1Z07A

Gppnhp-bound rab5c g55q mutant gtpase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
b'SICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIQAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rab-5C
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 52
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z07A00
3ZIAA 3W34A 3VKHA 1L8QA 2XOKD 3PEWA 4BFWA 3O8CA 4C7OA 3ZVNA 1IN4A 2ZRIA 3LAWA 1SQ5A 2MSEB 2XGJA 1S3GA 2ANBA 2AHOA 1OIWA 1NBMA 3RS3A 1FQJA 2VEDA 1N5LA 2R6GA 1OFTA 5KDOA 2QSYA 4Q02A 3H2YA 3HU3A 3KKQA 3SBEA 4CT4B 2H5EA 1M6NA 3IKJA 4PSVA 1BH2A 4MDFA 3AB3A 3SQXA 4DLXA 1GILA 4PR0A 2F1IA 1ZNYA 5D3MA 1E9BA 2IHYA 4RD3A 3TGPA 4FCWA 4HDQB 4LV6A 2JLRA 2FA9A 4WA7A 1JEEA 4BFTA 2H92A 1M74A 1XD2A 1P75A 4EIWA 1W4RA 2VP6A 3A1WA 3SYNA 4LUCA 4DCNA 4DDVA 4HYYA 4EQ6A 4RZXA 4JBXA 1FW6A 4PAQA 1ZCBA 2QMHA 5A5GA 1ZJ6A 1KK0A 2Z43A 2DWOA 1W2GA 1P62B 4NCJA 4PZLA 5FOTA 4E5UA 2XB2A 1CS4C 1Q57A 2BVNA 3MJRA 1IQPA 4IXNA 3KUCA 3EC1A 4KFSA 1HY3A 1Z0JA 1MRNA 3K0FB 4UNNA 3W6OA 4LJ9A 2AKYA 5DI9A 4LYHA 5KU1A 4ZCLA 5H70A 2CDNA 4HLDA 3EWAA 4MKHA 5AWFC 3GLFE 5L3SA 4OJQA 1E32A 3QXCA 4NKRA 3CIOA 2O8CB 2QE7D 3BS4A 4Q9LA 3RVBA 3T15A 4DSUA 3KXKA 1A1VA 1E79A 5DI3A 2PCLA 2F1JA 3IHWA 4DLSA 3QOFA 3BGWA 3JZAA 2PT5A 5CDFA 2ZYTX 1HYQA 2I1QA 4K8OA 2R2AA 1Z06A 3HPQA 2AD1A 4X8MA 1Y3AA 2IL1A 3RYTC 1KI3A 5E7MA 2P3SA 1D9ZA 3I1FA 1KDTA 1KMQA 3B6EA 2QMEA 1GZSA 2AX4A 1LFDB 1II8A 2P67A 4FMCB 3THOA 4FMCF 1II0A 2FFHA 2G77B 2VYFA 1P72A 4B3DA 3IBGA 2BV3A 2GF9A 2WKPA 1QF9A 2ZI3A 3QUSA 1CLUA 2UZIR 3GCGA 3RS2A 1KMHA 4GMXA 4NU0A 4AC9A 4MQBA 1LNZA 1YZQA 2G9NA 1ODFA 1VYUA 2GCOA 1G3UA 1VKJA 3NHBA 4HB3A 3LBHA 1FFHA 2V54A 2QGNA 3H86A 4PPQA 4S35A 4R9UC 5FOXA 1OH8A 1PZNA 2O5VA 4I99A 1Q3TA 3QPWA 2RGNC 1AJEA 4P33A 4Q1EA 1XCGB 1R8SA 2V4ZA 5FPTA 2KWIA 2XNDD 1NBME 1YU9A 4QL3A 2ZJYA 4M8NE 1ZNXA 4BQSA 4BLSA 3AF2A 3I5YA 4OJKA 3B5JA 2ZRCA 3B85A 1Z8FA 4JL8A 4V0LA 4UNSA 4F38A 3CX8A 1LVGA 1VCOA 3SI7A 2RCNA 3OF5A 4P4TA 2O8FB 4M1MA 3VTKA 1ESNA 1FPMA 3SHFA 3ZZUA 1J2JA 1V43A 1MO4A 2N42A 2Q0HA 1VECA 2ZE7A 4FCTA 4JYBA 4LHZA 3UIEA 1UKVY 2WSSA 4TMZA 2QA5A 5FOSA 5FI0B 2NPFA 3IBYA 3Q5DA 3EPLA 5CLLA 2N46A 2GEUA 2QTVB 3CR8A 1Z0KA 2QP4A 3NH6A 4JLJA 3DDCA 4PTLA 4XSGA 5KYKA 1DAFA 4JLPA 1KJYA 1X1SA 4C4PA 5HKKD 3PENA 3PUXA 1DOAA 1P3JA 4QRHA 5BW8A 5JJLA 5GVRA 3AUXA 2O0JA 4TN1A 2DY1A 1WE2A 3U60B 2BJVA 3IILA 2ZSFA 1D5CA 1Q20A 1R2QA 3CRRA 4WAUA 1D9XA 1P2TA 4MKFA 2BHRA 4ZCMA 2YC4C 4RVCA 3ZVRA 1XMIA 1RVDA 1Q1EA 2FX3A 2QTHA 1FL9A 2J3EA 2FDCA 1KO8A 1MR3F 1X8KA 3AF0A 4I1VA 4NPHA 2O8EA 1RE0A 1YZKA 4II7A 4MUBA 2DR3A 3OE7A 3AQ4A 4OHWA 5KSPA 1ZUNB 421PA 4I4LA 2ZXUA 2IC5A 5CDFE 3LRPA 2XTZA 1CIPA 4BLTA 1SHKA 1NJGA 2ZRDA 2ZITA 3W9YA 4QHTA 2F6RA 1ZVQA 2WWWA 3EA5A 3L2OB 2XZPA 4AKHA 3SJAA 4P3YA 5B57C 1P60A 2JLUA 4ASUD 3CUEF 2JIZD 2QAGB 4NYJQ 1XMVA 1TEXA 4OQLA 3KKMA 5H1YA 4I1UA 2OO7A 2Z5FA 4AYTA 5JJIA 2VP2A 1T8TA 1ZM3A 5TV2A 1OIXA 4CT5A 3NKVA 3C5HA 1NLZA 1KKLA 3FFAA 4NP6A 5E7IA 5EE1A 4N0EA 2W6IA 3QF7A 1MRSA 1SXJC 2FPLA 3UMRA 4Q9JA 3K0CC 5KDDA 1G16A 2G3YA 2ZRAA 2P6UA 3TK1A 3UG7A 3LBNA 4KI0A 3S1AA 4BFUA 4UJ5A 1ZNWA 5JECA 2ZI5A 1GIAA 2XNSA 4OK6A 3GLFB 1OKKA 3NXSA 2C8VA 1WBDA 1U8AA 2IS4A 1XB2A 3NC1C 3OAAD 5SZIA 4B75A 5AUNB 4M2LA 5B30A 1DO2A 5DGXA 4BRWA 4YDHB 1Z3IX 3ZGXA 2ONJA 3QENA 4ABYA 4Q5IA 4DUGA 4E07A 1H8EA 1F2TA 2IYTA 1E2DA 1Z6XA 3FOZA 4YMTA 4A9AA 5LBIA 3O47A 4M9ZA 3SJBA 4B6FA 1G8PA 4TLCA 1R5OA 2H1LA 2I4IA 2EYUA 3CO5A 1E0KA 1UM8A 3A1VA 4RZ2A 1K5GA 4A4DA 4A6XA 4OQMA 3SJZA 1E2EA 3P20A 2J7PD 1RIFA 5JI3E 1QHHA 1G6HA 1F2UB 2ODBA 4KYUA 1R10A 2QORA 2F55A 1WBBA 3EZ7A 4RD2A 4MYUA 3PXGA 5FTKA 3K70B 3GEIA 1EWQA 4B47A 4HUTA 5KOYA 2ATVA 1E4YA 2ZSDA 1ZU4A 3F3YA 3TVDA 4X8HA 5DH9A 3QKRA 3VHLB 3RRMA 3QEOA 2A3RA 5KNCA 2PMDA 1EG7A 4QM6A 4HB0A 2O0HA 2CLSA 3OIWA 1GWNA 2FFAA 4EPYA 1TTTA 1VCMA 1JXMA 2DHRA 2IXFA 1YZGA 2OV2A 1E9EA 3RRYA 1KI1A 2JLSA 4KFRA 4LPSA 4Q18A 5CJPA 4LYAA 4DDWA 4G5QA 4A15A 1JNYA 3A1UA 1EX7A 4KLNA 3OIYA 4FW9A 4RJLA 1CJUC 1QHYA 1GITA 2JDID 1TF5A 3PVSA 3ZS8A 1N3BA 2W00A 3TE6A 4L9WA 3SYKA 4DLRA 4TLDA 3LX5A 1KSHA 3RDPA 3AVXA 3N2EA 5TXGA 3UK6A 4ZDJA 4TL8A 2ZVQX 2ZJZA 2J0SA 3WNDA 3K70D 3I62A 1M1YE 4EFMA 4LI0A 4EQ6B 1YR6A 3CNOA 2GZDA 2XAUA 4Q4HA 1COWD 4IVRA 3W6PA 2J0VA 1N6NA 4D4MA 4DLWA 4Q7JB 3ZQJA 3B78A 2WWFA 1LF5A 4Z54A 2WKRA 3C15C 3K9NA 1LV7A 4TYQA 3NDBB 1T9HA 1DAGA 4QFMA 4B71A 2X2EA 4FD2A 1VMAA 4MGKR 4XJXA 4MA4A 2XITA 4K81B 1NBMD 3QI2A 1IBRA 4P31A 2WJIA 3LVRE 4KSCA 3PCRB 3TQCA 1GRRA 1DEKA 2GAAA 2VHCA 4A1FA 1NIJA 2J7KA 4URYR 3LNCA 1OFHA 3KZ1E 4PPGA 5DYIA 1ESMA 4LV8B 4V0NA 5HCIA 3GLHA 5IF9A 5LD2C 1FTSA 3AF4A 5DHFA 2SHKA 4TYWA 2D2FA 2GNOA 3KKPA 4FN5A 4IVPA 1GNQA 1ZUHA 2NPIA 3VX3A 2W83A 5G40A 1EWRA 2BKEA 5D3QA 3SFVA 1II8B 5F9FA 2NGRA 4R7ZA 3F5FA 4G5RA 3G0HA 1HTWA 2J87A 4WZ6A 2IF2A 3LWNA 1RRPA 1NMYA 2CJWB 4A0RA 5SZJA 2QT0A 4OI0A 5J40A 3PJRA 2OFOA 2J9RA 4JL6A 2GCOB 1JAIA 4O25A 2NTYC 1DG3A 2AN9A 2IUSA 5EXSA 4Q4AB 3OFNA 3GPLA 3SC3A 1AN0A 3SJCA 4Q1FA 1VHTA 4C3ZA 3B2EA 2ZJ2A 1XEWY 1XJQA 2EU8A 2FSHA 2RHMA 3SEAA 2O8CA 1UBFA 1VTKA 2GVZC 1E79D 3NWJA 1EGAA 1OXTA 1QZXA 2AKAB 5DNYB 3VAAA 1TQ6A 3BERA 3PQCA 4JLDA 5FBWB 4M22A 3VR5A 4EAQA 2C9CA 2ZYWX 4D6PA 3MWYW 4B35A 1WF3A 3GFTA 3KUDA 5CIWA 4C0QC 1G8YA 1KZGB 1Z0DA 4QGHA 1II9A 1QHXA 4Y0VA 4XVQA 4AYXA 4CYMA 2QM8A 2OCBA 1G1MA 2IK8A 4D0GA 4AKIA 1M2OB 1B0UA 5FTNA 2IS2A 4NONA 4M0LA 1N6PA 4H1UA 1T8UA 1EFRA 3K0AB 4IEEA 3RS7A 4IHQA 5FPSA 1N2CE 1RRGA 1Q1ZA 1UF9A 2H18A 4TL9A 4D2IA 2WIAA 2XTNA 5KNDA 3MJHA 2IYWA 3FHOA 4PO8A 2WHXA 1SVOA 3MWLA 2YOFA 4HI0E 2REXB 3X1XA 2CXXA 5BYJA 8OHMA 5B2ZA 4AG6A 1W0JA 3SS8A 2QRNA 1MT0A 4Y0AA 1C9KA 2EFCB 3NBFA 1JAHA 3FE2A 2FGJA 1NF3A 4JLMA 2JCSA 3MSXA 3HU2A 4Z8XA 2XJ9A 3AVOA 4HAYA 4EJSC 5JRJA 2CE2X 1AGRA 2ZI7A 1UBGA 3WNBA 3P26A 821PA 3L82B 1OV4A 4M9SA 2CHQA 2PX3A 3HPRA 4GOXA 1Q3HA 1RC8A 4EPXA 1ZU5A 1ZD1A 1US8B 2PBRA 2OZEA 3W3ZB 3KL4A 1YR8A 3GFPA 3LX8A 5FUWA 2HJVA 3ECCA 1NG1A 3OIUA 1XCPA 1DAHA 4ZV4A 5IT5A 2XZOA 2O8EB 3W6NA 4RSGA 3IHLA 3GLHE 4JZKA 1Z47A 4RCYA 2O8FA 1J8YF 1OFUX 1OB2A 1ZP6A 1U9IA 4LRWA 1FNNA 1W49A 4GSYA 4P4UA 1E2JA 3U2QA 1DAIA 2Q9CA 2X77A 1G41A 4LJYA 1C1YA 4EPVA 3RRZA 2PZFA 5CK4A 2RGEA 5M04A 2CVFA 2R8RA 5C18A 2PMKA 2RGGA 2VH5R 3ICEA 3A36A 3Q85A 1JR3A 1VCNA 1IXSB 3B8HA 5CB8A 1DELA 3GJ6A 1E2QA 5K8UA 4FCVA 3ADDA 3KB2A 1DVRA 1JJ7A 3VU9B 1QDEA 3FGNA 2O52A 2DWPA 1UFQA 3SBDA 4DEXA 1HV8A 4NCHA 1W36B 4TMWA 4KBGA 2Z6VA 3T61A 3LW7A 4PC2A 4MRRA 2GXAA 2QY9A 1O3YA 3NIBA 3MG9A 3HU1A 1WP9A 5H8WA 1N6IA 2OILA 4HUQA 2HEIA 3OE7D 4JKIA 4Z8YA 4ZCIA 1T0HB 4KXFB 3EZ6A 2C78A 1NVUQ 1VCIA 3L0SA 3QIAA 1RFLA 2ZE5A 3K0EA 1XTRA 3MAAC 5J4KA 1RRCA 1KI4A 3ZH9B 4Q01A 1BIFA 2BM1A 3PUWA 3SFZA 4TMVA 1I2MA 1ZAKA 2YWHA 3OEEA 1RJ9B 3B9QA 3K53A 1XEXA 1B23P 2QZ4A 3ZS9A 5F3WB 2XX3A 1T91A 1DARA 4R2HA 1GKIA 5IDVA 2FOLA 4TSFD 5AR1A 5IHPA 3EG5A 2B7CA 1ETUA 5FTJA 1Q0UA 1NNEA 3CF2A 2C5LA 2HF9A 3A1SA 2KE5A 3CZPA 4PAMA 4DB2A 3FHTA 4OK3A 1P7CA 1W4CA 3B82A 1XP8A 2QI9C 5AJVB 2IYUA 1QHHB 3R20A 2W2TA 2FZ4A 1HQCA 3E2IA 2ZJBA 3HYTA 1CJMA 1JEDA 3T1QA 2JEOA 2G0TA 2IYXA 1AK2A 1TUIA 4WW0A 3I4LA 2HF8A 4F4IA 3K0SA 5ANRB 3HP1A 1OKKD 2W6JD 4JVLA 1CR0A 3U6BA 1N0VC 4KFTA 4B74A 4D0NA 2IYZA 1KI8A 2GCPA 4LZZA 4XVUA 3KTAA 2ZJAA 1P73A 1XPUA 1IM2A 3I72A 4CEHA 3B60A 3A4LA 4DUGD 3DEFA 4TQAA 1H8ED 1TF2A 4DWJA 4G5OA 4BWYA 4TQ9A 3H4MA 3TRFA 1E9SA 2OFWA 1KKMA 4LGMA 4OQFA 5FUVA 1Z2CA 3EX7C 1TF7A 2ZRLA 1GOTA 1Z83A 4PPNA 5C4MA 5KPDA 5G53C 3CF6R 2PJZA 1MO3A 1ELOA 5KSYA 4DEYA 1KNQA 1RRFA 4LJ8A 5G3YA 3QBTA 1LB1B 4QJ5A 2DCUA 2WVJA 5FBRB 1JR3E 3DMNA 1MOZA 3RNLA 4AYWA 3WY9A 1F2UA 2ZIAA 1CULC 1OHHD 2OAP1 2ERYA 4B43A 1ZRHA 2RGXA 3U3KA 2VF8A 3IGFA 4Q4HB 1KI6B 1XRJA 3NDPA 3ASYA 4BECA 3UPUA 2BJWA 1QBKC 2QL6A 3LBIA 4IDOA 2BDTA 2OBMA 3TAHA 5FOWA 4JLVA 4M9XA 2VP5A 3ADBA 3K70C 2DFNA 2ZREA 2QNRA 2GHIA 1T3LA 2EWVA 1GKUB 4EPTA 4LYJA 1BS1A 5H68A 4DLUA 4ZPXA 1D8TA 5JS7A 2DPXA 3SOPA 2ZU6A 3IUYA 3C5CA 4PPFA 4GMDA 2QENA 4QHYA 2GZHA 2VPPA 1MV5A 4JLKA 1NY6A 2ZRJA 5A0FA 3AVPA 4G0NA 4J0QA 4RZUA 2OT3B 5BWMA 1IN6A 5FL3A 4CF7A 5JRZA 2G6BA 4ARZA 1IN8A 4JJZA 4CEIB 1IJFA 1MO6A 3FVQA 3PEVA 2BOVA 1MH1A 1VIAA 4HLQB 4US1R 3GLHB 4WXRA 5FUYA 4Q48A 4IDNA 2DWQA 4UXJA 5K8TA 2V3CC 3U44A 4TL7A 1XTKA 4AI6A 2MMCA 3CPHA 3GP8A 4UQOA 4B3FX 4XWOA 4DLTA 4ERNA 2GXQA 3VR4A 2XZLA 4Q21A 2WJHA 3N5CA 5SZHB 4PAOA 1DBSA 3TAUA 2ZRFA 2AR7A 4KBFA 1G8HA 2VRWA 2W2XA 3I73A 4CEJB 1BYIA 2WWGA 3CM0A 3CBQA 5FR1A 1RW4A 4MYHA 2WOOA 1S4QA 3A4MA 3GJ3A 4BFVA 2W58A 4OHYA 4HAWA 3I5XA 2ODNA 3IQXA 1KJZA 2KBFA 2QSZA 3PUYA 3I92A 4ON9A 3B13B 1A2KC 2JAQA 3UMFA 2OSBA 2CBZA 4W9MC 1U8YA 2IYQA 3ETLA 2LWIA 3EZFA 1GSIA 2C96A 5DSZA 1EFHA 3PFIA 2R6FA 2J0UB 1QVAA 1ZNZA 2QP9X 3REGA 4JBYA 4X8OA 4HAUA 2AXNA 2ZUCA 4BGDA 1JECA 4ESVA 5DO9A 1SVKA 4MRPA 1G3QA 3K9GA 4G1UC 4PSAA 1E9RA 1VYTA 5F98A 4V0ME 3QE0A 1UDXA 1N6OA 4Q1DA 1XMJA 4PHHA 1T3HA 4AIIA 1FX0A 3L43A 4R71A 4C0AC 1ZW6A 4RZ3A 1W2HA 2PT7A 3PIRA 1XPRA 1GKYA 2AL7A 2B21A 4MKIA 4NCKA 5LB4A 2JJ1A 1DTSA 2CJWA 3OZXA 4L5BA 1G4UR 4C0KA 5L3RA 4YMSA 5JCZA 4TT3D 2DYKA 4YDSA 3RWMB 4DRZA 1KJWA 4KLZA 1VG1A 4ESHA 4Q4AA 2GK7A 2VBCA 3EPHA 4F91B 3T34A 3BH7A 4PC1A 4Q7MB 1Z63A 1YHNA 2J46A 5FPHA 1RYHA 1P5ZB 3PV0A 1SVIA 4LHVA 2AK3A 3E5HA 5HE9A 4ZDIA 1LS1A 3U3JA 1QHNA 4PQYA 1GP2A 1R0YA 1D2NA 4IDPA 1LS6A 4RKEA 1E4VA 5EP1A 3WHLA 2UZ3A 4QHSA 2BBTA 2PLFA 1NI3A 1R0WA 2WKQA 1Z6AA 4PC3A 1W48A 4TZ6A 5KPJA 4DLVA 4G3XA 1E98A 2YWGA 1CR4A 5J4HA 4LHWA 1TQDA 4ILEA 1EFRD 2G1KA 5GJVC 5DHAA 3NTUA 2LKDA 2A9KA 4YMWA 3TUIC 3K0AA 1NL3A 4HDOB 2V9PA 2OBNA 1H8HA 2ZS7A 4TLBA 4DSNA 2WMNB 1YZLA 3A58B 3RS0A 2ZU0C 1KYIA 1S0UA 2GVDC 1W46A 3R7WB 4XD7D 4XH9B 4I81A 3SHWA 3B1VA 1TADA 1G17A 3FPAA 2WWYA 2D7CA 1CJVC 1JQLB 4CVNA 1GVNB 1W5SA 1WRBA 2RGBA 5A4JA 4DCTA 2QU8A 4EDHA 1YZTA 3P4YA 4LBYA 2ZI9A 3DHWC 1KAGA 2ERXA 5DISB 3EIQA 1DG1G 2ZSBA 3D8BA 4QGFA 2WPDA 5JWHA 1YZNA 2GEVA 2O8BB 1AA9A 1TQ4A 1Z08A 2Q3MA 2ATXA 3FB4A 3TNFA 4D4LA 2GWHA 1TAGA 2YYZA 4PC7A 3V00A 4QG7A 3VHXA 2J45A 3VNUA 1US8A 3IPYA 4NCIA 1Q1BA 1XXHA 1DPFA 4KJZA 1W4BA 4RD4A 1WCV1 3O8DA 2ZJOA 4LHYA 4B6EA 3VKGA 2OLKA 4HUQB 2RHDA 1OF1A 5DIFA 3CH4B 4CZ2A 3I32A 3ONWA 4N1AA 5J4YA 1N6HA 1QRAA 1HE1C 1CRPA 1EK0A 1TEVA 1YZUA 2GBLA 1G21E 2NO6A 2VF7A 2C04A 3GJ7A 4QOSA 4RFVA 3K8YA 4RD6A 1LW7A 1ZD8A 1E9CA 5AK0A 1F3OA 5CIQA 1CR1A 4BASA 1XEXB 2FNAA 3QG5A 4URZR 4I1SA 4A0HA 1JR3D 2FMXA 2FSFA 3CH5A 3UG6A 1R0XA 4U02A 2OCYC 4Q00A 2JGNA 4S2EA 1VG8A 3NBXX 3IIMA 1Z0AA 3W5JA 2QP3A 4EFNA 2XTMA 2YHSA 1EFCA 2ECKA 3CRVA 4LJ6A 3VU9A 2Z0MA 1U0JA 1TX4B 4MRVA 4YXWD 2GK6A 3SQWA 2UKDA 1NVWQ 3FKSA 3WXMA 2O0KA 3QXHA 3TR5A 3SN6A 4NCNA 1IHUA 1GRNA 5BN3A 1CP2A 1TPZA 3CF0A 3CPJB 2ZS8A 3ADKA 3QPVA 3A4NA 3CX7A 1FNMA 2IEYA 4CDGA 1Q21A 2AD5A 3VR2A 1Z6YA 4LOAA 3RS4A 4AY2A 3LFUA 5JWRA 1N5IA 3RABA 1IAQA 3KTAB 4P0TA 3OEED 5BYKA 4WVFA 2PZEA 4CEHB 1RJ9A 1E2IA 4W7SA 2BEKA 1G6OA 1IONA 4TZ0A 4YLGA 2A30A 2GEDA 4IFEA 3QSYA 5EXPA 2CK3A 2F7SA 3FMFA 2PZGA 1VYVA 2VA8A 3U5ZB 3AVYA 3LV8A 3MRSA 2V7QA 1IN5A 3QVVA 4GZMA 4F4JA 3NBYC 3QQ5A 1KDOA 4A8JB 4QBFA 2L0XA 4A2WA 4Q66C 2QPAA 3B1ZA 4LWZA 1R8QA 4QGGA 4IEIA 1M34E 1RYFA 3H1TA 2E1RA 3DM9B 3M4YA 5HCNA 3RSOA 1RPZA 4GNKA 2W0MA 3UATA 5LDDC 2MMGA 1NVXQ 1XTQA 4WXPA 1I4DD 2IYVA 1G291 3GEHA 4XTCS 5EJEA 4B3CA 1N0WA 4JS0A 1NN1A 3CB4A 1GL9B 4M1WA 3PEUA 1XTIA 2P6NA 4JT4A 1P2VA 3TSWA 2OFXA 1TU4A 3BAFA 1PLJA 5FR2A 4BFZA 1W1WA 4DHEA 3J81k 1TNDA 4QNRA 3KKNA 4A6PA 3QPUA 4F92B 1GL7A 1W0KA 1D6JA 4RD0A 3I3SR 1XX6A 2ZR0A 2D62A 1XXHE 3L8YA 3QF4B 2EYQA 3CWQA 4M4SA 1W5TA 4XSHA 3KQUA 1N25A 2X2FA 3Q5EA 4HDCA 5DLQC 3FWYA 4BLQA 4BRUA 1AM4D 4DDTA 1EESA 2CLCX 3DPUA 1T3SA 2HCBA 3Q72A 1QG4A 2IEZA 1KGDA 3RRNA 3E1SA 3NHAA 4TQUS 4C0SA 4OHZA 2IWRA 4ARZB 1A7JA 4M1TA 2D7DA 1X8JA 1UKZA 2VLIA 2DFKB 1X8LA 4ZKDA 5B64A 5J5CA 4M1KA 1KTVA 3MGCA 1XTJA 4NYMQ 5EZ5A 4MDEA 1XFAA 3U44B 2FF7A 2ZE8A 4PANA 3W5IA 2CEAA 2CLDX 4BLOA 2FFBA 3KFXA 1E99A 2GJ9A 3DKVA 3DZ8A 3KJIA 5HZKA 3U7EB 3LO5A 1WB9A 1KI6A 1ZM2A 2HLDA 3B7GA 4HAVA 5TDHA 3U3RA 3BE4A 3W8RA 3ZIAD 3THYB 1XJCA 3E70C 4LYFA 3NBZC 2H16A 1PUJA 1CTQA 5JBQA 5TMPA 5F9HA 4GOKA 2ZRBA 5BN4A 4M53A 4Q7LA 2VTKA 1S2MA 3BB4A 2GA8A 1TQ2A 3K09C 4JVSB 2HT1A 2G1JA 4IDQA 4DBLC 4QXAA 4PX9A 5AJXA 3ZLJA 3FKQA 2G83A 2WJVA 1Z5ZA 3T1OA 2ZVPX 4UNQA 1IXZA 3CNNA 4HAXA 1VDZA 1Z07A 2CCJA 2CVHA 2F1RA 2WM9B 2WJJA 1SXJE 3GJ8A 3X1YA 4HLUA 2FFQA 4ACBA 2F3TA 1NN3A 3A1TA 4QBHA 2MSCB 4Q7KA 4CEIA 2FV8A 2IA5A 4IJMA 1S1MA 2GJSA 1UKYA 1BYUA 2CL6X 4ZDWA 2QAJA 4L8GA 2J0QA 1U2RA 1S1CA 3DOEA 4B76A 4E09A 3U3MA 3AKDA 2H7VA 1P61B 2EFHB 2B8WA 1NVVR 2ZSEA 4ZKEA 1FX0B 3L0PA 1H65A 2A5DA 1WMSA 1U0HC 2RGCA 3LW8A 2IYRA 3TR0A 721PA 2HCJB 4BZPA 1W7AA 1T0JB 2B7BA 3THWA 4ZO4A 4CEJA 1YQTA 4EFLA 3T5GA 3NEJA 1S9HA 1OSNA 5E95A 2XEXA 4ZDKA 4AG5A 1OXVA 4IRUB 1U94A 3ND8A 2OG2A 1CF4A 4MKGA 1D2MA 2BWJA 3TW8B 4LBWA 3AUYA 1JPNA 2WMOB 2WSMA 3IIKA 1VPLA 2WJGA 3MCAA 4PFSA 3VR6A 4DZZA 2ZAMA 2IS1A 3U7HB 1XEWX 4PQFA 4US0R 2J0UA 1VG9B 1Z29A 3C41J 1O87A 4OYHA 4GPTA 3VQTA 3CWZA 4TWZA 5E7JA 3ZZTA 3DM5A 4KYIB 221PA 5EUMA 2J5XA 2W2VA 1E6CA 4DT1A 3DKPA 4L16A 2H8KA 3FMPB 1A82A 5EE5B 3C7KA 1X6VA 4HB2A 1HQYE 3VKWA 4LSGA 3D3QA 4KODA 4MYCA 5FBLB 2JJ1D 3BFXA 4MRSA 3RWOA 3CKLA 3X1ZA 3M0EA 4Q4LA 2ZANA 4NL4H 1VHLA 1NN5A 1XDBA 2E9SA 1FMJA 3QKTA 2NQ2C 3NEYA 2IXGA 3BJIC 3D31A 3GLGB 5CM9C 3DZDA 1AKEA 5GADl 4WZAE 2OXRA 3LY5A 2QQEA 4C2UA 1G18A 1NLYA 1NKSA 3ASZA 2VP4A 5LB2A 1XU4A 3X1DA 4D0LB 4XWKA 1LTQA 1XBTA 3JVVA 2A2ZA 2ZTSA 4O2RA 3SU8A 2OUKA 3HYRA 4LY6A 2BCJQ 2GZAA 2NMVA 1YKSA 3R8CA 3ZYCA 3AGPA 4JIMA 4URWR 5L3QB 1NSFA 2GTPA 3BBPA 1XNJA 4CW7A 5FPKA 3PUVA 4TTQA 3VMFA 4IVQA 1XXHB 4NBSA 4YC7A 1R5BA 1PJRA 4M9QA 3LH5A 3QG1A 2P6RA 1A5TA 1OIVA 3U7FB 2VP9A 5HKKA 2WV9A 4KVAA 5EXXA 3UMSA 2CHGA 1H8HD 3FTQA 2QQ0A 3LDAA 4D81A 2YV5A 3QBVA 4KSBA 4Z1MA 2C99A 1ZYUA 2FSIA 2WSSD 3ADCA 4POAA 4Q03A 3FDIA 2YNMA 3R7WA 2ZRNA 3EARA 1U9IC 4NYMR 4US2R 4IOLA 1FMLA 2GF0A 2EWWA 4N0DA 2ORWA 4V0OA 3I61A 2VHTA 2JATA 2IWHA 2R62A 2WPDD 4B33A 1N6LA 4WIAA 1P4SA 4D25A 3F0TA 2O8BA 4A82A 2CCGA 1G3RA 2JJ2A 2NO1A 3JZMA 2C98A 2PEYA 3T5DA 1BMFA 4B3GA 1XEFA 2ONKA 4OI2A 4HSEA 4PQRA 5JCPA 2VHUA 1FZQA 2BMEA 2UVQA 1AGPA 3BB3A 1MABA 3AVQA 1K8RA 4OHXA 2BEJA 3VX4A 1G5RA 2WAYA 2F3RA 5EQTA 4M1YA 2JLWA 1GFIA 2X8AA 1ONBA 3C4JA 3REFA 1SXJB 5DN6A 4BFSA 5HR5A 1SGWA 5HZHA 4QBIA 3R9XA 4PHGA 1ZM9A 1VIYA 4B2IA 3OHMA 2VHJA 4B32A 1UAAA 1DS6A 1G7SA 1G4AE 3AKCA 5JFGA 3T35A 2ZS9A 3THXA 1IJEA 4G5GA 2KB0A 3CZQA 1L4YA 4GOJA 5B58C 3QKUA 4MGYR 3MD0A 2NO9A 4A92A 3CRW1 2I3BA 1Z6GA 4DIDA 4NYIR 2VP0A 3ZDQA 2XSZA 4KV9A 2QAGC 2Q9BA 3K9HA 4WZBE 1W36D 1G5PA 3AKYA 3FKSD 3R9IA 2RGAA 3IPXA 5FFMA 2AFHE 2REOA 2W6ID 2F43B 4PSKA 2P65A 3AVVA 1F6BA 2VQSA 1XMSA 3GLIE 3CONA 1I4TD 2ZETA 3OEHA 1KI9A 1ZC3A 2D3WA 2QEQA 4ZIRB 2DFTA 2ORIA 3QXXA 1CR2A 4GBMA 2GRJA 4HATA 3QVUA 1UPTA 5AUQA 1R6BX 1J8MF 1ZBDA 3BOSA 1OH5A 4O2LA 3SR0A 2CE7A 2E87A 4FI3C 1SHZA 4C9BA 4TMKA 4CGZA 4PHTA 2CK3D 2Y8EA 4XWAA 3WYFA 2FH5B 3RANA 2V7QD 1YJ5A 2XXAA 4V0MA 2B8TA 4FINA 4B34A 1HEIA 1HT2E 2JJ8A 1G64A 2A7QA 1T6NA 3IO5A 4A8JA 1YRAA 2ZRGA 1EFUA 4GI7A 2VSFA 3SYLA 1KO7A 1AQUA 3TUJC 5P21A 3T06B 4W5HA 4FWIB 4QKQA 2VL7A 5GVSA 4XVRA 3Q8XB 2P2LA 3W3AA 3H0KA 2RAPA 3QNUA 2CCKA 3KQKA 3KB1A 2BBWA 1KK3A 2IT1A 4UKDA 3IEVA 5IK2A 1ZM4A 1UEJA 3WNCA 4DB4A 1W0KD 4DVGA 1Z0FA 2A5YB 3L0OA 4PZYA 2ZI6A 1KO1A 2X19A 1OXXK 1FOEB 3B9PA 3MWJA 4A2PA 3QF4A 5JI2E 2TMKA 4BZXA 5AJZA 2Q21A 3RHFA 2A78A 3U61B 2GETA 4LV5B 4AKGA 2WWXA 2FPKA 4ZI3A 3GEEA 3EWSA 3EZ9A 2P5SA 4FMBB 4YQFA 1OW3B 1CBUA 5K8LA 2BIFA 4HZUB 5F2EA 3UKDA 1K6MA 5JHHB 2XJ4A 3MLEA 4MH0R 2WAXA 1JR6A 3RC3A 3GFOA 3PG5A 2Q9AA 2FGKA 5CJ2A 5HE8A 3X1WA 2WJYA 1Z2AA 5AUOB 3U4QB 2ZROA 3TW4A 2OEPA 5FPYA 4LX0A 4AD8A 4MRNA 1J7KA 1Q1QA 2HLDD 2DB3A 1J70A 1S9DA 1W47A 3KJHA 1E0AA 3THYA 5LD2B 3O8BA 5IRCD 3BORA 4JLBA 1CEEA 2OM2A 3THWB 2F9MA 3QKSA 3K1JA 2D74A 3CRQA 2YZ2A 4PZZA 2WTUA 4D80A 1UBCA 2I1VB 4BLRA 4GL2A 5C1BA 1AQYA 1KI7A 4D4KA 4EPRA 2IXEA 5J47A 4YMVA 3MFYA 2WIBA 1IN7A 1ZUIA 4QGAA 5EUQB 3TKLA 5CYOA 3WYGA 1F48A 1QG2A 4BE7B 4A0FA 4DLZA 1CJTC 4TLEA 2JLYA 1TUEA 5TY0A 1JBKA 2OCPA 1G7TA 2QGZA 5JZVA 2HYIC 3CW2A 5C2JB 3TBKA 2CMKA 2PEZA 3QJYA 2BMJA 2D06A 4IOKA 1GRQA 4JSYA 3I8XA 5L8VA 3EPKA 4DT1B 2QMOA 4ITRC 4K46A 5GJWC 3ZVLA 5FTLA 5FH9A 1S8FA 4JBWA 1E9AA 4Q1BA 1E9DA 3AV0B 1FUUA 4MUAA 5J4LA 3LLUA 3RLFA 5FL7A 1T5LA 1X3SA 4AURA 3LXRA 3CR7A 4DJTA 2ASEA 2EFGA 4C0LA 3KQHA 2DFLA 2ZR7A 3BK7A 4LK2A 5FUXA 3JVUA 621PA 3V4RA 2BMDA 4RKFA 1KY3A 4D26A 2CL7X 4JVNA 1FP6A 3Q7QA 1S3SA 4TYPA 2QROA 1AS2A 3OFND 1W44A 1NKTA 2QUZA 1CKEA 4Q9KA 1N5JA 4C2TA 3BIFA 3WBKA 1PLLA 5FI1B 2GXSA 3GLIB 4TTRA 3KKOA 3RSLA 1G7RA 4LBVA 2QMUA 5EP2A 1NIPA 1NY5A 1Z6TA 3KJGA 2J59A 3TJZA 4OHVA 3FHCB 3BH0A 1ZINA 3CPEA 5KSOA 2O8DA 1YE8A 1OT3A 3UWKA 5KSZA 2VSOA 3V9PA 3UWOA 1J90A 1T4GA 3N2IA 2RGNA 1M7HA 3F8TA 1KSJA 1E1QA 4EJSB 5JS8A 3AVTA 5KTYA 4IFBA 1BO6A 2BBOA 2FN4A 4JYCA 4E22A 4V0KA 4L4UA 5FBVB 1YVDA 3BFKA 3LQQA 2BMFA 4F7WA 1P9RA 3U7GA 3BH6A 3BD9A 3L0IB 1PVOA 4L9SA 3ZZ0A 2ZAOA 3V4FA 1D2EA 4DSTA 3EIEA 1Q44A 1P2UA 2GCNA 3QXJA 1KDPA 1OXSC 4Q4JA 5EP4A 3GLGA 2IS6A 2IHBA 2YC2C 1OXUA 3KJEA 1W0JD 4EPWA 2GAOA 2YWEA 1L2TA 4FXPA 4QBGB 4TL6A 3BWDD 5TB5A 3IEUA 4KAXA 2RKOA 4UXHA 1OYWA 1XWIA 3P4XA 2Z4SA 4QNMA 2WICA 4LJ4A 3KQLA 5ELXA 1G3MA 5HTKA 4WOPA 5TVKA 2IX3A 1DO0A 3RAPR 3GJ5A 4B3BA 5L3QA 3HDTA 2V6IA 2ZSAA 2IUTA 2ODEA 2NZ8A 2ZI4A 3LD9A 4F4CA 3L8ZA 3TMKA 4JMPA 4B48A 3B1XA 1MABB 4LHXA 2C95A 5KDLA 1QHIA 2D4HA 2ZUDA 1R7RA 3BFVA 1X86B 1TL7C 5FBQB 2QPTA 1RKBA 3WBJA 4Z1MD 3AGQA 2WWIA 4GRAA 4HZIA 2OBLA 2Z4RA 4F93B 1G7CA 1NVVQ 4LDJA 3NC0C 5CB6A 2GBLC 1G8FA 3B1WA 3A37A 3THXB 1G20E 2KJQA 4H1VA 2HXSA 4U00A 4R98A 2IYLD 4HLCA 4C0JA 1M8PA 3ND9A 5FOVA 1HUQA 2C9YA 2Q3HA 3SZRA 3T1VA 2BKUA 1ZIPA 2JJ2D 4P4SB 3T1TA 2NO7A 1BMFD 5DYGA 1VG0B 5EE0A 1X1RA 3U3OA 5LPNA 3WP0A 3IDQA 3PUZA 3A6PC 2J1LA 2OCAA 4QJ4A 1W36C 2IUUA 2OE2A 2NOAA 3TLXA 4UNPA 2ZM5A 4NZYA 2EW1A 4TSFA 3KXIA 3OESA 4TLAA 1G9XA 2IF0A 2ZJ5A 2G0NA 5DN6D 1E2GA 3WRYC 3WRXC 1SXJA 3CLVA 3UANA 5E4FA 3K0CA 4GP7A 1E0SA 1EFTA 5FTMA 3Q7PA 1IY0A 1KIMA 1JALA 1IOZA 4PO9A 4D4JA 4JLAA 4H9GA 3QXSA 1S96A 5C4GB 2QBYB 1KSFX 3EASA 1NLFA 4HEJA 2CNWA 4DSOA 1N6KA 1WQ1R 2HJGA 1KK1A 3BC1A 4I1OA 2V1UA 1SVWA 2XXAB 4XIGS 3CRMA 1E96A 4UNRA 2B6HA 1E2MA 1CXZA 5C46F 1E2LA 1E1RA 1HE8B 2QTFA 1ZD9A 3P27A 4JL5A 4ZI2A 1OLOA 2W6JA 2XSZD 1U90A 3TSZA 4DCUA 3IQWA 2R6AA 3GLGE 1KAOA 3P32A 5J4VA 2YINC 5JHGB 2F43A 4TTPA 3GD7A 2ZEJA 1P2SA 2C03A 3OEHD 2ODWA 4DLYA 3KXLA 4ZIRA 5JSZB 1NJFA 1WXQA 2ZRMA 1XF9A 3R9WA 4PXAA 1BKDR 4IKEA 1ANKA 1WDTA 1ZC4A 2V55B 5KHOC 2KI5A 4KVGA 3VFDA 4BPBA 1OH7A 5KNBA 5KO2A 1SKYE 4CRWB 1NMXA 3N70A 3UXMA 1R5NA 3LVQE 2ZYVX 4DIEA 4EKDA 2G88A 4G5SA 1ZM7A 4MGIR 5CYPA 3WMFA 1WA5A 4JSTA 2FZLA 3LQRA 4LCBA 3DOFA 3GJXC 2ZJ8A 4QC2A 1HA3A 1E2NA 3PITA 3FMIA 1OHHA 4MITA 4C30A 4W5JA 5SZKB 3T12A 1Q22A 3HR7A 2ZQ5A 1NSTA 3BRWD 4LPKA 1KY2A 3W8NA 4C7OB 2XOKA 2BBSA 2HDNB 4RD1A 2GKSA 4AK9A 2WZQA 2LKCA 4NE2A 4JVMA 2PLRA 5K8IA 3ZD6A 3D7MA 1HURA 2GXUA 2YKGA 1NP6A 1T5IA 1Z0IA 2HUPA 4TMXA 4RFSA 2AFIE 3K9LA 1BOFA 4PC6A 3HR8A 5IK2D 3AVUA 3QKSB 1NN0A 2OESA 1UDWA 5D3MB 4B73A 4TMTA 2GJAA 1KOFA 2JLZA 2ZRHA 2IYYA 4XTRA 3AP3A 4NH0A 3ZJYA 4BFYA 3WMGA 1GAJA 1GUAA 1K5DA 2WBLC 2GILA 4QJ3A 1OPXA 1XD2B 2GESA 2VSXA 4JLNA 3AVWA 4MYTA 1AZSC 4HB4A 4NDZA 1I2DA 4NMMA 1YRBA 1E0JA 5JJKA 3IO3A 1J99A 1PV4A 4GFDA 4Z51A 5JEDA 4HZUA 4O0MA 2Z83A 2ZUBA 1SKQA 1SZPA 1KK2A 4BZQA 3AP1A 3LA6A 3K09A 1GM5A 3EIHA 1GTVA 3O8RA 2PJRA 1V5WA 1DAKA 3C16C 4HLUC 2RB4A 4LC1A 1A2BA 1TU3A 5G3ZA 3RC8A 3FMOB 2XB4A 1IY2A 4LJAA 1NRJB 1AS0A 3B1YA 4OK5A 3U4QA 1DAEA 2AK2A 2FE4A 3GJ0A 2ORVA 3AM1A 1RZ3A 2FJUA 4NYIQ 5L3SB 1GL6A 3WYAA 3LLMA 1C4OA 2PL3A 3WMEA 4DC9A 1OH6A 1PUIA 2QE7A 3VR1A 4A0GA 2Q3FA 1E9FA 2K5UA 3AP2A 2AXPA 521PA 2OHFA 1L7VC 5DI3B 4BUJA 1CJKC 2QN6A 1G8GA 3M1IA 4IW3B 4W5WA 2C2HA 2ZRPA 4URUR 2MSDB 1OE0A 3AH8A 5EXTA 2RGDA 4D82A 2KBEA 2PX0A 1SVMA 4JKYA 4FIDA 2X1VA 2Q6TA 3DO6A 1MKYA 4P32A 5KUTA 1XD8A 2FG5A 4OQXA 2CHVA 4GP6A 4HAZA 4NYJR 3TSOA 4BFXA 1SVLA 5AUPB 1KMHB 4V03A 1KSGA 2P5TB 4ACAA 3GMTA 2O8DB 4BLPA 2YJTD 4G01B 1AZTA 4TT3A 3ZVMA 4N3NA 5CM8B 3ZQ6A 4WBSA 3GJ4A 3K0FA 1HT1E 2ZRKA 1E2PA 3TUZC 1KO5A 1NMZA 2V8OA 4GDFA 1HH4A 2ZR9A 2H57A 2HT6A 4RCZA 4L15A 3PR1A 2D2EA 1QHGA 5FL7D 5GJCA 4O3MA 3FFBA 1LY1A 3LXXA 2A5FA 1DAMA 3Q9LA 1N6RA 2J41A 3HWSA 4Q9HA 3QY0A 2XNDA 4Q1CA 4Q4JB 4IDHA 1F60A 4OI1A 2JA1A 3X2SA 3AEZA 3ZD7A 3RS5A 1KI2A 1I4LD 4TYNA 2BM0A 3NVAA 2HXYA 4KFUA 3GLIA 3KDSE 5JWOA 1Z28A 5GJBA 5BQ5A 5JEEA 2R6CA 6Q21A 2EFEB 121PA 4UXIA 3R8FA 2EFDB 4GZLA 2R44A 1E69A 2IYSA 4OQNA 4EUNA 3WP1B 2ZYUX 1G5TA 5EZ6B 1CU1A 1SKYB 3P1JA 4IOJA 2OLJA 5DE3A 2JLQA 4NTZA 1UJ2A 4FWTA 1JJVA 1E1QD 1UKEA 1GNPA 2PCJA 2WWHA 4XD7A 2A5JA 5EE9A 5BN5A 4EJSA 3EA0A 2QT1A 2R6DA 2VIIA 5BXQC 4DXAA 3PEYA 4BEBA 1P6XA 4NHOA 3SE0A 3TH5A 1P9NA 2ZE6A 2R9VA 4Q47A 4OL0A 1EX6A 1XJ0A 2W0SA 4DCVA 4M1OA 5FOUA 3KFVA 1FP7A 1XCMA 5L3VA 3EW9A 5HPYB 4M21A 5JMTA 2B92A 3CX6A 3EXAA 1M7BA 5TARA 1TMKA 1EXMA 1KNXA 2QPOA 4PO1A 4E03A 4CIDA 1M7GA 2HYDA 1ZIOA 1YR9A 4JT2A 5CK5A 3W90A 1CRQA 1UBEA 4BEJA 1U99A 2QM7A 2YOGA 3G5UA 1YR7A 2CL0X 4Q19A 3EC2A 3TQFA 1AS3A 1Q12A 1DADA 1E2KA 2F9LA 3EZ2A 4YMUA 1N0UA 4A36A 1U81A 2ANCA 2NZJA 3TVTA 3NG1A 4KHZA 1IXRC 2EVWX 3GQBA 4LJ7A 4Q1AA 2NG1A 5EE3A 3SNHA 2C77A 2GDJA 3SDZA 2FPMA 1OFIA 1AIPA 4FMDB 4FMDF 3C14C 2YOHA 3TIFA 4DKXA 3EPJA 4ASUA 3D6TB 1ZMXA 2BC9A 2JIZA 4C0HA 3CNLA 4U5XA 1N5KA 4TYYA 2RH5A 1G3IA 1OB5A 2FWRA 2JLXA 4R2IA 4YXWA 3BB1A 3M6AA 3MMPA 2V6JA 3C8UA 2FEOA 2F1HA 1PLKA 2ZPTX 2LCFA 5AJYA 4C0BA 2FU5C 3DL0A 4URVR 3AF3A 1E2HA 2HV8A 2H17A 1XPOA 4B2PA 2GJKA 2AWNA 3DMDA 2VO1A 3S1AB 1UADA 2C9OA 2REBA 3AKEA 2BCGY 2RMKA 4DCSA 1Z22A 2NO0A 1E3MA 3MUFA 1QHSA 3VNVA 3HJNA 1FTNA 2FSGA 5EP3A 4P4SA 4LC0A 4B44A 3ICQB 3OAAA 3G82C 3VR3A 1KHTA 1XZQA 3FYHA 1AKYA 1GDDA 2GJ8A 4LJ5A 2NIPA 2DBYA 1F2TB 2OAQ1 4B2LA 4B3XA 2N1BA 1G19A 1JXOA 2QAGA 3KX2A 1P9WA 3OIVA 2YWFA 1SXJD 2PH1A 1QVRA 4JLOA 2YVUA 3DVLA 4Q9IA 3Q3JB 4KITB 1KZ7B 4KO8A 1FQKA 1JPJA 2JASA 4JJKA 2QG6A 1GNRA 4GT1A 3EAQA 4V02A 1GG2A 5CLQA 2P0EA 3I8SA 4OKSA 2CNWD 2QBYA 1XZPA 2J7PA 1SVSA 4QM7A 3WHKA 2AWOA 1SULA 2VHQA 1U0LA 1OJLA 1Y63A 3A8TA 1JQJC 2IBMA 1E1RD 3BXZA 4XOIA 1KO4A 3KQNA 4OBEA 3GLFA 4A2QA 1DE0A 1MO5A 3AF1A 4AKEA 1E2FA 3QKRB 4DDUA 4URXR 1R0ZA 1ZCAA 2KSQA 4A8JC 4U7DA 4LBZA 1A4RA 1IY1A 1U8ZA 2WOJA 5UKDA 1W4AA 4MGZR 4RFSB 5JSZA 1NG9A 4RY2A 5CITA 5G41A 3QEJA 1LF0A 1L4UA 2QRZA 4IOMA 2A5GA 4PHFA 4AWXA 1F5NA 2OXCA 4KCGA 3IIJA 1R4AA 2R65A 4M1SA 1JB1A 1FUKA 2JDIA 1OYYA 4UJ3A 1UEIA 5AJWA 4KU4A 4OI4A 4X8LA 5E3HA 3NH9A 5JLJA 3MWKA 1XTSA 2IW3A 3U6KA 2FEMA 1U98A 1XD9A 1E94E 1JI0A 2V1XA 4YONB 2EQBA 1KDRA 4IXMA 2JLVA 1COWA 3H84A
chains in the Genus database with same CATH superfamily
1LJUA 2WWTA 1NF8A 2XCOA 4ZEWA 1FVXA 2WZDA 3VKHA 4BDTA 3PEWA 1N92A 5KX5F 1EVZA 4S04A 3O8CA 1B73A 1N5DA 2YWJA 3E3MA 4EEXA 5CT8A 4YUWA 5C1PA 4BMZA 1WKCA 3PFGA 3AEYA 4CG2A 2QX4A 3LAWA 4ENTA 4EQZA 4RH1A 3ZV6A 1V8FA 3HCDA 5JD4A 3I01A 3LCCA 2XGJA 1S3GA 1WULS 1FNBA 5KJ1A 1OWMA 2XOXA 5A2QA 4PVDA 1J0AA 4Z7QB 4UASA 1NXPA 1N5LA 2FEWB 3IURA 2VK8A 4D8WA 4IEFB 1P4RA 4CT4B 3BXPA 3P5BA 4BQIA 4DLXA 4YYEA 1VPTA 5K6RA 1ZHOA 1FNCA 5DM60 3PTAA 4AIRA 3V7WA 2G71A 2AMVA 3ZTTA 3HCCA 3TGPA 4FCWA 4HDQB 1NW3A 4BMPB 2JLRA 1BXKA 1HETA 1RVV1 1I2CA 2CN1A 3HZRA 3OLVA 1PNOA 3COZA 3UJ8A 4PS1A 2H92A 1Z5NA 1JAYA 1M74A 3B3FA 3JVDA 1XD2A 1I7PA 1P75A 1X7DA 1W4RA 4FK8A 3JASA 1T9KA 5CU7A 1U8FO 3A1WA 1JIKA 2JHGA 3PU6A 3WL5A 4JBXA 2ZSUA 1E1MA 1TQHA 1ZJ6A 5E2BA 2O2YA 2Z43A 1EGQA 2DWOA 3GN2A 3L7BA 4NCJA 5FOTA 4BP9A 4CT0A 1JXAA 3IAXA 1UPAA 1SC6A 3CKMA 1K4YA 3I52A 4KQJA 4PCAA 4UFOA 4Z2YA 3A1DA 3MJRA 3HJHA 1SUEA 5E6UB 2B20A 4UFPA 3DHYA 5D3ZA 3HA3A 3KUCA 4KFSA 3Q7RA 2XQIA 1LBHA 1IM8A 4UNNA 3W6OA 6LDHA 2AKYA 3BEOA 2Y0PA 3EDMA 4LYHA 4OM7A 2PU7A 3TZQA 4MKHA 1LX7A 2ZWOA 3RVOA 4AJ9A 2I7DA 4TPKA 3NPMA 4LDAA 3CIOA 4O4HB 4FC6A 5LYYA 2O8CB 1JVBA 1P2FA 3BS4A 1BROA 1VKZA 3UGJA 2GD2A 4DSUA 4EFKA 5HQJA 5IMSA 4ETIA 4I1IA 2ATCA 1UZLA 4C0XA 2G4LA 1XVLA 2XMZA 3QOFA 3KZOA 2EG9A 4A5SA 1E1NA 4QDJA 2R2AA 2OOKA 3KSRA 3KT6A 3OFJA 4AO6A 1R1DA 1VLHA 4FQ5A 4K28A 2CDBA 5KHAA 3X2FA 2P67A 4FMCB 3P2EA 1DXOA 2QQFA 4J1TC 2VYFA 2G77B 4QJIA 4RZHA 5IUNC 1NUQA 3UJNA 1IK6A 2MOKA 3IBGA 3LT0A 3QU7A 2NVUB 2BV3A 2GF9A 3MBIA 3DHNA 3P2OA 4Z4FA 2JBWA 2CZGA 5BRJA 5DW0A 2WVHA 4Y2TA 2YVLA 2OKCA 1ODFA 4KO2S 2G9NA 1PR1A 4HQLA 4B4UA 2I3GA 4MQ4A 2OFFA 4OOEA 1VKJA 4KJXA 4PBRA 3VOSA 3UK7A 1QZ3A 2XWSA 4LF7B 1FFHA 3DO8A 3KQWA 3R24A 5A9TA 1JGTA 5ALDA 1RI3A 1RXSA 1Q0SA 1V16B 4I4TA 5KYNA 1C9JA 3UK0A 1MH9A 1E5QA 3FRIA 1CG6A 4I99A 5KBYA 4ARCA 1QUFA 5FCDA 4YROA 5EJIA 1CNMA 4P33A 1ZWKA 4Q1EA 1UPFA 2IUEA 4TMFA 1XYGA 4FEYA 3L7CA 5EJ6A 1FYVA 3AI7A 2DKFA 1F2VA 3T7CA 4KZPA 4B46A 2KWIA 5C3MA 5HOQA 2EJWA 1YU9A 2C54A 2ZJYA 3PVCA 3GA5A 5DTIA 4DDMA 1OV6A 5JC1A 1KRWA 2XMDA 3O5AA 3DC2A 3E9EA 3IUMA 3AF2A 3R0IA 1F12A 1FYEA 3WR5A 2GYVA 4JNCA 4OJKA 4CLDA 3KPJA 5E9AA 4DXDA 1PV1A 1U6IA 3KJXA 4H1TA 1QK3A 2V8BA 3I2JA 4X1IA 5DWDA 1GZ6A 5BVHA 3CINA 4RK5A 1LLCA 3CY6A 1WDMA 4D8YA 2NSYA 3AFIA 1HDEA 3H5IA 4P4TA 4V3BA 3VSEA 1ESNA 1FPMA 3UUWA 1D04A 1ZD4A 1CDDA 3BWCA 5AJHA 3QWIA 2GT1A 1AKMA 4EY4A 1A8UA 2BGKA 4JYBA 3WGVA 4I4CA 3A2KA 1UKVY 4E11A 3OIDA 4TMZA 5HGXA 2Z2YA 4FFBB 5A7FA 2QA5A 3L7MA 5LZ4A 1M6HA 1AQ6A 1C9EA 4OA5A 5TMDA 2MU1A 3Q5DA 2ZIGA 4WLFA 3EPLA 5AVRA 3NH6A 4E5MA 1BTOA 1NQAO 3N3BC 1RQ7A 3DDCA 5AM4A 4JLPA 5K3SA 4CPDA 4FYPA 5LUAA 5BVGB 1AG9A 4KDFA 3KP1A 4JXZA 4CLHA 2ZBVA 2C0CA 2VH1A 3DHVA 3SJUA 2NUPB 1ZN7A 2DY1A 3IMKA 4CIBA 2JD0A 4JLWA 4WKBA 4HR7A 2IOFK 3P2JA 1NUUA 1W85B 3VKUA 3ADOA 1Q20A 3G0BA 4WAUA 3AZOA 2Z56A 1P2TA 1C2YA 3B9BA 3NNSA 3LC1O 4MKFA 1DOHA 5D5HA 2YC4C 5DLDA 2QVLA 4BO4A 4ZCMA 3ZVRA 1Z88A 3S8YA 5CIYA 4EG4A 1GU1A 3HE3A 3N0WA 3S5UA 5EN4A 1FL9A 5TT1A 3ZDDA 3IBTA 3T8YA 1KO8A 2LDXA 2N9UA 2FOXA 3E22A 5K0BA 4KR0A 5FEUA 1CQJB 2GA9A 2PGOA 4II7A 2IYEA 2FCRA 4TUYB 421PA 3KEFA 1I5EA 4MUXA 4H08A 5K3OA 2IC5A 3I04M 1K6JA 1LV8A 1KYXA 4IF6A 3SNKA 1LX6A 3ZYZA 3JALB 3HRKA 3WB2A 4ZZ3A 1NJGA 3CUUA 4QHTA 3NBMA 4EHDA 3EA5A 3K3PA 3R0ZA 1R4NB 3L2OB 5AVZA 1V3UA 4F6LA 1U3VA 4HYTA 1THMA 2BM8A 4BJ1A 1EAYA 4XSVA 5GGYA 1W88B 4M49A 1ZESA 4DQ0A 4Z4EA 5C8DA 4NYJQ 5IDWA 4PIMA 1XMVA 1SZCA 3A6ZA 3M5WA 2WW8A 4AWBA 3GFFA 3ZXXA 3DEZA 5H1YA 1M1YA 2V97A 5MN4A 1N9GA 3G79A 2ZSKA 2FTKE 2JIPA 4P92A 1WCYA 3RBXA 2GN4A 1SOWA 2RSLA 2VP2A 4GU5A 4KDCA 4OKIA 5G4KA 3U3ZA 1Q1GA 3ZE1B 2PVCA 4REMA 5DLYA 4CT5A 3HM2A 2OGSA 3C5HA 3BEDA 3VUEA 1KKLA 2G07A 4NP6A 2OHVA 5EE1A 4N0EA 1FTQA 2OZVA 1QP8A 3AXTA 5TQ2B 3UMRA 4Q9JA 5DHPA 1NI5A 1NI4B 4Z0TA 2J3QA 5KDDA 1G16A 3BSSA 3PHJA 3TK1A 2ZRAA 3UG7A 3PGA1 4PRLA 2DVMA 3S1AA 2Q3LA 1LA2A 2BFEA 1XTPA 2VZEA 2Y2VA 1X7HA 1OKKA 3NXSA 2KYRA 4IIYA 3L4BA 1P6QA 2GNAA 4F4UA 1XB2A 3IT1A 3O94A 3OAAD 5AUNB 2DERA 3ZHCA 3IL2A 3F97A 2P4SA 1YUNA 4Y2PA 4BJ3A 4DMLA 2H1IA 3OOSA 4BRWA 4ALMA 5EKTA 3BKWA 3DH0A 1Z3IX 2DQ4A 3ZGXA 3HTXA 3SPXA 5LYJB 2X9GA 4Q5IA 4FOLA 4DV3B 5JVDF 1LSJA 2IYTA 1J25A 2YHBA 1Z6XA 3Q7EA 2IZ1A 1VFPA 1YQ9A 2O7SA 4IQ4A 1J42A 4PYOA 3ROGA 3ROPA 3TPZA 5FV4A 3FOZA 5JT1A 5LBIA 3FFXA 3SJBA 2GN1A 4RQAA 2AI3A 3H16A 3CO5A 2I4IA 4AZVA 1E0KA 1NBHA 1UM8A 2JKYA 4LOHA 1K5GA 4RZ2A 4U2GA 3VDRA 3WZMA 1U1FA 2A0FA 2HRDA 4IIBA 4OQMA 1P17A 2RKBA 3OD5A 1BCSB 1NVAA 2P9GA 4G4SO 1K4KA 3FMVA 4AICA 4RHEA 1WG8A 1JQBA 2QORA 3TNYA 3JQGB 4EMUA 1OR8A 3D6AA 3JQ9C 4MINA 5FTKA 1K7XB 3EF1A 5LIPA 1VPVA 5FUQA 1DXHA 2HRRA 3QTLA 4U7HA 5KOYA 2YBDA 5HVNA 5CXXA 1E4YA 1R9NA 1IOVA 1M0WA 1P18A 1ZU4A 2P4QA 2ZSDA 2BY4A 4XGQA 3TVDA 4I1PA 1WABA 3JD2A 3IPLA 2F67A 3VHLB 3I6YA 3IP7A 3RRMA 1XC7A 2A3RA 5AJTA 5FLYA 4B3HA 5KNCA 3FNQA 3ZJUA 1EG7A 1WCIA 4HB0A 5DBIA 2CLSA 3HWX1 2C2YA 3OIWA 4EPYA 3QPDA 1J5EB 3P9YA 1I2AA 1R6VA 1SBIA 1VCMA 4MP6A 2IXFA 1BNCA 1BGVA 1YZGA 2Y1WA 3AR3A 4KKVA 1BRMA 4NNOA 2CWWA 1E9EA 4PWZA 2XNJA 1Z4OA 3NUZA 3C39A 1KI1A 1QK5A 3RD5A 3RRYA 2JGAA 1P4HA 2A9FA 2JLSA 3LYLA 3PC3A 3PDUA 4G5HA 4IHKA 2CMFA 4LYAA 4Q18A 3NATA 4G5QA 4L08A 3S2UA 2JZCA 3OHSX 4MHOA 4BKRA 3OIYA 3PVSA 1GITA 3RJ5A 2XMPA 4CKXA 3PS9A 4HGOA 1N3BA 1X80B 3C43A 3LY7A 4WFJA 4TLDA 4AZ0A 2H2HA 3LX5A 3QHAA 3TR6A 3UK6A 5J2UA 2Y1CA 4GSKA 1K8ZB 4OHMA 2W2LD 1SBQA 1I3OA 1XL1A 5SYNA 4KRFA 3PQEA 4EQ6B 4EHFA 3E03A 5U4QA 2WMYA 2AVNA 3KOUA 3KSDO 4K9KA 4YPFA 4YJ2F 2COUA 2J0VA 3LZDA 1N6NA 2WD8A 3A9VA 4HS4A 1U0EA 4Z54A 2ZIUB 4MEJA 1DI0A 4IGEA 5ICSA 3IE1A 4B71A 2X2EA 1VMAA 2CJFA 4XJXA 2A1UB 2XITA 4K81B 4MS4A 3TLGA 4EUHA 2XCQA 2EZ8A 2XGMA 4OQDA 3GWZA 1O03A 4P31A 4RX1A 1AV7A 2WJIA 3PE6A 3I9FA 4C4OA 5CH8A 3TQCA 3UMGA 2GAAA 3WX0A 4E21A 4MW6A 3E0QA 1M9NA 8GPBA 2J33A 4TV9F 5D7NA 1EJ0A 3KZ1E 4G0QA 2ERCA 2ZSHA 4W6ZA 4EW2A 1MZPA 4RVOA 1HDCA 1IQ0A 4Q34A 4LV8B 3ZQUA 3PCTA 1K8YB 1A9PA 1KERA 3TPCA 4KE9A 1IBLB 4CM6A 2D2FA 2GNOA 3KKPA 2NV0A 4IVPA 2WWVD 2QU7A 2WHYA 4DA8A 1M76A 2BKAA 2LR0A 2VUUA 1QRSA 2PGNA 5K0CA 1KFEB 2YV2A 3RC1A 4CDMA 3J81A 5EWMA 1J2YA 5G40A 1I7QB 5D3QA 3RS8A 1P7PA 1L1FA 3GP5A 1Z9BA 3LUBA 2NGRA 1JDUA 1VLZA 4JUIA 5TNXA 1NLUA 2ALJA 5KINB 3G0HA 5ARBA 1HTWA 3DMGA 3CZAA 4WZ6A 5LWQA 1RRPA 1NMYA 3TI9A 4P7BA 4J75A 5C7IO 1NZJA 4I55F 3N3AC 4LF5B 3PJRA 2AYYA 2F3SA 1V4VA 3F2IA 4QUDA 3OLWA 5E6UA 2VF4X 3H99A 1V9LA 3LUHA 1W96A 5HOEA 2GCOB 1QNFA 4XM0A 5AVWA 1UT6A 1UZAA 4AJ2A 4KMRA 1DG3A 2AN9A 2IUSA 4Q4AB 3T7SA 3OFNA 3GPLA 3GR6A 4GEKA 4D45A 3MM4A 2BFOA 1I0LA 2BTOA 2VXYA 4RADA 3M5CA 1N7JA 1USKA 2O8CA 4FZJA 4BO3A 1UBFA 1VTKA 5JMOA 4G8BA 5I9MA 1AB5A 3R44A 3H4VA 1E79D 4DANA 2EFJA 1EGAA 2VUTA 2O1WA 1OXTA 1CJCA 3KWLA 3SMVA 1QZXA 2Q6OA 4G63A 4JOSA 1TQ6A 4H0NA 5FBWB 1ESCA 4MNTA 5DNYB 1Y7TA 3RK4A 1UFKA 5IBPA 1C1XB 1CRZA 1WF3A 4DL9A 1EJBA 3R23A 4RV4A 4MQEA 4C14A 4EKNB 1ZY2A 1II9A 2B98A 2WJ6A 3AHHA 5LQRA 1B8PA 1X7ZB 1NW5A 2IGTA 5HJEA 4CYMA 4HDKA 4LW8A 4RZSA 2IK8A 2HMSA 4D0GA 1NJ6A 1DDOA 1I6MA 2YICA 3F1KA 4NONA 5IM5A 3RPEA 4C08A 1N6PA 3C6YA 2P2DA 4NV3A 4CBVA 1T25A 3MFQA 4KUHA 2NVUA 1EPUA 4IEEA 2VJOA 3QUQA 1N2CE 2O2XA 3AERB 1YB5A 1UF9A 4MWGA 3I3OA 3GQVA 2B2CA 2RJNA 4QUKA 3QBJA 1BU8A 2QRJA 2GM4A 1ACMA 1SVOA 3EYWA 4XQ9A 3ZTYA 2REXB 3G02A 2J9FA 2GARA 5B1DA 3TYXA 2XGGA 1S8OA 3ZHBA 4AG6A 2BDUA 3I4FA 5AI0A 1V16A 4H4DA 1XR3A 1C9KA 1JAHA 3L1VA 1MTZA 2D1TA 2JCSA 1BFDA 4Z8XA 3BXGA 3AVOA 4HAYA 3RRFA 5BV0A 1RM5A 3UBTA 3QU5A 3CO0S 5AM1A 1O6ZA 3BMQB 1PEYA 2YVQA 1C4KA 3C24A 4NHEA 1UBGA 821PA 1WUKS 3EEOA 2HV9A 3DLIA 2OO3A 3LUDA 2IQ5A 3TRHA 3W5BA 1QFXA 1Y9ZA 4B3TB 4EPXA 5K0EA 1H4VB 3QLUC 1US8B 2ON6A 2OZEA 5DGHA 1DKNA 4CCWA 3BIXA 1QQAA 1YR8A 2DUWA 4YGYA 4F60A 2HJVA 3FBWA 4A91A 1NG1A 2Z2JA 1QSGA 1DAHA 1XRNA 1ZIXA 1B6SA 1W4ZA 2WSLA 4B40A 2OCLA 5JDIA 3KSUA 5ALUA 3RS9A 5T3YA 2CNBA 3T41A 1UBLS 3LYAA 4JZKA 1Z47A 4PYRA 2BRUC 4BJ6A 3T4EA 4EF5A 3G2HA 1N4AA 3RUCA 5F12A 3W05A 5E2IA 2GPYA 1J2UA 1QUEA 1DAIA 4ZAYA 4LJYA 2JGFA 4CJXA 4EPVA 5FQNA 3KCNA 1EQ2A 2PZFA 3RRZA 4X1OA 2V6GA 4G0MA 2PNJA 3LVBA 4FFBA 5BN1A 1EYZA 4DQUA 4Y2VA 3PSAA 4HYEA 5IF3A 5KHLB 1RC1A 1GA4A 4AROA 4GSLA 2P9EA 1PE0A 4A6EA 1ZGGA 3M89A 3PUIA 5K20A 1LDEA 1WZNA 2NUPA 4MGEA 5KYYA 2I8CA 1ENOA 5C5IA 3YASA 4F3YA 4UHDA 3SBDA 2Y1LA 3HLYA 3PHGA 1L6IA 3DBRB 3I9LA 4DEXA 1W36B 3VPXA 1GU0A 4DQLA 3NHRA 4GVPA 4E7OA 1KBQA 3NEPX 5EWLB 3UM9A 3ZBPA 1EI9A 1WXHA 2CW5A 1Y5LA 2J3JA 4GECA 5EESA 1MJ5A 1MAUA 3U40A 4CLEA 4D9EA 4QTYA 1ZUWA 3K5IA 1B0AA 3HU1A 2F8LA 1YS7A 1N6IA 2DULA 2WJ3A 4HUQA 3HBJA 1CQJA 1ODCA 1LDYA 4ZCIA 1N2JA 1AMNA 3S2EA 3U7QB 1HNNA 4KOEC 2O7NA 3Q3HA 4TUYA 1Y3FE 1GFZA 3NORA 5J5VA 1YZYA 3ESYA 3F5MA 3MAAC 3W8FA 3AEXA 3JALA 1MPXA 2VT3A 2WSIA 1KI4A 1U0NA 1X7YB 4KTVE 3ZH9B 1BIFA 2TMDA 5HGJA 4R2MA 4TMVA 3FUUA 2W42A 1CQZA 3PA6A 2ROQA 3S68A 1FSSA 3R2JA 4NFYA 1T1IA 5LR6A 4R6XA 4TTAA 1K2VN 3CXUA 1KS9A 1GKIA 5KWJA 4TMYA 4XDHA 5HHTA 3WKEA 4R1TA 2AOVA 2B7CA 3IR5A 4RTMA 2O20A 1KPIA 1M2VB 2UVPB 1KEZA 1CUBA 4MVJD 1CUDA 2YX1A 5A3VA 4PAMA 2WZCA 4DB2A 4YIHA 2HRQA 2DM6A 3E5MA 1W4CA 3ILVA 1EWTA 2XPCA 4K40A 3SWWA 3VO9A 2QI9C 4OQPA 1QHHB 3TJMA 1JYFA 4PNPA 4MPDA 1QPBA 3T3EA 1HQCA 2ZYDA 1NI4A 1JEDA 1I0ZA 2YZ7A 5AO9A 2IYXA 1AK2A 3TEMA 4WW0A 3I28A 4MVJG 1QWSA 4TWBA 4MCIA 2QLBA 4LXYA 2W6JD 2HSZA 2PFKA 3C4VA 2FAXA 5C1IA 5LQUA 1CR0A 3R9KA 1WNFA 1U0GA 4KFTA 4B74A 2DBVO 4JT8A 3RSQA 2V4MA 3SQOA 1V5IA 2A1TR 4LZZA 4XVUA 5E38A 4UTNA 2EV9A 1Z82A 4RU1A 3HB5X 4FHDA 4EHLA 3TMYA 4XIJA 1P73A 1OWLA 2IZZA 1IM2A 4Y9TA 3I72A 2WC1A 1VE6A 3O4FA 1LJLA 2DPYA 3A4LA 3K72B 3OBIA 2CF6A 5T67A 4DUGD 1A5AB 1HNXB 4G5OA 1SBNE 4TQ9A 2VZLA 4OXYA 3UC9A 5KYTA 3ORFA 1ZK2A 4LXGA 2G0AA 5FUVA 1ONSA 1Z2CA 2A0YA 1LXCA 3RSSA 5KQRA 3HXMA 3C45A 1XZJA 3TRDA 2PJZA 3MJDA 1XROA 4MDYA 1KNQA 2JCVA 3U4QB 3NV7A 3QBTA 1LB1B 1CRLA 3G5LA 2JIMA 3A14A 4EYKA 4GAEA 1E5TA 3O1IC 2RBKA 1AOXA 3C48A 5IW8A 3D3EA 3DMNA 2PUJA 3GGSA 4TXLA 2JW5A 1BCSA 3RNLA 2DQYA 3OPNA 1X9HA 1CULC 5FPQA 2ERYA 3JQGA 4M88A 4PZ0A 1EE9A 4IH9A 1KI6B 4BECA 3P9CA 1MN6A 4NNPA 2QL6A 4FDTA 3RHSA 4N3AA 3D0RA 4TSRA 3TRJA 1J09A 3KZNA 1O95D 2OBBA 4H0FA 3WL3A 2CT8A 2YFYA 2VP5A 5DCLA 2AV6A 3BJRA 1NRWA 4FDUA 1C8VB 2VPTA 2DFNA 2G5TA 2QNRA 2GHIA 3DF9A 1V3TA 2EWVA 1GKUB 3ELBA 3UHPA 3ZNPA 3SBOA 1BS1A 5H68A 4DLAA 3U3XA 2FXIA 4G97A 2JRLA 3BL5A 1GZ4A 1Z2EA 4JY7A 4YRDA 5H0IA 2ZU6A 3IUYA 4I8XA 4PCUA 4AG3A 1H5UA 4LFAB 3KRTA 3QYJA 3WGNA 2CXSA 2I91A 5HIJA 1RMYA 1SUBA 5ALMA 4DDKA 5TQVA 1RC0A 5F5NA 3KJFA 4GW3A 5H02A 5BWMA 3A3PA 3OTWA 1L3IA 5FL3A 3RV3A 1EB8A 4JBHA 4X95A 5E3JA 4KXUA 3S4YA 3PEVA 4IG9A 4WXRA 1MH1A 4HGYA 4JFAA 3NW9A 5DVZA 5FUYA 3B6KA 1KJ9A 3L01A 3QX8A 2BUAA 4M8IA 4Q48A 1W8DA 1FFAA 1X80A 1Q19A 2B99A 4N18A 4TV8B 2XNHA 1XK6A 1XK7A 1EGHA 4X00A 4OFBA 2PIDA 1TGYA 3DE5X 4Q12A 2C0PA 3CPHA 4LDNA 4HH4A 2ZTMA 4RSRA 4ZT4A 4UQOA 3RVMA 3U81A 4XWOA 2GXQA 3A9WA 4G0ZA 1R66A 3GK3A 4BP8A 4ZCQA 2DT8A 4INOA 2OK7A 4ISBA 3TAUA 2ZRFA 1DZ3A 1NGSA 1M2HA 2AR7A 3H18A 2QX8A 3PDJA 3R7NA 1ISPA 1SCDA 3SK0A 2GJ4A 3I1IA 3GIWA 2CHFA 4BX9A 1RW4A 1JDVA 5IC5A 1J06A 1RAIA 4R9NA 4BFVA 1R16A 4BO6A 2A1UA 1NXWA 3IQXA 5LA6B 4MP8A 1QIDA 1EVKA 4DR2B 2Q2OA 3I92A 4ON9A 3B13B 3SC4A 1A2KC 3TEFA 1ESEA 3SXJA 1V2GA 1UUFA 4KN9S 1QIKA 4EY7A 2H3HA 4P36A 2EBHX 3VR4H 2VS1A 4JB2A 3UJHA 4YRMA 1TKBA 3QWHA 1T1GA 5HJ7A 2R6FA 2Y9PB 2HJHA 1QVAA 1NJ1A 3ZHQA 3IVCA 4X8OA 4W1PA 3LCRA 1O7JA 4C3VA 4BGDA 1MX5A 4NULA 3EVCA 3H5RA 2OECA 5DO9A 4AECA 1J0BA 3WL8A 1IHPA 3BILA 4GLBA 5HCUA 4CMIB 1RZRA 3P2KA 1N6OA 1J7JA 3DNMA 1CYDA 2AEMA 1HFWA 3W8EA 2C5AA 1VLLA 5AM0A 4R71A 1ZW6A 3F47A 1FFGA 3FUVA 3RTEA 1YJ8A 3KOZA 4Z9XA 3OOWA 1GKYA 2Q07A 4IILA 4MKIA 3VYVA 4XYLA 5C8YA 5EHXA 4MCJA 2DR0A 4L5BA 5T4EA 3VRHA 4YV1A 1OB5A 4NG4A 1U5CA 2AEJA 1GAWA 1FK8A 1VE3A 4X6LA 1KZ9A 4YMSA 1IBCA 5JCZA 1XQXA 4TT3D 1X38A 1KAHA 4WECA 1JIQA 2VAMA 1BDMA 4NJOA 1VG1A 4RL4A 4TT8A 1O94A 4IUCS 3ZY5A 1TK9A 2H4ZA 1NURA 2GK7A 2RGUA 3E8SA 1OLXB 2GSWA 2I67A 3OF2A 4J4HA 1YRYE 3BH7A 3NC4A 3PTZA 5LLDA 1YHNA 3KHTA 4KIWA 1T2FA 2C1EA 2IP2A 4PYMA 1RYHA 4LHVA 5HKAA 2Y4NA 4JUCA 2RHGB 1L1RA 3FETA 1ADFA 2AK3A 3KHSA 1LS1A 5EUBA 5SY6A 2P2YA 3U3JA 4BEBA 3OO1A 1AUOA 1GP2A 3FPEA 4QUJA 2XDAA 2OBXA 3L6OO 3HACA 3U7RA 2COKA 3F6BX 1R9GA 4RKEA 5BSEA 1EAMA 1E4VA 2YFHA 5HKOA 2W9XA 2VJMB 3ACDA 1X7GA 3L02A 1C1XA 1T3ZA 1JDBC 2HNAA 3ECSA 2BBTA 2ZCUA 1W0CA 3AJAA 3PFKA 4IZ6A 1X7ZA 1SPXA 4PC3A 4TZ6A 5KPJA 1DDIA 4DLVA 1E98A 2D2VA 1K3UB 1EE1A 3MCVA 2ONZA 2HMWA 3B5EA 3HC7A 1EDEA 3KHUA 4OTZA 4CLOB 4CWAA 1MRZA 1O97D 3ZU4A 1YHZA 5FULA 2ZS7A 3AERA 1HLGA 3D7RA 5FBZA 3U4MA 5DPMA 5ECGC 1KWGA 2CBGA 2ECQA 1S0UA 3WHPA 4CMGA 3PXEA 1W46A 1NE7A 4XGIA 3ELWA 3B1VA 3SZMA 1I94B 1I32A 3KQYA 3VGPA 1SB8A 3CJQA 2D7CA 1JJBA 1SZJG 4UPVA 1VL1A 2P79A 2WYOA 4CVNA 2IIQA 3PGKA 4DCTA 1CUUA 1JBQA 4PLZA 4EDHA 1ACJA 2C9DA 4ZGBA 4G5YA 1W5AA 5PGMA 4EW3A 1UP7A 1TLTA 2ZUSA 1YDFA 2BH9A 5DISB 2ZSBA 5EVCA 1SD5A 5SY4A 4G65A 1QORA 4XR4A 4WVLA 1F8GA 3LUAA 1VI5A 1HNWB 2RH9B 5AKGA 4RDCA 3FB4A 4AW9A 1MQ8B 1C2TA 4EVIA 2F00A 4G0VA 4HGRA 2GWHA 1DBPA 4QG7A 1EX1A 2FQYA 2J45A 2XMGA 4IG4A 5DLPA 1US8A 4BLVA 4BTVA 4JENA 5ALJA 3W04A 4GICA 2ZZKA 1EFPB 4B6EA 1RWKA 1I7SB 4LZWA 3V6LA 1OF1A 2VJYA 3CH4B 3RREA 3E7WA 1XG5A 3L9WA 3ONWA 4HQFA 5J4YA 1QRAA 2HWYA 1HE1C 5C5CA 2EATA 2V9CA 4ZGWA 4JGBA 1TUBB 1YZUA 1ZGCA 3CISA 5DSXA 2VF7A 4F8YA 1YQWA 1NV9A 5B1IA 3GEPA 3GJ7A 4QOSA 2HIAA 3LE8A 1M8FA 3VVCA 3X1JA 4YPVA 1SXQA 2V0GA 4RD6A 1LW7A 1ZD8A 1GSOA 3H6GA 5AK0A 3ZI7A 5CIQA 4IJKA 1DIRA 4W99A 2FNAA 4QDZA 4OFZA 1JIIA 2VQFB 3CH5A 1CCWA 2DTDA 2ZT7A 3DTTA 3JYHA 4AY6A 4MB0A 2JGNA 4GPIB 2I3DA 3IIMA 2HIMA 1JHUA 2D0IA 2QP3A 1ZISA 4HVAA 3T52A 1IPEA 1H2YA 2A4MA 4DIBA 1EFCA 3IP8A 3KIPA 1XKTA 3NIGB 1E7QA 2ECKA 3Q0TA 4H7HA 5HF6A 5H80A 3NOOA 1HYBA 1DWQA 3UOAB 2FHPA 5L95A 2GK6A 3DBRA 3DGFC 1M54A 1C5KA 1Z56C 3DEAA 3P8ZA 5FJJA 2VDVE 5IG2A 5EWLA 4G6ZA 1M0EA 4B8ZA 3OOJA 4NCNA 3VPGA 1U8TA 3AKZA 4HDNA 1K0UA 1CP2A 3EG9B 2ZSIA 3K96A 4HXEB 3ADKA 5CTAA 3TOVA 1ONOA 2JHCA 3CX7A 4HXGA 1YVUA 2IY7A 5EJFA 3WLLA 2IEYA 4E4TA 3VR2A 2EIHA 3U7QA 1Z6YA 4YP6A 5SYMA 4EYQA 2XVXA 2XUAA 3B5IA 4ZOLF 4ZPJA 1N5IA 1SG0A 3RBAA 3RABA 1Y8AA 1X70A 3QE4A 1RM4A 2IIPA 2B37A 1IAQA 3HGQA 5JDCA 4P0TA 3B6MA 2H51A 4DQKA 3O95A 3D8TA 4L8FA 3G6WA 4KDRA 2YHUA 4CEHB 4W7SA 3OE5A 2BEKA 3UO8B 4ZGGA 3MTEA 5DFAA 2A30A 4IFTA 4IL5A 3UUEA 3FMFA 2PZGA 5LZ9A 3SS9X 1IXYA 3BDVA 1FP4A 4HMOA 3MRSA 5C53B 4GP9A 4K9DA 4PSUA 5A6SA 3ANMA 2TSYB 1M2VA 4FFNA 3QQ5A 5B1SA 2ZYIA 2UVPA 3AYXB 1KDOA 3UHOA 3S1SA 1U2DA 5EI5A 2VJAA 2VPQA 3B1ZA 3PNQA 1R8QA 1UBRS 2YRXA 3MMNA 3NM4A 4LWZA 3RSOA 1RPZA 2GH1A 2ZBEA 3DD5A 3DM9B 3UATA 1XNRB 4PIPA 4MW4A 1W94A 2EGUA 2WYWA 2ENWA 3N2YA 4WXPA 3PJFA 2P7HA 2A1TS 2IYVA 2PQMA 3EGXB 4HEA1 1G66A 4BNKA 4BB9A 1N0WA 4JS0A 2Y05A 3MJVA 4LQDA 2Z9DA 4H6VA 2VHYA 2EZUA 3R5FA 1TU4A 3BAFA 4JDUA 1W1WA 4F04A 3QEAZ 2I0FA 3ETNA 1TNDA 3NI2A 4QNRA 1FDWA 4UZFA 4C04A 3E9RA 2X5NA 3TI7A 1JQ5A 3JQDA 4B81A 3LTNC 1XX6A 1U1CA 2JVKA 3BWBA 2D62A 3HB7A 1XXHE 2FX5A 2X6TA 4QARA 4AZSA 2EYQA 2G04A 1PR9A 4M4SA 3JTMA 1WQ3A 1N25A 2PZBA 2D59A 3AC0A 3WIEA 3R4CA 4BRUA 4AQ7A 4Q05A 3DPUA 3PYLA 2D5IA 2OM6A 3HXTA 1VJ1A 1SBHA 1V7ZA 3NAZA 1MGPA 3M34A 3Q72A 1QPGA 5FNZA 3WIUA 4HC4A 1YJAA 4AT1A 5K99A 4FFWA 1KGDA 2Z1NA 5LBTA 2OSVA 1SC9A 3KK0A 4OHZA 1A7JA 2COEA 3N53A 1ZZEA 3AX6A 1JUDA 3OJLA 1J8DA 2JHFA 2DFKB 1VSUA 3PRKE 3PKZA 1YB1A 3FLEA 2LXNA 1XTJA 3DE2X 3MAGA 3P4UA 4M1KA 4MMXB 4XEUA 5EZ5A 4CM3A 3OA0A 2FRVA 4O4LF 2UUAB 2FFBA 2HSGA 1I3CA 2F1OA 3R0VA 3I83A 3KFXA 4IXWA 3P9QA 2GJ9A 3ZKWB 3P0EA 2J8ZA 3JQEA 3KJIA 4GMGA 2B2XA 3MJEA 4FR5A 4MQ6A 1CP3A 3G89A 4AL4A 4CMCA 5HZKA 1YF3A 1KI6A 1EZ1A 4C6HA 3THYB 1WB9A 5TDHA 4QASA 2QLTA 5GZ1A 2QVXX 4TROA 4LYFA 5D86A 3U13A 2H16A 1EWKA 2OKGA 1H9CA 3ME5A 1PUJA 1PDOA 2XZDA 3FNBA 2JFBA 4LVUA 5KOJB 1P1CA 4W7HA 5KVCA 3LDFA 1PK9A 4K6GA 2ZRBA 2HA2A 3L79A 1SC3A 2C00A 3PL1A 2VTKA 1E7MA 4Q7LA 3BMOA 2OBYA 3H2IA 2AMFA 3SVLA 1DCKA 4JVSB 2C5FA 2HT1A 2G1JA 4YAFA 4PX9A 3ESCA 3FKQA 1XVVA 1Z5ZA 4ZYYA 4UNQA 3CNNA 1A8IA 3FTFA 1KYQA 1Y48E 2CVHA 3GJ8A 3H7AA 1V35A 1LD3A 5CUQA 4ZOBA 1TTPB 3G2LA 4D96A 1DINA 3WDLA 5HZGA 4G0UA 1S1MA 4OQQA 3HB4X 1BYUA 1HMPA 4C4SA 3DMHA 3N8KA 3BD7A 4G4GA 1QCYA 2V6MA 4TV8A 4XRRA 1AXGA 2YV3A 1D5WA 1Y4DE 5HIKA 2EZTA 3AKDA 4FYJA 2EFHB 3V1UA 2XRMA 2B8WA 2XT9A 3RJTA 4MKZA 3EISA 3BRQA 3WA6A 3G5TA 1YBHA 3KKLA 4YYZA 3A4VA 3N7TA 1JKFA 1QIJA 1JN0A 1WMSA 4MULA 2RGCA 3TR0A 4BMDA 2G76A 5KMGB 4BZPA 4D9KA 3LQYA 2B7BA 1W7AA 1USGA 1VBFA 4ZO4A 2ZUTA 5KOHA 3KU1A 3IV9A 3GVIA 1GEEA 1YQTA 1QF7A 3T5GA 3RF6A 3C3AA 5DP2A 3E8MA 4DMGA 1HDYA 4B8YA 4I9HA 3AU9A 5IKEA 4GM0A 2O0MA 2ZXEA 4AG5A 3FOAA 5DHUA 2E5FA 4H35A 1KJIA 4IRUB 1U94A 2WIJA 2Z09A 3DOJA 1TGVA 3NAGA 1LRLA 1G9SA 2I99A 2QVCA 3HBAA 3IIKA 1RQXA 2M98A 2WJGA 3ONEA 3BRCA 3AZQA 3MCAA 4DZZA 4PLYA 2ZAMA 3U7HB 2XAAA 4IO0A 4PQFA 4US0R 4XB2A 1Z29A 3C41J 1KEPA 1CHNA 4M9CA 2WUFA 4N5NA 5E7JA 3U5TA 4KYIB 1T1RA 1X13A 4XB6B 2IPMA 2WSBA 1KAMA 1X15A 2HOQA 4ARIA 1WMDA 5FXMA 1AURA 1I4OA 3DKPA 3KO8A 1XZNA 3DMYA 3GZJA 1X6VA 5IANA 2HRCA 3KLPX 5IPFA 3A7DA 1E9VA 4KODA 1SKUA 4LGCA 3EDOA 4MYCA 5AOAA 5EVJA 5FBLB 4BRSA 3QOWA 1IWOA 2W8ZA 3CKLA 2FP3A 4LVCA 3LL4A 1K8QA 2P5UA 3HCNA 4NL4H 4RD1A 4Z1OA 5KTPA 1GUBA 3GMSA 4OA8A 5KTMA 3TDNA 3TLKA 3VYWA 4CTOA 4J7CA 5J1TB 1EQUA 1XZFA 1PHPA 2XNKA 3H13A 1R6DA 3NEYA 3FHLA 3M3PA 2BW0A 3IUPA 2P1ZA 3DZDA 5IBRA 1OLXA 2H4HA 1HFKA 2C4WA 2HJ9A 3DVAB 3L1IA 1CWUA 4PVCA 5LB2A 3X1DA 1TZJA 4W1SA 2VI5A 1U0RA 2NUTB 3VSAA 3D0KA 4ZU6X 1CY4A 2WM8A 2K7ZA 2Q1XA 4O2RA 3QOXA 3SU8A 2LIPA 4NOLA 1OI7A 2GZAA 3QX9A 2NMVA 1E0DA 1D09A 1V37A 2GUGA 3A32A 4BMOB 4URWR 1GQYA 2B8NA 1C8LA 1F1BA 4MW1A 1XNJA 3PNPA 3JRWA 2HADA 3GU3A 4O63O 3VHXB 3WBBA 1EB9A 4YWHA 4XDGA 1G4HA 2R7LA 1BMQA 2H63A 5J59A 2AGVA 1ZWLA 1XXHB 3PQFA 4NBSA 2AEFA 1ZEMA 3CURA 1PJRA 1NT4A 3DTNA 3AUTA 3QG1A 2J5BA 2XRFA 2YXLA 4P5DA 3RTAA 3DDSA 3L8CA 4Q02A 5HKKA 2OC4A