1Z06A

Gppnhp-bound rab33 gtpase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
165
structure length
165
Chain Sequence
RIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords Ras-related protein Rab-33B
total genus 51
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z06A00
1X1RA 3ADCA 1OE0A 1AKEA 1G4UR 4DLSA 4URVR 1GDDA 3QF4B 1JI0A 1J99A 4KCGA 4YMUA 3AP1A 3MSXA 3EPJA 1SXJB 1WE2A 4LJ6A 2B21A 4JLDA 2CJWA 3H84A 3BAFA 3QXSA 2JLUA 2ZS7A 3LQRA 2BMJA 2FFAA 1KIMA 4X8LA 3SJBA 2R6DA 3X1WA 1YJ5A 2JLQA 4LV6A 2IXGA 3RS7A 2EFEB 2H16A 3KXIA 4V0NA 4Z1MD 1YE8A 1TU4A 1XJCA 2FGJA 3CWZA 2Q9AA 2QROA 1PVOA 3BRWD 4BWYA 4BE7B 1W5SA 4IJMA 1KO7A 4GP6A 1F2UB 2N1BA 3B9PA 1KMHB 4R2HA 3B7GA 1Z0KA 3F0TA 2BMEA 1XMVA 2RAPA 2YC4C 2ZSAA 4Q1FA 3WBJA 2ZROA 1XZQA 2XSZA 1U8YA 3GJ6A 2A30A 1JR3D 2ZRPA 2CEAA 2F1RA 5UKDA 2HT1A 3F8TA 4DSTA 4B6EA 1SKYE 1ZP6A 3DO6A 3KJGA 2C98A 1LW7A 4IVRA 4TTQA 3HPRA 4W5WA 1E98A 2W00A 2F1JA 4JYCA 2P67A 1T6NA 3Q5DA 1GKYA 3CKLA 4XWKA 4NE2A 4CDGA 4PPNA 1X8KA 2AFHE 2DHRA 4A2WA 3K70D 1Z07A 1KI6A 1G8PA 4YLGA 1GNQA 3I61A 1BMFD 4YDHB 2QRZA 2WJVA 1IXZA 1E2KA 1G64A 1JPJA 2AKAB 3NBZC 1EX6A 4ZKEA 4LHWA 1WXQA 3M0EA 3ZD7A 1P75A 1UBGA 4PSAA 2NO0A 4OQLA 2J3EA 2JJ2A 2IYTA 3F3YA 2RMKA 1KDRA 4WVFA 4L4UA 4QKQA 1N6OA 2WWFA 2NZ8A 2O8FB 4POAA 5ELXA 2HV8A 3PVSA 3EPHA 3GJ4A 4YONB 3TUZC 3AKEA 1BOFA 1KI9A 5FPYA 2R44A 1YRBA 2SHKA 4KBFA 4MGIR 1CRPA 2OHFA 3GQBA 4IW3B 4M1OA 5C1BA 3MJRA 2QSYA 4H1VA 5HCNA 3RRZA 4QGGA 1U0HC 1HE1C 4DCUA 2F7SA 2KB0A 2BBOA 1Z0FA 4NU0A 3NKVA 1KSGA 5B64A 1FFHA 1E0KA 2C03A 1UF9A 4BEBA 4A6XA 4B3DA 4PQYA 1OPXA 3ETLA 4GBMA 3RS2A 4CRWB 1T4GA 3AUYA 1KKLA 4LJYA 1NMZA 1SXJD 3LD9A 4B3XA 1XD9A 4DCTA 1SVWA 1JALA 4BLOA 3QQ5A 1RJ9A 1DADA 4BFTA 5FPKA 2VHTA 2AK3A 3S1AB 5EE5B 4TT3A 4BZPA 1A1VA 3I5XA 3VR3A 4MDEA 2XXAB 2FGKA 4Q48A 4FXPA 4OK3A 3Q3JB 4N0DA 3BC1A 4O25A 1TMKA 4GZMA 2ZREA 5FR1A 4M9XA 3FFAA 221PA 1A4RA 1N25A 3KB1A 3MGCA 1LTQA 1W49A 3L82B 3C4JA 4DT1B 5G3ZA 2QY9A 2WPDA 2ZJYA 3AKYA 4LUCA 1OIXA 1WRBA 2H18A 1E1RA 1GM5A 3ND9A 4R98A 2J0SA 4A36A 5KDLA 2VSFA 1E0AA 4JVSB 3B1YA 2DWOA 4YXWA 5EE1A 4F7WA 2FFQA 3I92A 2ASEA 4C0KA 3SYLA 2WWYA 3U2QA 1FNMA 2ZR7A 2REXB 5DYIA 2C5LA 2GA8A 4OK5A 1EFRD 3B1WA 3THYA 3KUCA 4L5BA 2I3BA 2VHCA 4QBIA 2ZJ8A 4GDFA 3ADDA 1SVKA 3CW2A 4UNRA 1G7CA 4Z1MA 2AN9A 3OZXA 5AJYA 4BLSA 2QTVB 3DVLA 4NL4H 2VEDA 1ZNXA 3CRRA 5CYPA 1AN0A 1XD2B 1LF5A 3DM9B 4RD1A 4RKFA 3SN6A 1CJVC 3KFVA 1XNJA 1N0VC 4MYCA 4Q66C 3ZZUA 1U90A 3ZVLA 2VHUA 2V3CC 2NIPA 3AM1A 1DG1G 2O5VA 1GRQA 4TMKA 3SZRA 5HZHA 3AVVA 2ZYUX 4UQOA 3OIWA 4DLUA 2K5UA 4ZIRA 1P6XA 4O2RA 1G8GA 1SVIA 1W44A 3L0IB 2ANBA 4Q9JA 2GETA 2EWWA 3UXMA 4P4SB 1CJMA 2ONJA 1LB1B 4KFTA 2H5EA 3IHLA 3R9XA 2KE5A 1WQ1R 2VSOA 4PHFA 1T3LA 4LHVA 1NY5A 5DO9A 2UZ3A 1CR1A 3TKLA 2ZAMA 4LGMA 2C9OA 1M1YE 4WOPA 2QN6A 2ZYWX 3QEOA 2BKUA 4AG5A 1YR8A 5KPJA 3T1QA 2O8FA 4AK9A 1DEKA 2WIAA 1YR7A 1W0JD 2R8RA 1Q3HA 3AKDA 4WZ6A 5FTLA 5SZJA 4RY2A 3ZS9A 4IVPA 3DHWC 3IILA 3TLXA 4KLNA 4Q4JB 1I2MA 4GMDA 2X2EA 2IS6A 1US8B 5DI3A 2IF0A 2RH5A 2JEOA 3AF1A 4L9WA 4TWZA 1JBKA 1P60A 2ZEJA 1XFAA 1OH8A 2QMUA 3LLMA 3LBIA 4RKEA 1OH5A 5FPSA 3MWJA 5JECA 2Z0MA 1KI6B 5LB4A 1HYQA 3GLGE 5CJPA 3M4YA 2HYIC 1VHLA 4RFSB 4LOAA 2ZRMA 3PEWA 2J0QA 3VFDA 4CT5A 1CIPA 1G5RA 3B13B 4EIWA 1JAIA 3IIMA 3WNCA 2VO1A 2QG6A 3OAAD 3LNCA 3IPYA 2VTKA 2RGNA 3CRVA 5SZIA 1D2MA 2C77A 1D5CA 3QKRB 3V4FA 1R8SA 4C30A 3WBKA 5L8VA 1DTSA 3WNBA 4DLZA 1H8ED 1BYUA 5HZKA 3ND8A 2QGNA 3A58B 4Q47A 4NYMR 2FZLA 4BFUA 3SJAA 5DNYB 2YV5A 4UKDA 2AXNA 2ZI6A 4Q4AA 1OIWA 1IXSB 2IYQA 2FE4A 4JL6A 3NC1C 4NONA 3THXA 4J0QA 2QQ0A 4URXR 2OG2A 2YOFA 3DDCA 2EFGA 4CYMA 1OB5A 4TT3D 1P61B 1OHHA 4JLBA 4BRWA 3TW4A 1J8MF 4MUAA 3AV0B 4FW9A 1EK0A 3OEED 2QGZA 2VA8A 2Z6VA 1Z0DA 2W0MA 3FDIA 1UADA 5SZKB 1F48A 4MRRA 4KYUA 4X8HA 4HI0E 2JIZA 1XRJA 2OE2A 2VP5A 2ZRFA 4C2TA 1JR3E 1UKZA 2WPDD 3EWSA 2IC5A 3FMOB 4QNMA 1EXMA 5FL3A 1Q22A 1VECA 2X1VA 3Q9LA 1NVVR 4US0R 3UK6A 1KSFX 2OBMA 4P4TA 5EXPA 3CR7A 3K70B 1SGWA 3BE4A 1TUIA 4RD3A 2WSSA 2DYKA 4XTRA 3A36A 4PFSA 3FTQA 2VP0A 5SZHB 4A8JA 2ATVA 5EP1A 3AVXA 2NOAA 4AYWA 1ZC4A 1N0UA 1YZUA 4JS0A 2O8BA 3GCGA 3P26A 4M1TA 4JZKA 3EWAA 2WJIA 1VIAA 3UWKA 3GLIB 5JI3E 2O8DB 3QPVA 121PA 1II0A 1F5NA 3I62A 4HLQB 3G0HA 3OE7D 1F60A 1TF7A 1G1MA 1KAOA 2NO1A 4Q7LA 1LY1A 1M8PA 3UPUA 3VHXA 1KK0A 1NP6A 2D06A 1T5LA 3K0AB 4G1UC 4Q4HA 1N6IA 5BN5A 1II8A 1E79A 3I8SA 4FWTA 2RHDA 3AEZA 5G53C 3QG5A 3GJ3A 4HB4A 3QY0A 1MABB 1Y3AA 4ARZA 4P4SA 1HUQA 4F4CA 1XCGB 2HT6A 2GTPA 1CF4A 4CEJA 3TRFA 1Z6GA 5GVSA 2ZE5A 4RSGA 3CF2A 3SE0A 3U3RA 1OYWA 3NWJA 1CJTC 1ZW6A 2G6BA 2FSFA 1TF2A 2WTUA 1NKTA 1E9CA 3I8XA 4BLRA 3AVTA 2ZS8A 5HKKD 3LX8A 4V0LA 4EJSC 4EAQA 2HCBA 1W36C 2JJ2D 4M1KA 2PJRA 3TR5A 2Z43A 1C9KA 3DOFA 3PIRA 5DH9A 2XAUA 1E2EA 4DB4A 1P62B 4XWAA 2ZR9A 2P0EA 1VDZA 2GCOB 3O8DA 3MLEA 4JLOA 2QEQA 4B32A 3R7WA 2CBZA 5JEDA 2V55B 4S2EA 4Q19A 2DR3A 3W34A 3CH4B 4JLPA 4JJZA 1IHUA 2RKOA 2O8CA 3FHOA 5HPYB 2GILA 3RVBA 1EFUA 2ZIAA 4XIGS 1MO6A 1TAGA 3CNOA 3O8BA 4TL7A 1TQDA 3B82A 2GJAA 1Z8FA 1H8EA 4HAWA 1UDWA 1COWD 1E1QA 4MH0R 5M04A 3FKSD 3VHLB 5JCPA 1H8HA 4LZZA 4D6PA 5EE3A 2A5YB 4S35A 3OAAA 4W5JA 4IRUB 4AYXA 4B44A 2IL1A 4Z8YA 5J5CA 3NBYC 3MWKA 2XNDD 5BYKA 2WWHA 3FB4A 1IJEA 3SNHA 4JT2A 2DY1A 3HDTA 3P20A 3RNLA 3IPXA 4QBGB 4A8JC 2XTZA 4GPTA 5FOWA 1TL7C 3PUYA 3RS3A 2V4ZA 4OHYA 4HLUA 4DIDA 4BFSA 1CR0A 4XTCS 1VPLA 3NVAA 3QPWA 1DG3A 2H17A 2ZYVX 3LDAA 4QBFA 3TSZA 2UZIR 3GLFB 2VHJA 2CL6X 1YZGA 2IBMA 1XJQA 4OK6A 2IEZA 2MMGA 3BH7A 4PHHA 4OL0A 2EFCB 3LH5A 3GLHE 4Q7JB 5HE8A 3D31A 4OHWA 4M53A 3QVVA 5LDDC 5IF9A 1DOAA 1FPMA 1UBFA 2CLCX 2ZI3A 1R0WA 1ZD1A 4DDTA 1E0JA 1S3GA 3DZ8A 4UXHA 1Q20A 4G5SA 1D6JA 3CR8A 2JATA 4V0ME 4XOIA 1IXRC 4ZCIA 3SI7A 5L3VA 1VHTA 2BV3A 2J7PA 4PC7A 2FU5C 5J47A 2FN4A 2CL7X 4TMTA 5C46F 4PO8A 2GXAA 2ZRHA 4PC1A 3UIEA 4TZ0A 4FMDF 1AQYA 3JVUA 2C95A 2PX0A 4OYHA 3B2EA 4JKIA 4M9SA 3B9QA 1GKUB 1VG9B 1XCMA 5F98A 3M6AA 2VF7A 4CW7A 1PUJA 4RVCA 4KFRA 1G3MA 2R2AA 1SVSA 3DPUA 4ZKDA 4BASA 2O52A 1E2NA 4TLBA 1U94A 3O8CA 1JR3A 5A4JA 2Z4RA 3EZ9A 3LXRA 3OE7A 4JBYA 2CCJA 2QENA 4JIMA 4NYMQ 4ZIRB 2IYSA 3MAAC 3KKPA 3OIUA 3U7EB 3D3QA 2IXEA 4I1VA 3RWOA 1HQYE 3B1ZA 1QG4A 1IN8A 3W5IA 3O47A 1XTIA 1RKBA 1E9SA 3NH6A 4Q21A 3EARA 4PAQA 3EW9A 1Q12A 2BMFA 4A82A 1NF3A 2ZUCA 3QENA 5EE0A 1N6KA 3TAHA 2DFTA 3MWLA 2ZJBA 4JLNA 2PLFA 1G3UA 2B8WA 4DIEA 1ZRHA 2FFBA 2VH5R 3BB3A 4A0RA 1XBTA 2WWIA 2XNSA 4C3ZA 3OESA 3KZ1E 4XWOA 1LVGA 2GF0A 4LC0A 2CHVA 2GJ9A 5AJXA 3IBGA 3QPUA 1ESNA 4A9AA 3KXKA 5FI1B 4ITRC 4JMPA 3W3AA 4PZZA 3B1XA 4MRNA 4ZCLA 3KQKA 4RD6A 2PMKA 3D6TB 2QPAA 3D8BA 3U60B 2O0HA 2OESA 2BJVA 2L0XA 2GXUA 1Z3IX 1SKYB 1Z0JA 2B7CA 2CE2X 2DFNA 4CZ2A 1ZCBA 3U7GA 1NG9A 3BK7A 5JZVA 1G5PA 3R9WA 2OLJA 2ANCA 1ZNWA 4XH9B 5FTJA 3T61A 5FI0B 2QMOA 2OO7A 2VP4A 3BH6A 3QXCA 2FH5B 3HWSA 4IXMA 3K70C 3VX4A 3AVOA 4FMCF 1SKQA 1P72A 1DAMA 2RGNC 4HEJA 2IXFA 3P32A 3VU9A 4X8OA 4M8NE 5FOSA 1E2GA 4CEJB 1X6VA 1SXJC 1KYIA 2BM1A 4P31A 3BFXA 2MSDB 1O3YA 4LJ9A 2UKDA 4DCSA 2WBLC 3ZD6A 1XDBA 2GJSA 3ZDQA 1S0UA 4BZQA 2ODNA 1RJ9B 4LPKA 4ON9A 5BN3A 4LY6A 1BYIA 1COWA 1RPZA 4TYNA 1WCV1 2ZQ5A 1BIFA 2Y8EA 2HLDD 3KQUA 1G8YA 3BORA 3H0KA 4C0SA 2CNWA 2ZRBA 2RB4A 2YWEA 4OBEA 2JASA 4LBZA 2OAQ1 2O8EB 4R9UC 3Q7QA 1ZINA 4UNSA 3AQ4A 1F3OA 1E2HA 4D2IA 3PENA 4MA4A 2D3WA 2QNRA 5HE9A 1KO4A 2ONKA 4ASUD 3DM5A 3QKRA 4B71A 4U00A 5BQ5A 1W4CA 2QP4A 4N3NA 3AVQA 3W8NA 2OV2A 5E95A 3K53A 3MUFA 1Z22A 1F6BA 5GJBA 2ZITA 2AD5A 4HAUA 2FOLA 2YWFA 2BCJQ 3R9IA 1CLUA 1QRAA 4QHTA 2FPKA 4OQXA 3T1OA 3OHMA 3R20A 1XPUA 1NN5A 1OKKD 2ZRGA 4UJ5A 4Q02A 2QE7A 2ZRDA 2BWJA 5KYKA 3FHCB 1KJYA 4A8JB 2E87A 3RC8A 2ZI5A 3SQWA 4ESVA 3VKGA 3VNVA 1FX0B 4Q9IA 2WKRA 3V00A 1UM8A 1AKYA 4O0MA 4K46A 3P1JA 3EIEA 3LO5A 3LVQE 3TSOA 1WA5A 1T0JB 3RRYA 4JLAA 2JDIA 2GCPA 2GEUA 5KSPA 2WAYA 4D4KA 5CB6A 5JBQA 2WICA 4F93B 1YRAA 3A4MA 2VP2A 3L2OB 2NGRA 2FSIA 5JFGA 2DFLA 3R8FA 5TY0A 4PPQA 3CONA 3WYFA 1AS0A 2ZETA 2R9VA 4JSYA 5FH9A 1OH6A 1KI7A 4B73A 4GOXA 1TNDA 1PV4A 2B7BA 1GP2A 2BC9A 3QEJA 1P5ZB 3KTAB 1QVAA 4JLMA 3TW8B 5A5GA 4XVQA 1G3RA 1MRNA 3AVWA 1XD8A 2V8OA 1OXSC 4DLWA 3LFUA 1S1CA 4LSGA 4PHTA 3DZDA 2WWWA 3VNUA 4IEEA 2GXSA 2ZJZA 5J4VA 3PUVA 3QIAA 2B92A 4LC1A 2GHIA 1DAIA 2BBTA 1Z6AA 4ZI2A 4KFSA 1S9DA 4QG7A 3U7FB 2XGJA 2OILA 3LX5A 4CEIA 1TADA 4M0LA 3K09C 1XXHA 2ZR0A 3ZVMA 1OW3B 1RVDA 2IYUA 3SEAA 3EZ6A 4JL5A 1U99A 1KI1A 1AGPA 5EXSA 2V7QD 3BBPA 1KK3A 5FBQB 4B3CA 1RRPA 1W4RA 2F43B 2P2LA 3WMFA 721PA 4EPXA 1LS1A 2RGEA 2O8CB 3W3ZB 1L4UA 2F43A 3B78A 4K81B 3GLGB 1JB1A 1DPFA 2C04A 3NH9A 1X8JA 2BKEA 4F91B 2FX3A 4HB2A 1XTJA 4ZI3A 4C0HA 4NYJR 1GTVA 1OF1A 3G82C 4C0AC 1W1WA 4D0GA 2FSGA 1LF0A 4B76A 2RCNA 1E6CA 3VR4A 5DN6A 1G7RA 3A4LA 1K6MA 2C8VA 2OFOA 3GLIA 2JLRA 3C7KA 4PHGA 1EFTA 1SVLA 1T9HA 2VSXA 3HYTA 1MRSA 4EFLA 2PH1A 4KYIB 3QSYA 3THWB 3QI2A 5F3WB 1S4QA 3TJZA 4JL8A 3U61B 3D7MA 3IO3A 2HXSA 2KWIA 3WMGA 1R5NA 2XZPA 1XMSA 1R8QA 4LYFA 4TL8A 5ANRB 1US8A 3ADKA 1AM4D 4PO1A 2MMCA 2EYUA 4PPFA 4FCVA 4WBSA 5EQTA 2CLSA 1IN6A 5GJWC 2ODBA 1XZPA 2CNWD 4TQUS 2QM7A 4PANA 3WYGA 4PSVA 1F2TA 6Q21A 2WJHA 2ZRCA 3IGFA 3FFBA 2QU8A 4BECA 4EPYA 1UEIA 1RRGA 1EFRA 3N70A 2HYDA 2OSBA 3WHKA 1G20E 2CVHA 3PEYA 1KO8A 1KMQA 3K0EA 2QRNA 2Q9CA 5F9HA 3NEYA 1XX6A 5JJIA 2OBLA 4NBSA 4URZR 3Q72A 1FUUA 1W0KD 5AUQA 3SBDA 4YXWD 2PBRA 4JVMA 5FOXA 1TTTA 3ZH9B 1TQ6A 4US1R 1AQUA 5KNBA 4LI0A 2FA9A 5L3RA 1DAHA 4O3MA 1IY0A 3OEEA 2NPFA 2ORIA 3T5DA 4A0GA 1TX4B 3X1DA 1KK1A 2FF7A 5TVKA 4ACBA 2BIFA 4NPHA 1ZM4A 3EIHA 4PO9A 3T12A 2NG1A 2XB4A 4TTPA 4FCWA 1GILA 4Q03A 5H68A 4EFMA 5B58C 5DIFA 4GFDA 2I4IA 1YZLA 2ZRLA 2NQ2C 3FMPB 4HSEA 1YR9A 2I1VB 4QM7A 3VMFA 3CIOA 1CTQA 1E2JA 2BOVA 3SHFA 1PLLA 1QHNA 3KUDA 4B2PA 1Q1QA 4TSFD 4WIAA 1SHKA 1NMXA 3KTAA 4JYBA 1CR4A 4DRZA 1GL6A 4P3YA 4ARZB 2R62A 5B30A 5JJLA 3K9HA 4A6PA 1IY2A 1O87A 1CJUC 4DDWA 5JRJA 2ZVPX 1X86B 2QUZA 4EPRA 1LV7A 2X8AA 2XOKD 1E9DA 1UFQA 3A1UA 2FG5A 1ZD8A 4TQ9A 1KZGB 2OXRA 3FKQA 2EVWX 4R7ZA 3HYRA 3DL0A 4GP7A 2G9NA 5KSOA 1JAHA 4DVGA 5DISB 2ZE6A 3FE2A 2A5GA 2ZS9A 3ASZA 3GJ0A 1HE8B 3LQQA 1DBSA 2ZSDA 5IK2A 1MO4A 2DB3A 1I4DD 3SC3A 1XP8A 5TV2A 2C2HA 5C4MA 3UMSA 3W9YA 2IWHA 1VG8A 3CM0A 2VRWA 2YVUA 4MKIA 1JPNA 1EGAA 3OIVA 4G3XA 3NHBA 4U7DA 4DUGD 3K0AA 1NY6A 1KTVA 1NIJA 4U02A 1G21E 2CK3A 3GFOA 4GOKA 2LKCA 1AS3A 5LBIA 3E70C 4TLAA 2PLRA 4BLPA 1W2HA 3K0CC 3QXXA 4ZPXA 2CCGA 4W7SA 1KI3A 2IUUA 2XB2A 3K9GA 5L3QB 3C15C 5GADl 1KJZA 2EFHB 5FUXA 3GP8A 3SJCA 1KGDA 1W47A 2CMKA 2WHXA 1W2GA 1ZNYA 5KDOA 2P6UA 3PJRA 1ANKA 4EDHA 4QGHA 4GNKA 4Q1CA 1NBMD 4RZXA 4IXNA 4O2LA 5BXQC 5TMPA 4DJTA 3CRW1 2IYWA 2QAGB 3WY9A 3PR1A 4Z8XA 2MSCB 3BH0A 5FPHA 4HAXA 1M34E 1XJ0A 3SJZA 3V9PA 2DWQA 5BYJA 3UATA 2QAGA 4DCNA 2J9RA 4N1AA 1NVWQ 4HAYA 1E9EA 1IOZA 1R4AA 3L8YA 4DLTA 4PZLA 1JEEA 4WAUA 3LXXA 3JZAA 3WNDA 4DLVA 3SS8A 2PCJA 2ZE7A 4LJ4A 3T34A 1OHHD 1XEWY 3OFND 3RYTC 4DZZA 4KHZA 2H57A 2QT0A 3Q8XB 1RYFA 4HZUA 4C7OA 1A2BA 4B43A 2R6FA 3BD9A 3B8HA 1E2DA 3CLVA 4LBYA 3RS5A 3QOFA 3RANA 1AJEA 1E9BA 3KKNA 4DCVA 5C2JB 1RRFA 1BO6A 2LCFA 2JJ1A 4G0NA 1FNNA 3AGPA 3M1IA 3SR0A 1KNQA 3N5CA 1EESA 1GVNB 3VKHA 2F3TA 1M7GA 2EU8A 1J70A 1IQPA 1L2TA 1TQ4A 1ZM3A 3IO5A 1P2SA 1NL3A 2IYZA 2WSSD 4NDZA 2QPTA 2XX3A 1VCIA 3T5GA 1XEXB 1S8FA 3HU3A 3ZS8A 1CXZA 1ODFA 2X2FA 4B6FA 2Q3FA 3ZJYA 3GJXC 1ELOA 1KI8A 2WJGA 4F38A 5L3SA 2BVNA 2YOHA 4FN5A 4Q01A 4YMSA 1KI2A 5FUYA 2EFDB 1G16A 3EC1A 2BBWA 3KKQA 2IW3A 4MITA 2NO9A 1E79D 1VCNA 4URWR 4ZDIA 2ATXA 2FDCA 4QJ5A 4TSFA 1N5JA 1ZIOA 2FEMA 3LBNA 4JT4A 1KO5A 4HLDA 4YDSA 5FOTA 2ZM5A 4ILEA 2XTNA 4MGZR 1KJWA 3U44B 4URYR 1RC8A 1OSNA 3TVTA 1II9A 4FINA 1W36D 2PZGA 2O8BB 2DBYA 4LJ7A 1NVVQ 1I2DA 5D3MA 2IHYA 4LWZA 4G5RA 1G8HA 4JKYA 5FPTA 3W5JA 4M9QA 1TU3A 1G291 2CL0X 4GZLA 1XXHB 1UDXA 2D2EA 2VYFA 3A8TA 4GL2A 3TH5A 3TSWA 2A5DA 3AP3A 4KLZA 5J4KA 5P21A 1OJLA 3ZYCA 2FJUA 1QHSA 4MKHA 4QL3A 5IK2D 3I32A 4A0FA 1GRRA 2F6RA 2TMKA 4G5OA 2V9PA 3AP2A 5AJZA 2DPXA 5HTKA 4WW0A 3VR5A 3LRPA 1UKYA 2WV9A 2ZPTX 1UKEA 4KFUA 5HKKA 5DYGA 4MKFA 4C2UA 2OFXA 4KVGA 2OM2A 5KNCA 3GFPA 1ZU4A 4TLCA 2IS2A 1GRNA 4OQNA 5AUOB 2ZSEA 1G6HA 2YNMA 1N2CE 1HT1E 1NJFA 1KI4A 1SVOA 4IDNA 4DSOA 1YZKA 2WZQA 5FR2A 2FWRA 2NTYC 3PG5A 5AJWA 1UKVY 4OI0A 2ZRAA 1OH7A 5DGXA 1ZUHA 3L43A 3KX2A 5TB5A 4TMZA 1E1QD 2OCAA 3T1VA 3EA5A 3SFVA 2QBYA 1WMSA 2A5JA 5EP3A 4MDFA 3RS4A 4YQFA 4Q1AA 4ACAA 3ICQB 2AWNA 1QF9A 1HY3A 4XVUA 1H8HD 3DEFA 2GCOA 2OLKA 4MYUA 2QP3A 5DHAA 1S96A 1U2RA 1VG0B 4LYHA 1KSHA 3CWQA 4CGZA 4OQFA 3TBKA 3TAUA 5BW8A 421PA 1Q3TA 2CDNA 3LBHA 4Y0VA 4LDJA 3R7WB 3WHLA 2OEPA 1DAEA 1IJFA 3KKOA 2C9YA 3JVVA 1C4OA 1NLZA 2YJTD 3NXSA 1ZU5A 4FMCB 4V0KA 4IOKA 2CLDX 1DAKA 1CKEA 1DO2A 1VG1A 1XWIA 4NCNA 1F2UA 4WA7A 3QXHA 1DARA 2BEKA 3RSOA 3ZIAA 3I5YA 1Z6TA 1E99A 1TF5A 5J40A 2RGBA 1U9IA 4Q9HA 3VKWA 4DLRA 3H2YA 2CHGA 1WP9A 2PZEA 3HPQA 3LV8A 4G5QA 1OT3A 3RLFA 5G3YA 2WKQA 1W0KA 1BKDR 3UKDA 1P3JA 3VAAA 3LW7A 1OIVA 1W5TA 2P6RA 1N5LA 3OIYA 4G01B 1WBBA 4ZDJA 3IHWA 5JRZA 1RE0A 2ZI9A 4HATA 1EWQA 1FMLA 4NYJQ 3NBXX 1ZYUA 4TQAA 4ZDWA 3GJ5A 1T5IA 2ZSFA 3BB1A 3CB4A 5AK0A 5FL7A 4BFYA 2KSQA 3ADBA 3TVDA 4I81A 4MRSA 4MUBA 4DDVA 4AWXA 4PAOA 4AKHA 4IOMA 4HZIA 3QKSB 1P73A 5LD2B 4HZUB 2D2FA 2YZ2A 4DWJA 2P3SA 3GLHA 2QE7D 1OLOA 2YC2C 1TEXA 4KODA 3LVRE 2GWHA 2EYQA 4DB2A 4XJXA 4OQMA 4TTRA 4QHYA 4JJKA 1OB2A 3T15A 5DHFA 2IF2A 4Q4AB 1YHNA 2AKYA 2HEIA 2ZI4A 3SOPA 1Q1EA 1Z0AA 1E4VA 1JNYA 5H8WA 1G3QA 3WMEA 1BMFA 2W2XA 2GK7A 1CR2A 3REGA 5JWRA 1E9RA 1AZSC 2DFKB 2AD1A 3HR7A 4FMDB 1XMIA 4Q7MB 2W6JA 2MSEB 2XOKA 2JCSA 4HUTA 4GI7A 2Q9BA 4DSNA 4BUJA 2FFHA 3WXMA 1DS6A 2X77A 4TYWA 2HJVA 3IDQA 1AGRA 2ZXUA 1LS6A 1GFIA 3RAPR 4RJLA 4YC7A 5GJVC 4P32A 4DDUA 1Z6YA 4B2LA 3C5CA 3BJIC 3ZVRA 2ZSBA 5KUTA 1NBME 2ZUDA 2J45A 4B75A 1NMYA 4LJ8A 3TGPA 3CBQA 1FUKA 1MV5A 3CF0A 3TUJC 1XMJA 2YKGA 2KBEA 4OJQA 5HCIA 1DO0A 4I1SA 1A5TA 3ZZTA 1G19A 2IYLD 3KQHA 1ZMXA 2HJGA 2VIIA 1K8RA 1QHYA 2OT3B 2A7QA 2GCNA 4PQRA 2FPLA 4PXAA 3ZLJA 1DE0A 1FZQA 4A4DA 4TMXA 1XEWX 2VL7A 1WB9A 4I4LA 5JWHA 2XNDA 2C78A 3TNFA 3TQFA 2PX3A 4FCTA 5F9FA 4IDOA 2FV8A 1QHHB 2EWVA 1X3SA 3K09A 3QJYA 1II8B 1PUIA 5KOYA 4IFEA 4MYTA 3SDZA 1ETUA 3EX7C 2B6HA 1X1SA 2HLDA 4MKGA 5AUNB 4H1UA 1D9ZA 1HEIA 1U9IC 3L0PA 3GLGA 1Q21A 1F2TB 4RZUA 4TZ6A 2J7KA 5CYOA 1NKSA 3PEUA 2C99A 1OKKA 2R6GA 4TMWA 2OCYC 5JSZA 1VYVA 3CPHA 2ZI7A 4PC6A 4UXIA 3PXGA 2QZ4A 4DXAA 4TLDA 1GNRA 5FBWB 1DAFA 2G77B 2GVDC 3EZ7A 4HLUC 5CLLA 2ZRJA 4LBWA 1E69A 1N5KA 1L7VC 2GJKA 4IKEA 4ASUA 3FMFA 4C0BA 4Q1BA 5JHHB 4X8MA 2JIZD 3EZ2A 4BGDA 2DWPA 2ZAOA 4NTZA 5JCZA 3QUSA 1HA3A 5KTYA 1XPRA 3SHWA 1EX7A 3KXLA 1HH4A 1VIYA 3IQWA 1XEXA 1AK2A 3TUIC 3GEIA 4QJ4A 1QG2A 5EUMA 4R2IA 3VR2A 1RYHA 5J4LA 4UNNA 5B2ZA 3UWOA 3NG1A 3PV0A 4C7OB 3C14C 3VU9B 3ZZ0A 2YWGA 3ZQJA 2CHQA 4TL9A 1KAGA 2AFIE 2JLYA 4B3BA 2A78A 1B23P 1Z63A 2JLVA 3EAQA 5C4GB 2F55A 1I4TD 1Z2CA 4Q4LA 2F1IA 4OI4A 2OUKA 3G5UA 4OHZA 2EW1A 1P7CA 1NN3A 1PJRA 3S1AA 1EFHA 4F4IA 1FQJA 3I1FA 3AKCA 3B5JA 4Q4JA 2P5SA 3AVPA 4PQFA 4HB3A 4G5GA 2YHSA 4M9ZA 2UVQA 2J59A 4V02A 1QZXA 1X8LA 2IEYA 4A92A 1GAJA 3CX8A 1FTNA 2HCJB 1WF3A 1Z5ZA 5TXGA 4P4UA 1WDTA 2G0TA 4JSTA 3DKVA 3U3KA 4A2QA 4ZV4A 1YVDA 5CJ2A 4D25A 1XTRA 3QXJA 3FHTA 5KDDA 2GZAA 1N6HA 2O0JA 3DMNA 1EG7A 1NJGA 1XF9A 4LHZA 1U81A 1PLJA 2LKDA 5KO2A 1W0JA 4DT1A 2OZEA 3CNLA 2V7QA 4C4PA 2F1HA 4U5XA 1KO1A 3QF4A 2IWRA 3IIKA 3MG9A 1K5DA 2AK2A 4HUQA 1NNEA 3I3SR 4BPBA 1R6BX 4KJZA 1YZTA 2P65A 5DI9A 1VMAA 4RD2A 3U4QA 1G18A 2QTFA 3NEJA 3AF4A 2GESA 3EIQA 2W6JD 1KHTA 3C8UA 2GK6A 1MABA 1NN1A 4BLTA 4BFZA 3GJ7A 3RRMA 1IM2A 1TEVA 5D3MB 821PA 1CP2A 3KJHA 1GG2A 4MRVA 1KKMA 3B85A 3P4XA 1FMJA 1BH2A 1GSIA 3IQXA 3IUYA 1KSJA 2QT1A 1NLFA 2FNAA 1KMHA 1ZUIA 2IK8A 3I73A 5LPNA 2O0KA 4NCHA 1MKYA 1JECA 4W5HA 3DMDA 4URUR 4RD0A 1B0UA 1GKIA 4PAMA 1G6OA 1RIFA 3SYNA 4V0MA 4A0HA 1KDPA 3K9LA 2FPMA 3L0OA 3SFZA 1ZNZA 4HYYA 2G83A 1A2KC 1N0WA 3L0SA 2Z4SA 2FEOA 4NHOA 1MR3F 3VR6A 5B57C 1JQLB 4QHSA 3X2SA 4YMVA 2X19A 3RSLA 5JHGB 2ZANA 4TN1A 1SXJA 3RABA 2VP9A 4YMWA 3T1TA 3KL4A 2PEZA 1T8UA 1CU1A 5DN6D 5CM9C 2WMOB 2IT1A 2FZ4A 3ZIAD 2RGGA 3K8YA 3ONWA 4HDOB 1V43A 1YQTA 3WYAA 4LK2A 2W6IA 3KJIA 3MCAA 4BFVA 2G1KA 1VYTA 2KI5A 5IDVA 2ORWA 3EA0A 2ZRKA 4CIDA 4AURA 1NI3A 2NO6A 2RGAA 4QFMA 4QRHA 5FBRB 2R6AA 4XSHA 3GJ8A 4NCKA 1QDEA 2GZHA 1P9RA 4NP6A 1C1YA 3N2IA 3CNNA 1XPOA 3KQNA 2REOA 2D4HA 3BS4A 3GEHA 5J4YA 3BWDD 1G9XA 4NYIR 1SXJE 4FI3C 3SYKA 1U0LA 3MFYA 4M1MA 3W6NA 1Z06A 3K9NA 2GNOA 5G41A 2CCKA 4AI6A 5EXTA 4M1WA 5DI3B 4EJSB 2R65A 3BERA 4E22A 3EPLA 3IIJA 2A3RA 4I1OA 2J7PD 5JEEA 5K8TA 4AC9A 5K8UA 4FIDA 2XEXA 4Q9KA 4BLQA 1FP7A 3HJNA 1FP6A 4WZBE 3FWYA 3A1TA 3RWMB 2WJYA 2Q3HA 1G5TA 4Q7KA 1S2MA 2HF8A 2PT5A 2QORA 2A2ZA 3CZPA 5CK5A 1J8YF 2HUPA 1MOZA 1JJ7A 2OAP1 1TQ2A 1Z29A 5FTMA 2RGCA 2QBYB 4LCBA 1CBUA 3Q85A 4PTLA 2V1XA 1I4LD 4E09A 2Q6TA 3VTKA 2ZTSA 4P33A 1GUAA 1GL7A 4HDCA 5FBLB 4A2PA 1GIAA 2ZU6A 1CRQA 2PL3A 4DEXA 2NZJA 2H8KA 2JGNA 2VLIA 2XSZD 3NTUA 3QKTA 5KSYA 3TMKA 2A5FA 2REBA 2BJWA 4KBGA 4AKEA 2GAOA 1ESMA 5EXXA 2BCGY 1HURA 4D0NA 1UEJA 4TMVA 5E7JA 2ZE8A 5KHOC 1U8ZA 1UJ2A 4RD4A 3UG6A 3MMPA 4NMMA 2JA1A 4QGAA 1T3SA 4BZXA 1M2OB 4HUQB 3BIFA 2V6JA 4RCZA 1KNXA 5LD2C 4M21A 4LX0A 2KBFA 5CM8B 4H9GA 4Q1DA 3VR1A 4DLYA 2FSHA 2VBCA 5DE3A 1UBCA 4ERNA 2ZRNA 3KQLA 2YYZA 2F9LA 2GAAA 4CEHB 1ZC3A 1VTKA 3QVUA 3U3JA 1IY1A 5AJVB 2CK3D 3THOA 1CJKC 4DHEA 1NSTA 3PFIA 2VQSA 1QBKC 4ABYA 4DUGA 3LY5A 1FX0A 4LV8B 4B3GA 3U3OA 4F4JA 5GVRA 3WRXC 4L16A 4EQ6A 1S1MA 2IHBA 2W0SA 4D26A 3RDPA 2O8DA 1UAAA 3ICEA 4PR0A 5G40A 1GNPA 1R0ZA 2Q21A 2WWGA 3WP0A 3X1YA 5AUPB 1MO5A 1N6NA 4D81A 3E1SA 1V5WA 3LW8A 4KO8A 1E0SA 5D3QA 2IUSA 5JS8A 1SULA 1U0JA 5C18A 4NYIQ 4EFNA 1BS1A 4B34A 2GEVA 1AZTA 2W58A 4KSBA 1E32A 5E4FA 4AG6A 1RW4A 3THYB 1N3BA 4UXJA 3ZGXA 3PCRB 5BN4A 3SBEA 3KJEA 1YU9A 4BQSA 1JJVA 1TPZA 2ZVQX 5L3QA 3C5HA 3O8RA 5JLJA 2W6ID 1E3MA 4KU4A 2GRJA 5JWOA 3SQXA 4QC2A 4AD8A 4B74A 4NCIA 1FTSA 3JZMA 4PX9A 1S3SA 4MGKR 3A1WA 4JBWA 4B33A 1YZQA 5EJEA 2WM9B 1FW6A 4GT1A 3EASA 4IVQA 3FVQA 1W36B 3H1TA 2OBNA 2VHQA 1IN7A 1E1RD 3CUEF 5EZ6B 3UG7A 1T91A 4EPVA 5FL7D 2JDID 4B48A 3T06B 2J5XA 3BXZA 2G1JA 1DELA 4Y0AA 4P0TA 4CT4B 3CRMA 1N6LA 3NDPA 3CPJB 2XTMA 4BEJA 1N6RA 4OJKA 3KDSE 5AWFC 4TYQA 5FOUA 2V1UA 1G4AE 2WWXA 4IHQA 1UPTA 3I4LA 1EFCA 2YINC 4OHVA 2G3YA 3TK1A 1G3IA 4M22A 3N2EA 4CEHA 2HDNB 2PEYA 1R7RA 1GL9B 2OCPA 4MYHA 5LB2A 3C41J 1XTQA 2J87A 1E2MA 1YR6A 2XZLA 2ZYTX 4DC9A 4OI2A 5CITA 3PITA 3GFTA 3I72A 3U3MA 2QL6A 4RZ2A 3SU8A 1R2QA 4EPTA 3OEHA 1U98A 2VPPA 1OXUA 2D74A 2ZJ5A 3W6PA 2AXPA 2GZDA 4IEIA 5JSZB 1KOFA 4EQ6B 1Z47A 3RHFA 3DOEA 4CF7A 1ZCAA 2BM0A 3E5HA 4NH0A 5FUWA 5E3HA 4KXFB 2PMDA 3RRNA 2P6NA 3X1XA 4M1YA 3FOZA 4XVRA 3GLHB 1HT2E 4JVLA 3U44A 3QE0A 3MRSA 5FTNA 4QM6A 2OXCA 4IDPA 3GLFE 2Q0HA 1A7JA 4C0LA 4LBVA 1ZM9A 1Z6XA 2IYYA 4GSYA 4B2IA 4Z51A 3R8CA 1E2IA 4PZYA 3CPEA 2JLZA 2B8TA 2RHMA 2PT7A 4R71A 5CB8A 3THXB 2WAXA 4OHXA 1AIPA 2GXQA 5JS7A 4IDQA 1E9FA 4E07A 1RZ3A 2J0VA 5IT5A 3ZVNA 2ORVA 4B35A 4CVNA 1OFHA 4DSUA 5L3SB 1OFUX 4K8OA 5CIQA 1W4BA 1L4YA 3U4QB 2ZRIA 1SVMA 1K5GA 4UNQA 3FKSA 3UMRA 621PA 4LPSA 3FPAA 3PUZA 3UMFA 2ODWA 1TUEA 3OF5A 1NG1A 4A1FA 8OHMA 5EP2A 1IONA 4LV5B 5F2EA 1MT0A 5DLQC 1W4AA 4MGYR 2N46A 2GF9A 5DSZA 1WBDA 1GITA 1J2JA 2BHRA 3A1VA 1T3HA 3TQCA 3GPLA 2H92A 4QJ3A 1G7TA 1W46A 1IBRA 4JLKA 3NIBA 2D7DA 1YZNA 1OFIA 2GJ8A 3B60A 2PCLA 4US2R 1JXOA 4D82A 3E2IA 2QTHA 2KJQA 1OFTA 1T0HB 2XITA 5FTKA 4LYJA 1P2VA 1QHXA 5E7IA 1ONBA 1PZNA 2VP6A 4Q18A 4DLXA 1G17A 1E9AA 1T8TA 2HF9A 4II7A 2WVJA 3CH5A 3B6EA 2ZU0C 4NCJA 4OKSA 2IYVA 3HR8A 4AKGA 2IX3A 2NO7A 1KZ7B 2BBSA 5H1YA 3AF3A 1IAQA 4D0LB 5CK4A 1SQ5A 4I1UA 1Q1ZA 4DBLC 2C9CA 3QNUA 2CVFA 3AH8A 4MQBA 3AF2A 5HR5A 1RFLA 4Q4HB 2R6CA 2H7VA 5CIWA 5TARA 1KK2A 3K1JA 1R5OA 4M1SA 1UBEA 3NC0C 4Q9LA 2RGDA 2BMDA 4D4JA 1SZPA 3IEVA 2AX4A 4L9SA 5GJCA 5JJKA 2BEJA 3TE6A 2IA5A 4A15A 3K0SA 2G88A 3CZQA 4HAVA 1R0YA 2ZUBA 3PQCA 4WXRA 4AY2A 1R0XA 3AVUA 5KPDA 4GOJA 2RGXA 1EWRA 5EUQB 3CX6A 1HTWA 2WIBA 2JAQA 1QHGA 3MWYW 3ECCA 2GVZC 3IEUA 2ZJAA 3EZFA 4OI1A 4TL6A 1M7BA 2JLWA 4DKXA 1D2EA 3QBVA 5E7MA 3AB3A 2ECKA 2D62A 3OEHD 4FWIB 4LJAA 4D4LA 4XD7D 1KY2A 1QHIA 4D80A 3GD7A 5EZ5A 4B3FX 3V4RA 1NIPA 2O8EA 1E2FA 1G8FA 4HDQB 2F9MA 2WMNB 3RC3A 2OCBA 1J90A 3Q7PA 2PZFA 2JJ8A 2ZJOA 2NMVA 1E2QA 1R10A 4DEYA 3GLFA 2GBLC 2FMXA 2QPOA 2GKSA 4F92B 2ERYA 1D8TA 2J41A 4KITB 4QNRA 2WSMA 1P2UA 1JQJC 2V6IA 3CO5A 4AYTA 3FGNA 4KAXA 4L8GA 1Z28A 3U5ZB 4Q5IA 4PC3A 5CLQA 1SHZA 3VQTA 2W83A 1Z08A 2ODEA 4C9BA 4QGFA 1IN4A 3K0FA 4EPWA 1Q1BA 5TDHA 1AA9A 1M6NA 4M2LA 1FL9A 3K0FB 1L8QA 3X1ZA 1A82A 1GWNA 5KU1A 1S9HA 3LA6A 5CDFA 1XTKA 2D7CA 4L15A 2W2TA 4LYAA 1Q57A 1ZVQA 3AVYA 1LFDB 1E96A 3DKPA 4QXAA 4B47A 4HLCA 1NSFA 2WOOA 4JLVA 3QKUA 4E5UA 1NRJB 4FD2A 2G0NA 3NHAA 2QSZA 3GEEA 2LWIA 4KV9A 4Z54A 3AUXA 3BFKA 2GDJA 1H65A 3UANA 3A6PC 1NVXQ 1E2LA 1G7SA 3W90A 2WJJA 2QP9X 3CX7A 4ZO4A 3NDBB 3AF0A 3A1SA 1KY3A 1ZJ6A 2VF8A 3T35A 5KSZA 1P4SA 5FOVA 4YMTA 2GEDA 3U6BA 5AR1A 5IRCD 4D4MA 2E9SA 2XJ4A 3P4YA 1YKSA 3WP1B 5CDFE 4IOLA 4RFVA 1E4YA 1HV8A 2Q3MA 3WRYC 2J1LA 4IOJA 1U8AA 1JR6A 2JJ1D 1J7KA 1N5IA 1MO3A 1P2TA 5FUVA 1XTSA 2QAJA 4TYPA 2IYRA 5FFMA 1DVRA 1ZUNB 4ZDKA 4PPGA 3TIFA 1HQCA 521PA 4CEIB 4E03A 4JVNA 1QHHA 1Z83A 1R5BA 4RZ3A 4UNPA 2CJWB 1QVRA 2HXYA 4LJ5A 3W6OA 3U6KA 3LWNA 3GMTA 1NVUQ 1W7AA 3VX3A 3KB2A 3J81k 1LNZA 2XZOA 3L8ZA 4QOSA 1XU4A 2WOJA 1CULC 3NBFA 1Y63A 1N6PA 2J0UB 4ZCMA 1FOEB 2EQBA 2QMEA 3U7HB 2QAGC 4KI0A 4UJ3A 3W8RA 2J0UA 5K8IA 1W48A 1P9NA 3H86A 2JLSA 4Q1EA 3THWA 1OXTA 1GZSA 1NN0A 1XCPA 5EE9A 3REFA 3BOSA 4EUNA 4MRPA 5IHPA 1VKJA 2AR7A 2QA5A 2QM8A 4WZAE 2DCUA 4GMXA 3CRQA 1Q44A 3RS0A 3MD0A 4C0QC 2OFWA 2QI9C 4JBXA 1M7HA 2ZJ2A 3H4MA 1XXHE 1E2PA 4BFXA 4XSGA 3KFXA 2YOGA 4EJSA 4LHYA 4M4SA 1CEEA 3HU2A 1RRCA 1PLKA 4XD7A 1VCOA 5K8LA 3LLUA 4W9MC 2YWHA 1VYUA 1KDOA 2CXXA 3AGQA 2GBLA 4GRAA 4TLEA 1Z0IA 5JMTA 2QQEA 1MH1A 3FYHA 5H70A 4AKIA 1E94E 1ZBDA 1OYYA 3TR0A 4HAZA 3ASYA 5FBVB 4HB0A 2ERXA 1CS4C 2QMHA 2JLXA 3F5FA 2I1QA 4QBHA 1IN5A 2H1LA 4RCYA 1G41A 4V0OA 4EKDA 3BFVA 4I99A 1Z2AA 3QBTA 5KNDA 3C16C 1OV4A 2AWOA 2XXAA 2F3RA 1ZM7A 3GLIE 4V03A 4WXPA 2IS1A 1ZAKA 2J46A 4NKRA 2AHOA 3EG5A 1P9WA 1ZIPA 5A0FA 1VCMA 2A9KA 1XB2A 1GOTA 1FQKA 3QKSA 1OXVA 4PSKA 1KDTA 1D9XA 4BRUA 3LAWA 4LHXA 4NZYA 3IBYA 1ZD9A 4PC2A 3P27A 3PEVA 3QG1A 2IS4A 3IKJA 4AIIA 2E1RA 1DAGA 4RFSA 4LRWA 5BWMA 2Z5FA 3K0CA 3PUWA 3QF7A 4FMBB 4IDHA 2W2VA 2XJ9A 4Q00A 4BFWA 1Q0UA 2Z83A 4ESHA 4TYYA 2BDTA 4JLJA 5JI2E 2P5TB 4IFBA 2IUTA 2AL7A 3EXAA 3Q5EA 1NBMA 4KVAA 3CF6R 3PUXA 2C96A 3A37A 3EPKA 5EP4A 1JEDA 2WKPA 1JXMA 1OXXK 1M74A 2PJZA 3MJHA 2V54A 3EC2A 1ZM2A 3HP1A 3OFNA 1D2NA 1NLYA 2IYXA 4KSCA 1XD2A 4N0EA 2N42A 3B1VA 3BB4A 3HU1A 3KKMA 3FMIA 2NPIA 3ZQ6A 3BGWA 1AS2A 2CE7A 3A4NA 4C0JA 1XEFA 5J4HA
chains in the Genus database with same CATH superfamily
3KYDA 3L07A 1P7VA 2VQ3A 3IKMB 2VF2A 5KYXA 4OATA 1H3FA 1GDDA 1XG5A 3QF4B 3BREA 3R0QA 4N8EA 3RGGA 1T2CA 4URVR 3EPJA 1NVAA 1T1EA 3TM5A 2RE8A 2XQVA 1H0KA 3WJ1A 4RANA 1IMJA 1ORWA 1Y9JA 5AKYA 5T64A 3B6IA 3QXSA 2OYCA 3X1WA 3SJBA 2QR3A 2XW6A 1BFUA 4LV6A 2IXGA 4I55B 2EFEB 3JSXA 1R27A 4Z1MD 4DKJA 4NMLA 2IOFA 3RTBA 1BZYA 1P77A 2FOIA 2Q9AA 4KE9A 1H4SA 3RC7A 3BRWD 1MORA 1C8KA 3FPEA 3RREA 3UK1A 4IJMA 1KO7A 1NT2A 2CY0A 4BLUA 2N1BA 4R2HA 3SXUA 4E5NA 4B3IA 4E2YA 3I42A 3MCZA 2Q4EA 1JEQA 1XMVA 3D3JA 4YO7A 2BLLA 2QTLA 4DREA 3FUVA 3WBJA 1JDSA 1I36A 3C8ZA 4UBJA 3GDGA 1TZMA 3GJ6A 4EEXA 2ZRPA 3UMVA 4JU9A 4P3PA 3D1VA 5IBCA 2Y2VA 4BQNA 4P83A 5C8YF 3ZCVA 1RCFA 2ETXA 1ZH0A 2OHVA 4RBNA 4AF8A 1YS9A 1LW7A 4TTQA 4TLLB 2ZIUB 4YRJA 4A16A 1T6NA 3A27A 2HREA 4DMRA 1NXVA 3V33A 2N3ZA 3ZHZA 4HH4A 4NE2A 2M98A 4RDXA 3E18A 1SK9A 5CVUA 2AFHE 1X7DA 3FSGD 4OHCA 4YWJA 4A2WA 5BUCA 4L5IA 4B4VA 5FJIA 3EGWA 3O8QB 1L4EA 1LZLA 1PJ8A 3GJZA 3PJEA 5A3VA 3NBZC 4X7RA 3W78A 1JN0A 1E4EA 1TXGA 1WXQA 2OBBA 3CZ9A 3GMSA 4JJFA 3AMVA 3IL2A 2PLWA 2QR5A 2ZBRA 3QVOA 3T3IA 5BVHA 5A3RA 1WWKA 3E27A 3GYGA 4WUVA 1DT5A 3GBPA 3RRJA 4HS4A 2VDLB 2RMKA 3GDHA 2NZ8A 2Z98A 1PCXA 3EBPA 2QUHA 5AI5A 2QRPA 2JRLA 4AUKA 1YD7A 2HU5A 4GO1A 4YONB 2UYQA 2PX2A 1IRXA 1EU1A 4CF5A 5K51A 3R3ZA 1YRBA 2PO5A 2SHKA 2BFEB 5DSXA 2O8NA 1HDYA 2F00A 2VVTA 3DZBA 3H5VA 3O93A 1GCGA 1MDFA 4OGKA 4R05A 3FGPA 3MJRA 1W88B 4H1VA 1DKUA 2ZYIA 1HE1C 2PMBA 3DCJA 3UOWA 4GM0A 4OY3A 3E9MA 3O5AA 4C7VA 2VBGA 1FFHA 2GN0A 2NVUA 1JKXA 2B5VA 3O9ZA 4YJDA 1Y6JA 1TM2A 3ZV3A 4BEBA 4R4JA 2UDPA 2A0FA 1QO9A 2CFIA 3IP7A 3KKEA 3FNEA 4A6XA 4LVNA 2B1IA 1LZKA 3GRAA 5ARCA 4M7PA 1NQUA 1VJGA 1UXHA 2J9XB 1U8UA 2ET6A 3FD8A 4FYXA 3TIXB 3MUNA 3R7SA 4B3XA 1XTZA 4DCTA 4YRMA 3NR2A 1Z17A 1JALA 1JFRA 1PJ2A 3D7KA 3QQ5A 4BLOA 2BMAA 3EXHB 3FNGA 3HVJA 2P2DA 3HVHA 1EB9A 5BSVA 4V3CA 1W6UA 4TT3A 4BE9A 1MW8X 5HJEA 3VYUB 1T35A 4IMJB 4LXUA 5ALMA 4E6PA 5LKRA 1WW8A 4RF2A 1SUIA 3R0JA 1VB3A 1MUUA 4OA8A 4C5CA 2UZ1B 1D1PA 4O25A 1TMKA 3NHJA 4GZMA 1ZAYA 1VA4A 2WRZA 4B79A 3USZA 1C9EA 221PA 2FSSA 2GASA 3PPYA 4HWGA 3L41A 3L82B 3ODPA 4MVCA 4DT1B 4RULA 3TG8A 4RKYA 2LIVA 1XCLA 1DCTA 2P5YA 1T3ZA 2D2XA 5EMNA 1IVSA 2J0SA 5KDLA 4A36A 2VSFA 4Z0NA 5IKOA 1TCUA 2W6PA 5REQA 4YXWA 4EI2A 4OX9Y 4QDJA 5TGDA 2FFQA 2G36A 3LA8A 3LQKA 2ASEA 4JI6B 3SYLA 4RTRA 3TLZA 5EVJA 2WWYA 4J90A 1Z2NX 3I76A 4GNRA 2BZ0A 4QULA 1CQIB 1GN9A 5DYIA 4CF4A 1VLJA 3L7MA 1NJ5A 2C42A 1DBPA 4ZT6A 3THYA 4IUCS 3KUCA 3QVXA 4CL8A 4L5BA 2HWWA 3T4EA 4I8DA 4NABA 2B1JA 2JIRA 1OAOC 4GZ5A 4P81A 4G9EA 4NJEA 3HBFA 3CW2A 1CZRA 2A5LA 3PDJA 4YDRA 1G7CA 4JSRA 2H5JA 1RSZA 2QTVB 4KGDA 4ZYTA 5B3LA 1P39A 3CRRA 1QP7A 4AN1A 1AMNA 2AOUA 3R40A 4LFAB 3C6MA 1XD2B 3EGXA 4RKFA 3BSFA 1CJVC 3I9V1 1N0VC 4X97A 3B9RA 4EO4A 4GL4A 1U90A 5ERXA 3WFIA 4GI2A 2FUEA 1C50A 1GRQA 4TMKA 1RWNA 3ER8A 5HZHA 1T0PA 2P41A 1DKLA 2A8YA 2P9JA 3KSDO 4QU0A 5E1OA 1FZTA 1Z4OA 1P6XA 3P5SA 3HM2A 3L0IB 1SVIA 4MSUA 5D5QA 5AQEA 5JALA 1J00A 4YV0A 3HBNA 3F9RA 3L1KA 5TLSA 2FUNB 3TLBA 2YDYA 4MS3B 2R48A 1R0CA 1ZX1A 2XMZA 2W6QA 4H2DA 3UXMA 4W6QA 5A6SB 3Q10A 1W8DA 5TF4A 2KE5A 3RVQA 2DUUA 2FB9A 1QH8A 1Z82A 4XLTA 1QYRA 5DO9A 2UZ3A 1CR1A 4MAMA 4C05A 3QFSA 1K7CA 1NWHA 3MS2A 3HCDA 1S7GA 2VWHA 2GPAA 3QEOA 3ZUGA 3SS9X 3ZX4A 2BKUA 2ZB8A 1K4MA 4QTXA 3KSZO 4QVKA 3T1QA 2OYRA 2ZSJA 4AK9A 2O8FA 4X84A 2R1TB 1DEKA 2W5UA 3ET5A 3JQ8B 3BK2A 3KHKA 4GVXA 4HNRA 3VR6H 3ZS9A 3IILA 3NRJA 2RG1A 2R6R1 1DJPA 3TLXA 2D5CA 3VO1A 2X2EA 3U56A 1G2QA 1L5YA 1I1QB 2RKWA 3VKUA 2G4LA 1NRXA 3L4SO 4XPIA 5JCOA 5BN3B 2IF0A 5COBA 1M33A 3PQ3A 1ZUWA 2XGMA 1JBKA 3W2HA 1LLQA 4GKBA 4YYZA 4MR7A 3DHNA 4LOIA 3KQVA 3M5PA 1OH5A 2HSDA 1UBMS 5JSYA 1MQAA 2FQQA 5LLDA 3GLGE 5CJPA 2IHVA 3C3KA 1RC1A 5CDUA 4YHHB 1DRKA 4RFSB 3OEWA 4D74A 3P9PA 3DEIA 4EOGA 1A4IA 4FHDA 5JSFA 3KOXA 4HGPA 2JBAB 5DHTA 2YVLA 3M9LA 3TX2A 2AR0A 1IN1A 1D2MA 2GT1A 1D5CA 5C31A 3V4FA 3SMQA 4IGIA 4XIYA 3WBKA 4CI9A 1QFMA 1XR3A 1DTSA 3FMGA 1H8ED 3VU1A 4IO0A 4E1BA 5CDGA 3W7VA 2XE6A 4R8LA 4GKKB 4DILA 2F8MA 2VJYA 4PZDA 2BKXA 1GPYA 4ZT5A 4HX2A 2JPDA 3BSSA 1Y8RB 4RH1A 3OPMA 1O0SA 2PH5A 2IYQA 4HPXB 2CKDA 3EQ6A 4NONA 2WTBA 3FA2A 2YOFA 5FFFA 2SKCA 2A1IA 4PXYA 4B7CA 1YCDA 1OB5A 2VDPB 4XXHA 1FBTA 1U5BB 2CNNA 4WCFC 2Q8QA 3VUFA 1N2GA 4J7XA 1EK0A 5AOAA 1GZUA 1OI2A 3OEED 3FLMA 4GPIB 4HYQA 1N0HA 1G63A 3ZIDA 5F4ZA 4BNHA 1UADA 5AHRA 3RJ5A 1U5BA 5H4HA 1AGYA 3MCVA 1NF8A 5E9AA 3SBXA 5JH7F 1L4BA 2EXXA 3F9CA 1V45E 3G2HA 4KPGA 2F3QA 2GWRA 2E85A 1U8XX 1JR3E 1UKZA 1ZJ4A 1SA0B 2NYVA 1KMNA 4FZ3A 3H6GA 2EQ5A 2IC5A 3M4NA 3O84A 4GI5A 3UMMA 4ECEA 5CXUA 1IFXA 4NPCA 3TTSA 1ECFA 4MZXA 3AZPA 4FI3F 5FQNA 1M1YA 3J7TA 2X1VA 4L5YA 1NVVR 3MBKA 4GRIA 4US0R 4BMCA 2V5AA 1XC7A 2VXCA 1KSFX 4TKMA 4E11A 3DZGA 5EXPA 3PQEA 3EW7A 3ILSA 3BE4A 3K70B 2HZ7A 4R1MA 1NBEA 3IHTA 2FPPA 1ST2A 3OZ7A 3OLZA 3FTQA 2VP0A 5GAJA 3UEOA 5BORA 2NOAA 1Y6GA 1DB3A 4RAQA 4AYWA 4Z3KA 1N0UA 1YZUA 4RPHA 1KWKA 3I9V6 4IGFA 1W93A 1AHPA 4M1TA 4DJJA 1H2HA 4BO2A 4PU0A 1UZNA 3TD9A 2R1ZA 4FBLA 1VIAA 1HFEL 1ECPA 4EGQA 4KH1A 4S0ZA 3VHXB 5AW4A 2G8LA 1W75A 4P7FA 4V2UA 3SZ3A 4BWVA 1TF7A 3E7FA 4CCAA 4ENUA 4ZYZA 2QB5A 4WJLA 1XJWA 1M8PA 3UPUA 1V37A 1KZ9A 1UOOA 4ZRDA 5FORA 2XF2A 5CVTA 3N8IA 2XF8A 2V9ZA 3EISA 1WV1A 5BN5A 4FUTA 3G88A 1KZ4A 3MJSA 1XHEA 3L4EA 5CBPA 4FWTA 2POCA 4NENB 1BS2A 1FSFA 2H0QA 3MB5A 4HWOA 1MABB 1PVDA 2Q6LA 4OH7A 1HZZC 4ARZA 4L72A 3MWGA 4UD6A 5FBHA 2BJHA 4KLRA 4BVEA 3K72B 4BTLA 4K9KA 3WA7A 5KKCA 4CEJA 1Z6GA 2PYZA 3OE5A 2GCIA 1TVEA 2M6SA 2QRQA 4GLFA 3PFGA 4JP8A 4MW5A 4NJEB 5HG0A 3NWJA 1CJTC 1G8AA 1O9BA 2G6BA 2JFXA 4OLAA 4DQ0A 3TWOA 4TS1A 3IEPA 3I8XA 3ZE6A 1X7XB 4UVIA 1RYZA 2ZS8A 5IT4A 1KOJA 1JEAA 2O2GA 4EJSC 1JFVA 2HCBA 3N2YA 1EG2A 4PLWA 1PW7A 1ZI8A 1F14A 1HYEA 1YJBA 2EC5A 2X4LA 2VPQA 1E64A 4ZVSA 4E33A 5IS2A 3DOFA 4LNHA 4NSNA 4TQGA 5F2KA 3W3AD 5LUAA 3QUTA 4U7JA 1YR2A 4ENTA 3R6WA 2O54A 2W9XA 1UT8A 3EWNA 3KT8A 4K1LA 3KU4A 3N2LA 4A03A 5CBKA 2C4UA 1IZ9A 2V55B 1SC9A 1K27A 2YV1A 1Z25A 1RWKA 4RPLA 1PSDA 5JS7A 3UC9A 5MN4A 1UT5A 3FHOA 4IRMA 2GILA 3OKCA 3RVBA 1NUHA 3K1YA 1UBLS 1TOAA 2X1LA 1MO6A 5LVAA 1H6BA 4ILKA 4PRYA 3KEFA 4ZN6A 2CF5A 1YIAA 1Z8FA 2PXXA 4GPAA 1Z39A 3V1KA 2BMWA 1COWD 4RXMA 2O7VA 4MH0R 2R8YA 4FNAA 2F90A 3VHLB 1JA0A 1CB0A 1L7MA 3O9VA 4KWCA 2R8ZA 3DP9A 1O95A 2ON6A 2YN0A 1E63A 5DP1A 4IRUB 4KNVA 4B44A 3WOHA 2BDEA 1UT6A 3NBYC 2P79A 1DKOA 4O2AA 1D03A 4LY9A 2BHLA 3EEFA 3FB4A 3SNHA 4CM7A 1VXRA 2FRDA 2PSHA 1J2TA 5HHTA 2CLEB 4BO4A 2F4NA 4A8JC 3C3BA 3KUUA 4N65A 3EGEA 4PM4A 3WYEA 2V4ZA 1A9PA 4G84A 2FG6C 2F1KA 4HLUA 5FT9A 8ADHA 4JVOA 4XTCS 1VPLA 4J1NA 4WUTA 4AY6A 1N9ZA 1TIKA 1M1UA 1VJ1A 3QPWA 4GR9A 4L27A 2Q6OA 3E6AA 4LWQA 1DG3A 2H17A 2ZYVX 3CEMA 5CCEA 4IQ8A 2RCYA 3L92A 4R83A 2E4UA 4OK6A 1XJQA 4KVZA 2IEZA 3NTVA 1MX5A 1RC0A 7MHTA 2PPVA 4N8SA 1LPAB 5KYUA 3DE3X 1EQAA 2EG5A 1W73A 2W8BA 2WT4A 4P2BA 4PWZA 5HE8A 4UHKA 1SBTA 3K9CA 4AM8A 3HK2A 2PH7A 3TCNA 5IF9A 3QX9A 2KX7A 2AMYA 2CLCX 1J49A 1QJCA 1XCJA 2ZI3A 4XYGA 4DDTA 5I47A 5HYVA 1S3GA 4HDAA 2DTDA 3DZ8A 1ACJA 2BP7B 1Q20A 2HBRA 3ABRB 2NSDA 2WY2D 4V0ME 4WHMA 1AUOA 3DFZA 3GEMA 4ZZ1A 2F8TA 3ELDA 3SI7A 4JP1A 1E3DA 2BV3A 4DCJA 1UZUA 4IIEA 1EYZA 4HH0A 3EXIA 4WFJA 2OV4A 5F7ZA 2CL7X 4RWZA 4ETNA 2ZRHA 2BFWA 2HPZA 4PC1A 5T4EA 3WMXA 4LFBB 1KFEB 3JW8A 3PLNA 4ZT4A 2JH8A 2VHVA 3TD2A 4Z0TA 3I9NA 3DOCA 5BV2P 1UK7A 3Q0EA 1XDZA 2Q29A 4CFYA 2GCEA 4BQEA 1VG9B 1XCMA 5CM2Z 2IH2A 4M9UA 4CR6A 4CW7A 3DNMA 4RVCA 1NNSA 1G3MA 1OJ7A 2R2AA 3PL5A 4JYPA 4KFRA 4PZ9A 5AW0A 4BASA 2O52A 3AHCA 4TLBA 3FOEC 4QU5A 1JR3A 1CVRA 2EL9A 3E9EA 1WTAA 3N8HA 2PWYA 1NE2A 1FRZA 3LX6A 2VPIA 3EVGA 3NT2A 4JBYA 4WNYA 3ENVA 5H81A 1XQ9A 4EARA 3KKPA 4AJNA 5EUBA 3I9FA 3U7EB 2XCRB 4IJWA 1DXQA 3CVOA 5CA1F 1EXWA 4WV3A 3ZV5A 2P0AA 4ABTA 3KJZA 1UXJA 3RWOA 4AJIA 4UTRA 2FW6A 1QQ6A 4YMGA 1ZOOA 3TKYA 5DYTA 2W7TA 1YZHA 3OZDA 4J49A 4Q21A 4YMIA 3EARA 4BNLA 3AFIA 4GE0A 2BMFA 4UPVA 2ZUCA 3INGA 2CGEA 5EE0A 4KE8A 3HVUA 1IVYA 3F5SA 4E1VA 4KJXA 2ZJBA 2JFFA 3ZWNA 4PFKA 3CLUC 1N2BA 2I76A 4Z9YA 1YH3A 2CLLB 4OHFA 1QOZA 1NBAA 1R6XA 3KZ1E 3PFCA 4GQAA 3CF4G 4LQDA 1VKHA 3L06A 4MLZA 4LC0A 1QSGA 2EP5A 5HF9A 1ESNA 2Y66A 2EW2A 2BF7A 4ITRC 4JMPA 4QPPA 4ZGWA 4ZCLA 1GYPA 1ULBA 3WGYA 1YMVA 4ZK6A 4RJKA 1VMEA 2QPAA 3BTSA 4QXQA 4Y2SA 3LSYA 5EQJB 5IH3A 2XEDA 3V8BA 3VR5D 4DIBA 3U7GA 2VWPA 2CE2X 5A2QA 5JH7A 1NG9A 3C3YA 4C76A 4CI0B 3UAGA 4E3WA 4F9TA 3OD1A 1SJ9A 4JNKA 4K1XA 3S8MA 3VYRB 3R9WA 2ANCA 4PQEA 1ZNWA 3AHIA 4GSKA 5AP9A 2EEZA 2WILA 4RMJA 5FTJA 4JK3A 3WGZA 2QMOA 2OO7A 2W2MA 3HC7A 2Z2JA 4IXMA 2G72A 3HR4A 2YQ4A 4KQXA 1V3UA 4MVJG 4PLVA 3TK1A 3VX4A 2H00A 5LDHA 4FMCF 5T41A 3ECAA 2W2KB 3R77A 2QK4A 2V8BA 5EA2A 3GB9A 3ESXA 4RSMA 4X8OA 3AW8A 3PS9A 5FOSA 4C78A 4MTCA 1FNBA 2JJQA 1CFJA 2CD7A 4RTKA 1KYIA 3SX4A 4G8JA 2MSDB 1V3TA 2GK4A 4OHUA 1D4OA 3JWJA 3KRTA 1SXQA 2PX6A 1XDBA 5JBIA 4QO7A 1ADYA 5L6MB 3RROA 3PFFA 5CXQA 4MA0A 1KEKA 3X1KA 1RJ9B 3K20A 5BN3A 3LNTA 4Z4IA 1PL7A 3LY7A 3CNHA 4MR7B 3D7NA 4IP0A 3DUFA 1L5FA 1E6KA 2II6A 1JAZA 4HMQA 4MW7A 4TWBA 1FXSA 4HUJA 4NNJA 5IAKA 1X94A 1ZMBA 1EUYA 1G8YA 3BORA 2QG4A 4XWYA 1THTA 1C1DA 1KH2A 2V6MA 3CVYA 4V1CI 3D3WA 3LFHA 4OBEA 4DLAA 5L6LB 2AYYA 1Q7BA 3SP1A 1ZIDA 3CCFA 3L8EA 4F0JA 1E1MA 2GPJA 1ZINA 4UNSA 2YASA 4D2IA 1PJ3A 5LU9A 2QNRA 1KO4A 1OBVA 2ONKA 1JE1A 2XBMA 5I7VA 4IIDA 1W4CA 2D5LA 1M6WA 2QP4A 3W8NA 4EW1A 2OV2A 5E95A 2OCDA 1F6BA 4HAUA 5HZGA 3DF7A 2FOLA 4JQSA 1ABBA 1T6YA 3CX3A 4I4IA 4DJEC 4QHTA 5A4DA 1H85A 3KBBA 1XK7A 4OQXA 3OHMA 3K4QA 1Y5RA 4KMRA 3SZOA 1S2GA 3S2IA 4BIIA 4BWFB 2ZRDA 2BWJA 3FHCB 2E4YA 2ZI5A 1WO8A 3UJ3X 4JQYA 3SQWA 4ESVA 1PTJC 3KWMA 4W9NA 1CQJA 1XRSB 1SPXA 2BD0A 2SNIE 1NXQA 2PBLA 1BJTA 1IK6A 4W4TA 4OBXA 2PAFA 3JARB 2AEMA 4M49A 5DX8A 2QTGA 1TJ3A 1UPCA 4H27A 4XGNA 2GEUA 4YBZA 2WAYA 3DVRX 4C0XA 5F2NA 2VZLA 5CA1A 3ADOA 1Z8DA 1U9ZA 2PMCA 4F93B 5HZMA 1FLDA 2VP2A 1ZIYA 1DTWB 1YQEA 1VE1A 2FW9A 2J9GA 2MYTA 1E7RA 1OT5A 3CONA 1AS0A 2GGSA 3CW8X 2ZETA 3PQDA 2R9VA 4JSYA 5EMMA 2Q2WA 2P3OA 3N76A 4GZ6A 3E3MA 4BKQA 3CLTC 1M1NB 3PJGA 4OUDA 3QEJA 1WXWA 5HM8A 1OVMA 3KTAB 5CURA 1QTQA 4FFRA 5CFRA 2B5WA 4J1TA 1BE8A 4NBNA 1Z5WA 1LDYA 2WU1A 5LIRA 3QBJA 4DPMA 1U0OC 4DLWA 4LSGA 3GJRA 2HBZA 3UJPA 1PR0A 2A1UA 3U39A 2REQB 2CHEA 2XWQA 1TYEB 2NV0A 5AW1A 5J4VA 5MHTA 3TLGA 3G7SA 3R5HA 3BBLA 1UBUS 1KZ6A 3V8RA 4AJ4A 1PGQA 4LYYA 3JYHA 1QIGA 4K7JA 4ZI2A 3I6QA 3R3HA 2E2WA 4AMGA 1BKYA 3O1JC 4M0DA 3EVZA 3K05A 5F21A 2DTEA 1OW3B 2C59A 3JQ9C 4EKIA 1RVDA 2DWUA 1J2YA 3ENNA 4CIAA 3SEAA 1C14A 1WBJB 3WHIA 4JL5A 1J39A 5BRJA 4HNAB 1U99A 1KI1A 1J0AA 2V7QD 2XXBA 4LYGA 4FVTA 2ZIFA 1RRPA 2O2SA 1MOQA 4INZA 4B4DA 3M6IA 4Y8VA 721PA 3DMYA 1LS1A 1T29A 3C6KA 3SC2B 3LVFO 2J0EA 4BX0A 1JB1A 1DPFA 1VL2A 2XUHA 1IOLA 2GEJA 4PTYA 1X9GA 2AJCA 4U6QA 3TOSA 1JG6A 3TZCA 2JGRA 4ZOQI 3CW9A 4REOA 1LWOA 1X8JA 4UDNA 3T54A 4HB2A 5B55A 3D64A 1TYAE 4E15A 3G82C 3P9YA 1W1WA 2C07A 3EVDA 4LFCB 2FSGA 2YJ4A 4NF2A 2AS0A 2EJWA 4B76A 1K75A 2YVKA 3HI4A 1DRWA 1U2TA 3FGZA 2X7XA 2IH4A 3MPOA 2X7HA 4ARBA 3C7KA 1SVLA 4C22A 2YKGA 2P7IA 5K3SA 5JG7A 2J6IA 5FEUA 3ZU4A 1AT1A 3UHFA 1LJLA 1QO7A 3TJZA 4KIWA 3TLJA 2GZSA 1QFXA 3IPLA 3IO3A 4OFBA 4DMCA 4LZAA 1R5NA 1SUSA 1DHTA 4IZHA 1G5IA 2Q0SA 4TTIA 4W63A 3BMOB 2NW6A 3V55A 4I0WB 4YJHA 1GSAA 4HT3B 2PO7A 3EZGA 2FQXA 4FCVA 3U0BA 2QNIA 3ZKAA 2ODBA 1YQWA 2WTAA 3GRPA 1N5OX 3DZFA 4PFJA 1JVSA 3GOQA 5K2MA 4YRIA 4PANA 4TRNA 3WYGA 4ARVA 1AQ6A 1QZZA 3M6WA 3WWZA 2DHEA 4QDZA 3LGSA 1U7UA 4RLFA 5ALEA 3MMNA 3PNVA 3IGFA 2O7NA 1Z8HA 2GUWA 4MI9A 5IAGA 4EPYA 4PG6A 3UN1A 1JKMA 1V16B 4KHPB 3JQ6A 1IM8A 3N70A 3O3MB 3OFVA 3RVJA 1GUDA 1IL0A 5K0TA 3U1VA 1KMQA 4AAYA 2QRHA 3BMCA 4J0CA 5AW9A 5F9HA 3T6KA 3MIIA 3AR8A 5DTJA 3GA7A 4FFWA 5TEVA 1AQJA 3F49S 2HO5A 2OBLA 1EHYA 1R0KA 1TM5E 2XBUA 4KAJA 5CDTA 1W0KD 5KOHB 1EP3B 4JVMA 4BE4A 3NVKI 3TZBA 5HX7A 4BFCA 3H11A 2GYYA 4BMDA 1DV1A 4LNAA 3R0VA 1P1HA 3UT0A 2NP6A 3E61A 3C87A 3OEEA 4C4XA 2ORIA 4QPCA 1QMPA 5TNXA 2CWDA 1DX9A 1FDRA 1TX4B 3X1DA 5TVKA 2MSLA 4F4UA 4Y3UA 3PE3A 3A10A 4MWDA 2VSYA 3AM5A 2RG7A 3WIBA 3EIHA 4KRGA 1N34B 3VJRA 3RG2A 5AW7A 5EINA 5J1TB 3UFXA 1KARA 2W4IA 4TTPA 4XEUA 5F7OA 3I2YX 1GILA 4LXQA 1LQTA 5H68A 3WJ7A 4XIJA 5DIFA 1Q5PA 1YJQA 2J5BA 2FFJA 1U0NA 2WHEA 1MB2A 2ZRLA 4HSEA 3QP9A 4W8HA 4NJOA 1P31A 3QUAA 1GFSA 4BC1A 4BYGA 4JROA 3G1TA 3IBCA 2BOVA 4LQLA 4RHCA 3SHFA 1TPYA 2ZWOA 4MQUA 4QODA 5EG5A 1XP5A 3H4VA 3UMGA 1QHNA 2IOYA 2HX1A 3KUDA 3OEYA 2D6FA 2OVBA 4YUVA 4WBNA 1Q1QA 2NZVG 4TSFD 2J6BA 3FRHA 2C29D 2GR9A 4JXXA 3VU3A 5HFNA 2XNKA 1JTFA 2HIHA 4JJEA 3WLRA 3KNZA 2FUG1 2R62A 2C5GA 4IYJA 3K9HA 4JAVC 1O87A 1T13A 3VHXA 4N39A 1IBKB 1E6MA 1LRKA 1X86B 1Z36A 2CHUA 2E55A 4LF5B 1KZGB 2P2SA 3FKQA 1TB4A 4CM1A 4R7ZA 3F3KA 3DBLB 4BPRA 1WPRA 2P9BA 3AERA 4G0VA 2O2ZA 5EQDA 2G9NA 5K0EA 1JHRA 1RQXA 2XYPA 3H6KA 1YZFA 3C74A 1QE5A 2VAXA 4OB8A 2ZSIA 3IUQA 2YS7A 3L8DA 4QIHA 4KFCA 1A69A 5C0OE 3K9QO 3WV5A 4AF6A 4P82A 1MO4A 4KX3A 2NNLD 1I4DD 4KIFA 1XP8A 5TV2A 5EJMA 3ELYA 2I34A 2R8BA 3GARA 4CLRA 3HCBA 2P4UA 1X74A 3GLQA 4MKIA 1KQOA 1U7PA 4G3XA 1BGWA 3NHBA 2V7PA 1NYQA 3ID6C 1A8HA 3OPNA 4KC0A 4QDUA 3EXHC 3O91A 1NY6A 4CM8B 3EDCA 1DGQA 3LYAA 2WG0A 4J16A 4GOKA 1CX9B 1AS3A 3GBVA 2B61A 4P5EA 3ROKA 3T38A 3HV2A 5BUSA 3PDHA 5C7OO 5LQCA 3DPIA 2QT9A 4LDQA 4W7SA 1ZO8A 1EEHA 1KI3A 1Y6ZA 2I2WA 2WW8A 2XAAA 3KAQA 4XLLA 2WZDA 2Y4NA 4OLFA 2RHLA 5CVJA 1KJZA 5AI8A 3GUUA 4RDHA 1M34B 1ULAA 3M70A 5FUXA 3GP8A 3UV6A 4OXNA 1JAYA 2FCAA 4U63A 4FLMA 5AW2A 1Z4IA 2HFJA 1ZNYA 2VJPA 3JQ8A 3DQPA 1FFXA 4EDHA 4QGHA 1ZUNA 3EJWA 4FHFA 4IXNA 4RZXA 5BXQC 3Q8KA 3L7OA 5IW8A 5CG2A 5AXBA 4UU1A 3GZJA 3V9AA 4N48A 2GHQA 4P54A 4HAXA 2XQGA 3FYUA 4QAQA 3SJZA 4DWOA 1OI4A 3O8LA 4JNCA 5BYJA 2GFIA 3W1EA 4P3XA 5K2OA 4NCBA 2Q99A 3WGJA 1MA3A 4FS8A 1P8AA 4X6XA 1BCSA 3EPPA 4TXMA 4OMDA 4A7PA 4BVGA 2X9GA 4E51A 3PTAA 4DDMA 2V7UA 3RTDA 1WHTA 1G0NA 4JR0A 1TW2A 2FFRA 3L8YA 2BAGA 1F7UA 1JTEA 1FCJA 3ZJ4A 3JZAA 1UOPA 5KEIA 2HSGA 2XUDA 3SS8A 3T5MA 3STXA 1OHHD 3ANLA 1LQUA 4KHZA 4ER0A 2H57A 5J43A 3SF0A 3GRYA 2R6FA 1CIJA 3HCCA 1JJFA 4ND8B 4RKWA 5CG1A 2WM3A 1P1IA 3QW2A 1JB9A 3GAFA 2ONCA 3NTRA 5FYQA 2P2CA 3OOYA 3QOFA 1HTBA 2FVXA 4HQRA 1RRFA 4G8BA 4YUZA 2IYPA 4G0NA 1XZ8A 1FNNA 2LVBA 4TKLA 4RZHA 3BMNA 3SR0A 3TTWA 5DKFA 5HNKA 1KNQA 3TNJA 3UOAB 3CUSA 1T0BA 2PGIA 1PX0A 2EU8A 2XYQA 3FPJA 4J6EA 1IQPA 3W8EA 3ZDRA 2DLNA 3SR4A 1ZM3A 1KJJA 2HD4A 1NL3A 1PJBA 4ND6A 2QPTA 1K7SN 2XX3A 4ZICA 3CF4A 1VCIA 1AHIA 1S8FA 3R23A 3GRCA 3HY6A 3S29A 2Q3FA 3ZJYA 5KREA 2JHAA 4H0NA 1RBYA 3COYA 4UFOA 4F38A 3PVCA 2YOHA 3CCCA 4FN5A 3BEOA 4Q01A 1EA7A 4YH1A 4YMSA 3S28A 2BL4A 1G16A 1AE1A 3BMCB 4MITA 2BBWA 2J48A 1R64A 4Y6OA 3A11A 1VCNA 4AF7A 1Y9AA 2VZ9A 2FCRA 3A4TA 3K6RA 3LECA 4QJ5A 4DG5A 4TSFA 1WY5A 3VVCA 5DX1A 1UBOS 2J5RA 2Q4BA 4YDSA 5EYPA 1N7IA 1YL5A 4X64B 3UGJA 4ILEA 3DYIA 5FI3A 4MGZR 4AFNA 1H6DA 1KJWA 3PHLA 6AT1A 3U44B 2OGUA 1EZ1A 2DFDA 2V5VA 2AF3C 4ZEXA 3G17A 3JQPA 1OSNA 3M6VA 3TVTA 1H4VB 5EI5A 1O89A 3ITKA 1I1HA 4IVNA 5IDQA 5KVCA 4LJ7A 4G5RA 1CUGA 2IZZA 3AHHA 4H60A 4M9QA 3ASVA 1G291 3FOCA 5CA1B 5YASA 1YDFA 2D2EA 2BN4A 1BGVA 1Z68A 3WHPA 3PC2A 3HB0A 3SVLA 1CUCA 3EA4A 3BEDA 1DWOA 3VO9A 2ZT6A 5J4KA 2R79A 2FJUA 3DE2X 4MKHA 4MQEA 1XRLA 3I32A 3KR1A 4YJ3B 5H7XA 2H1OA 1VKZA 2F6RA 2TMKA 4ZVMA 3AP2A 4IXTA 1LA2A 1NXWA 2DPXA 2JANA 4WW0A 2W2NA 3JATB 3LRPA 4L5JA 3U9TA 4BGUA 2FX2A 3AY3A 4KXUA 2FPUA 3EAGA 3KAPA 1RZVA 2ZPTX 1YS4A 3IC5A 1J9ZA 2EDAA 4KFUA 5BNZA 3DEYX 1U3TA 1C30B 2G7ZA 2O1EA 3CLSC 3P9NA 4MKFA 1H0RA 4C2UA 4R0VA 4ZREA 3LHDA 1FE8A 5LCXA 4DR1B 3CUUA 3DR3A 4H3VA 1Q11A 2C9DA 2DC1A 4X7BA 4YAJA 1X7XA 4P80A 4YI3A 2VT7A 4NOLA 3LUBA 4OQNA 3V8NA 1M0EA 3NJ4A 2ZSEA 5LZ8A 3IESA 1WETA 3TNYA 1NJFA 4EVSA 4IDNA 5IARA 3HFJA 1YZKA 1RM0A 4I2VA 2FWRA 3PG5A 1TUBA 1UKVY 1P1FA 2QTVA 3PQ2A 2ZRAA 1G5HA 3TQHA 1RAFA 1X9IA 2FTKE 3R0ZA 1FFXB 1E1QD 3RBVA 1GU0A 3T1VA 3ZG6A 2QBYA 2BSXA 2WKSA 4U9HS 3RS4A 3H17A 1D4AA 1N9GA 5J9FA 5K4GA 4XVUA 1TO1E 2G1PA 4ZVVA 1A77A 3L7IA 1P4RA 2QP3A 4OAPA 1WVGA 4O2BA 3CWQA 4CGZA 1QH0A 3TBKA 3TTTA 3WDSA 1XAHA 4HNSA 3TAUA 3SBOA 5BW8A 1YRHA 3C8DA 4YI5A 421PA 4GUDA 3BDIA 1JFSA 2XRMA 1SUCA 3W5VA 5F76A 2P68A 1NLZA 2QU7A 1ZU5A 2FMKA 4D9KA 4D0SA 1CKEA 1DO2A 2AXEA 4OD0A 3CN7A 2N0SA 4NCNA 4WMLA 2E4XA 1EM8B 3OUZA 2MYPA 1DARA 1I6MA 1PV1A 2C2KA 1ZDMA 3ZIAA 1XZNA 2Q27A 2UVPB 1Z6TA 1DFGA 1E99A 1ONNA 2RGBA 1U9IA 5J40A 3I4CA 5EWLA 4KXLA 1GY8A 1DKPA 3H9BA 3VU0A 2G71A 1ZESA 4NPAA 3AYZB 3UHAA 1HZZA 4DVJA 1H2FA 5C8YB 3EWIA 4J0IA 1OT3A 2QYSA 4Y2GA 5DP2A 1KZYC 2I4RA 5G3YA 1VSQA 1KH3A 1P3JA 1GT6A 2HTFA 4R1OA 3UKDA 1OIVA 3VAAA 2P6RA 3HXKA 4QOGA 3SLKA 3TECE 1WBBA 3SIWA 3OU7A 2WU3A 4W5OA 1S02A 1DRVA 3S2GA 4HATA 5I48A 3PNMA 1FMLA 2IU4A 5LDGA 5I9IA 3S1LA 1ZYUA 1MV8A 3AL2A 3MNFA 4JI8B 5B3JC 3WSVA 1Z15A 4FHGA 5FL7A 1RAHA 1U9CA 4DA6A 3BSYA 3TVDA 3I9KA 3IERA 3PNBA 1CIVA 1DNPA 3QVWA 4R2XA 5CNIA 3MPUA 3WKAA 4MUBA 3JVEA 4Y2JA 5SYNA 7GPBA 3KOUA 3P8ZA 2V9CA 4WKPA 4KREA 1JLSA 1LLUA 1DQYA 3TJRA 1PQUA 4I8IA 1NMQA 2GTIA 2YZ2A 5ES3A 2J6HA 1EUCA 2W8BB 5TSDA 2PPLA 1TIPA 3FFWA 3N2NA 3H1GA 4KODA 4UMDA 4NG5A 4DB2A 2EYQA 2Z04A 4OQMA 3LKVA 4RPKA 3REOA 1T9ZA 3NASA 3C7AA 4RQTA 4TTRA 1OB2A 4FOSA 4URFA 1OUMA 1WSAA 1RFGE 2RJOA 4Q4AB 2SKDA 2AKYA 1KDVA 1Q1EA 1Y48E 2OD7A 1Z88A 1E4VA 3C2QA 2HA4A 4JDUA 1PJAA 4MIEA 4TUYA 4KQ2A 4CIWA 3CA8A 1OZFA 3A1FA 5JU6A 3N8DA 2IEGA 2GK7A 4U8GA 2B20A 5JWRA 3BCUA 1AZSC 2DFKB 5A5VA 4I5EA 3ZD9A 3QEMA 4Q7MB 2QLFA 1OLUB 1J9EA 1CQJB 2I66A 2MSEB 3UV3A 4MYDA 3H5TA 4HUTA 4GI7A 2Q9BA 4BUJA 5U9CA 2W2QA 4EY3A 2OCKA 1AGRA 3NI2A 2CHFA 3D81A 2Q6IA 3LVBA 4A73A 1FVFA 5EHIA 5IZCA 2YW2A 1JJBA 2R00C 2E6KA 2FMIA 3BWYA 3C6BA 3NJRA 4ZQIA 2CJXA 4GOOD 1NBME 5HBRA 3KOYA 3O38A 4DW8A 2PKQO 4LF7B 2FPXA 3ELBA 4EMBA 4DV2B 4TXNA 4UBMA 1WIWA 3KZXA 3H9CA 3TN7A 3ZOZA 4BO0A 4E4YA 4OGWA 3WLSA 3OT4A 3QE3A 1TLLA 5EZYF 4OJQA 4BP9A 1DO0A 3KIPA 2D59A 4FOPA 4UPEA 3P0RA 4LTDA 3GNTA 4XUCA 2H4HA 4XDYA 1G19A 3ZZTA 4EECA 4L3WA 3I1IA 5I7HA 1FLVA 2WHPA 3M3DA 3RFUA