA 5E3HA 5FUVA 2IBMA 3TRFA 1W4AA 1W36B 2DFNA 2IYRA 4D4LA 3PJRA 1A5TA 1DBSA 2JASA 5FUWA 2QI9C 3TBKA 1XTSA 4ZCMA 4PHFA 2WJVA 3NH9A 5LBIA 3AKCA 3KKOA 3ZDQA 4DCUA 4P31A 1TUEA 5EP2A 3UG7A 1IN4A 2ZRMA 2PLRA 5CM8B 3K8YA 5E4FA 4KITB 1AIPA 1AZTA 2UKDA 2REXB 1NMXA 5C2JB 3Q5DA 4UXIA 2GBLC 4Z1MA 3I5XA 2QUZA 3OIYA 1TQ4A 4L5BA 2IEZA 1X8KA 1OXVA 4MKGA 4DC9A 1NBME 3SQWA 1G20E 3UMSA 1JJVA 4CEJB 1XTJA 3K53A 1T9HA 1H8EA 1VCNA 2QG6A 3FMPB 1ZM4A 1B23P 3DMNA 3O8RA 1QHNA 1J2JA 2LKDA 3TGPA 1T0JB 3M4YA 3AEZA 1S3SA 3B1YA 4QBHA 3GEHA 3TSZA 1KO8A 2GZHA 4D25A 2ZRLA 4B35A 1TMKA 2ZUCA 4BLOA 2GK7A 3DHWC 3BB1A 5IK2D 4PR0A 3VR5A 4FMBB 4QGAA 3RRNA 2CNWA 1RYHA 4R7ZA 2AWNA 1SXJC 5DHAA 4AK9A 1CJTC 4IDPA 3FTQA 5A0FA 4EFLA 1XEWX 4UJ5A 2GJKA 2EWWA 1XXHE 1IHUA 1E9RA 3TW8B 3KX2A 3LD9A 3Q7QA 2CCGA 1JPNA 4TMWA 4IOKA 2YWHA 4DXAA 2BMFA 2Y8EA 1K6MA 4GOKA 1HURA 5J4VA 5J4LA 2DHRA 1EFHA 1LV7A 1VYVA 3SJAA 2YOGA 1N6PA 4FD2A 2JLWA 2ZRGA 1P2TA 1LVGA 2JLRA 1D2NA 2YZ2A 4UNQA 1E9EA 5TVKA 1P72A 4BPBA 4QGGA 1IONA 3K09A 5J47A 4B3GA 4DSNA 4TMXA 3RANA 2C9YA 3W6OA 4A6PA 5EZ6B 1FQJA 1KK1A 1KMQA 4Q7LA 1DS6A 3CR7A 1VYUA 4LBYA 5FL3A 4BEBA 2O8EB 3O47A 1L4YA 4FWIB 1Z22A 1PJRA 3BE4A 3PVSA 1FQKA 4H1UA 4D6PA 2GJAA 4LHVA 4IEIA 2MSEB 2GESA 4G5OA 2IHBA 4Q19A 3AF2A 1GWNA 2CE7A 3GJ7A 3LLMA 1E2KA 1KZGB 3FHOA 2EVWX 5FTNA 3NEYA 5DI3A 3WP1B 3I8XA 3VU9A 3OAAA 1D5CA 2IS6A 2CVFA 4TWZA 3IILA 3BWDD 2EFHB 3TE6A 5G53C 2X77A 2CHGA 1YZNA 1E2IA 1ZD1A 2Q9CA 1WBDA 2O8FA 2O0HA 3CZQA 1W44A 1WQ1R 3H2YA 2PEYA 2QP4A 2OV2A 4JVSB 1KSFX 4B3CA 3ND9A 3QKSB 2GF9A 3VQTA 1E6CA 5GJVC 3IIKA 1N0UA 4LCBA 1NI3A 4R9UC 4JMPA 4AKGA 3CPHA 3B8HA 4Q21A 3DO6A 3Q7PA 1NN5A 4LY6A 5JRZA 4DDUA 1OFHA 4TLEA 1OHHA 3KTAB 3IEUA 1LF0A 4I99A 1XEWY 2W83A 1LFDB 2GXSA 2WKPA 4IOJA 4XD7A 5DN6D 1T8TA 1WB9A 1TF2A 1AQUA 5CK5A 4PX9A 1AGPA 1KDPA 2P6UA 2SHKA 4II7A 5TXGA 1ZM3A 3RWMB 3FWYA 1A4RA 1Z0IA 1NN3A 3IIJA 4TL8A 5TDHA 5CIQA 5EQTA 2WICA 3U7GA 3OZXA 2AWOA 5H1YA 2CJWA 4DSUA 1KIMA 3GJXC 1ZIPA 5F3WB 4PFSA 2JLQA 4LJ9A 2QROA 2XJ9A 2GXUA 2IS2A 4BGDA 1IN6A 2P2LA 2P3SA 2PLFA 2JCSA 3K0CC 3P20A 4RD1A 5D3QA 1MKYA 4A8JB 2O8CB 2CMKA 1T3HA 2ZRHA 2WTUA 2O8BA 4Q4LA 1EFCA 2HLDD 2HEIA 2QN6A 3Q5EA 3FHTA 1W46A 2VP5A 3EPHA 2VH5R 4WZAE 2PZEA 4RFSA 1N5KA 3ZIAA 1VDZA 5JS8A 1XWIA 3WNDA 2XSZA 3GJ5A 1N6HA 1ODFA 4LI0A 3VHLB 2B7BA 2ZI3A 1Y3AA 4QHTA 1XEXB 1JXOA 4XVQA 4FIDA 4MRNA 3T15A 3FKSA 2GHIA 1T5IA 4BRWA 4MDFA 1S9HA 4HLUA 4ON9A 2GRJA 1NP6A 4DLRA 2XNDA 2HDNB 1DAKA 3OEEA 4ASUD 1NLYA 4IW3B 4OI4A 1RFLA 2QPTA 1XD9A 4MGZR 3WMEA 2QSYA 2JLSA 3B7GA 5GVRA 1NSTA 4Q4HA 3RVBA 3ZZUA 2AXPA 2JIZA 4ERNA 5F9FA 1P9NA 1W4RA 5KU1A 2XXAB 1XJCA 1XMIA 2OEPA 4DCTA 3CX6A 1N6NA 2AD1A 3KB2A 4JLAA 4BLTA 1Q1QA 4JVLA 1O87A 3CRMA 4N1AA 2DB3A 2EWVA 4DLVA 1H8ED 4UQOA 2OESA 1NMZA 3Q9LA 1FP6A 3WMGA 2A7QA 3AUYA 1R2QA 4W5HA 1K5GA 2ZR0A 1VIAA 2WSMA 4GNKA 4EPXA 3F3YA 4JKIA 1GRQA 5FOWA 4C0KA 4JLVA 2ZRJA 3U6BA 3C14C 3TJZA 3ASYA 1NVWQ 4OHZA 4Z8XA 1L4UA 4OHWA 2RGEA 3OE7D 5G40A 4ZKDA 2WIBA 3CX8A 2OBNA 2W2XA 4X8LA 3IUYA 5P21A 4Y0VA 1QVAA 4JZKA 3HPRA 2FSFA 3SQXA 3PUYA 3AVUA 3DOFA 1R5OA 4B2IA 1G4AE 4OK5A 1BS1A 2IYXA 2R44A 3A1SA 5DGXA 2IS4A 4GMXA 4G5SA 4MUAA 1T0HB 4Q9JA 2BDTA 1KYIA 1OIVA 3JVUA 3SYNA 2GZAA 4DDWA 3MLEA 2DYKA 3W8NA 2WJYA 4OJQA 2FN4A 3T06B 2W00A 5JHHB 2FX3A 2AFHE 1M7BA 1CLUA 2N1BA 2ORIA 1G19A 2ZE6A 2QE7A 2QAJA 2R6FA 3P4YA 4HAXA 5KDLA 4Q7KA 3FE2A 1ZC4A 4LPKA 1J8MF 3VTKA 2IYVA 1N0WA 3AVQA 1N6RA 4ZDJA 2V55B 2ZRBA 1YZLA 2G1KA 3TAHA 4EJSA 1DADA 2FZ4A 5FL7D 4N3NA 3U2QA 4JLOA 3QE0A 1GOTA 1AKEA 2NO7A 3K1JA 1CJVC 3MSXA 2QNRA 4GT1A 4QHYA 4US0R 2NG1A 5B58C 2QBYA 2KBEA 3NXSA 4KO8A 4Q9LA 2IS1A 1W2GA 3W6NA 2DWOA 3GCGA 1QG4A 4P32A 3OAAD 2XAUA 4LC0A 1YR6A 3IO3A 2B92A 4QM6A 2CXXA 3MMPA 4XSGA 2HUPA 4BASA 1MRSA 2C04A 2ZPTX 5CYPA 4QBIA 4A2QA 4C0HA 1N5LA 4OI2A 3RAPR 2RHDA 3CF2A 3KXLA 4B44A 2KWIA 2GWHA 2DWPA 4TTQA 5HZHA 1KI8A 1SXJE 4OHXA 3AB3A 2CHQA 5JRJA 3PQCA 3TK1A 3BH0A 3A8TA 4P4SA 4DLSA 4M9ZA 2YYZA 1QHHB 1E2NA 1OHHD 1AZSC 3SJZA 2GJSA 2QQ0A 1DARA 3K0EA 4GI7A 4LPSA 3AVYA 5JWOA 1QHYA 4QGHA 1XCGB 2EQBA 3UATA 4O0MA 1KAGA 1OJLA 1KO4A 4URYR 5EP4A 1XTKA 3BXZA 3AM1A 2P6RA 4OKSA 5EUMA 2BWJA 2ZANA 2FSGA 1MO6A 5ANRB 1DAFA 1H65A 1Z2AA 4Q01A 4R98A 2QMHA 3HDTA 3FPAA 4A36A 1GITA 2DFTA 3PCRB 4QJ5A 4QM7A 1CKEA 1XEFA 2BBWA 2NPIA 2ZSBA 5FOSA 5L3RA 3EZ2A 1UDWA 4KFTA 2BOVA 1QHXA 4EFMA 2F1IA 1G3QA 1G8HA 2NO6A 1KMHA 1M34E 5LD2B 3K09C 4QRHA 1HUQA 3VHXA 5GADl 2G0NA 1FOEB 3EIEA 3U3RA 1E98A 2D62A 1TQ2A 2EYQA 3PFIA 4FI3C 4BZXA 3EA5A 2RGAA 2DCUA 3ZIAD 4HATA 3WYAA 1LB1B 2WIAA 2XSZD 3DVLA 4YMTA 3THWA 2CVHA 2EFEB 3U7HB 4A0GA 1G3RA 2ZRIA 4RD4A 1E1RD 1F2UA 1TQDA 2IYQA 4UNRA 1Z6YA 2W58A 4ZDWA 4AG6A 1LS6A 2OCBA 3W34A 2PMKA 4F91B 1KDTA 2XNDD 2GETA 5HE8A 3OEED 2ZS7A 4TSFD 3KQHA 1D9XA 2NO0A 4AYXA 1QVRA 3T1OA 4G5QA 3K9HA 5LPNA 2YV5A 2YWGA 4JBWA 4S2EA 3QSYA 4LJAA 2JIZD 4EDHA 2OFWA 3DKPA 3WY9A 4WAUA 2CBZA 3WNBA 1TADA 2RGNA 3IBYA 5AR1A 3T5GA 1AS2A 4C3ZA 4E09A 4ESHA 5KHOC 1P2VA 5GVSA 1D6JA 1WRBA 5HCIA 2G83A 2HF8A 2AK3A 2BM0A 4QC2A 2BEJA 4PSKA 1JXMA 4A2WA 1PLLA 4YDSA 1VCMA 4ZI3A 2GCOA 4URVR 2BM1A 4ZIRA 4NP6A 1MO5A 1Z47A 3FDIA 4ZO4A 4C30A 2J7PA 3ZD7A 2CDNA 3QKUA 1CR2A 2H57A 5TMPA 3SFVA 4M9SA 1A2KC 4DEYA 1RC8A 1XMJA 3P32A 4PHHA 2ZAOA 2Q6TA 5IRCD 3OESA 2WWYA 1HTWA 3QKRA 3WBJA 2X2FA 3WRYC 1E2QA 5B2ZA 2PCLA 4DUGD 3HWSA 2QY9A 2VP4A 3WRXC 2JATA 5FBQB 3ZD6A 3P4XA 5JI3E 2QQEA 4HLQB 5JWHA 4B2LA 2IXGA 3TUZC 4Q00A 2HF9A 3GLHB 4PANA 1GL7A 2F1JA 3SI7A 5KOYA 3NDPA 1E9AA 1XMVA 3IQXA 3TSWA 2W6JD 1U0HC 4XH9B 4TMVA 1SVMA 2ODNA 3AUXA 3AKDA 5L3QA 5AK0A 3CRVA 4PC6A 2ZSEA 3E5HA 4MRRA 2RKOA 1IN5A 2RAPA 4GFDA 5SZKB 1W0JA 4EPRA 3SU8A 4A92A 2OAQ1 4LYAA 2WSSA 3A1WA 4HZUB 3CH4B 4N0DA 2GTPA 5J4YA 2F9MA 3AQ4A 3PUXA 4ZDIA 3A6PC 1PUIA 2DPXA 3CPJB 5JSZA 3WHKA 1F2TB 1D9ZA 2RHMA 3EIQA 4BZPA 2YHSA 3EZ9A 1G1MA 4HLUC 1NVXQ 1WCV1 4TMTA 1RJ9A 4CEIA 1CF4A 1QHIA 1AGRA 2GEUA 2ZU0C 3NC0C 3QBVA 4E07A 2ODWA 5FBLB 3ZS8A 3U60B 4BLSA 3ICEA 1LW7A 5SZIA 2DBYA 2FFQA 1NKSA 2ZR7A 4DLUA 4Z54A 3HU2A 4OK6A 3LXRA 1YR8A 4Q1BA 4DZZA 1E2JA 2QEQA 1R4AA 5EP3A 2KB0A 3OHMA 5DSZA 4LYHA 1VKJA 4HUQA 2FMXA 1G7TA 2VP9A 2ORVA 4Q1EA 1LY1A 1GRNA 2JEOA 4EUNA 5L3SB 2QMOA 4LSGA 3THYB 1OFIA 3Q3JB 3ZQJA 2ECKA 1NVVR 4HAYA 4HZIA 4Q48A 5G41A 1T6NA 4DB4A 5EE1A 2J87A 1NY5A 5EE9A 3EARA 1W49A 3D31A 1Z0AA 4BLPA 1OW3B 1KY2A 5FUXA 2GF0A 2ZS8A 3I8SA 3I72A 4LYFA 3IDQA 1IY2A 4ARZA 2C78A 3EC2A 1V5WA 4C2UA 2RGCA 1L8QA 3KFVA 1E79A 3C5HA 4QBFA 1E0SA 3DEFA 4V0ME 2XITA 4TLCA 1GL9B 1IAQA 2VL7A 5FUYA 2PJZA 3QPUA 4LHYA 3W3ZB 1E9FA 3Q85A 1JQJC 4FMDB 1AA9A 1CJUC 5GJCA 2WOJA 4A9AA 2JAQA 2GAAA 2F3TA 5EXSA 3R9IA 4GOJA 4RKFA 4RZ2A 1I4LD 5AUPB 2J46A 2ZJ5A 2XOKA 4IDOA 4XVUA 3THXB 1XPUA 1E32A 1OXUA 3LAWA 1SQ5A 3K0AB 4V02A 4YXWA 5CM9C 4GRAA 3GLFB 4M4SA 2WJIA 1SXJD 2ZUDA 2ZXUA 1RPZA 1MABA 1W2HA 3I4LA 1KO1A 4LJYA 4NE2A 3SYKA 1G4UR 2J0QA 1X1RA 4MGKR 3U4QB 4EJSC 3I5YA 1Y63A 4PC3A 2QPOA 3ZGXA 1IXRC 4URWR 5EE0A 2R9VA 2CHVA 1KSHA 1ESMA 4IRUB 4B3BA 4BZQA 1KY3A 4KFSA 3TUIC 2ZE5A 4PQRA 4POAA 1G41A 1G9XA 5L8VA 1GAJA 2GVZC 4GP6A 4CYMA 3SYLA 4Q1CA 2ZVQX 2ZRAA 4C0QC 1N6KA 4KFUA 3O8CA 2ORWA 3F5FA 4RCZA 4IDHA 2EFCB 2QM8A 4CEJA 1TL7C 1G3MA 1U94A 2B7CA 3DDCA 1I4DD 5BN5A 6Q21A 3ADKA 1DPFA 2H5EA 4M53A 4RFVA 2Z43A 3QUSA 4KAXA 521PA 1KI7A 2B6HA 3D3QA 3LX8A 1Z0DA 4BRUA 2ZI7A 4FMCF 4TL6A 3AKEA 4M22A 2A9KA 1U81A 3L43A 3UIEA 2O8DB 4UXHA 4C4PA 4M1WA 1FTSA 3GLGB 1FX0B 4BWYA 2FV8A 1XFAA 5HPYB 2VF8A 1W5TA 5F2EA 3T61A 4NDZA 4AG5A 1NF3A 2WWHA 1P2SA 3EC1A 3UWKA 1L2TA 2A2ZA 3HJNA 3QEOA 3SHFA 4DT1B 2W0SA 1R0ZA 1KI6B 2C2HA 4U02A 4HI0E 1KHTA 2XTNA 1OYYA 4NYJR 2ERXA 1UKVY 4P3YA 1YVDA 1E2GA 1Z28A 3Q8XB 2ZVPX 1Z0FA 2ZSFA 1WE2A 2V6IA 1IM2A 1U0JA 4F7WA 5KSYA 1G5PA 3GP8A 1VG9B 2OG2A 2J0UB 2FEMA 1PVOA 4G0NA 4P4UA 4BFXA 1Q12A 1US8B 1Z6AA 4AKIA 4IXNA 2ZRCA 2LWIA 3ZJYA 3AP2A 4CGZA 2O52A 1FNMA 1FZQA 1W0JD 4F38A 2O8EA 3AVOA 2VSFA 5JFGA 2WSSD 2ZJBA 1VECA 1U98A 4QNRA 5K8UA 2WVJA 2ZETA 2FG5A 1NSFA 1QF9A 2IYUA 4Q5IA 4RD2A 3L0PA 1Q20A 3I1FA 2B8WA 4IOMA 3E2IA 3MJRA 2J45A 3EASA 1DEKA 3V9PA 2XJ4A 5HE9A 3QVVA 2XEXA 2A30A 2J59A 1YZQA 3IHLA 1NY6A 4V0NA 1UFQA 2QA5A 2BMJA 5CLQA 5SZJA 2QTVB 1OXTA 5FR1A 4W7SA 4CEHB 4V0LA 1ZD8A 1ZUIA 3QKSA 4D0LB 2RGNC 3BFVA 5FPHA 1NNEA 5JJIA 3DMDA 1VTKA 1BKDR 2WWXA 1P7CA 2WZQA 3DKVA 2RH5A 1VHTA 5AJZA 2AXNA 3RRYA 4LV5B 3KTAA 3H0KA 1UF9A 4XJXA 3TIFA 3NBYC 1OF1A 1M7HA 2HJVA 2BEKA 1CP2A 4C0JA 3QG5A 4B3FX 1DAIA 4F92B 4JLBA 2IWRA 2ZYVX 1JJ7A 2Q0HA 1ZMXA 2Z5FA 3FFBA 3L8ZA 4HDQB 4WBSA 4ILEA 3QKTA 4U00A 3QXXA 2ZR9A 5KYKA 2A5YB 1KK3A 1RW4A 2J0VA 1OLOA 1ZRHA 2YC2C 1FTNA 1ELOA 1U0LA 121PA 2C96A 4JL5A 5IDVA 1P60A 1Q1BA 1W1WA 4NH0A 4KFRA 2XZPA 4FMCB 1O3YA 1S0UA 3K9LA 4US2R 2F43B 3CWQA 3UMRA 5FTMA 1F6BA 4A8JA 2FU5C 2O8CA 5H8WA 2F7SA 2J7KA 1CIPA 2VYFA 2ZUBA 3T1VA 2REOA 3X1XA 4Q02A 1E2MA 2H17A 2VSOA 3EA0A 4MKFA 4MITA 2OCYC 2X8AA 2ZJOA 1A1VA 4Q4AB 3LVRE 4OHVA 3NH6A 4YXWD 4PC7A 2JLZA 2V1UA 2G1JA 1TUIA 5AJXA 1Z63A 3F8TA 4XVRA 4UKDA 4LUCA 3X2SA 3NTUA 1XEXA 1YE8A 1TX4B 1BMFA 3EIHA 1W36D 2CK3A 2GNOA 4UNPA 1XXHB 2Z0MA 4TYWA 1G21E 3RABA 4GOXA 2W6IA 4IVPA 3OEHD 3BERA 3CB4A 3X1WA 2VHUA 2WPDA 1P75A 1E94E 3OIWA 2G3YA 1FFHA 1II8B 3E70C 1ZNYA 2IF0A 2G88A 4MYHA 4DJTA 2ZJYA 4IOLA 1OFUX 2XXAA 4PO8A 1I2DA 3ASZA 2XB4A 2X1VA 821PA 1UM8A 4DSTA 5KUTA 3U7FB 2BCJQ 1ZBDA 1N0VC 2AR7A 1G5RA 3BFKA 5JEEA 1OB2A 3KFXA 1KI3A 4OQNA 1I2MA 3ZVLA 4YC7A 1OFTA 4KI0A 1HE1C 2RGDA 4Q4JB 1YQTA 1M7GA 1ZD9A 3CRRA 5B64A 3H4MA 2HJGA 4JVMA 4RD0A 2X2EA 3WNCA 1AS0A 1UJ2A 3AGPA 3DM5A 3NHBA 2CL7X 4PC2A 5EP1A 1EFTA 1FP7A 1Z0KA 4TZ6A 1E1QA 3QPWA 5CYOA 3LX5A 2ODBA 2REBA 1UEIA 4DCSA 1M1YE 3P27A 4Z1MD 4RZXA 3ZYCA 4YMWA 1Z07A 1MOZA 2FOLA 3A36A 3K70B 2D4HA 2GILA 1G18A 1SZPA 3DPUA 3NBXX 4UNSA 2ZQ5A 3CX7A 1OB5A 4M1SA 4DKXA 2WJHA 2WWFA 2QAGB 4AIIA 4Q03A 1P9WA 2HCBA 3TNFA 4LBZA 2AN9A 2P5SA 4AD8A 4DLTA 1X8JA 3GMTA 2QRNA 3QNUA 3CLVA 4PO1A 3BORA 1JEEA 2C9OA 2G9NA 4HAVA 2PX3A 4X8HA 1HA3A 2WAYA 4C0LA 3ICQB 3QBTA 2WJGA 5B30A 2D2FA 4DVGA 2RCNA 3VNUA 5E7MA 2P6NA 2CNWD 1P6XA 3A4LA 4D4JA 2UVQA 3HPQA 1EX6A 2V8OA 2V1XA 2IYZA 1VG8A 4KCGA 5KSZA 1OIXA 4BFSA 2E1RA 2O0KA 1J7KA 1K8RA 1XPRA 1W36C 4WW0A 4TYYA 3IPXA 2CEAA 3QG1A 1RIFA 3KXKA 1GNPA 1AKYA 2DY1A 1ZVQA 2GVDC 4BFVA 2QM7A 4OI1A 3L82B 621PA 5GJWC 3MUFA 3A1UA 1UADA 3PEWA 4YMVA 2F1RA 2ZJZA 1KO5A 1NIJA 4OJKA 1EFUA 2FGKA 4ZI2A 2WJJA 5FI1B 3EZ7A 2AKYA 1I4TD 3TUJC 2HXYA 4ZDKA 3I62A 1EXMA 2HYIC 2OLJA 2V54A 2WKRA 1CR4A 4G5RA 1OH7A 1KDOA 2Q9AA 3EWAA 4NCNA 3R7WB 2IC5A 4DCNA 1NG9A 2QP3A 4L8GA 3IIMA 2JLYA 3GD7A 1AN0A 4HLDA 4Q1AA 1WA5A 2WMOB 5B57C 4B6EA 4H1VA 3BH6A 2XZLA 2BJWA 1WMSA 2HV8A 1QHHA 2NTYC 3NVAA 3ZVRA 2C5LA 3GJ8A 1KI4A 2G6BA 2NO9A 4ACBA 1B0UA 1GSIA 2YVUA 4M8NE 3QI2A 1XCPA 4ZCLA 3QXJA 1R8QA 4OQLA 5JBQA 1ZU5A 3ADCA 2VHTA 5F9HA 4IKEA 2UZIR 2VTKA 2QTFA 2YC4C 3GJ6A 4NYIR 2MSDB 5KDDA 4QXAA 1Z08A 1IY1A 1M6NA 1OV4A 3W3AA 3NWJA 3GFTA 4PTLA 2NO1A 2PX0A 3HR7A 4IFBA 4URUR 3ZVMA 1NN0A 1G64A 3U3JA 2QPAA 1N6IA 1PV4A 1VCIA 4OQMA 2VQSA 1X3SA 1X1SA 4HUTA 4GP7A 3PUVA 3BJIC 5FPKA 4XD7D 1AM4D 3U44B 3TQCA 5K8IA 4MRPA 1S2MA 5BN3A 1W0KA 2JA1A 3LQQA 2VP6A 3BAFA 4FINA 1KK0A 3GLIE 5KNDA 1ZAKA 3KZ1E 4Q1FA 2ZE8A 1H8HA 4DRZA 1HEIA 2C77A 3U5ZB 1FUKA 2K5UA 3TVDA 4KXFB 3A4NA 2N46A 3I73A 3R8CA 1R0WA 2JJ1A 4CT4B 1RRGA 4OQFA 5AUNB 4CIDA 2ZM5A 1SKYE 4M21A 2RGBA 3NEJA 1U9IA 2WMNB 2W6ID 3ZS9A 4BQSA 1L7VC 1NVUQ 3MWJA 4LJ6A 3J81k 3W8RA 1VIYA 4AWXA 3CF0A 1R7RA 2BV3A 3KQNA 4OL0A 2VSXA 5UKDA 4F93B 1VYTA 1ZINA 2ZYTX 3TR0A 1E9SA 4O2RA 1CXZA 2ZJAA 3AVWA 4K8OA 1YZUA 4AURA 4LGMA 2AK2A 4ZKEA 4R71A 3BBPA 3GEIA 4LHZA 2AKAB 2CCJA 1C1YA 3FKSD 5L3VA 4EFNA 2DR3A 2IW3A 3LLUA 3G0HA 2OSBA 2LCFA 3AGQA 5K8LA 2NPFA 1OSNA 1U99A 4WA7A 4FCVA 2BJVA 2FGJA 4TMZA 5E7IA 2Q3HA 4KV9A 3KQUA 1GG2A 4MGIR 3DL0A 4EKDA 2FDCA 3LW7A 4GZMA 4TTRA 1HV8A 2WWWA 5FR2A 4LOAA 1E1QD 1ZUNB 3IEVA 1SVOA 3UK6A 3I3SR 2V7QA 5JCPA 2GJ8A 3VNVA 2A3RA 4MUBA 2VBCA 1G8GA 3QXHA 3PEYA 2FH5B 2ATVA 4XTRA 3RSOA 1PZNA 4LV8B 2CLSA 2ZAMA 1EWQA 1U90A 5DYGA 1IXZA 2WM9B 5CIWA 1P61B 1ZM2A 1CRQA 2BMEA 2LKCA 4EQ6B 1XD8A 1SXJB 4HB2A 3QEJA 4NPHA 3QF4B 2XZOA 2YOHA 1G7SA 4Q9IA 2F1HA 1DTSA 3GLHA 2CLCX 4RVCA 4FMDF 3LWNA 1Z3IX 4A8JC 4A1FA 1J70A 2NZJA 4RCYA 4RD3A 4W9MC 2O0JA 2JJ2A 3B82A 3QY0A 4ITRC 2ASEA 3MG9A 2EU8A 4FW9A 4Y0AA 4F4IA 5BWMA 3KUCA 2R8RA 1E2EA 2H92A 5C4MA 1SVLA 4GBMA 4HZUA 4OHYA 1SKQA 2XX3A 1EWRA 1P4SA 4MKIA 3GLIB 2BBOA 2HXSA 3N70A 5DH9A 1GDDA 1F2TA 2OLKA 1N2CE 1YRBA 3B60A 3FFAA 4M1YA 4US1R 4QJ4A 1T4GA 2TMKA 2GZDA 3VR2A 1E9BA 1ETUA 2IYWA 3EPJA 4WZBE 4URZR 1XZQA 3I61A 4LRWA 2PZFA 3NKVA 4GL2A 4JSTA 2GXAA 2JLVA 5JEDA 3QVUA 2NOAA 3DZDA 1NIPA 3PR1A 2QE7D 1N5JA 4P4TA 2OBLA 4MYUA 4EAQA 3VFDA 3TKLA 8OHMA 1GNQA 3H84A 2ZREA 4A82A 1SVIA 2R6GA 5IK2A 2ZIAA 4KODA 4GDFA 2VRWA 2I1VB 2QENA 4F4CA 4D81A 1JBKA 4KBFA 5L3SA 1DG1G 4C7OB 2Z83A 1EG7A 3T5DA 3THYA 4JT4A 2V3CC 4D4MA 1JALA 1W7AA 4LZZA 5IT5A 1DE0A 1RZ3A 3KL4A 2P0EA 3A58B 2FZLA 2ANCA 3AVPA 4HAUA 3SHWA 1II0A 3ZZTA 1LF5A 3B1WA 2VF7A 2ZRNA 2D3WA 5FTJA 3BS4A 3VKWA 2FJUA 1M74A 3LV8A 1OE0A 4D2IA 2D06A 3A4MA 3ZZ0A 5D3MB 5A4JA 3K0FB 2IL1A 1XU4A 2R65A 1CRPA 2JJ8A 4B47A 2HT6A 4JJZA 4PQYA 3V4FA 2XTMA 3B13B 1SULA 2JDIA 2OILA 4NYMQ 3VR6A 1KI2A 3BB4A 1IJFA 1HE8B 5TY0A 1WBBA 4JYCA 2PCJA 2VHQA 4JBXA 3K9NA 1VMAA 4KHZA 4CF7A 4NBSA 5JZVA 4XWAA 2OO7A 1R5NA 1XD2B 4CT5A 3PUWA 1DO2A 4LHXA 2FFBA 5C46F 3THXA 4JLMA 1E99A 1JPJA 3K0AA 4A0RA 4YMUA 3GLFA 4HB3A 4TQ9A 1W0KD 1Z29A 3F0TA 3B1ZA 1Q21A 2AL7A 4O25A 5K8TA 3QXSA 3EG5A 4MGYR 4O2LA 1HQCA 3U4QA 3AF1A 2C9CA 1WXQA 4IHQA 1S4QA 1T3LA 1JB1A 4JLKA 1RRFA 1PUJA 2JJ1D 2WV9A 4JIMA 4RY2A 1P2UA 2YWFA 2ZRDA 4CVNA 4LV6A 3KB1A 3ND8A 2ZYUX 3FOZA 421PA 1KNXA 5EXTA 4IEEA 4Z8YA 5HR5A 1YJ5A 4G5GA 1CULC 4F4JA 3JZAA 5KO2A 4NHOA 2IEYA 2ZJ2A 2CL0X 2PBRA 3C15C 3RS3A 4A15A 2YKGA 2F6RA 5FBRB 3TLXA 5AJWA 2FWRA 1Q57A 5BYJA 1BH2A 2A5FA 2PEZA 3CIOA 5CK4A 3CRQA 3RWOA 4JLDA 4A0HA 3CO5A 1P62B 2ZSDA 4FXPA 3N2EA 3U6KA 4TQUS 1HH4A 2N42A 3W90A 4XWOA 1SVSA 4M1KA 1IOZA 1KZ7B 5HTKA 1E3MA 3O8BA 1MR3F 1FMLA 3WBKA 1F48A 4KJZA 1FUUA 3TSOA 1GKYA 3KXIA 1E0KA 2OCAA 2QSZA 2H8KA 2ZI4A 4PHTA 1JQLB 2O8DA 1QRAA 4AI6A 1AS3A 2HYDA 4B75A 2IHYA 2OXRA 4PSAA 3A37A 1FX0A 4B71A 2YINC 4DIEA 3GLGA 3MRSA 1R0XA 3MAAC 1FPMA 5M04A 3FMOB 3G82C 5EE5B 4Q18A 4JKYA 4JLPA 2JGNA 1JR3A 1Z06A 4DT1A 3FMIA 2PMDA 4PO9A 1U8AA 4BFWA 1KI6A 3WXMA 4BFZA 2W2VA 1CTQA 2HLDA 1BO6A 4FCTA 1RRPA 1S3GA 2C95A 3THOA 2XNSA 4B3DA 2A5JA 1NJGA 4TL9A 2P65A 5HKKA 1JAHA 3C41J 1TEVA 3CWZA 2ZS9A 1TEXA 1TF5A 3VR4A 1N3BA 2VO1A 5DO9A 4A4DA 3Q72A 5FOUA 2VP0A 4K81B 2EW1A 2J0UA 2J7PD 3M1IA 1UKYA 1U8ZA 2IYTA 5CDFA 2NMVA 1QZXA 5AWFC 2ZE7A 3KKMA 1US8A 2A78A 3M6AA 1XJ0A 2FPKA 5LD2C 2QP9X 2UZ3A 5BN4A 1R10A 1GFIA 3RHFA 1XF9A 2JJ2D 3QQ5A 2ANBA 4ASUA 4DWJA 2WHXA 3VR3A 3AV0B 4HAWA 2C8VA 3CRW1 3D7MA 3EZFA 3NHAA 1TU3A 3GQBA 2XTZA 4TYPA 1VG0B 4WIAA 4HAZA 3S1AB 4KSBA 1DAEA 4ESVA 2J1LA 4DLXA 1U9IC 5JCZA 3T1TA 3KJGA 4HLCA 2VHJA 3IPYA 2BKUA 3TH5A 4BE7B 4LWZA 1D2MA 5F98A 4PAOA 1J99A 3U61B 2FFHA 4MYCA 5FH9A 2WWGA 4QOSA 4UXJA 1QHGA 3OF5A 4E5UA 5FOTA 2KSQA 3IO5A 3PUZA 2ONKA 3LBHA 4JVNA 3QF7A 4QBGB 2F55A 1KNQA 4CEHA 5GJBA 3OE7A 1A82A 4R2HA 5BYKA 2IX3A 3N2IA 5C1BA 2J41A 3KUDA 3FYHA 4KLZA 1RRCA 1Q3TA 1TNDA 1K5DA 3ZLJA 3FKQA 3REFA 3OIUA 3P1JA 4AYTA 4JL6A 1XTIA 1P3JA 4Q7JB 5JS7A 3UPUA 2EYUA 3WHLA 2P67A 4TQAA 3IHWA 5FOXA 1CEEA 1GL6A 5FTLA 3LDAA 4NYJQ 2CCKA 3SDZA 4PXAA 4LHWA 3AKYA 3VKGA 3RS5A 2BMDA 4CDGA 4TT3A 4TLBA 1KK2A 1NBMA 4X8MA 4D0NA 5LB4A 4KVAA 3W9YA 3H86A 1X86B 2WAXA 1Q3HA 3LFUA 3O8DA 3PV0A 5FTKA 4PPQA 1OKKA 4L16A 4I4LA 1DVRA 2JDID 4NCJA 4OK3A 5G3YA 5KNBA 2F43A 2BIFA 1GILA 4AYWA 4NTZA 1M2OB 2VP2A 4WXPA 4KSCA 1E2PA 3NBFA 4LJ8A 5DE3A 5CJ2A 2FEOA 3ETLA 1IY0A 1FL9A 1UPTA 4G01B 4I1SA 3ADBA 3D6TB 4QHSA 1YKSA 3H1TA 4W5JA 2OAP1 2AD5A 1EESA 5FL7A 2IK8A 4PQFA 2NGRA 4HB0A 4TL7A 4AC9A 1S1MA 2F3RA 3LXXA 4TN1A 1G8PA 4Q4AA 4D4KA 4PAQA 3IGFA 1E79D 1ZNXA 3JVVA 3RDPA 2F9LA 1Z6GA 3LVQE 2QRZA 4B48A 4PPFA 1QG2A 2QORA 5EXPA 1GKUB 2J3EA 3U3MA 3KQLA 1GUAA 1Q0UA 1XXHA 1JR6A 1NLZA 4MKHA 1Z6XA 3NBZC 1ZNZA 2L0XA 3FB4A 4MQBA 4CW7A 4XOIA 1P5ZB 1S9DA 3TAUA 1G17A 1S1CA 5JI2E 3A1TA 4E22A 4PZYA 1II8A 4NL4H 1KDRA 2QGNA 2XOKD 4IDNA 1EK0A 1R5BA 4C9BA 2FE4A 1XP8A 2WKQA 2VIIA 1MO3A 3MGCA 3GEEA 3EAQA 3HYRA 4KU4A 2RGGA 4U5XA 3RSLA 1Z5ZA 3C5CA 3X1ZA 4MRSA 2GKSA 5KNCA 1P73A 1WDTA 3BB3A 3TMKA 5DI3B 3BC1A 4DIDA 4R2IA 3VU9B 1LNZA 5G3ZA 1MV5A 2FFAA 1OPXA 1NJFA 3WYFA 1OIWA 1RVDA 4Q4JA 5FPYA 3LNCA 4PC1A 1BOFA 2Z4SA 2O8FB 2QTHA 1LS1A 2FNAA 3B1XA 4PPGA 3B9PA 2QMUA 1NRJB 5JMTA 2DFLA 4G3XA 4GPTA 2GK6A 5SZHB 3V4RA 3BD9A 3CR8A 1KOFA 4RZUA 1KKLA 1YR7A 2RB4A 3CKLA 4I81A 3KKQA 1XTRA 2AFIE 4M0LA 1G16A 3SR0A 5EE3A 1GM5A 3BOSA 2O5VA 1ONBA 3C8UA 3BK7A 4NZYA 4OI0A 2V9PA 4Q9HA 1IXSB 5CJPA 4NONA 4AKEA 2QAGA 1BYUA 1XRJA 2WWIA 2A5GA 1JR3D 4QGFA 4KYIB 1TTTA 1N6LA 1Q22A 1ZU4A 4C0AC 3A1VA 3D8BA 4NCKA 5E95A 1G8YA 3EXAA 5HKKD 1FW6A 2FA9A 5J4KA 3PIRA 1YZGA 3IQWA 5H70A 3AVVA 1SGWA 4P0TA 2G77B 5LB2A 2QGZA 4IVRA 5AUOB 2JLXA 4DB2A 2ATXA 2CJWB 2GA8A 4TYQA 1XB2A 4TLDA 3GJ4A 3QPVA 1QHSA 1E1RA 4A2PA 1LTQA 1ZNWA 4JT2A 3LH5A 3UWOA 3R9WA 3TW4A 3KJHA 4JSYA 1CBUA 5HCNA 1W47A 1UBCA 1COWA 1CJKC 1YRAA 4PZZA 5C4GB 1W48A 4TSFA 4CRWB 4DLZA 4Q47A 2GCNA 2ZJ8A 2Q9BA 5AJYA 3BIFA 2O8BB 2VEDA 4XTCS 2KJQA
chains in the Genus database with same CATH superfamily
4D80A 4ID3A 3WJ7A 4JJ4A 4IR7A 4I6GA 4EB0A 3R8FA 4JL8A 2G08A 1TVKA 2CLDX 2VJOA 4D0RA 2H2FA 1JEDA 1SHZA 4FSDA 5EXXA 1P7ZA 4AXXA 3AHJA 3MJHA 3Q7RA 2R87A 1Z5PA 5FPTA 1Z0JA 2OXCA 4JHXA 2XWJI 1YQEA 1ZCBA 1UQTA 1GKIA 1GXSA 4HEJA 4R3NA 4ZQHA 3SY8A 1YOVB 5LP1A 2UV8A 5HKLA 5L4LA 2ZI9A 2PHZA 4YWJA 3HYTA 3RU7A 5CBPB 1RACA 2DE0X 4RIEA 3B5JA 2IWHA 1ZK0A 3EW9A 5J63A 3VX3A 3OBBA 2A84A 2WB4A 3IUQA 3UMCA 3PFBA 2JEYA 1AQYA 2W42A 5AK6A 4RJLA 1U7WA 2LRHA 2WWTA 1U3WA 4L9WA 4IWNA 4MPJA 4DY4A 4F4HA 4QT4A 3QUTA 2NUBA 1OH5A 5AI0A 2VJMA 4GPZA 2D1QA 2BHRA 1GNRA 1IOLA 2D2XA 3C4JA 4YJFA 4OMUA 1G6OA 1KAOA 4D99A 4OX9B 4Q9KA 4WESA 3TM5A 1IN8A 4MUJA 3EK2A 1I9CA 1ZN7A 4JWTA 1U7ZA 4HSEA 3CNNA 4LDJA 1IZ0A 1PW5A 4M7WA 5DX8A 2XCIA 5F1YA 2R00A 3EZ6A 4REQB 4B6PA 3WTCA 2P68A 2QUKA 4DR5B 4M9XA 2VWHA 1EP1B 2C5GA 4YHBA 4BVLA 4HN4B 1BKSB 1SM4A 2ZVDA 3HB0A 1NBMD 1ABFA 2BKLA 5U4QA 4BQFA 3I92A 3PFHA 4MR8A 4AMYA 1W29A 1WPGA 2WSIA 1E96A 4DQLA 3MERA 3GCXA 4YRTA 5FI0B 1N5DA 5I9BA 2RDMA 4LYEA 3LPAA 1V1MB 2NQTA 3CLHA 2ZYHA 1KJWA 3IKVA 3W7VA 1ZVMA 1ZC3A 2Q8QA 3SBDA 2KI5A 1SU6A 4R1QA 1YB1A 3R3XA 5HILA 1AHPA 1EP3B 2VCHA 3V4PB 4KDFA 4IIEA 2Z8XA 3FVWA 3LUDA 3M4XA 1JSXA 1FVOA 5IF9A 2P9GA 5DDIP 3VU3A 3P9XA 1KAHA 1RHKA 4NJEA 1M1YB 4L1KA 5LQNA 1OQAA 4Y67A 1MT0A 4MYSA 2AI3A 4IQ4A 4Y30A 2HT1A 4NARA 4Y2RA 1WCWA 4EMSA 3HYSA 5JDIC 3FYTA 1SWWA 4JX8A 3T7DA 5AKXA 5KIAA 2HEGA 2QVZX 1C7IA 4DR6B 1VJCA 1N4AA 3A04A 2XYHA 3ONDA 2XKAA 3O6VA 1ULHA 1Z8FA 5DLQC 3ORQA 4FFMA 2IUTA 2X6QA 2YXNA 4CETA 2A9JA 4ZMRA 1ZM7A 2AE1A 2W8ZA 1XMOB 4YLGA 1JN0A 1J5PA 2Q27A 4AMGA 3PITA 1V43A 2IYPA 1ADCA 4EJSB 1QOZA 4UTOA 3FNIA 4FDVA 2WNIA 2AFRA 1U4OA 1MH1A 4QPJC 4OYRA 3GRCA 2Q07A 1EGHA 1RQNA 2BFNA 2VT6A 3CZMA 4MHSA 4UMFA 2FP4B 1E69A 4UMVA 3LT2A 3EH2A 1V16A 1BX1A 5DCWA 3FX2A 3GH3A 1MJNA 4I1OA 4Y2SA 1DIBA 4CF6A 3A6GA 3DXXA 3IVMA 3DDSA 1BYIA 4XYBA 1BMFD 2YVQA 1DAGA 2CK3D 3GJ3A 4HB4A 3HHEA 4X7BA 3RIEA 1Y34E 2HK6A 4C4OA 5GAJA 2BFFA 1UMBA 4PO3X 3DJFA 2WOOA 5HHTA 3VSEA 3K96A 3LBIA 2P0AA 2RMKA 3MTEA 3QU5A 2QZ4A 3EGCA 2P1ZA 3GUZA 1A2BA 4BFYA 4Q24A 3IMKA 3TTSA 3ETDA 3OFSA 1C4OA 3K9QO 1S8FA 2ISSD 2Z4RA 3NCTA 5DYYA 3CPEA 1FQOA 2CHUA 2QX4A 1DEOA 3GLRA 1O97C 4D79A 3K70D 1FTQA 4S1TA 5AW8A 1UPXA 8ADHA 4EPWA 4S35A 3QUCA 4IX9A 4K9MA 5LMNB 3ZDXB 1T1JA 2ZI6A 1PDOA 2FHPA 5I9SA 3ZBUA 1ZOOA 2X3UA 2X7JA 3AEUB 4EA9A 2PXCA 1P2GA 3VZPA 2GCGA 2RHTA 3MHPA 4BMPB 1BXGA 3IQEA 1WG8A 2B4QA 1GFWA 3L8YA 3RLFA 2CXNA 1OROA 3KJEA 3LY5A 1ULZA 4RPLA 2G09A 3K16A 3PE3A 1AX9A 1NURA 1DBWA 3MELA 2PKXA 5JJ5A 4C76A 2O2EA 5ELXA 4M1MA 1R0SA 4U3JB 1EFRA 1WD7A 4IIJF 2XZTA 2H7VA 5AM2A 3M6XA 3F8SA 2I7XA 3I2KA 4LKOA 5AI8A 2MSKA 2W98A 4H7IA 4F96A 5KTYA 4LK2A 1WXFA 3LQ2A 5KYXA 5ICFA 1VGQA 4ID9A 4DS3A 3G88A 2Q2WA 2R1VB 4BVAA 3GLIA 1UQRA 4O1IA 5LZ5A 1CS0B 16PKA 2P35A 2QYSA 4G5HA 2GEVA 3MWLA 4M1EA 5CLIA 5FKJA 4CKZA 1U1DA 3C3BA 3TVTA 3FTFA 1KMHB 4CQMA 3W8DA 1N6OA 3SX2A 4PBTA 1R4NA 3PDHA 2E87A 2FEPA 1LH0A 3OX2A 4PSVA 4QEZA 2FSHA 2W2NA 4WZ6A 5H02A 3SEFA 2HSGA 2ZITA 3PEUA 2GI4A 4L08A 3V7UA 1J1UA 4QBTA 2W8BB 4MZDA 2FW9A 5BV7A 3ND6A 5JXJA 4JBHA 2HRBA 4BLQA 4CLOA 5HZKA 3THWB 2FSIA 3HU3A 1A9XB 2OFXA 3FPJA 3G7SA 3ZY6A 3T5AA 1A77A 2A57A 5BWBA 1N3YA 1T0IA 3KHKA 1NPYA 2ETXA 1FJHA 2OHGA 1BE6A 4NOKA 4YONB 3UNXA 3H2KA 4I1UA 5ES4B 1XMSA 4JDUA 2X19A 2FF7A 4IJVA 3T3OA 1X1QA 2PZGA 3UAYA 2J0SA 3QX8A 2OY0A 3LWBA 1KYXA 4E2YA 3PRKE 3Q7SA 1GQRA 3A26A 4QAJA 3PQ2A 3ZH9B 3M3PA 5BW8A 4C7OA 1GEEA 3QW2A 2MHCA 3GEPA 3OZIA 4J4TA 3V7WA 3HMKA 3LTNC 4II2A 5T8KA 1QLHA 2V4ZA 4AWBA 4L15A 5JXGA 3HUUA 4JBYA 1BX0A 3CEHA 1CD5A 4EI8A 4G1BA 2ZULA 4C0BA 1VOTA 3IUJA 2I1LA 5KPJA 1AK2A 3ZE8A 2TSYB 6NULA 1PVDA 2PG3A 4ZHSA 4CZ2A 4KRFA 4AKHA 2ZROA 4RVOA 4ND1A 5IHPA 4KW7A 4YACA 3TLKA 2X8WA 3KSUA 4GX5A 2ZRPA 3RTGA 4AN1A 1XJQA 4WECA 4K46A 4OUDB 2I4IA 1USUA 5JISA 1XQYA 2DH6A 4D5GA 4MDEA 2AIRA 1PL0A 2C2OA 3LUAA 1KJYA 1PZHA 4WNAB 2MMCA 2PA3A 4MV9A 3GG2A 5LYJB 3F90A 1Y9ZA 4RA9B 1LVUA 3HHPA 2NO4A 2HDWA 3NNNA 2ISQA 4LXHA 2OZEA 1SKUA 4LA4A 2ZU6A 5IVDA 2P1DA 3Q0EA 4TYMA 3NP9A 1NLFA 4YMSA 2D7JA 2I99A 2PGXA 1JKIA 1J1IA 3GBPA 4BLUA 2BR4A 4IIJA 3T9AA 1E3LA 2ZSJA 4M3NA 3RROA 4E03A 4YJ3A 1XTZA 3F96A 2O19A 2RHRA 3F47A 1OT5A 2NXCA 4B46A 2PZ8A 2QT0A 1OH8A 3ZQ6A 1XAHA 1E1NA 1UPFA 3P9CA 4GECA 2D2EA 3QJYA 4NKRA 4NMMA 4QATA 5E2BA 2RHOA 4WWHA 4ZTZB 1QV9A 2BDUA 4QFMA 5E4YA 5BNIA 2C03A 3ENWA 4YV1A 1T1EA 3NLLA 5KWIA 4AQDA 2C1XA 4EBBA 2CY0A 3CNLA 5AM3A 1Z2CA 3VR1A 1T91A 1JJIA 4L85A 3IV9A 1NJ8A 4DQVA 5AVVA 3DBHB 3K9GA 4UUQA 3R6LA 1ZI6A 3IH5A 2H0RA 4TV8F 3RS2A 1XRQA 3DEHA 3G2NA 4RZQA 3P9QA 2PS1A 3K9FC 3PXDA 1E7MA 1IN7A 4CM3A 1OGYA 3FLEA 5SYNA 2QZ9A 3ZU5A 5HM8A 5TEWA 5K45A 2A8YA 1RJEA 4QASA 5AW1A 3I2YX 5FP0A 2I71A 3DKRA 4GKJB 3OJ0A 1NE7A 4L4UA 2BZ0A 5CA0F 3ONWA 1F8FA 2CGEA 5BW4A 4J1TC 4EPVA 3LTEA 1R3UA 3PYMA 5KAPA 3FHCB 3C16C 3BRWD 2XD9A 1TYBE 2A6PA 1BVHA 2XI4A 5B4TA 1H8HD 1KGDA 4YP6A 4UVHA 1SU4A 3GDOA 4EUEA 4UU8A 2ZI5A 4J6FA 5EMMA 1XDBA 2QT1A 1L1EA 5AO9A 3PNQA 4JYAB 2WZBA 2IXFA 4QQRA 5C8ZA 1EBUA 2AYZA 5EIEA 2OAGA 4AJNA 2NLOA 1RBZA 2R97A 4Q3NA 1DT5A 4B34A 3BFXA 4MJ3A 4NU0A 2JGFA 4PXYA 4XIGS 3VISA 3ZVNA 2AF4C 2GN9A 3T8YA 2AXQA 4GI2A 2KBFA 4TZ0A 3KETA 3OF2A 4ZK6A 3F9IA 2WRZA 4OQPA 4MR7B 4XUDA 2RHGB 2ZJ4A 1I7SB 2C7QA 1PT7A 3CM0A 1P0IA 1SOMA 2GJ9A 3BWMA 2AZDA 3E0XA 4JB2A 4ZWNA 4JZYA 3OKAA 3ADDA 3HP1A 3B51X 3D6VA 3JQ8B 2R4QA 4JLJA 5HK9A 2IP2A 1B6SA 4Z49A 4LJ5A 1SK8A 5L40A 1YHNA 3GLSA 1YDHA 1AJEA 3JASA 3RU3A 1JU4A 3JWGA 5FOVA 2VJQA 4ZVLA 5FFMA 9LDBA 1FUEA 3KZVA 3CBQA 4PSCA 1VSTA 3DVAB 3QQPA 4G8DA 4DPLA 3CF6R 3C3KA 3PGJA 4PLWA 2QY6A 2QZJA 2MINB 3EDQA 1VP3A 2VSQA 3LM8A 3ZQUA 4BMXA 2HKIA 3H8WA 1GSHA 1NL3A 2YXDA 3QV1A 3ZHYA 3NDBB 2VDNB 1IB6A 5JO9A 4YDHB 3VO2A 2YH2A 2YJTD 1DEXA 5DZSA 4BC0A 1VPLA 3R20A 3T9CA 3Q7EA 5AVWA 3B5EA 4S1VA 4OBEA 5AM1A 5TJHA 2Q0XA 4H17A 1D2GA 1GEGA 4JB3A 4EYSA 3K0SA 2QNBA 5D86A 3U09A 5EJ7A 2Q2QA 3KWJA 4BFTA 4C6HA 3GRPA 4CODB 2P9ZA 4PLTA 5BPHA 3FWKA 4LTDA 4E70A 1GVNB 2HA5A 2B9VA 2BI4A 1TPYA 1JDBB 1KTVA 1TYCA 1XWWA 2ZTHA 4GI1A 4FDUA 4M1TA 4Y9TA 3SXJA 1Y1RA 2IW1A 1GA1A 1MEOA 4INJA 3S2ZA 1L8AA 4C2TA 4TV8A 4NSNA 1TJNA 1ZYUA 3G13A 5AP9A 1II9A 3EVGA 1EIZA 1WZIA 2RGYA 3E9MA 4DM7A 3S1AA 5CB6A 1U0BB 2JFGA 3WK8A 4KYUA 1M8PA 3HRKA 4IZOA 1D8TA 5KKNB 3PFNA 4LJ4A 4BEWA 1C4XA 4CM7A 4XGIA 1L5GB 1Z83A 2KQUA 2X58A 2BGKA 1FX1A 5CA0A 2GCIA 2J6CA 4FI3F 3TRFA 3CU5A 7MDHA 2PWPA 1F7VA 3CSSA 1B26A 4YVFA 3W9SA 3STXA 4B3JA 3PJRA 1DBSA 1ULAA 5FUWA 2UUOA 4R2LA 3WL7A 3QE9Y 2OQ2A 4L4YA 1NFQA 2PGIA 4PHFA 1UDAA 3U7IA 2J85A 3LFTA 1NUUA 4I9GA 4AKSA 5KVSA 3CVVA 4U2KA 4EJ2A 2XVMA 1WHSA 5ULLA 1WUTA 3QEAZ 1TUEA 1XHEA 1IN4A 3KJFA 1M33A 3O4RA 4AMUA 1ACMA 4I3FA 4KITB 5AK3A 5C7YA 2REXB 5C2JB 3A2KA 1UJCA 5C52B 3I5XA 4JIGA 3BFPA 3AWIA 1ISFA 2FPRA 3OIYA 3NANA 2GS9A 2JD0A 3MMNA 2AOVA 4RPGA 1NVMB 1YU6A 3E3NA 4MKGA 5DW0A 4YUZA 3ZCPA 1NBME 4DC9A 3EGWA 5DT2A 2GK4A 1PZMA 1PT9A 2NP7A 4CEJB 1NW9B 1T9HA 2DECA 1H8EA 2VDJA 4O4HB 5BN5B 2ZBQA 4QUJA 5F35A 1ISRA 4GGMX 4QQKA 1QHNA 1J2JA 1ND5A 1HDIA 2C61A 2LKDA 4TT8A 1T0JB 1IHYA 4M6WB 4I50F 2ARKA 3AEZA 3B1YA 2AEJA 2G8NA 1B8OA 1DX4A 1RQXA 4TKUB 3RJZA 3RQSA 4OTZA 1A2QA 1P1JA 3RYFB 3UJDA 3EVTA 4ND2A 1E3TA 2WUFA 3F49S 1U1GA 3DCNA 1Q2XA 3A9UA 2ZYAA 3P0JA 3KEGA 2XVZA 1JHPA 3CPSA 4PR0A 4C88A 1EVEA 3EG9A 4CXMA 3HKEA 4N5HX 4QGAA 2WT8A 1AZWA 3ZN2A 1GCAA 3DO5A 4NAHA 4JVOA 3RRNA 5HUQA 3PHJA 4Q15A 1QIGA 1TC2A 5IDWA 4XPZA 2SECE 3T3GA 2CC2A 3JAKA 1ZVVA 1P39A 3VYVA 1XXHE 4DCMA 2Q29A 2CBGA 3ZW8A 2RK3A 3OLWA 4HY3A 4WK0B 3GNTA 1GUDA 3VNBA 3GBSA 4F3KA 4RTPA 1X80A 3RJTA 4IOKA 3DB1A 2C2BA 4M0MA 2Y8EA 1K6MA 5J4VA 3G2IA 5DCUA 2WTNA 5THQA 4A8TA 1DDOA 2D5CA 4TVOA 3MPOA 1SWVA 1LV7A 1V11B 2X13A 3EXG1 1CYEA 4MIOA 5JNRA 5LOVF 1BFKA 3UENA 1P2TA 3WWEA 5JCXA 1RSZA 3IQHX 4OH7A 1E9EA 4MVJE 3WO0A 4B3GA 5JATA 1FYWA 4DSNA 3RANA 4DSZA 5M5BA 5KU7A 2WHPA 2GVNA 3TMAA 1SOVA 4OMCA 1GQOA 4BJHB 1A4UA 1Q16A 3LNTA 1WW3A 5EZ6B 1FQJA 1KMQA 4BVFA 1B00A 2I4NA 2Z1MA 3HY6A 2V03A 5LN1A 2ZIWB 2GM4A 1YR1A 3N8IA 1JJBA 1FA9A 1YQ9A 2B3TA 4OP3A 2QRMA 2HNKA 2J8ZA 1QGYA 3LDUA 4QYSA 4WKGA 4ETIA 5A9TA 4X1YA 1FQKA 4H1UA 1OZ0A 2YVKA 3IJPA 4LHVA 4P5EA 3AY7A 2MSEB 5HF6A 2J6HA 3W8EA 1YDWA 4EEZA 4G5OA 1SNYA 2IHBA 2Z57A 3AF2A 1XDSA 2Y9PB 2OQRA 5ALEA 2VZ9A 4G0YA 3M81A 4Z99A 5LQRA 4HDNB 1R9NA 2B37A 1YZ3A 1IHDA 3GVIA 2JGEA 3NAZA 5ALXA 3ICOA 4UVIA 3CUVA 1AQ6A 1EK6A 1BC5A 1HFJA 2R48A 4UEJA 5DK6A 4BFWA 4DQUA 5GZ6A 1I3MA 2G80A 5DGDA 5G53C 5F5XA 1O89A 1QGZA 3QVGA 2YMPA 1ZD1A 4DR3B 1WBDA 2A9OA 1WQ1R 4RK1A 2LGJA 1SY7A 5E8RA 1ONSA 3WWYA 1QMGA 2OV2A 4JVSB 4Y6LA 4Z4EA 2EWMA 5J2TB 1L4HA 1KSFX 1NV8A 3HJCA 5AVJA 4B3CA 5C31A 3S6JA 1YIAA 1Y8RB 3B3FA 4I50A 4IL5A 4EAQA 1E6CA 3OBIA 5GJVC 1KJIA 1JLLB 2BEVA 2ZIXA 1PU2A 1OFGA 4R9UC 5G1PA 3CPHA 1FNBA 3CRNA 4Q21A 3DO6A 1NN5A 2QX7A 5E1MA 1YS2X 5C7OO 2HHLA 3RVJA 3IEUA 4GX0A 4JGBA 1IVSA 1LFDB 1E59A 4RV9A 3SYTA 3QGMA 1E77A 5I9NA 1DJNA 5EGSA 4P58A 4XCQA 1TF2A 2FPWA 4PX9A 5CK5A 3PDIB 1AGPA 2SHKA 3RSZA 3RWMB 4PG6A 1Z0IA 3LGSA 5TDHA 3FFXA 1CDZA 4WVLA 1K9SA 1JE0A 2V3WA 1KU0A 1ZOLA 2VJYA 4QQ8A 5EJFA 3WLTA 2WIDA 1I51A 2YJZA 4M86A 4YQYA 5K3AA 3ZDYB 3N0TA 4YJDA 3WLKX 2XB9A 3DLHA 1XQXA 5KYGA 2CB9A 1ZIPA 4YRPA 5ITZB 5ABPA 5NLLA 1ABBA 4GIBA 5LOVA 1RXWA 5JAOA 1Q0RA 4PLCA 5EQDA 1EQUA 3SDSA 5GINE 4KFCA 4H3HB 1WXWA 1PQUA 3F4BA 3H5IA 4CF5A 2YJ6A 5B2EA 2VT3A 5AOAA 1RWOA 3V6LA 3D2LA 1RNLA 1WEHA 1KR2A 2X7HA 1W93A 3P9PA 2VH5R 1PZXA 4WZAE 4FR5A 1RRVA 5JS8A 4FSHA 1XWIA 3RARA 4L57A 3VR4D 5AVTA 3L84A 1ODFA 4TKZA 1NNLA 1ZH6A 4HGZA 4I14A 4ZRNA 4FB5A 3VHLB 2UZ1B 1Y3AA 3PQ5A 1OLXB 1XEXB 4AS3A 2X42A 5BQXA 3FKSA 4MICA 4PGHA 1U6JA 1MDFA 3WMRA 4BRWA 3DTTA 2DPHA 1FXSA 1YOVA 3IAFA 1DWOA 4U9HS 1S9HA 1NVBA 1NP6A 4DLRA 2B1JA 1INLA 3TI7A 1UFRA 1PSZA 1BRTA 1FVXA 2FMFA 4NV1A 1DAKA 1RYZA 1E6LA 3V48A 5CBPA 5HS6A 3V1MA 4OI4A 5K8VA 1RFLA 5BSHA 1F6DA 1G0NA 4BVJA 4WT7A 2JLSA 5HS4A 3K4HA 4E11A 2AXPA 2QF7A 2JIZA 4K1LA 4X6YA 5F9FA 1P9NA 3GUUA 3MUEA 1FS6A 1TZJA 3PI7A 3QE3A 4YAOA 1XJCA 5TQ2B 1OBOA 1EHCA 1T4BA 1F9EA 2AD1A 4MS4B 3D9QX 4BLTA 1Q1QA 2IYOA 2G04A 4K2AA 1O87A 4RVUA 3RFCA 3AEKB 5KJEA 4XI9A 4N1AA 5EIXA 2DB3A 3NYWA 2GN2A 1LQTA 3ZX5A 1BQ3A 4CHTA 4MJLA 4G4JA 4G6ZA 3UHJA 2JJYA 4REQA 1WVMA 2A7QA 1R2QA 4KXQA 2R8ZA 1J09A 1K5GA 2ZR0A 4W5HA 1FRNA 4GHWA 2FMIA 2M1ZA 4JKIA 1CK4A 1RD4A 4C0KA 3WE7A 3HWX1 2FVYA 3GJYA 3I2FA 4OB7A 1NKVA 1NGSA 3C14C 3VPBA 1F0KA 4R16A 1QO0A 1X1EA 3WJ1A 1YL6A 1GTMA 3ER8A 4Y9SA 3OE7D 4I46A 5EAIA 2R0QC 2WIBA 1H2FA 2XA1A 3MTDA 3FOEC 3F2IA 4FDTA 2AOWA 1EPUA 1F5SA 1ZESA 3DE6X 3KBOA 4IV0A 1V1MA 4IFIA 1PFGA 4AULA 2FSFA 3AVUA 1VSBA 1XAIA 2CXOA 1XL1A 1XVVA 5DXFA 1USVA 3IBCA 3F9CA 4MX8A 1KJQA 3N8KA 2DUWA 2NSLA 2PX2A 1LDNA 2ZGVA 3A1SA 3EQ8A 4QDJA 4F3TA 3Q87B 3Q7TA 5EJIA 2ZPUA 1R0LA 5FD8A 1M1YA 4LRTB 2GZAA 4CF3A 1O97D 1ONPA 1QQ7A 3SZGA 3TZCA 4DDWA 3MLEA 3WWOA 2EEPA 2EJTA 1K3UB 2XT9A 3QU7A 1U04A 2ZB7A 2FN4A 3P52A 1K4MA 1AKVA 2FX3A 1JLSA 2JCBA 4BUCA 1KEKA 4A8HA 2AFHE 3D0QA 2V6MA 2ZE6A 3X1ZA 3ILXA 2QAJA 4HAXA 1BN7A 4OQDA 3ZWXA 1ODCA 3NFYA 4Q7KA 1T2CA 3VR4H 4RLHA 3ZWWA 4D74A 4ALLA 1J8MF 1SQ6A 4MA0A 3ZWCA 1FS5A 3HB9A 2Z6AA 2AQIA 5FF9A 3KOUA 4EJSA 4JI7B 2FTKE 5GZ3A 4B6OA 3GNQA 3PKIA 4P93A 2XR1A 3V1LA 5IM4F 2WIJA 4TVBA 4N3NA 1ATIA 3ULKA 4B8ZA 2H48A 1SIBE 1AKEA 3M5DA 3FTNA 4EY5A 2FP4A 2GBIA 3EQ2A 4OQYA 5EXDA 1H2XA 1K2WA 2G7ZA 4IGIA 2ATIA 1H2HA 3GH1A 4WNIA 4Y18A 1CJVC 1CY8A 1K75A 2CZCA 3JV7A 2DSTA 1N92A 3PUHA 2JD2A 2INGX 2QM0A 3UK0A 2EGHA 4R1NA 3M6FA 5K6RA 1ZNQO 1OFUA 1YXMA 4M7RA 4MGEA 4LJKA 3W6NA 1HOXA 1KVUA 1B0AA 1OWNA 1XTTA 2G72A 2FETA 2GPNA 2PYZA 3ISJA 4AP9A 1QRSA 1YR6A 3IO3A 4H18A 4QM6A 1PGJA 2CXXA 1LLUA 2VYVD 3MMPA 4GBED 4OHFA 3DZFA 1ZOIA 3QMPA 4KC0A 4C7JA 2I22A 4Y1EA 1V3VA 3I1YA 4ER3A 2C1ZA 1H4SA 4FP9A 3RAPR 4J9UE 3NR2A 3NS7A 4RFLA 3KV1A 3NM6B 4ZCRA 4BGIA 1KI8A 1SXJE 3GRRA 1I5EA 1ZK3A 3AB3A 4RKQA 3ZWVA 2GJ4A 4G1VA 4HHEA 4JR0A 5DB4A 5CFPA 1T8WA 3TK1A 4UQPA 1Y8ZA 1IBKB 2G4VA 3KWMA 3A8TA 1P6UA 3NT5A 1WW8A 3NAMA 3R0XA 2W22A 4TTTS 3QX7A 1VPDA 1NXOA 3ZD8A 2YYZA 2QTWB 1E2NA 2VP3A 3K5HA 4P0QB 2IHJA 1KYQA 4XGKA 3DC7A 3SJZA 3AEUA 1JB9A 2P9EA 4JCOA 5LYJF 5JWOA 5KVAA 3AG6A 3IESA 4D3ZA 1V6SA 3F1LA 3X0DA 1OJLA 2G4CA 3FCOA 1CETA 5EP4A 4A3SA 1HO3A 3DLIA 1XTKA 1FDOA 4U0KA 1DC8A 3ZCVA 1J4AA 4OHUA 3NIGB 2F4NA 4U3JA 1OILA 3I12A 1LI4A 1XKTA 2X0IA 1CZLA 2N9UA 1H65A 1Z2AA 3E5RA 5ANRB 3BXHA 4CU2A 2QMHA 4E5YA 2Y05A 3P97A 3ZGLA 4KAFA 2NPIA 5L3RA 4CGYA 2RSLA 4ER6A 1VJ1A 4KDEA 2Z5LA 4KFTA 5L4SA 2Q5IA 2R1VA 3IA2A 2V7TA 3IE2A 1CS0A 2PXXA 4RPHA 3UVEA 1KMIY 1YCFA 1K0FA 2JAUA 4V3CA 3TLCA 4BCCA 3GA0A 1E6MA 1KMHA 1M34E 2J32A 5LD2B 1HUQA 2C4KA 3H75A 4HOYA 3RJMA 2GEKA 1FFSA 3HL4A 4B9AA 2X9NA 3DTYA 5GPBA 3U3RA 5AXDA 3JXEA 2I7CA 3AYZB 3WVNA 2W8BA 2LUOA 3ZIAD 5C1DA 4LF4B 5ALUA 1LNSA 4HATA 1Q7GA 1TMOA 2GN8A 3WYAA 4DFDA 5IM4A 2A92A 2G06A 3DVLA 4IZ6A 3THWA 4YP1A 4XJSA 1A9XA 2Y2VA 4HEA1 1G3RA 1X7HA 2WSYB 3ELDA 3D81A 4G67A 1E1RD 1UC5B 4N0PA 1LLCA 4MOWA 3ENQA 3OZEA 4UNRA 1SCKA 1Z6YA 4I1IA 4ZP1A 4ZDWA 5C1OA 1BDIA 3UJ9A 1OVGA 3I9V6 1I1OA 3HQ4O 3BMNB 2OO5C 4NEQA 3HWRA 4LJLA 3IEKA 3HFGA 1ECPA 3K6KA 2JI8A 3K9HA 2NVWA 3C3JA 3HUDA 2WP0A 2YWGA 3Q7IA 4JBWA 4QYMA 3SLGA 3QSYA 3I9MA 3DLPX 3Q3HA 3ODGA 3ENNA 1XRSB 4X3PA 2ZJFA 3TO5A 1ZGGA 4CUKA 4L0MA 3H1EA 1RBYA 4R9SA 4FILA 4D4HA 1I7QB 3UBTA 3JQAD 1NQAO 2IBSA 3K5PA 4YNBA 4HWRA 3MJ4A 4BMCA 4BZZA 1P2VA 2DPGA 5I3CA 2AK3A 3K1TA 4OUDA 1JXMA 4JOQA 2VRCD 1NONA 4ZAGA 3O0TA 4LVCA 4K9DA 4P2BA 2XW6A 1YB4A 3LY7A 4YDSA 5CXXA 3RT1A 2IHKA 2R4TA 4HN2A 1F8YA 3IMEA 4WNAA 5T57A 1IFXA 3P4UA 5LYJA 4C30A 1IHOA 2J7PA 4UDYX 1GPKA 4RA9A 2CDNA 3QKUA 1XKQA 5I9MA 3EW7A 2A9VA 2RBKA 2DC1A 2IS2A 2CYAA 2PRYA 1AKNA 1PBNA 4AJKA 1L8XA 1F51E 4HSGA 2B36A 3IKTA 1RCTE 5IAJA 4J3NA 2ZAOA 4G5FA 4JNKA 4ZJZA 4HMPA 4DCCA 1XYYA 1CDOA 4UPEA 5B2ZA 4ZZ3A 1TO2E 2VZ8A 3IFSA 1GQYA 1O9BA 1QRDA 2QY9A 4EG3A 1WSDA 3P9ZA 3KQOA 2H7XA 3K35A 3WRXC 4BX0A 4F8YA 2Q3BA 2YMLA 3DA8A 3DE0X 2CXSA 5JI3E 4CL8A 4HLQB 2HQRA 2IXGA 2HB6A 1BA3A 1L4NA 1Q14A 4Q00A 3AOEA 3H9UA 2W2KB 3A6HA 3NDPA 1E9AA 4J91A 4ZJPA 4GBGA 3BA1A 3VGJA 4XH9B 4RTSA 1ZHFA 4FYJA 3E23A 3JYNA 4MEAA 4N5IX 3V34A 2CNNA 5CXSA 2ODNA 3DBHA 4P98A 3AKDA 1L4EA 3JYHA 1B2RA 5K3DA 3T1HB 4RH0A 3E5HA 1M72A 1NUSA 1IN5A 1E89A 3KALA 1XGKA 1TJ3A 2A1UB 1D4ZA 3O3MB 1V4NA 2OAQ1 3PF9A 4M0EA 3JTMA 4WCVA 2QLNA 5J4YA 2F9MA 4DAEA 1Z15A 5B58T 3A6PC 3I83A 1PUIA 1VXRA 2HADA 3CPJB 3NNDA 2GRUA 3OWOA 2RHMA 4H08A 4O29A 4U2CA 5BOSB 3EZ9A 4EUHA 1JTVA 3HEBA 4BRSA 3H3JA 1TJ4A 1NVXQ 1WCV1 2H0AA 3JQ9C 2AMLA 1NFFA 1YIDA 4TMTA 3TZHA 4D02A 4DV6B 2NO5A 1JWLA 3TLAA 5BNTA 4NATA 3BE6A 3QWBA 4RIGA 2P2DA 5BT9A 4P3XA 1QRUA 1AGRA 3JWJA 2OWDA 2IDKA 1T2UA 4BLSA 2F17A 2JIDA 1OD6A 2Q4OA 3F67A 5SZIA 1NKSA 2ZR7A 3WFIA 4OK6A 3LXRA 3NRBA 4Q1BA 2VQFB 3GRYA 5C3UA 2QEQA 3WG9A 1R4AA 4BB6A 1WDWB 2W2QA 3OUZA 4LSWA 1MBZA 1W0CA 3GEBA 4D45A 4LYHA 1VKJA 4GPAA 2FMXA 2AI1A 2VP9A 1TVEA 2AC4A 4PCVA 3NQ41 4JJ6A 1B7GO 1LY1A 4MR7A 2H1RA 4O4HF 3IP3A 3P2EA 1P81A 2YL2A 3HA5A 1QF6A 1U28A 1Y33E 2EOAA 2OC9A 2Z2ZA 4PTZA 3MBKA 4KK3A 1A95A 3JQ8A 5G41A 5KNDA 3H5WA 3P9SA 1POXA 1E6KA 2J87A 5EE1A 4K28A 5EE9A 4G24A 1GCUA 2I34A 3ZXXA 2WTXA 4FZJA 5C1IA 1OW3B 4MVJM 1AY0A 3DVAA 5FUXA 2RONA 2ZS8A 1Z12A 3S8YA 2MINA 4C4YA 1TO1E 3EGIA 1G59A 2WF6A 2D5AA 3OTOB 1CRLA 5JH7B 5K9ZA 1XT6A 2FXVA 5I7UA 3JQ7B 1E0SA 3DEFA 3WGGA 4M8SA 4MV0A 1XJWA 4QU0A 1DMSA 2PBLA 4QXPA 1EJ2A 2H4XA 4WJZA 2PJZA 4E5SA 5ECGC 5K01A 3GFFA 2YIVX 4EABA 3EBPA 5TJ9A 3FNGA 1JQJC 1YFKA 1ODLA 4TSKA 3H16A 1AA9A 1ZK1A 1L4FA 2DR2A 4YRLA 3VH1A 2GAAA 1YI1A 4NZ9A 1I4LD 4KUHA 1NDHA 3N53A 4W5QA 2XOKA 1E32A 5HUJA 3LAWA 3GROA 5F3DA 3QYPA 3QP9A 4HYQA 5K0LA 2ZXUA 2QQGA 4WY2A 4D6YA 3JCZA 2CJYA 3N75A 4R3WA 5KJFA 4NE2A 5KTNA 2WMDA 2HPZA 4ZVRA 2B0JA 1X1RA 3HA3A 4MGKR 5EWMB 5AQ1A 5LUBA 1Q0LA 1Y63A 2TS1A 3ZGXA 1N78A 3L9WA 3RFUA 5L7WA 1Y89A 1F20A 2PGLA 4P92A 2CHVA 3AY6A 1KSHA 4PINA 1I80A 2GDZA 1QG0A 5DHQA 2XHEA 1MNAA 1ORTA 3IBFA 2ZIZA 3PKZA 4OHKA 1AU9A 3CFYA 3ES9A 3MT8A 4PQRA 2JAHA 4FCWA 3GGGA 2QYTA 5EMKA 1QIJA 3ONEA 1DV2A 3KLBA 3LLVA 4GP6A 4MIYA 3SYLA 3UUWA 1C9DB 1SHTX 4EMTA 2BDEA 4KFUA 3O8CA 3HDQA 2BI8A 2IU6A 1WCXA 2QLTA 4LXQA 3ZTTA 1KWGA 1RTTA 1O7JA 3PGXA 1JFTA 2XWBF 4FPXA 4X3CA 4RCZA 4QVGA 1JNXX 3H17A 5EYPB 2VXBA 2FWBA 3DOCA 3F98A 5F1OA 3WSTA 1W85B 2O3JA 2ZP1A 1CX9B 4GYYA 3DDCA 4O4HA 5EVJA 5K4GA 3K7EA 5BN5A 2V58A 3A14A 4HDKB 3STVA 5J2TF 3IAM1 4M6WA 3URKA 4KAXA 1P2BA 1P1IA 1YWGO 3II6X 5HWSA 521PA 4EHKA 4TKUA 1Y9AA 1Z0DA 1CUGA 3RYFA 3OFJA 3ILHA 4FK8A 4FMCF 1BHJA 4M22A 5K0SA 1U81A 5A5FA 1NPTO 2O8DB 4B3IA 2XLBA 4EO7A 3WIBA 2GYYA 2OGTA 4M1WA 1FX0B 1NM5A 2PPVA 2I4MA 13PKA 3TOCA 4W9NC 4Q16A 1SCJA 2FEWB 4HH0A 3D6JA 4KBYA 4EY7A 1FDIA 1GU7A 1FFWA 3A1FA 2J3IA 3PNSA 2QYOA 4NDZA 4PCAA 4AG5A 2ZWIA 1RJDA 1ZSVA 1P2SA 1AKUA 3TTYA 3UWKA 5BO5A 1JQBA 1KKUA 3QEOA 2YN2A 1QDUA 4AY6A 4XZ3A 3TW6A 1KI6B 4U02A 1YMUA 5I7FA 2CV2A 1SC6A 3PU6A 1CUBA 1YVDA 1E2GA 1Z28A 3ISTA 1JAXA 1XEAA 3L41A 2GPJA 3SLKA 3B3QA 3PDCA 2ZSFA 1V11A 1SKBA 3ESQA 4KQ9A 3T3HA 5ILOA 1U0JA 2GD6A 3NMUF 4FE3A 2VPZA 3HXTA 3PT5A 2AVNA 4GLJA 4DTCA 2RHBA 2FEMA 4U2EA 5F5NA 5ICSA 2FMTA 1NATA 4M98A 2Q2VA 1GDTA 3W2GA 1US8B 3HG7A 3EXG2 3QFCA 5BN4B 5K51A 1K5HA 4GXNA 2APJA 1PE0A 3J81A 3AP2A 4L3WA 5F76A 4YYEA 3OLYA 3L0BA 2QRUA 3KU4A 4LTNA 4C7BA 5FLXA 2HUNA 4GSLA 5I6DA 3COSA 3AVOA 2VSFA 5JSFA 4BO9A 1TZKA 4CIAA 3AEXA 4P22A 2H1FA 1IBSA 3OHSX 1DT3A 2ZETA 2FG5A 3ZJUA 1EZ4A 1Z7EA 1DOZA 1P45A 4LNHA 3ZGYA 2V7EA 2D8AA 3ZHXA 4UHDA 4LFCB 3I1FA 3OECA 1L7PA 4A91A 1QWSA 2B8WA 1NC1A 4IFTA 4J49A 4AKTA 4DABA 1C0LA 1SUFA 2B78A 4HDNA 4MV4A 3CVUA 4IMIB 1GAXA 2C2WA 2PH3A 2JJMA 3X1KA 4MWTA 5KB3A 3TTTA 2BZSA 5LQCA 2OECA 2ADFA 1PQYA 3JZIA 4FHFA 3IUBA 5E7QA 1ZMOA 1XFDA 3G49A 1Q7RA 3I5YA 2A0WA 2OMKA 3OJXA 3Q15C 1VLJA 5FIUA 3UHPA 5FOQA 3TLYA 5KBYA 4EFKA 5FR1A 4XB1A 1IHXA 1XUOA 1GQSA 2LXNA 4ZI5A 2SICE 5J2TA 4CEHB 1M75A 3CLSD 1JDUA 1Y8RA <