1Z07A

Gppnhp-bound rab5c g55q mutant gtpase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
SICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIQAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5C
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 52
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z07A00
2DFNA 2EWVA 3HR8A 4QBFA 1NF3A 4XOIA 4F4JA 1G41A 3AP2A 4L4UA 2G9NA 5BW8A 4N0DA 1UKEA 1YZLA 3GLGA 2AXNA 3UG7A 1ESNA 3B78A 3D6TB 4QOSA 4C3ZA 4DIEA 2ZRGA 3BB1A 3T35A 3FPAA 3FTQA 4F38A 3QI2A 2J46A 4M8NE 3AVVA 2BJWA 2XTMA 3THWA 1S2MA 1Z29A 2Z4RA 4HLUA 4TLEA 3TSOA 3T1QA 4PR0A 2VA8A 1JXMA 4C2UA 3EPKA 4QHYA 5FBWB 2JGNA 1YQTA 3LVQE 2OBLA 3K09C 3NBXX 2JLQA 3WRYC 4IEIA 4KVAA 521PA 3BAFA 1Z0IA 2YZ2A 4UXIA 2BWJA 5CJPA 3UPUA 3F8TA 1ZIPA 3PENA 2WBLC 3C41J 1G291 3TLXA 3IPYA 4OJKA 1KJZA 3O8DA 4Q1FA 3OF5A 1W44A 5FUYA 3TW8B 3BERA 2F3TA 3BORA 1T4GA 3R8FA 3P27A 1VIYA 2C98A 1YZNA 1R8SA 1EFUA 1R2QA 3B13B 5TDHA 4EQ6B 4A2WA 4Q21A 2KBEA 2G1JA 1R0WA 3TNFA 2QMUA 3FMOB 2O52A 4UKDA 2HF9A 4BFYA 3QOFA 5CLLA 3ZGXA 1YHNA 2CCGA 2WJIA 2WSSA 4QXAA 2FDCA 3AF4A 1ETUA 1Z6GA 1C4OA 2HLDD 2QT0A 2ZRIA 4JLMA 4PSAA 4AD8A 5L3VA 1BH2A 1YRAA 1UKVY 4Q4LA 5DGXA 3BWDD 5K8TA 1M1YE 1NKTA 3QEJA 4B48A 3ZZTA 2ZJ5A 1UF9A 4D26A 1X8KA 1M7HA 2KWIA 4H9GA 3UATA 2HCBA 4AKEA 1C1YA 1NVVR 2ZI6A 1TTTA 1ZAKA 5KPDA 1W7AA 2FSIA 4QBGB 2W83A 3ZIAA 4UNPA 4OI0A 2GXUA 3DZ8A 4TLCA 4DDUA 3U7FB 5L3QB 2OFWA 3IIMA 3NG1A 2A7QA 3I8XA 3R7WB 2EW1A 4BFTA 3DOEA 2CBZA 4PAQA 3X1DA 1G8FA 2N42A 3K0FA 2JJ1A 1N6IA 5LD2B 4G5GA 4TMWA 2R62A 1VCOA 3LXXA 2NG1A 3EC2A 3F0TA 1RJ9B 2WMOB 3H1TA 1W1WA 3T15A 1CR2A 5AJYA 3TQCA 1JAIA 2OZEA 1IM2A 3HU1A 4BLQA 4QRHA 4YMUA 2F6RA 2A78A 1ZCAA 1T5LA 5L3SB 5IRCD 3NXSA 4G5QA 4QM7A 4P4SB 5FFMA 4B2PA 4DJTA 1IHUA 2BIFA 4IDNA 3REGA 3U7HB 2OXRA 1ZP6A 1FP6A 2ZSFA 3CX8A 1CBUA 2BKUA 1SGWA 2RGDA 4R98A 3OEED 3IIJA 5EUMA 3KKOA 1EXMA 1RYHA 3K53A 1NI3A 1LF5A 2O8EB 3FHOA 1P2TA 3CX6A 1WBBA 1SXJD 2IS1A 2XAUA 3FKQA 1G18A 2WAYA 2GVDC 5CM8B 2ODEA 2QMEA 3RRMA 3N2IA 2H57A 5BYKA 3FFBA 3H0KA 3VR5A 3CRRA 4PZLA 1W2HA 3QF4B 1F2TA 3GLHB 3KJGA 1E9CA 3B7GA 3RDPA 4OQMA 1HEIA 2I1QA 3AVOA 1X1RA 4CRWB 3GCGA 1XEXB 5FTKA 2C9CA 1GL6A 2HXYA 3WP0A 4P33A 2AKAB 2RHMA 2H7VA 1P9NA 3IBGA 1FUKA 2F43A 2GZDA 2PEYA 4O3MA 1YU9A 1XPRA 2CXXA 5G3ZA 2ZSDA 4CIDA 3T5DA 2IW3A 4HDCA 5JHHB 1TEXA 2NO9A 2JA1A 5AUPB 3A4MA 4BFSA 3LBHA 1Q3HA 2J0QA 4GP6A 1KY3A 4RZXA 1HV8A 1AQUA 4TYPA 3EPHA 3SNHA 1G4UR 1NMZA 1KI8A 1E0JA 4DSUA 4LI0A 3R9WA 3ADCA 1VCMA 3K9GA 4AKHA 1NN3A 1ANKA 1ODFA 1U9IC 1YKSA 1Z0DA 2IEYA 3IKJA 4LBWA 4CZ2A 5LDDC 5HTKA 1NN0A 3CUEF 5E95A 1ONBA 3SHFA 3V00A 3H2YA 1YR8A 1UPTA 2J45A 1KK2A 4V0LA 4TQUS 2FG5A 2ZI4A 2NZJA 3GEHA 1E4YA 1NMXA 3WBKA 3ZS8A 1GP2A 3OESA 2EFGA 1RIFA 2CL6X 4DVGA 1AJEA 1P3JA 3IQWA 4JVLA 5CM9C 3DVLA 4B43A 5B64A 4XWKA 1DAFA 4G5OA 1CJVC 3ZQ6A 2UZ3A 3LX8A 1D5CA 1SXJB 2XX3A 4WA7A 1TEVA 4LHVA 3BC1A 1J2JA 2RHDA 5SZJA 5EE9A 2BM0A 2FFQA 2W00A 3B1XA 2PT7A 5EE0A 5FUVA 4ZIRB 3L0PA 3EZ9A 5E4FA 4YC7A 3HWSA 3QKSB 1YR6A 4MKGA 3GLHE 3W34A 1ZC4A 2HDNB 2OLKA 2QPTA 3AUXA 4MKHA 4CF7A 3GLIE 1KI6B 1P75A 1QG2A 3I62A 1OFHA 1D9ZA 3BK7A 1JPJA 4F92B 4NH0A 4EPXA 3GJ3A 1Z3IX 2H16A 3U3OA 4BLOA 1GITA 4NYJR 4BFVA 1A82A 2VP0A 1FMLA 3K9NA 3ICEA 3KQKA 4JT2A 1RPZA 1LY1A 2OBMA 3BJIC 3CNLA 121PA 2GEVA 1U8YA 4NPHA 4M1SA 4OI4A 4LK2A 2Z43A 5BN3A 3BB4A 2WPDA 1S4QA 221PA 2ZPTX 4JBXA 4DSTA 1IY0A 1BIFA 4QGAA 5TXGA 3TAHA 3EZ2A 3NEJA 1E2LA 3AGQA 4EIWA 3BFXA 3WMFA 4JLPA 3WYFA 4BUJA 1RE0A 3H86A 2RH5A 4BRUA 4L8GA 2FPMA 1VYUA 2B21A 3LLUA 3AVWA 4NYJQ 5J4LA 2RAPA 3K70D 2Z4SA 4DXAA 1H8ED 4GT1A 3ADBA 4M53A 1HUQA 2VIIA 1I4LD 4TMKA 5AUOB 1OHHA 3LD9A 1W5TA 4V0NA 4A0RA 2VHUA 1BMFD 2FX3A 3IPXA 4LJ6A 1OPXA 4A0FA 3OFNA 1TL7C 1N6HA 5AJZA 2ZRFA 3RS7A 4C0KA 1IXRC 4ZPXA 4D4KA 4O2RA 1JR3A 1UKYA 4A8JC 3JZMA 4EPYA 2ZSBA 4M9XA 3VKGA 2QTHA 3CIOA 3LAWA 4DLYA 1W4AA 2ODWA 1J8MF 3NWJA 3F3YA 4IDOA 4JS0A 2QTVB 2R6AA 1NSFA 2JAQA 5KDDA 1A7JA 2GBLC 2AD5A 4PSVA 4DT1B 1S96A 1G6HA 3BBPA 3CLVA 2MSCB 4TSFA 2O0HA 2YHSA 1EFCA 2B7CA 5FI0B 4ASUA 4AURA 1X3SA 3QVUA 4PQRA 1W36B 5EP1A 3NDBB 2IXFA 621PA 1H8HD 2ZS9A 4LCBA 1F2UB 1ZD9A 1D2NA 2H17A 3GMTA 4NONA 1GRNA 5KDOA 2GK6A 4NCNA 4LHWA 1JB1A 2QBYA 2GXQA 2QG6A 2VHQA 1SVOA 3EIHA 3ZD6A 5FOWA 3NH9A 4JLJA 2ZS8A 2JCSA 2WWIA 4D4JA 3CF6R 3IGFA 2MSDB 1W5SA 2C04A 3IUYA 4PQFA 4BFXA 5HZKA 2D2EA 1E9FA 3H4MA 2IEZA 3VR1A 4RZ2A 5CB6A 2FH5B 5E3HA 4Q47A 4QM6A 1P9WA 2C9OA 2OM2A 1XFAA 3SU8A 4B3BA 1CR0A 1E96A 1Q0UA 2FNAA 3OEHA 2ZSEA 4QL3A 1PUJA 4HLUC 5JJIA 2ERYA 1AGPA 2FZ4A 1UBGA 3P26A 2PCLA 4QNRA 2XJ4A 3CRQA 4EJSA 4M1MA 1IXZA 3AVUA 3MFYA 2HXSA 3OE7D 4JJZA 4P31A 2GCPA 3L0OA 4G5SA 4RFVA 2Z0MA 2LKCA 1Z0KA 3RYTC 1E2QA 4MYHA 3A6PC 4ACAA 5B57C 5FPSA 5DI3A 3I5XA 5CIWA 1JJ7A 2P5TB 5AJXA 5HCIA 2BCGY 1OFUX 1B0UA 5BXQC 1ZUIA 4JYBA 1JR6A 4TTPA 5CK4A 2X2EA 3I92A 4UNSA 4A4DA 2PMDA 1G7SA 1KI4A 4B35A 2XOKD 4L9WA 1N5KA 1Z8FA 1GL9B 1P2UA 3KKPA 2J7PD 4IOMA 4NU0A 1GNQA 1L2TA 1TQ4A 4KJZA 4W7SA 1YZQA 4BECA 2R6DA 2RGNA 2IA5A 1GTVA 2DY1A 3UMSA 2IYWA 3DL0A 4OK5A 2W0MA 2BMEA 4I99A 4US0R 4X8HA 3DDCA 5HE8A 2OV2A 1NRJB 4PAOA 4TLAA 1R5OA 4Q1AA 1XEWY 3MD0A 4A9AA 5CB8A 2AXPA 4FIDA 2R44A 4FCTA 5AR1A 3X1YA 5IK2D 1T3LA 4MA4A 5FBLB 3VR2A 2VHJA 3HR7A 1G20E 3KFXA 2WWFA 4ZI3A 1UM8A 2YYZA 1COWA 1E0AA 4DRZA 1MO4A 3ONWA 3QVVA 1RYFA 2O8FA 2QAJA 2GNOA 5EJEA 2ZYVX 2BMFA 4L5BA 1OKKA 4KITB 3Q72A 1ZNZA 5A0FA 1KSGA 1W46A 3Q5EA 1KY2A 1KDPA 2Q3HA 4ARZB 2VQSA 4JLAA 4DZZA 1EG7A 1ZNWA 4U7DA 3CB4A 3I4LA 1GG2A 1ZIOA 1E6CA 3EXAA 1I4DD 1E79D 3T1VA 3KJIA 4NYMR 4A0GA 4FMBB 3UWOA 4DDWA 2IC5A 2WOOA 3Q7PA 3ADDA 1J70A 1Z6TA 3CX7A 4JSTA 3TVTA 3A1WA 5TB5A 2NIPA 2BJVA 2CE7A 4KFUA 3A8TA 4AYTA 4JJKA 3EZFA 1P60A 2QP9X 3ZYCA 2R2AA 3GP8A 1G16A 2P6UA 2ZR9A 5DN6A 3CO5A 3RRZA 4MGIR 4EPVA 4YMWA 5FBQB 1A2BA 3B9QA 2YOGA 2IYSA 1RRCA 4ZCMA 5UKDA 1XRJA 1JXOA 2O8DA 2FEOA 2FPKA 1AGRA 1M7BA 1SKQA 1G1MA 2VTKA 3MJRA 4PZZA 3WNCA 3MWYW 4YDSA 5FOVA 3WYGA 1D2EA 2G77B 1JEDA 4WXPA 4W9MC 4KBFA 3LBNA 2WOJA 2P3SA 3G82C 2NQ2C 3O8RA 4LHZA 2CEAA 4CDGA 5DHAA 4MH0R 2R6GA 4Z1MA 5JI2E 2FPLA 2V3CC 4V0ME 4Z54A 3M6AA 3GLFA 1XEFA 4BLPA 2IK8A 1XXHB 3MRSA 1WB9A 1QHHA 2A9KA 5EE5B 3W5IA 2J0UB 2MMGA 3R9IA 2IYXA 4HUTA 1FP7A 4II7A 4ZKEA 4KVGA 4ZDIA 4PAMA 2DPXA 4TQAA 4A0HA 3AF0A 2UVQA 2O8CA 4HAZA 4Q01A 5DIFA 5JJLA 2RB4A 1UKZA 4UQOA 2C96A 5FI1B 3CPEA 3MSXA 4WXRA 3GJ6A 4LV6A 2V6IA 1G5RA 4TT3D 1XD2A 4MGKR 1Q57A 1E9AA 1RW4A 2XNDD 1N0UA 3N2EA 5FPHA 2HEIA 1PVOA 2GF0A 1U99A 2QZ4A 3EA0A 2GCNA 3NH6A 4KSCA 3WY9A 5KSOA 1VG8A 2VP2A 2Y8EA 3AKDA 1S9HA 1Y3AA 2ZRJA 1IXSB 4CW7A 4NP6A 2P6NA 1Q1ZA 2GAAA 2VRWA 2B92A 3AUYA 3PXGA 1UEJA 4LYJA 4KXFB 3OHMA 3QBTA 5CJ2A 1TQ6A 5JWRA 1HT1E 2CJWA 4ZDKA 4BZXA 1E3MA 5AUQA 1E2KA 4KYUA 3G5UA 2EYQA 4HAWA 1N25A 1NVXQ 3T34A 4F4IA 3THYB 2CK3A 4C4PA 1XU4A 2XNSA 3K0AA 2G0NA 4X8MA 2QQ0A 2IHYA 1VIAA 5JECA 5JJKA 4DLTA 2ZREA 3L0IB 1CU1A 4A2PA 4A92A 4IW3B 1HH4A 1TMKA 4ITRC 1E2DA 4KI0A 1IAQA 3R9XA 1S3SA 2FN4A 3HJNA 1X8LA 2O0JA 4FINA 1XXHE 1ZM3A 1KTVA 3P4YA 1DS6A 3RSLA 5E7JA 3W90A 1WA5A 2RGGA 2Q3FA 3A37A 3BH0A 3OAAD 4HSEA 2XJ9A 2R65A 1G8GA 2NZ8A 4PZYA 5TY0A 1US8B 2I1VB 3KQHA 2ZE8A 3GQBA 4W5HA 2A5GA 1E1QA 3DZDA 1O87A 1TU4A 3CPHA 1G6OA 3BFVA 4H1VA 2F1IA 2XZOA 1W49A 2B6HA 3E5HA 4IDHA 2W58A 4LC0A 4NMMA 5J5CA 3A58B 2OUKA 4MDFA 3U4QA 4ZI2A 5FOTA 1VCNA 2FOLA 8OHMA 3SDZA 3SFZA 2V7QD 1GNPA 1OXUA 1MABB 4HUQB 3TRFA 3DMNA 2WMNB 2ZJ8A 4HZUA 5FPKA 3EIQA 4XTRA 4CT5A 2DFTA 2VL7A 2ZR7A 4RZ3A 2GJ9A 4YXWD 5EXPA 1W48A 1T9HA 3EZ7A 4PO8A 1YZKA 1ZMXA 3IDQA 5KO2A 1HURA 4LC1A 2AK3A 2GILA 3LW8A 2FFBA 2XXAB 1IOZA 2QP4A 2GZAA 4KAXA 4Q4HB 5C4GB 1M6NA 1AKEA 2QAGB 2ZITA 1SVKA 3BH7A 1LS1A 5F2EA 2WJGA 1VYTA 3HP1A 3PVSA 1JECA 2VLIA 1A5TA 5KNCA 2ZR0A 1M34E 1P2VA 3KB2A 4E03A 1Z0JA 3HU3A 4QBIA 3GJ4A 4C0AC 4S35A 4HB0A 3LY5A 3RS3A 1OW3B 5JSZB 1ZC3A 3KTAB 4LJ4A 3O8BA 2CDNA 4RJLA 3EW9A 3ZQJA 5JS8A 5C46F 1OYYA 1RVDA 2W6JD 3R7WA 3OIUA 3QPVA 1CTQA 1XD8A 4FMCB 1KO1A 4PO9A 4DKXA 2G83A 1XZQA 4JL8A 4EKDA 2GCOB 1FTNA 1R7RA 1R5NA 2ORVA 2W2XA 1VG1A 1CP2A 1QHNA 3NHAA 2QNRA 3BRWD 2D3WA 2OSBA 1NJFA 2ZUCA 4Q02A 2J3EA 2GJKA 5BN4A 3EA5A 1OJLA 4P4SA 2D7CA 3BGWA 3M0EA 1G9XA 3HU2A 1T3SA 4R7ZA 1MO6A 4R2IA 2YC2C 1OYWA 4CYMA 1U81A 4Q7KA 1XMIA 1R8QA 4GOXA 3CKLA 2GESA 4EJSC 3NBYC 3CNOA 1DAHA 2C78A 2HLDA 3RS4A 3B8HA 4LJ7A 5EXSA 2J0SA 1II8B 1Z2CA 1VCIA 2WJJA 2QM8A 2F55A 1RFLA 3M4YA 3B6EA 2D74A 2QM7A 5HKKA 2B8WA 1NBME 3DKVA 1DE0A 4LJ8A 3FMPB 2FJUA 1NSTA 2WJVA 1DO2A 1EK0A 4OK3A 4HLDA 4LRWA 4M2LA 1XEXA 4BZPA 2BC9A 2QPAA 3LQQA 4D81A 1CJTC 1KMHB 3IO3A 4A8JB 1D2MA 2JLZA 3I61A 2HV8A 2Z83A 4B3FX 1KKMA 2OXCA 4OQLA 4XD7D 3BXZA 1U0JA 3NIBA 3IIKA 1KGDA 4GMXA 4BWYA 3T1TA 3PQCA 3K1JA 2EFHB 3A1UA 2RGNC 2AR7A 2QE7D 2JEOA 1XB2A 3EX7C 5L8VA 2W2VA 4UNQA 2C03A 5FL7D 3RC3A 4BFUA 2P67A 1VHTA 3PIRA 4WAUA 3SJAA 2VH5R 4JVNA 1DTSA 3AQ4A 5EZ5A 1P4SA 5DNYB 2PH1A 2FV8A 4E07A 2ZRLA 2ZU0C 1N0VC 3DHWC 2HT1A 1KDRA 1W0KD 2IL1A 4LUCA 4Q4AA 3KJEA 1OXVA 5CDFA 1G64A 3AV0B 1ZUNB 3HPRA 3A1SA 2W2TA 1FPMA 3HPQA 4DLUA 1IY1A 1KNXA 1G8YA 4BEJA 1B23P 1DAMA 1NN1A 1NP6A 3OEEA 2G1KA 4DIDA 2D7DA 3KZ1E 1NVVQ 4MRPA 1L4UA 2CHGA 1CEEA 2JLUA 3KX2A 1SXJA 3THWB 4LY6A 3SJZA 1LV7A 4E22A 4ZIRA 2OG2A 1E2FA 1KZGB 3AF1A 4RD6A 2JLSA 1IN7A 1H65A 3LRPA 4V0OA 2OCYC 3THXA 3WNBA 4IVPA 1YZTA 5BQ5A 4Q4JB 2PMKA 4G1UC 1XCMA 4QGFA 5FTJA 2ZRCA 1KI6A 2JJ1D 3L8YA 2OILA 2PT5A 3P20A 3CW2A 1DBSA 4Q48A 2JLYA 2V6JA 3EC1A 4MGYR 4YMTA 4TYNA 3HYRA 1OLOA 2JASA 3KUCA 2BM1A 5BN5A 3KKNA 3R8CA 3GLIB 3U61B 2IBMA 4DDTA 3F5FA 1E2IA 1GRRA 4OQXA 1BYUA 4JKYA 4V02A 3KUDA 2D62A 5EP4A 3OIWA 4KHZA 2ZI5A 2ZJ2A 4KFRA 4DB2A 3FMIA 1YR7A 3W5JA 1Q12A 1D9XA 5DYIA 4H1UA 2J87A 3FKSD 3GFOA 2OLJA 2ZI7A 2CNWD 2ZYTX 4GP7A 3KXKA 3T06B 5BWMA 1GVNB 4XVRA 4KV9A 1NL3A 3GD7A 1T8TA 1XJ0A 1E2MA 5FOXA 3TJZA 4DLWA 2FU5C 5F3WB 3BH6A 5DSZA 2DWOA 5HCNA 3P4XA 4Q9JA 1CJKC 3B5JA 1E1RD 3GLGE 721PA 3AVXA 4U02A 1GL7A 4EPWA 3C8UA 3QKRA 3QXCA 4A6XA 1N6OA 2NTYC 4DCSA 5JRJA 1D6JA 1LNZA 3PR1A 4R2HA 2P6RA 2NPFA 3E70C 1KO5A 2BDTA 1E4VA 4QKQA 3SJCA 4IOJA 4I1OA 1DAEA 3UIEA 3U44B 3I72A 3L82B 2C99A 4A6PA 4B3DA 1ZVQA 3K0FB 3ZH9B 3S1AB 1TX4B 3PEYA 1CJUC 4HLQB 3CWZA 2R6CA 2WWXA 2JJ2A 4OYHA 1DVRA 4JL6A 4RVCA 4NDZA 1AS2A 5KU1A 4DB4A 3A36A 4Z51A 4OKSA 3CR7A 4PC2A 1S0UA 1JALA 1WDTA 1YZGA 2HJVA 3O8CA 3QENA 1NLZA 4ZO4A 4YLGA 1RRFA 4RSGA 2RGEA 1F2UA 4KO8A 1N5JA 5H68A 2F1HA 3LH5A 5EXXA 1DADA 3R20A 5EZ6B 4FWTA 4PX9A 2PLFA 4LWZA 3B9PA 2ZYUX 4QG7A 3MUFA 2VP5A 4MUAA 3ZZUA 1P6XA 4HAYA 1TADA 4KU4A 4WZBE 3RC8A 2WKPA 3GEIA 3PUWA 1W36D 3PUZA 3PEVA 1T91A 3AGPA 2F1RA 3DM9B 4TMTA 1YRBA 1ZNYA 2Z6VA 2VO1A 2XEXA 3U5ZB 4D25A 4B75A 1H8EA 3KJHA 5TV2A 1MH1A 4B74A 2BKEA 3B60A 3EARA 4CEJA 1OSNA 4DUGD 1BMFA 3TSWA 4Q66C 3QF7A 1VG9B 4FCWA 1S8FA 3JVUA 4FMDB 1T0HB 1OB5A 2R6FA 4KLNA 2QPOA 1XPOA 4B47A 4LHYA 1K6MA 2PX0A 2ZM5A 1XTKA 2C8VA 1OIXA 2EQBA 4MRNA 2FSGA 4DCNA 4RKFA 2JLVA 4TTRA 3Q5DA 4JIMA 2KBFA 4KBGA 4PPNA 1OFIA 2HT6A 3B1YA 4DCTA 2J59A 2KJQA 5JWHA 5J4HA 4AWXA 4HB2A 3UG6A 5KNBA 2VSFA 2REXB 5LPNA 2ZETA 4D2IA 2V1UA 4BRWA 4O0MA 2ZEJA 2QA5A 2YC4C 2ZJBA 3KQUA 2QORA 4TL7A 6Q21A 1X1SA 5CITA 3QUSA 1H8HA 1AK2A 2G6BA 2QGNA 3QG1A 4I81A 3KXLA 5JCPA 1OH6A 1Z06A 2QL6A 2J9RA 2ZI3A 3BE4A 1NN5A 4NKRA 1N6RA 2DR3A 1C9KA 1U8AA 1ZU5A 1P7CA 1M2OB 4NCJA 1R4AA 1W4BA 3RLFA 2XGJA 4BLTA 4IVQA 4RD1A 5LB4A 1OH8A 2V54A 1N5IA 4R9UC 4TZ0A 4LJ9A 1F6BA 4BQSA 4OK6A 4BPBA 3TKLA 3NEYA 1FX0A 1FTSA 2OCAA 1ZINA 5H8WA 4DCVA 3NVAA 1DG3A 1GZSA 2ZJYA 5ANRB 1Y63A 1P9RA 4UXHA 2FWRA 4Q9KA 2OEPA 2BBTA 2JLWA 1XMSA 1W0JD 2QRNA 4E5UA 1KO8A 3DMDA 2XSZA 2IYQA 3GFTA 1G7TA 1UADA 3VFDA 3AF3A 2PJRA 1FZQA 1T3HA 5FTMA 1J99A 1AKYA 4UJ3A 1CR4A 2DWQA 3PFIA 5JWOA 1WP9A 2ZAOA 2ZRDA 4M9SA 3OE7A 1N6LA 4ARZA 1A1VA 3IQXA 3FVQA 2GJSA 5SZKB 5FR1A 2GEDA 5DISB 4CEHB 4RD0A 1S1MA 4POAA 4L16A 2HCJB 5GJCA 1NVWQ 3RSOA 2EYUA 1BS1A 1OH5A 5D3QA 4URWR 4PQYA 1HQYE 3C15C 2VP9A 2ZXUA 5C18A 4AKIA 4QHTA 2XOKA 3TVDA 1XX6A 2ZQ5A 4M21A 2E87A 4C30A 1MO5A 2IUUA 2PZFA 4GOJA 1RKBA 2J7PA 5F98A 3KQLA 4RD2A 2GF9A 2YNMA 4IDPA 4PSKA 5H70A 4JBYA 2REOA 4XSGA 2DYKA 1J8YF 2JIZD 3ZJYA 4DWJA 1Q1QA 3MJHA 4JT4A 4RFSA 5G41A 4NHOA 2IWHA 4B6FA 4DHEA 5IK2A 4ESVA 1PUIA 2B8TA 3AKCA 3WMGA 2R9VA 3U6KA 1T5IA 2TMKA 5EE3A 4IXMA 1XCGB 1S9DA 3FHCB 4MQBA 5GJVC 1XWIA 1G3UA 3K0CA 3RWMB 3RS5A 3SFVA 1K8RA 4PXAA 1OH7A 3NKVA 2P5SA 3GFPA 4CEIB 1TAGA 5IT5A 3LX5A 2CHQA 1IN8A 1KIMA 2ZSAA 4LYFA 4LSGA 1FFHA 1P5ZB 821PA 1DPFA 2QP3A 5J4YA 2H8KA 1WE2A 2JDIA 1QG4A 1LVGA 4MITA 3W8NA 4EFMA 3CF0A 1E79A 2ZJAA 2BBOA 1E9EA 5DYGA 3ADKA 2OAQ1 3I3SR 1EX6A 3TAUA 2Q9AA 4CVNA 3NC1C 2ANCA 3ICQB 1TQDA 2J1LA 1G8PA 1VDZA 3TUZC 5IDVA 4GL2A 2ANBA 2VF8A 2QGZA 4M1KA 1CULC 2GZHA 1BKDR 4GFDA 4Q7JB 2IUTA 4J0QA 4LPKA 4GDFA 1GKIA 1KO7A 1ZM4A 2VF7A 3KL4A 4LOAA 3IBYA 2ZRAA 5JEDA 3Q3JB 3UMFA 1XTRA 2YWFA 2C2HA 4E09A 3D7MA 1XTQA 1SXJC 1N6NA 1W2GA 1QRAA 2G0TA 2RMKA 3CPJB 2FFHA 4JVMA 1GKYA 2BOVA 2ZE5A 5DO9A 1OKKD 5BYJA 4EJSB 4AY2A 2WIAA 1EFRD 3CRMA 4N3NA 2IUSA 2FSFA 2YKGA 5DE3A 1NG9A 1Z07A 1NKSA 4IOLA 3X1WA 4G0NA 1F48A 2ERXA 4FCVA 4NYMQ 1Q3TA 1JR3E 4MYTA 2NOAA 1E2PA 2GWHA 2H92A 4FXPA 2X8AA 5K8UA 5GVSA 3LWNA 4Q1CA 5AUNB 3SYKA 2QMOA 3PJRA 3CR8A 1JAHA 2WZQA 4PO1A 3TMKA 5FR2A 1KI7A 3FFAA 3TE6A 2XB2A 2WVJA 1XP8A 5EP3A 1JQLB 1S1CA 1US8A 4ESHA 1AM4D 5J4KA 1AQYA 1OXSC 2OHFA 2EVWX 5GJBA 2AWNA 3NDPA 1CRQA 5KDLA 3BFKA 4TT3A 3ZD7A 4C0SA 4WW0A 1BO6A 2XNDA 5SZIA 4QJ3A 4QNMA 4C0JA 3J81k 2CLCX 5KOYA 4IDQA 4LDJA 3A4NA 4GOKA 4BFWA 1EGAA 2ZYWX 1YVDA 2A30A 5JMTA 1YZUA 1Z0FA 1EESA 3I73A 2X2FA 1ESMA 5AJVB 1KSHA 4IRUB 3U60B 3LBIA 2DFLA 3PUYA 4LJYA 3QXHA 1V43A 1QHXA 4TWZA 5KTYA 1P73A 1MABA 1TU3A 2FFAA 4JYCA 2JLXA 2HF8A 1Q22A 2HJGA 1ZUHA 3RRYA 2ZUDA 1PZNA 4P4UA 4PPFA 2CLSA 2P65A 1TF5A 3ASYA 2WIBA 2RGAA 3K0SA 3I8SA 3FHTA 5G53C 3VU9A 3AEZA 5HZHA 4GPTA 1FW6A 4UNNA 2H18A 4FD2A 3V4RA 3CZQA 5J40A 4L15A 2ZRHA 4Z8XA 4D4MA 1J7KA 1ZM9A 1KI1A 2QU8A 3W3AA 4IXNA 4Z8YA 2VSXA 2JLRA 2QAGA 3ZS9A 1U0HC 4M9QA 1YR9A 4QBHA 1G7RA 2CHVA 4Q00A 2ZIAA 5L3RA 2GXSA 3OAAA 4JBWA 3KDSE 2ZRMA 2WHXA 2ORWA 3N5CA 4OHZA 1KHTA 3SYNA 2QT1A 1KAOA 2PZGA 4YDHB 5AK0A 5JSZA 3JZAA 1NBMD 1WMSA 3A4LA 4IJMA 3SHWA 1II9A 3AF2A 1IY2A 4F4CA 5LB2A 4Y0AA 3FMFA 4D0GA 2QEQA 3X2SA 1N3BA 2IS2A 1QHSA 3TSZA 1G5PA 4C0HA 4XTCS 3BS4A 3U6BA 2WV9A 1XTSA 3CNNA 3W9YA 3B1VA 1F5NA 2V7QA 4Q5IA 4MYUA 2DB3A 2E1RA 3SI7A 4Q1EA 1SVIA 2ZUBA 3K70C 3VR6A 4EAQA 2AN9A 4I4LA 1QHIA 3GLFB 5AJWA 5KUTA 3DO6A 2ATVA 1JNYA 2FMXA 5P21A 5KSYA 1XTIA 3I1FA 1R6BX 1E0SA 1FNNA 1RRPA 3MWLA 4QHSA 3U7EB 1IN6A 1OF1A 2Q21A 2ZE7A 1KMQA 4EQ6A 1I4TD 1L8QA 1CXZA 1EFTA 1Z6XA 1MV5A 3U3RA 2ZU6A 1SKYB 2PCJA 2YWEA 3MLEA 3TGPA 2NO1A 4IKEA 4TZ6A 4NL4H 2J41A 4ILEA 4HAXA 4ON9A 5FH9A 5HPYB 2IS6A 3VKWA 3DEFA 4FI3C 3GJ7A 4ZDWA 1LTQA 1QHGA 1HE1C 4M0LA 1NY6A 2CCJA 2PEZA 2Q0HA 4C7OB 1F3OA 1FNMA 2DHRA 5FBVB 3THOA 2HYDA 2W6JA 5AWFC 1A2KC 2I4IA 4P32A 1Q1EA 1UDWA 3UMRA 3Q85A 4FMCF 2CMKA 1P2SA 1KSFX 4HI0E 4I1UA 1UBCA 3IHLA 5L3QA 5F9HA 3RS2A 2F3RA 4JMPA 1N6KA 2WSMA 3PEWA 4I1VA 3SEAA 5FPTA 2ZE6A 3SQXA 3B85A 3SJBA 1V5WA 4LGMA 4TN1A 1GWNA 1RJ9A 2ZJOA 2H5EA 3GLFE 2W6ID 4OHWA 4MRVA 1XJCA 3ECCA 2GEUA 2AHOA 2MSEB 5B2ZA 3VNUA 5L3SA 1R10A 3JVVA 3QKUA 3FGNA 2W0SA 1KKLA 4BEBA 4KFSA 3RANA 4JLKA 1GILA 4MKFA 3EPJA 1SULA 2D06A 1SKYE 4NCHA 2AFIE 1OIWA 3QXXA 3C5HA 1AIPA 1GKUB 2AL7A 5FBRB 4YMVA 3EWAA 1OE0A 1VKJA 1ZRHA 2O8EA 2ODNA 4Q4JA 4F93B 2PZEA 2O8BB 4XD7A 4M1OA 1AN0A 4PHFA 3U4QB 4TMVA 3T61A 4DLRA 4GNKA 1ZBDA 5D3MB 3QF4A 3GLHA 1GNRA 1LW7A 2QE7A 4A2QA 3HDTA 5FL7A 4LZZA 1TNDA 4S2EA 1TQ2A 2PL3A 1OXXK 2GTPA 4OL0A 2IYVA 3GLIA 4HZUB 3GJXC 4ACBA 1W4RA 4DLXA 2ORIA 4LJ5A 1G7CA 3C14C 4MGZR 4DSOA 4LV5B 3OIVA 5KPJA 1M7GA 1PLLA 2RKOA 3DKPA 4D0LB 5F9FA 1JI0A 2JATA 1Z6YA 2LCFA 1W0KA 1JJVA 2GKSA 4GZLA 1XMJA 3SR0A 3BD9A 3NC0C 4B3CA 3K0CC 3WNDA 1GSIA 3LFUA 3L2OB 2DBYA 3AM1A 3ASZA 2A5FA 2HUPA 5CYOA 2ZRBA 1WQ1R 4QGHA 4PPGA 1QVAA 1BYIA 5HKKD 3FYHA 2RGBA 3B82A 2XZPA 3D31A 2YINC 3TQFA 4FN5A 1IJFA 2BCJQ 4RCZA 2WSSD 4X8LA 1KK1A 4HYYA 3TR5A 4NYIR 4JL5A 5A4JA 3FB4A 1JEEA 1IJEA 1M74A 2IF0A 1RRGA 4JLNA 1T8UA 3U3MA 1HA3A 2WKQA 3GLGB 1KI2A 3DM5A 3E1SA 3RWOA 4ZDJA 4K8OA 3VTKA 3MAAC 3QJYA 1CRPA 4A36A 1U8ZA 1HE8B 3U44A 4LX0A 2IYUA 1Z5ZA 3QBVA 3VR4A 5JBQA 5TARA 1XZPA 2OFOA 3I32A 3K9LA 5FOUA 5FPYA 3S1AA 1Q21A 1MOZA 1W4CA 4TYYA 3ZIAD 1MT0A 1VHLA 2XITA 5DHFA 3B1ZA 2F7SA 1X86B 2NPIA 3QKSA 3V4FA 5G40A 2IHBA 2MMCA 3FDIA 3Q7QA 4XVQA 1ZCBA 3B1WA 1QVRA 2RGCA 1EWRA 2BMDA 4NYIQ 4AK9A 4AG5A 2JJ8A 1UEIA 1WXQA 1ELOA 4Q9HA 3LNCA 2P0EA 1VMAA 4TYQA 1PJRA 1GDDA 3K0EA 3VAAA 3FKSA 4HLCA 3WP1B 2CNWA 1I2DA 4US1R 2YOFA 3U3KA 1SQ5A 3D8BA 1P72A 4EFLA 4OHVA 3WXMA 4HDQB 2V55B 1MR3F 1MRSA 1GFIA 3NBFA 1M8PA 5CLQA 4XWAA 1G8HA 2NO7A 3IEUA 1XPUA 1E1RA 4G01B 4W5WA 4EDHA 1GUAA 4ABYA 4BLRA 3ZVRA 3AH8A 4A1FA 5ELXA 2ZANA 2QTFA 4B3XA 1UJ2A 2G3YA 4BLSA 2IYLD 1N5LA 4P3YA 1VPLA 4AG6A 2AWOA 3U7GA 1AZTA 1JBKA 1E69A 1Z83A 3C4JA 421PA 4W5JA 1U98A 4UNRA 2Q9CA 5JEEA 4LYAA 1N2CE 1G21E 2FSHA 2C9YA 2PJZA 4DEXA 1VYVA 3VHXA 1R5BA 2EFEB 4HEJA 1NG1A 3KXIA 1S3GA 3P32A 2ZJZA 4EPRA 2ZRPA 2V9PA 4CGZA 3LVRE 2IT1A 2OO7A 4PC1A 5TMPA 4B3GA 1DOAA 2K5UA 2LWIA 1FUUA 4KFTA 4Q4AB 1XMVA 3U2QA 4ZCLA 2FEMA 4Q03A 2ZTSA 3VMFA 4IFBA 1QZXA 3TUJC 1DAGA 1NLYA 4XJXA 3QY0A 4URZR 5K8IA 1G3QA 4B76A 4DT1A 3E2IA 3L43A 4GMDA 2ECKA 1XNJA 2UKDA 2QROA 3QXSA 4EFNA 4K81B 1VTKA 1Q20A 2VP6A 3PEUA 1DAIA 4C0LA 2D4HA 2IXEA 2QAGC 3PG5A 2BBWA 4BASA 3IEVA 1E9RA 1QHYA 1FOEB 2NO6A 4QJ5A 3THXB 2ZI9A 4V03A 1X6VA 4OQFA 1UBEA 2BEKA 2IX3A 3X1XA 4DUGA 1KZ7B 3FE2A 5TVKA 1DELA 5KNDA 5KHOC 3AVPA 4P0TA 5CYPA 1F2TB 2JJ2D 2OE2A 3AKYA 3GJ8A 4O25A 3ZZ0A 4PC6A 2AX4A 4DLVA 1T0JB 4M1YA 4QFMA 1CKEA 1KI3A 4FMDF 4JKIA 2AK2A 2VP4A 1HYQA 4HB4A 5CIQA 3TK1A 5EE1A 2F43B 1KDOA 2PX3A 4CEHA 1U0LA 1SVSA 1Z22A 3M1IA 1KSJA 4K46A 4X8OA 1SVWA 3RAPR 3TR0A 5A5GA 2IS4A 1BOFA 1GOTA 3RVBA 4MYCA 2PBRA 1NVUQ 1QF9A 2QMHA 3QPWA 3WMEA 1II0A 1G3RA 1OV4A 2FGJA 4OI2A 1G3IA 2X19A 4TQ9A 2AFHE 5CDFE 4GRAA 1NIPA 4MDEA 5JS7A 2GXAA 3MG9A 4ERNA 1O3YA 4TLBA 1UBFA 2A5DA 2ODBA 2ZRKA 2WWHA 1G17A 2O0KA 4OQNA 3C5CA 4Q1BA 1N6PA 3T1OA 2F9LA 4B44A 3WBJA 5M04A 1OFTA 4JVSB 1J90A 3REFA 1HT2E 3QKRB 4V0KA 2WPDD 1KAGA 4QC2A 2RCNA 2VHTA 1SXJE 4XSHA 2N1BA 4LJAA 1DG1G 2X1VA 1WF3A 3FWYA 4Y0VA 3LO5A 4DEYA 2QI9C 1FQJA 5JHGB 2IYZA 3CRW1 1W0JA 4LHXA 1TUIA 4AYXA 1XTJA 5LBIA 1G4AE 2E9SA 2FF7A 3BOSA 3ZLJA 1G19A 2VSOA 4DDVA 1PLJA 3KB1A 4URVR 1OIVA 2GETA 4B73A 4AKGA 2ATXA 4M22A 4OBEA 5GVRA 5J47A 1OHHD 2DCUA 3A1VA 5J4VA 3UXMA 4BFZA 4G3XA 4CEIA 1Q1BA 4RCYA 4TMZA 4I1SA 1KO4A 4ZCIA 4IEEA 4UXJA 3OFND 3PCRB 2FE4A 4V0MA 1L7VC 4NE2A 2IYYA 1NLFA 4P4TA 2ZVQX 2CVFA 5DI9A 1JR3D 4TL8A 3W3ZB 1SVLA 1Q44A 1OT3A 2KE5A 2WJHA 5EUQB 2D2FA 3T12A 5CK5A 4Q19A 2ONJA 1PV4A 4IFEA 2J5XA 4N0EA 1AS0A 3UKDA 3V9PA 1XJQA 2B7BA 4KSBA 1VECA 2LKDA 5JFGA 5JZVA 3CH4B 5LD2C 4AI6A 2VYFA 4TSFD 5GADl 3ND8A 5FL3A 4HDOB 4ASUD 5IF9A 1LS6A 4US2R 2CCKA 1NY5A 4QGGA 4C2TA 1I2MA 4R71A 2JIZA 4BZQA 5DLQC 1ZD8A 3K09A 1LB1B 3WYAA 2Q3MA 4LYHA 4DBLC 4TL6A 2WAXA 1SHKA 3K70B 3SN6A 4CT4B 2P2LA 2QY9A 3LQRA 5JRZA 4Q9LA 2XSZD 1A4RA 4EPTA 3GJ5A 4IVRA 1ZW6A 2OCPA 2HYIC 3CONA 4CEJB 1QDEA 1CS4C 3CH5A 1KYIA 4B34A 2Q6TA 2XTZA 1AS3A 2OESA 3MWKA 2IYTA 2VHCA 3NTUA 3KFVA 3X1ZA 4G5RA 2G88A 3PUVA 1E94E 1NIJA 2OBNA 2V8OA 2A5YB 1SVMA 1MO3A 2X77A 3VQTA 3OEHD 4QJ4A 4A82A 3UANA 4D0NA 2ZAMA 5FTLA 2WWYA 5EQTA 4AYWA 5K8LA 2GVZC 1P62B 2GJAA 2QRZA 4URYR 3L0SA 2WICA 3GEEA 3TH5A 1E99A 1EX7A 1CIPA 4YMSA 1KJWA 2Q9BA 3AKEA 3TW4A 2GHIA 3VX4A 1AA9A 1XXHA 2KI5A 4ZV4A 5E7MA 2EFDB 3Q8XB 4F7WA 3KKMA 2J0UA 3N70A 3LLMA 3QSYA 2WM9B 4KCGA 1ZJ6A 3O47A 1X8JA 4DC9A 4C9BA 4L9SA 5FTNA 1E32A 3SYLA 3MWJA 4XWOA 4A15A 1JQJC 1MRNA 1D8TA 2O5VA 2GDJA 1PLKA 1TUEA 4N1AA 2CL7X 3CBQA 4DLZA 1Z63A 1KOFA 2C95A 2EFCB 4NTZA 3SE0A 3I5YA 1FX0B 5FUXA 2IXGA 4B2LA 4U5XA 2QBYB 2SHKA 1EFHA 1U2RA 4NCIA 3AP3A 2BHRA 3IO5A 4TLDA 1SZPA 2ASEA 1E9BA 1HY3A 3DPUA 4RD3A 4DLSA 2VEDA 3B2EA 4BGDA 4Q7LA 1MKYA 1DAKA 3Q9LA 3TUIC 2KSQA 3CZPA 4AC9A 2H1LA 2WTUA 1K5DA 2UZIR 5HR5A 4LBZA 4M1WA 2PLRA 1EFRA 4D6PA 4YQFA 4GSYA 4C0QC 3VNVA 3AVQA 1COWD 4MKIA 1DARA 4IHQA 4TTQA 3THYA 4FWIB 4M9ZA 4PPQA 1XCPA 3HYTA 3AB3A 5E7IA 4B33A 2JDID 4WBSA 1SHZA 2QUZA 5C4MA 3AVYA 2KB0A 4PFSA 1KJYA 3RABA 1GM5A 4XVUA 2I3BA 2J7KA 1G5TA 4O2LA 3VKHA 1Z2AA 1E9SA 4D80A 2XZLA 4MUBA 3C16C 3RNLA 3GPLA 2N46A 5DI3B 4HATA 2YVUA 2GK7A 1IONA 2YWGA 2F1JA 1E9DA 1OXTA 3DOFA 1FQKA 1YE8A 3PUXA 3H84A 4LPSA 2OCBA 2FGKA 3KKQA 1TF2A 2R8RA 1CR1A 2WKRA 5G3YA 2QQEA 2IF2A 3BIFA 4RD4A 3SOPA 5EXTA 1Z0AA 4URUR 4RFSB 3ND9A 3WHLA 3RHFA 3BB3A 4KODA 3SBDA 3AP1A 4D82A 2AD1A 5DN6D 3EIEA 2CE2X 3C7KA 3CRVA 4JLDA 1AZSC 2BEJA 4Q1DA 1WCV1 4UJ5A 1GRQA 1NMYA 4AIIA 2GRJA 3WHKA 4EUNA 3EWSA 4OI1A 2A5JA 1E2EA 4TMXA 1U94A 2BV3A 2VBCA 1IN5A 1IN4A 3EPLA 2DFKB 5KSPA 4IOKA 4B32A 1HQCA 4MRSA 1KNQA 1U90A 2CLDX 3MCAA 3AVTA 2GAOA 4PC3A 1U9IA 1Z08A 5HE9A 2Z5FA 4F91B 3OZXA 4DCUA 1LF0A 5FOSA 3EG5A 4M4SA 4HUQA 2VPPA 3W8RA 2YV5A 1LFDB 5C1BA 2NMVA 3K9HA 4XH9B 3RRNA 2O8FB 4Z1MD 3CM0A 4HAVA 5B58C 3QKTA 3QXJA 1KI9A 2IYRA 4YONB 3TIFA 1RC8A 1Z47A 4JLOA 3EAQA 3EZ6A 2BVNA 3P1JA 3NBZC 2V4ZA 4LV8B 1E0KA 3ZDQA 4C0BA 4NZYA 1ZM2A 2YWHA 1CJMA 3SQWA 1ZNXA 2XXAA 2OFXA 4Q18A 4BE7B 4URXR 4Q7MB 4Q4HA 1NNEA 1KDTA 1Z6AA 1IBRA 1GAJA 2GA8A 2FA9A 2YJTD 4XIGS 1NBMA 3SC3A 4FW9A 4PHHA 4C7OA 3SBEA 2V1XA 5FUWA 2REBA 1RZ3A 1Z28A 4HAUA 1EWQA 1E2JA 2NO0A 1QBKC 2EU8A 1R0ZA 1XBTA 3QE0A 3UK6A 3LW7A 4KLZA 2XB4A 1R0XA 3ETLA 3FOZA 1ZM7A 5GJWC 1XEWX 3KTAA 3QG5A 1UAAA 1W36C 2CL0X 2CVHA 2IWRA 3UWKA 5IHPA 3ZVNA 3GJ0A 1W47A 3ZVMA 1CLUA 1KK0A 1KK3A 3WRXC 4GBMA 3G0HA 5DH9A 2O8DB 1FMJA 1CF4A 2ZROA 3A1TA 3U3JA 2ZRNA 1TF7A 4OHXA 3VX3A 1NJGA 3CWQA 1UFQA 4OJQA 5JLJA 2GCOA 2WWWA 3OIYA 4MRRA 2CK3D 3QNUA 3MMPA 5C2JB 4OHYA 4TL9A 3W6OA 1N0WA 1JPNA 3K8YA 3LXRA 2L0XA 1WRBA 1TPZA 2ONKA 2YOHA 5SZHB 5KYKA 3QPUA 2C5LA 4WZAE 3QIAA 2BBSA 2QENA 1E2GA 4B6EA 4PANA 1YJ5A 4LBVA 1QHHB 4RY2A 3EASA 2WJYA 2QSZA 3IILA 4YXWA 3D3QA 3W6PA 4DSNA 2F9MA 4ZKDA 2AKYA 2ZVPX 4NBSA 3PITA 1E98A 1E2HA 3LV8A 1E2NA 1XD9A 4RKEA 5H1YA 4PHTA 3ZVLA 3LA6A 2J0VA 2ZS7A 4M1TA 4JZKA 1P61B 2O8CB 1II8A 2OAP1 2O8BA 4PHGA 1ZU4A 1T6NA 3QEOA 3SZRA 4WIAA 3LDAA 4JLVA 4LBYA 1E1QD 2QSYA 5D3MA 1XDBA 4D4LA 1XD2B 1WBDA 2WWGA 3KQNA 4PTLA 5JI3E 1UDXA 4TYWA 1IQPA 4Q9IA 1K5GA 4B71A 2GJ8A 1FL9A 1KMHA 4A8JA 4B2IA 4PC7A 5JCZA 2A3RA 2BMJA 3CF2A 5KSZA 1R0YA 2XTNA 4WOPA 1GIAA 4JSYA 4JLBA 5EP2A 1G3MA 1XF9A 1ZD1A 4KYIB 2CJWB 3VU9B 4GI7A 1DEKA 3PV0A 3NHBA 2GBLA 2EWWA 1OB2A 4WVFA 4U00A 5B30A 3TBKA 3VHLB 3MGCA 4GZMA 4NCKA 3K0AB 3IHWA 4HB3A 4RZUA 3T5GA 2RGXA 2W6IA 2A2ZA 1HTWA 2FZLA 2C77A 1ZYUA 2QN6A 2OT3B 4WZ6A 3RS0A 2NGRA 3QQ5A 3SS8A 3W6NA 1L4YA 3VR3A 3L8ZA 1DO0A 1F60A 1VG0B 4HZIA 2DWPA
chains in the Genus database with same CATH superfamily
1CUGA 4GC5A 1H0SA 4HG2A 5FQNA 5ARDA 3PDJA 4F4JA 1DKMA 4RY8A 1XZBA 3FF1A 1CUYA 2AFVA 4G67A 3E2PA 4L4UA 3O5AA 1TVCA 2ZBUA 1N2JA 1L5VA 2WE8A 1XFDA 2AUNA 3ZY2A 2PT6A 4DJFC 4YAIA 4ER6A 2M6LA 2GGSA 4QOSA 4A7PA 4C3ZA 4DIEA 2ZIXB 5KYTA 3FPAA 1Z13A 3K31A 4DKJA 1HM5A 3QI2A 4M8NE 2JL1A 3AVVA 1JDZA 1W4LA 1YULA 4V0SA 2FPWA 1Z29A 4HLUA 1DKLA 4GPBA 1LWOA 3GQBB 3HCBA 3HCNA 4MV9A 1XA0A 3B48A 5AKIA 5FBWB 3LL4A 1ZY2A 3LYHA 4LXGA 2EARA 3EEIA 3WSTA 3STUA 2OBLA 3WK6A 1H4SA 2NAFA 1UK7A 4D5GA 1F0NA 2CF6A 3KUKA 4HK4A 1Z0IA 2YZ2A 3BHNA 2BWJA 1SA0B 1Z4QA 3HA2A 4MVJF 5CJPA 5FJJA 6LDHA 3PENA 3UPUA 2WBLC 3MTDA 3FYUB 4HQ0A 4U7PB 3UA4A 3C41J 3R6WA 2O4UX 2VUHB 3WK9A 4I46A 1IZ9A 2PS0A 1T4CA 3BERA 5A5EA 2REQA 1GU7A 3BORA 3QFTA 4V1CI 2YVKA 2Z09A 1VIYA 2C98A 1YZNA 1DX6A 3CLUC 3ENZA 3FZEA 4ARAA 1GTSA 3B1KA 1BW9B 1ODIA 4EQ6B 3GX1A 1YA4A 2GD6A 4BJ1A 4CM6A 5IF3A 2KBEA 2CZGA 1KVQA 2GM3A 4FFDA 2O23A 2FP4A 4Q37A 1ZNQO 1EM6A 3JQ7A 3R0JA 3M6VA 1X9IA 2EJVA 1CQXA 2HFKA 4UEWA 3V42A 3VYTB 2HF9A 3U4GA 4BFYA 4AO7A 3DPSA 2JVKA 5CLLA 3AR6A 1GARA 3GPDG 4I1PA 2FKAA 2WJIA 3K15A 2PX8A 4YGXB 4KRYA 3JYLA 3TS1A 1P6QA 1C4OA 2HLDD 2ZRIA 4PSAA 4AD8A 4INOA 1THMA 3ICVA 2BTQB 2CUZA 4L28A 4CLRB 5K8TA 4HR7A 1LWNA 2ECOA 1VSQA 5DGCA 3MOSA 4B48A 3DL2A 3E5NA 5GGYA 2ZJ5A 1SOVA 1M7HA 2KWIA 3HO8A 4K03A 4P1ZA 3NRCA 1QS0A 4YUWA 2EJWA 3P5SA 1C1YA 4B7AA 3JQCA 1I01A 3HE3A 3KK0A 5CGQB 4F5DA 1W25A 1ZAKA 1VL2A 3M6FA 4R0NA 1IMOA 3LHDA 3Q9UA 2GXUA 2IZ5A 3DZ8A 4TLCA 3SQDA 3WRVA 1U28A 3U7FB 5E1DA 1TYCA 3CZ4A 3NIDB 2FN7A 3SZGA 1ECGA 4BFTA 3SAJA 1G8SA 3DOEA 2ID7A 3BIJA 4BV8A 2C2WA 4M0MA 4H60A 3HWWA 2YVQA 5LMZA 3JVIA 2JJ1A 3CLSC 5HF6A 5LD2B 3OBBA 1DBWA 2AMYA 2R62A 5C5CA 3LXXA 4M0PA 3QPCA 2PA3A 1W1WA 3ANMA 5DBFA 1BQ3A 1G63A 5AJYA 3S8YA 4FDMA 2NYAA 4LOHA 5GPBA 4K9NA 1T5LA 7YASA 5B37A 3MCVA 1D2GA 5AVQA 4GKJB 4RZHA 4KRFA 5K8CA 3B6IA 4E31A 3VVMA 4XCVA 2P9TA 3MNFA 1QTIA 2OXRA 4ZEOA 4N47A 2HRZA 3H13A 3P9ZA 2QD3A 4H3VA 3CX8A 3ZWOA 1SGWA 2HPHA 1NPDA 3FFTA 2ZSUA 4ND8B 3IIJA 3D3WB 4R8KA 1EXMA 1YVPA 3D4PA 2HMWA 2P2CA 3UAWA 1TC1A 2B2CA 3PBKA 3KZOA 1P2TA 2FPPA 3LI2A 5EWJA 1WBBA 1SXJD 3N8GA 4E5NA 4PE5B 3B5EA 3N2IA 4YNBA 5JVDF 2I9KA 3KC2A 3EXEB 3KLBA 5AKZA 1XCLA 4R2JA 3LM8A 5KMGB 1L1EA 5ERYA 2I1QA 4LNAA 5J3JA 2AEMA 2CUNA 1M2HA 3ER8A 4RKWA 3O26A 2WIDA 1UKCA 5FIUA 1T0UA 3H99A 5CDGA 2QL7A 3U48A 1P9NA 1SU7A 5D3ZA 4P82A 3ZKWB 1A9XB 4L5YA 4RK5A 3T5MA 3WWCA 5G3ZA 1BG6A 1M1ZA 5GOTA 4CIDA 2MHCA 4HDCA 3UVEA 5JHHB 4XGNA 4R9VA 1RBYA 2JA1A 3KHKA 2QS9A 3A4MA 2ZJ1A 3O4IA 3LBHA 4G1VA 4XLLA 1Q3HA 3L7MA 4BFSA 1LK5A 1T34A 4RZXA 3U7QA 1HV8A 1C9JA 1V7ZA 2H2DA 1Q0PA 1VPEA 1XJ5A 4PHCA 5L7YA 4WLOA 1G4UR 2IUFA 1GNVA 5G0WA 1KI8A 2F1KA 1E0JA 4ZAYA 5JCJA 3DLCA 4DAOA 2D1FA 4LI0A 2VH1A 4Q24A 3OIDA 4YAJA 4X20B 3IKJA 1ODFA 4FQ8A 1TVKB 4ZOAA 5DX1A 4CZ2A 1OLSA 2NWQA 1ULZA 1ZOPA 4K9RA 5JZ9A 3CUEF 2Y2UA 1UMDA 3BCRA 5E95A 3ZV3A 4JELA 5FTWA 3ZCPA 2XYHA 3MCUA 1CPYA 1PS8A 4IPTA 1KK2A 4O33A 2I3AA 2FG5A 1PJBA 4E21A 3GEHA 2NVWA 4Z86A 1NMXA 4AY6A 3ZS8A 1AQIA 2FRXA 1YB1A 4H7FA 4BNIA 1HYHA 2OXIA 4MEBA 1DX4A 1Z4MA 4QQKA 1EIWA 2CL6X 1V5EA 2D2VA 4DG5A 2ES4A 4DVGA 1MJNA 4W5RA 4JVLA 1JWAB 1USUA 3DVLA 4G5OA 3TZEA 2UUPA 7MHTA 2JGEA 5E1MA 5K0EA 5D1HA 4J1SA 4ROSA 3BC1A 5IP5A 2RHDA 4BP9A 1DPGA 4RVFA 2W00A 5FUVA 4KWTA 2WU4A 4FOOA 3R5HA 3WB1A 3PUIA 2IHUA 1PJQA 1XLUA 4I55F 4AJ4A 3HWSA 1QGUA 4EB3A 1X1TA 2OMKA 3L6BA 1T24A 3QKSB 1Z12A 2BP7A 4MWEA 3W34A 2PANA 2GARA 4ZEXA 4HXYA 3RVQA 2QGFA 1Z2NX 2ZVDA 3EOAI 4MKHA 4CF7A 2I6SA 5CTAA 3EDYA 1QG2A 2WIKA 4WXMA 2RK6A 2XRFA 2QYTA 1JFSA 5HG0A 2XGMA 5HJ7A 3SZMA 3TXXA 1T13A 1GZVA 3DE4X 1A4IA 4PIPA 4LQCA 5LZ4A 5T5QA 1UZNA 2C8JA 1R66A 3GHYA 2Q5LA 3OA2A 3NC4A 4YCMA 4NYJR 4U4AA 1G1AA 5DHQA 1F14A 2BFCA 2OQRA 1RPZA 3EFOA 2R8XA 1T8PA 4UM8B 2OBMA 4TTJA 4KVZA 5PNTA 1Z75A 2NZ2A 1E1MA 3ZGVA 1R74A 1LC0A 4U9HS 1CUEA 2Z2KA 1U8YA 1Z26A 2P8JA 2CBGA 3PR3A 4XIJA 1SZCA 2O1XA 3ESCA 1LK0A 1YVRA 1C0LA 3BMNB 3PLRA 4NPHA 1L9XA 4EHAA 3FTFA 3F3MA 2Z43A 5BN3A 4DREA 5IBRA 4EY6A 4KXQA 2G5TA 5JAIA 4RVDA 1ZMRA 2WPDA 3OE5A 2B5VA 1BIFA 3GEGA 5ADWA 3EZ2A 2QRHA 4MVCA 3RVRA 3AGQA 1YIAA 2PQ6A 3CFYA 3NU1A 1P77A 1UXOA 3BFXA 4PZ0A 1W94A 3WMFA 1RE0A 1X1AA 2RH5A 3QA9A 1U4NA 1VZ2A 4BQPA 4EEKA 3DMRA 3OTWA 2FPMA 1JHQA 2X9QA 4QXQA 5HF9A 1RXSA 2PWPA 5J4LA 2RAPA 1JIIA 4DXAA 2WQ6A 1LK7A 3NV9A 2VIIA 1I4LD 3LFTA 4DG8A 1OHHA 1RC1A 3QVVA 5AUOB 5IFKA 4HQRA 4Y6LA 4AF7A 1X7GA 4IJVA 2I3ZA 4ALIA 1RT9A 3KV3O 5BRNA 1BMFD 4S1OA 3BVPA 1L4NA 1YK1A 5LVAA 2VJLA 4A0FA 3WWYA 3HKBB 1TL7C 2MWMA 4C76A 1EDBA 5AJZA 2HMUA 3RS7A 1EFKA 4C0KA 2GPNA 2EJTA 1JW9B 3LSTA 4ZPXA 4C1BA 1JR3A 3JZMA 4QUHA 1V4NA 2ZSBA 1BDJA 5BSHA 5GINE 3NEPX 2FMUA 2IU0A 5JJCA 1E3JA 2GUGA 1ZGGA 2FUEA 2HADA 2R1VB 1XG5A 3K1TA 3OTGA 4NIMA 5KYYA 2OXFA 3FWZA 4IDOA 1F6WA 4RTJA 4YJFA 4K1XA 2R6AA 4XWGA 1LZLA 1JJAA 1Q2UA 2C2MA 2XBLA 4FFLA 4BKMA 2AD5A 4PSVA 3GU3A 1WHTB 2PRKA 4PCVA 4LS3A 4I50F 3BBPA 4TSFA 3KSRA 1L5NA 2GK4A 5LIRA 3ZI7A 5LA6B 4ASUA 5IUNC 1X3SA 5JSFA 4PU0A 2X0NA 1TK2A 2JFXA 3G1UA 5EP1A 1U11A 3TKYA 4DCCA 2FSVC 2O3SA 4EX6A 1F2UB 5B1YA 1QLHA 3H1AA 4RADA 2H17A 4MWTA 1GRNA 3QLTA 3E3MA 4LHWA 1KH3A 2PKEA 3QE9Y 2FQQA 2QN7A 3G2IA 4MLCA 2ZVJA 2HGSA 2Y27A 1FRZA 4OHFA 5JXHA 3R3ZA 2VHQA 3EIHA 2QX6A 1PNQA 2V7PA 4YO8A 3NH9A 4JLJA 5F5NA 3TNLA 3ZWVA 2ZS8A 4E5SA 4D4JA 3EGVA 2P40A 3CF6R 4BFXA 1W5SA 1XMPA 3VPGA 4DVJA 5HZKA 1T5SA 2D2EA 2IEZA 5CB6A 1OD6A 4AO6A 4Q47A 1K8YB 3L7LA 5JDIC 2HHCA 2B1RA 1P9WA 2C5SA 1IQRA 1A9SA 3AO0B 4NV0A 5AI0A 2JGFA 3ZGLA 4PLZA 5F4ZA 4ARVA 1E96A 3U7RA 1FSSA 2ZSEA 3A9TA 4PLFA 3J80A 1TUGA 4QL3A 1Q77A 3WZLA 3SLGA 5JJIA 2G0AA 1J33A 1YS1X 4GPAA 2QW8A 1UBGA 3GEDA 2Q1XA 5TQ2B 4HNQA 5I9TA 1JEJA 2PSEA 3ICWA 4EJSA 3AVUA 4M1MA 1IXZA 2Y1WA 3FVWA 3OE7D 2ZP1A 1CDDA 1Z0KA 4H3KB 5ESRA 5HFJA 4MYHA 4ACAA 4FI3F 1NAHA 2G36A 1X80B 2W8ZA 2EW2A 5B55A 4BVBA 1B0UA 1SKBA 1SC3A 2H11A 3FSGD 4ZHSA 4Y6QA 3SLRA 1IRXA 2X2EA 4A4DA 2FEXA 4UNSA 3M5DA 1UT6A 2AG6A 3CE9A 2VXYA 4GMHA 5FWXB 5IJ0B 1CUUA 1N9ZA 4B35A 2C1EA 1VJGA 3TECE 1Z8FA 1GL9B 2VHVA 4WLVA 2VWPA 2ZW9A 4QPNA 1P2DA 3RFVA 4ZO8A 2YASA 3EAGA 5CGZA 3ZWQA 3H0CA 4E33A 3E9NA 4BECA 4DN6A 3IQDB 1MEOA 1PEDA 3M34A 4GGOA 5F1KA 7AT1A 4YDQA 2Z3VA 4ZQFA 3KNZA 2X4GA 2IYWA 2J3IA 2XMZA 3DL0A 5E3IA 2BMEA 2I99A 4ZC8A 4X8HA 5AHOA 1DCMA 2RKBA 3DDCA 1Z45A 3K4HA 3E0QA 5A1TA 1R5OA 4MMZB 3FLBA 3MD0A 5CB8A 1SKAA 1WY5A 2GLUA 4MKXA 4D74A 1DC8A 5DT2A 1D2CA 4U7GA 4E5DA 4ZMSA 5IK2D 1IN1A 1T3LA 2CEKA 3TRKA 1A3CA 3PT5A 4URHA 1VBNA 3HR7A 5IABA 1ORHA 4PQGA 3WYEA 1CUDA 1Q0LA 3NHSA 1SC6A 4MW6A 3ZHVA 2AQKA 1E0AA 1YH3A 3BF8A 1F8UA 1HBJA 1W76A 4GAEA 2GF2A 2CUTA 1OWPA 3COPA 3F8SA 4MAAA 4YEDA 2ZYVX 4KUEA 2H2IA 3JQFA 4L5BA 4MCIA 1OKKA 3AWDA 5FADA 5A9SB 4B3MB 3TQOA 4YLEA 1ZNZA 4M0FA 1W46A 2LXNA 1TVMA 3Q5EA 3KVOA 1ZWKA 1DKPA 2XV1A 2VQSA 1QUFA 5BR1A 2YW9A 5J2TF 2YFKA 2FETA 1OBOA 3E7WA 4RHXA 3II6X 4TXNA 3ZYZA 4CUZA 3B1JA 3PWKA 2JFOA 2AJCA 3DMYA 4TKLA 2XAAA 3VTFA 2GN8A 4ADSG 4DA4A 5DNDA 5AVRA 1E79D 4OEHA 1PRYA 1HLDA 5EIBC 2PD6A 1OX6A 5DWDA 4EYKA 2CJYA 1Y9AA 2AVNA 1HDIA 4JYZA 3CX7A 4DGSA 4DSAA 2BI8A 5GV7A 2NIPA 2VF2A 4AYTA 3WAJA 2QP9X 4MP6A 2GR9A 5EL0A 3NT5A 5B1DA 3ZYCA 4AXXA 1G16A 4WMLA 2ZR9A 4DG9A 3CO5A 4EARA 1AUQA 3DBLA 3U1VA 3B9QA 3MUNA 5K3DA 1FSFA 3VH4A 3A1EA 3N58A 3ER6A 1WS6A 4Y2QA 2O8DA 2Q8PA 4CPDA 1W19A 2WSYB 3C5EA 2FPKA 3FPLA 4KIWA 1M7BA 3R4VA 4LSWA 4B3JA 3RTAA 1JFLA 1GRVA 2CSUA 1YFKA 2ZUSA 1HYBA 2VTKA 4M60A 3F7NA 3WDLA 3W06A 5A4KA 1JZQA 3P2OA 1CUCA 1XZHA 3DWIA 3GPCA 3UBMA 4FYIA 1NVBA 4D96A 1PHPA 3WNCA 4B3HA 3C5VA 1KJIA 1QZZA 4YDSA 5FOVA 3WYGA 4W1RA 5EINA 4WXPA 1SCBA 1ZR2A 1CZRA 2WOJA 4RCVA 5AJHA 2BZGA 2WSBA 3O8RA 4YB8A 3KWLA 2CEAA 1B8UA 5ECGC 4KN6A 3H4IA 4RLQA 2PRIA 4RZSA 3S2GA 4K3VA 3HEAA 1JA0A 1Y3FE 1XEFA 2OXEA 2PUJA 3M6AA 4HRXA 3V1KA 4BLPA 2G09A 2MSNA 2Y1GA 2Y3IA 1Y8QA 3M4NA 4ZXPA 1E3LA 3VDQA 5A5DA 5BQFA 2FPRA 3AZQA 3R9IA 4S04A 4N18A 4PZPA 4HUTA 1ITZA 5EJ5A 3SSAA 1D4ZA 2DBQA 2ACWA 2OGWA 4II7A 2HREA 3ZHCA 1R4MB 4ZKEA 1D07A 4UEQA 4KVGA 4ZDIA 3QNWA 1TUBA 2W6PA 3JYQA 4OAQA 4XYGA 5D00A 5DNCA 4AS1A 2X9NA 4XX0B 3G2PA 1C81A 3KLOA 3NMUF 2O8CA 3FR7A 1ICIA 4Q01A 5JV5A 4WNCA 2H85A 2TMDA 3AESB 4HWPA 1CFJA 5GONA 4UQOA 1KE1A 1W87A 1L4BA 5FI1B 3H75A 1BNCA 2J9XB 4LV6A 2XT6A 4TT3D 1S2OA 4F9FA 3B89A 3L6RA 3OCCA 4ZVPA 1Y1KE 3PR2B 2HEIA 4CF3A 1U99A 3S27A 2Q99A 4KSCA 2JIRA 2WTAA 2JH9A 3AKDA 2DBZA 3MIZA 3PP8A 1Y3AA 1NJ1A 2ZRJA 4OVKA 4F4HA 2ZBFA 5K8JB 3IAHA 4RORA 1DIRA 1O58A 1Q1ZA 1SWWA 3H5NA 3NZEA 1HL3A 3PXGA 4KXFB 4P4NA 4N3BA 3WYDA 3RYFA 4N39A 4V1CA 1F4VA 4BZXA 4MI3A 4Z4FA 3QE2A 1UJBA 1PBTA 4LF5B 4XI9A 2Y66A 4LY9A 3G5UA 3EVCA 2IHTA 2YUTA 1XAGA 4OH1A 1ODTC 1EGVB 4CDNA 4EG3A 6REQA 2YHIA 4RO0A 5FRDA 3E8SA 4QFBA 1ZD3A 5IJXA 2QTGA 2WFLA 1TD1A 1CU1A 3N3BC 1G55A 2GN2A 4Q3CA 2SNIE 4HN9A 2JFGA 1I6MA 1U1EA 2GO7A 4REQA 1IAQA 3VH3A 5HGXA 4ZI5A 2DKFA 3EBLA 1JQAA 2ECPA 5TR9A 3MBOA 1R6TA 3VAZA 1X13A 4I6JA 2RI0A 1FU4A 1RPAA 2D2IA 1C1HA 4OP1A 2NSJA 2PVPA 3C3BA 4HN4B 2C00A 1C80A 2B9EA 3R7FA 2M9MA 2WLSA 2F8LA 3RS8A 4DRYA 4QBTA 2E49A 3SVTA 1CUAA 1UJMA 5E7JA 2RGGA 1EIZA 2Q3FA 3OAAD 2QZ9A 5CCBA 2W2LD 1GPLA 2XWBF 1G59A 1M0TA 5EPEA 3ZE1B 4G8DA 4MIYA 5JSKA 3KQHA 2QMYA 1PJCA 1VE1A 3D7KA 1DJQA 1E1QA 3DAOA 3NGLA 4HDNA 4UDOA 3BFVA 4RTQA 1L8AA 4YJGB 3QV1A 4F8EA 4M54A 4MPPA 5DF1A 5J5CA 1RTTA 2ILVA 2ACEA 1ULUA 1WXEA 2GPWA 2HSJA 3AIOA 3P9SA 4HDMA 2GB4A 1CUSA 2G4CA 4REOA 4D1YA 4INJA 4BJ6A 3D4LA 3AOEA 4LQ4A 1P19A 2H5IA 3ELDA 4QQNA 4RL6A 8OHMA 2YMLA 3IE2A 3LUGA 1TAUA 3ROFA 4HGPA 5JXGA 1GNPA 3IB3A 1U0TA 3FKJA 2R8OA 3IV6A 4MW2A 5J43A 2OD7A 2ZJ8A 2AT1A 4HZUA 3DJYA 5LWHA 3UKJA 2OUIA 3VR6D 1WD7A 3UJNA 2CJPA 1ECPA 3VZRA 1NBIA 2ZQZA 4CT5A 1SXHA 4RZ3A 2ST1A 2B5OA 4OIFA 3ZUPA 4MK4A 1ZMTA 2C9DA 3C1AA 5IEBA 4M98A 5L7TA 1W48A 1RI5A 3I0NA 4RKYA 3W5SA 4CTMA 3EZ7A 2HN9A 5KO2A 5FULA 1HURA 3BEDA 2GILA 5AXBA 3VVBA 2XXAB 5LP6F 1R18A 3GIDA 5IYZA 4KAXA 1IM5A 4YP1A 3X3HA 4NATA 5C4GB 3RO7A 3R5TA 1JG3A 1M6NA 1ENOA 1AKEA 3PGA1 2WFZA 1L6IA 3CQ9A 3IQGX 1F8YA 4M6WA 1YS2X 4YRDA 3KR9A 2OA0A 1VYTA 1PO7A 3LDHA 2FHSA 3TL6A 4ZYTA 1DT3A 1CSEE 2WP8J 4O4HB 5BQOA 1SH7A 3I9LA 2E6UX 3L6CA 2HSZA 2ZR0A 1WTCA 4RQBA 1P2VA 4Q6WA 5AW3A 1Z0JA 1TJPB 5AW1A 5E1OA 3NBUA 5LBTA 3LY5A 3RS3A 1X2BA 2PU5A 1M2KA 3GLQA 2B2XA 3O8BA 1Z3CA 4IUYA 2OENG 3G9XA 2PAAA 3P0IA 3DD5A 5FNVA 1N2CA 2W6JD 3QMPA 3WJAA 2XCTB 3R7WA 2FPIA 4HMPA 5CA0A 3I2YX 3OIUA 4KYTA 1AU9A 2FQXA 3GVCA 3G9ZA 4WK4B 4G24A 2JHPA 1ZI6A 1EK2A 4BB0A 2HHHB 4IUBS 4CKEB 4L08A 1NR1A 3INTA 1IUPA 3BJMA 1EFLA 1VG1A 2PS3A 3T15A 1CP2A 1Z0SA 4F3YA 4ZGBA 3E22B 3IOYA 4DCGA 4LE1A 4UTZA 1DEOA 4F6LA 3S40A 1HZZC 4ZYYA 3DXXA 3N0VA 4P4SA 1L7RA 1G9XA 3UYKA 3CR3C 1BXRA 2E6KA 4R7ZA 1C7FA 3RROA 5D7BA 1YHZA 2PL1A 2XD9A 3WX0A 4TV9A 1WIWA 3UHFA 3WKEA 4CYMA 1R8QA 3ZBUA 1RU3A 4XASA 2GN4A 4DA0A 3C8MA 1MENA 4EL5A 1MJFA 4C6HA 5KB3A 5ICSA 5DIZA 3NBYC 2JEZA 3GFSA 1DAHA 4KQKA 3M2PA 5ALSA 1A98A 4DF3A 1IG3A 2HLDA 3ZZ1A 1UH5A 3B8HA 4KE8A 1VCIA 4H27A 1RR6A 2QM8A 4F5YA 2F55A 3TNYA 1K7EB 2QB5A 3B6EA 3M4YA 3TX2A 2H0QA 1SCAA 3VOBA 2Y4NA 1DE0A 2QN1A 3AI3A 3ZEIA 4DMMA 1U3UA 3WL5A 3HJAA 1DEHA 1NSTA 4PZUA 3RFXA 4F46A 5JANA 2GNAA 4B3RB 1PJAA 1XEXA 4M2LA 3WV5A 3LQQA 1YOVB 1D2MA 2WD8A 2HV8A 3H9EO 3RC2A 1SG0A 3ZY4A 1KKMA 3UC5A 3AEKA 3ZCXA 3IIKA 3ZHSA 1PFYA 1KGDA 1LLQA 1EHCA 1T6BY 2O6HA 2IP1A 3HA7A 3I5UA 2IHZA 3K1JA 4PBTA 4RM3A 5A62A 1OXKB 2RGNC 2OL4A 2FVYA 2JEOA 1BMQA 1YZ3A 3AXSA 3AU8A 3MMNA 3T9CA 4OXNA 4UNQA 1O7JA 3LY8A 4PG6A 4BFUA 3S99A 1R8XA 5JAOA 2WB2A 3KFLA 4G5FA 4I4TA 3SJAA 2VH5R 4Q1VA 1DTSA 4P54A 4K1LA 1ZWLA 3DEHA 4O4IB 5CT6A 1LC3A 5EZ5A 4ZO6A 3R8XA 4E12A 2XMQA 3ZHBA 1PWYE 2Q0XA 2PX4A 4JJ8A 5K0NA 4BAGA 1DQRA 1ZH6A 2IL1A 5JZSA 2YR0A 5A4AA 1OXVA 1XCJA 2CLLB 2TYSB 5LQNA 4HTAA 4NJEB 3AV0B 3HBNA 4P84A 1U8FO 2C7GA 2PTHA 2I7TA 4U3JA 2ZYDA 2Q0SA 2C2YA 4DLUA 1GTG1 2BAGA 2H54A 1DQPA 1M2VA 3B20A 3AR7A 3DZIA 1NN1A 1NP6A 1U5CA 2B94A 1Z6PA 4DIDA 1MIOB 4FFVA 2D0OB 2UVPB 1GKKA 4MAFA 2D1TA 3KZ1E 1CHDA 3I28A 3P94A 4MRPA 5H4GA 1L4UA 1IRIA 1FMCA 2OK8A 3GNQA 4K9OA 4F1JA 3KX2A 3HJRA 1SXJA 1CEEA 2V0GA 1TMOA 1F20A 2M32A 5AHWA 4IIJA 1LV7A 1QB8A 1BE8A 2HHLA 1TIKA 1LLUA 4ZIRA 1KZGB 3AF1A 4EGJA 1GR1A 1H65A 2G4LA 1Y4SA 2PL9A 2Q4OA 1SBYA 3KLPX 1A72A 2OCYC 1FSGA 4FK8A 3RSGA 3T3OA 3L4JA 1FNDA 3BDAA 5E4JA 1JDTA 3HZOA 2ID4A 1EU1A 5BRJA 3VR4D 1YE5A 2AI2A 4MUNA 4AL4A 3HHPA 1KI6A 2VNIA 2ZXFA 2OILA 3QITA 3O2NA 4KDFA 4MTCA 5C8XA 5IDQA 3BIWA 3EC1A 2JLYA 3ROKA 5JNSA 4TYNA 2JASA 5ULLA 1L4FA 3UXHA 2GD0A 3ILSA 3EIXA 3IALA 1Y0BA 2QR5A 4LWPA 5MFPA 3RHTA 1OT5A 3GLIB 4WL0A 3T5BA 2GM5A 4P7BA 5T57A 5E6UB 2WUWE 4H1WA 4BAUA 1SBIA 4V3BA 2II6A 4N01A 1QX4A 2FP4B 3STYA 3WQQA 2L69A 3JQ7B 4JIGA 2XIQA 4D8TA 4DB2A 2O5EA 3W5JA 1D9XA 1LX6A 3AIIA 1UC4B 3KIPA 4P4GA 4P92A 1XKXA 3G2NA 1QDUA 4K6CA 4EWLA 5ITSA 2ZYTX 3AJAA 1K97A 2IW1A 4AUMA 4XVRA 3E9MA 1NL3A 2WT8A 4EHLA 3GD7A 1KDVA 1RXWA 1XJ0A 1PBNA 1H1LA 4AZ0A 3O91A 3RG8A 2C2XA 5ALFA 3Q6IA 5DSZA 2DWOA 4B09A 4QAJA 4IH9A 2IUYA 1C4XA 1QKJA 1T4MA 3D8SA 2IGBA 1KERA 4TWIA 3ASUA 4Z9XA 5A3JA 4S1PA 2XMPA 4U02A 3C8UA 1IM8A 3OCWA 1HG1A 3QKRA 2EF0A 4UBNA 1JZTA 4ZD6A 3QXCA 2W70A 1FDSA 1KAHA 3R5JA 2OHXA 4L4SA 3N53A 4G0UA 5CJJA 3RYHA 4Z0PA 2I4RA 2ATIA 3J7TA 4BNNA 4CL2A 1GPAA 1AKTA 3AUKA 3E18A 4FIZA 3E70C 4CUJA 2YXEA 5C53B 2GRAA 1KO5A 2BDTA 3WTCA 4QKQA 4ZT6A 5GIPE 3SJCA 1X2EA 3U44B 1OV6A 4BLVA 1T2DA 2ARKA 3GJSA 1ZL0A 2QVLA 4HEA6 1YONA 1YCHA 4JB3A 3S1AB 3PEYA 4FLEA 1E6LA 1O0SA 2VDQB 3CWZA 5KIAA 1H42A 2A1TR 1PWEA 3ELUA 5HBGA 2JJ2A 3AEUB 3CTMA 2C07A 2NUTB 2Q3CA 4RVCA 2EG9A 1AS2A 2LIVA 2XLBA 1QKKA 1QNFA 2ADFA 2PMWB 3GRZA 1XQ6A 1PGQA 2R00C 4WFJA 3CR7A 4KFCA 3DMPA 2HSDA 1SQ0A 2QVZX 1WDTA 1YZGA 2GZ3A 1K68A 2P7IA 2HJVA 2WMYA 4PS0A 3O8CA 4J3NA 2OV4A 1C4WA 2YJ3A 4M7PA 4YLGA 1GAWA 2P4EA 1FJ2A 4B6PA 4WBNF 5KTOA 1WAMA 2GYWA 3CGGA 4GZ5A 4KO8A 4C6SA 3OSUA 1E1CA 1MAWA 2B4RO 1UWCA 1T1EA 2XUQA 3A7DA 2ZYUX 3B9PA 1E7MA 4MQFA 4QFDA 2IH5A 3AF6A 3VMMA 2G08A 2P79A 1P6XA 3D7SA 5EWJB 3Q7TA 3GEIA 4H7DA 1JTEA 3PGJA 3W4KA 1ZGZA 3B8EA 3IRVA 1G5HA 1T91A 1U3CA 3SDSA 5LYYA 1MEJA 5AVKA 3Q7RA 1M2EA 1GVHA 1H2RS 2VO1A 2XEXA 1FX1A 5EI5A 4YV0A 4D25A 5HCUA 4N7JA 4B74A 2BKEA 3HA5A 1KPIA 3GFQA 1V6SA 2WNIA 3EARA 4LECA 4YPVA 3TG8A 4JVOA 1X1QA 4ZZ0A 1JDSA 3AMVA 3KVRA 1T8YA 2Z2YA 3V55A 1V8OA 1BMFA 4MWZA 4MR7A 3TSWA 3SHTA 2UV8A 5BQ3A 2ZBQA 3BEOA 3IAFA 3NT4A 3NP7A 4TSKA 2C8KA 2E3JA 4LRSB 3U7QB 3TB6A 1FS6A 1K6MA 2F90A 2PX0A 4LHYA 3DEIA 3I76A 1I6KA 1LH0A 3ICPA 1NVGA 1Y7LA 4M49A 3TJRA 3WGKA 3ZCQA 1YCDA 1NOIA 4OTZA 4DCNA 2JLVA 4NBRA 4TTRA 3HYSA 3Q5DA 2EJCA 2A6PA 2KBFA 1NVAA 4KBGA 1OFIA 4PCAA 4EA7A 1JAXA 3FLMA 5BNFA 3B1YA 2QUBA 1ADCA 1BGXT 2J59A 1OLSB 4RM2A 5C0OE 2K7FA 2DQKA 4HB2A 1UMDB 2VSFA 5EQDA 5LMUB 1SHLA 4O0MA 4R1TA 1UPFA 3K7EA 6Q21A 5JARA 3KQUA 1U9YA 2O3UA 3VJRA 3CNHA 1YR3A 1QG0A 1QYWA 5C4IA 1JFVA 1RCUA 5JCPA 1VKHA 1I9GA 2I78A 2ATEA 2UUBB 4L9RA 1NVEA 1U8AA 4J03A 4JXZA 1M2OB 2XYGA 4NCJA 3L0YA 3RLFA 5D1NA 1OH8A 4TZ0A 3QW2A 3AHEA 1RQLA 4J3FA 3I9NA 4C4SA 3TIVA 4BQSA 3TKLA 1Z4JA 2M98A 3R77A 1KOJA 4HCJA 1FX0A 1I0ZA 2V6MA 1ZINA 4O2AB 4CG0A 2AYXA 5BR7A 3NVAA 3OMXA 4UXHA 1FXWA 2A4MA 1QGUB 1V1RB 2O7QA 2WA2A 3A06A 1W0JD 1XMSA 1YTLA 1YRLA 4RK0A 3ZGOA 4DE5A 4S05A 4Z3KA 1GN8A 5K4HA 1JF8A 1G7TA 2XMBA 4AJPA 2PJRA 5FTMA 2FWIA 2PMEA 3C3EA 5HKLA 4ALKA 4RNCA 1ZQ9A 2QG9A 5D84A 2OY0A 4M9SA 3OE7A 1NVMB 4C4TA 4HVCA 5IBQA 5BWLA 2XBMA 4IX1A 1VMEA 4NSNA 3ZIDA 3BD6A 1GA6A 2DFVA 5GIOE 2PMFA 1BJKA 5F77A 1EFPA 4CXMA 4HWTA 5FR1A 4C87A 1GV0A 2BFCB 3AZOA 4W5QA 3OE4A 3O84A 4CEHB 3OU2A 4RYDA 2I8CA 5KTMA 1OI7A 4E7OA 5TGDA 3C6MA 3SKVA 5T4EA 3ZZ0A 4UVHA 3L40A 3FSGA 5SYAA 5KKCA 4ER0A 4PIVA 1XQ1A 3H42B 4GH5A 1DTWB 1RYZA 2ZXUA 3HJCA 4CG2A 3RQIA 5IWAB 5BN3B 2I7CA 1V8DA 2ZQ5A 1BHSA 1EX9A 2E87A 1WR8A 3JQQA 5FV7A 3VZCA 1ZGBA 3ISVA 2PZFA 3LUFA 3K73O 1BSVA 1CUVA 1UPBA 4MUYA 3KQLA 1JTFA 4UUNA 2P2SA 1HXHA 1F0PA 5I9SA 4AU1A 2REOA 2IEGA 3I6ZA 4KXVA 4FSXA 2JIZD 1PZHA 2A0UA 3JR3A 3ZJYA 4QZVA 3GLKA 4JT4A 1KEEB 3Q3EA 2WJ3A 5FBZA 1Z8NA 4KQ1A 4KSYA 2A0FA 2YUIA 4R1MA 4YJ2B 5COBA 2IWHA 3V4PB 4KN5A 3ID6C 5IK2A 4DHEA 5JAMA 2J3KA 3ACDA 1ZRMA 2NU9B 3AKCA 2VN8A 4FU0A 4B4WA 4DS3A 2XRYA 3IAXA 2M6RA 1SBCA 1HK7A 1DU4A 3PPIA 2OYCA 3D8UA 4NMWA 4XIIA 3MBKA 5FYQA 2JGMA 1JAZA 2AR0A 1A9RA 2VXBA 4MQBA 4OU5A 1XWIA 4ALMA 1NJ8A 5DEOA 4PN7A 5EUCA 5KINB 2AXQA 3NUGA 4JSRA 4CM1A 5H83A 4J1TC 1ZZGA 5K99A 1ZVVA 1AF7A 5KVQA 4ZU3A 4G6ZA 3FTNA 1TAGA 4EQZA 1JLHA 1QP0A 3W78A 1IN8A 2ZBRA 4ECEA 4EI8A 1JQDA 1FFHA 3R75A 4CCWA 1LLCA 1QLJA 2R8EA 3EXG1 1DPFA 4RA9B 4YJFB 4B17A 1FVFA 2DUNA 4CN8A 3CVYA 1LVHA 1WE2A 1LVGA 3TOVA 3AYXB 2FUKA 1E79A 1NQTA 2YDXA 1DI0A 1PSWA 3T7SA 1JVBA 1E9EA 4IHKA 4ZI7A 3IT2A 3A25A 3KTDA 1JIVA 1OTHA 4TYMA 5DYGA 3ZCTA 3ADKA 4UD2A 4B4KA 2VDMB 1EX6A 1BAPA 3ENKA 3I3SR 3R7LA 3TAUA 4BO5A 2ANCA 2J9GA 4H7KA 4TGLA 2GWRA 2J1LA 4H08A 4WCDA 4XR4A 5E0KB 4RPIA 1G8PA 3CF4G 1O2DA 1PT8A 4JXJA 3WO0A 2HA6A 4AICA 1HWYA 1DCKA 5AO9A 2QSJA 3UUGA 4M1KA 5TMEA 1IBMB 3JQ9C 1CULC 1LQ2A 1TK3A 2GZHA 3K1YA 3KCNA 3NO4A 4J0QA 3W1EA 3F5MA 1KR2A 2OQ2A 1EH5A 2YXDA 4ZO9A 1ZM4A 1M0SA 4LOAA 5ES4B 5GGXA 3FFWA 4GSLA 4RF4A 4DTCA 3HZHA 2VC2B 4WLEA 4CF4A 3AUJB 3KR0A 4U5QA 3PDCA 3VGJA 3KOZA 1B6SA 2YWFA 1F7VA 3D7MA 1BKSB 2ESRA 3NFYA 2C5HA 1SFRA 1VPDA 4BHTA 4JVMA 4UHJA 4FP9A 1RC8A 1XK7A 1P7PA 4Z9FA 1QJCA 1EZZA 1K9VF 2WSIA 3F4KA 3LY9A 4I1IA 1I7DA 3PT9A 4EJSB 3OQNA 2WIAA 1EFRD 3CRMA 3LUDA 2O06A 1XKTA 4JJEA 2YKGA 4X60A 1MNQA 4UPDA 3A05A 5KS2A 2ID8A 1LSOA 1IVYA 5TF4A 4G0NA 3G2QA 4NYMQ 1JR4A 4MYTA 4KHPB 1XZIA 2WYIA 1NDQA 1PFGA 3STXA 4FXPA 4YAKA 1VPVA 2AHRA 4O4JF 5F64A 1K7FB 2TECE 4NBTA 4XYEA 5K8UA 2FR8A 1DIHA 3SYKA 1E20A 3PJRA 1Q6ZA 3TOCA 4CGYA 3KE8A 5IAAA 2RHLA 1H6BA 2JFUA 2Y6VA 3HO6A 5BVGA 1U6IA 1Z18A 3TSAA 3BTVA 2WU8A 3EUEA 3JWIA 1PKXA 2VDOB 2F3SA 4NCAA 2C82A 3KQOA 4HWSA 1JQLB 3TFWA 1S1CA 1US8A 5CW2A 2Q2QA 5JTTA 3V7NA 1JDPA 3DC7A 1B8NA 2MCFA 4FBGA 3BFKA 4TT3A 3SNKA 4RA6A 1SU4A 3DZCA 3IE1A 2J5KA