1Z07A

Gppnhp-bound rab5c g55q mutant gtpase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
165
structure length
165
Chain Sequence
SICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIQAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5C
total genus 52
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z07A00
4IXNA 4US0R 1G6HA 2F9MA 1SVWA 2F55A 4FCVA 2QY9A 1A2KC 4PZLA 1XJCA 4Q48A 1NIJA 4YMSA 3QE0A 3GEHA 3NC0C 1SVIA 4XH9B 3KQNA 5GJBA 1US8B 1BMFA 4EJSC 4B3CA 3ZZ0A 4U02A 1I4DD 3VU9A 5FOVA 2V6IA 5JZVA 2BCJQ 4BFSA 1II0A 5KYKA 1YZNA 1Z6AA 2JIZD 1CKEA 4RD0A 3K0CC 1PZNA 1B0UA 4PAQA 4EAQA 2CE7A 5EXTA 3TLXA 4MQBA 1VCIA 2J0UB 2J3EA 3GLGE 3LQRA 3CR8A 2GJAA 3LWNA 4LJ8A 3H84A 4DDWA 2RGAA 4G5OA 4A0RA 3UG6A 4IDOA 4X8OA 4EFLA 1QRAA 3SJCA 1E0KA 2DWPA 3U6BA 4JL6A 1G3QA 3F3YA 4PR0A 1U9IC 3QPUA 1UEJA 4URUR 2IA5A 3DO6A 2A5YB 4YMTA 2YZ2A 4AY2A 2IEYA 3RC3A 3C5HA 3VQTA 2YWFA 2FWRA 4NONA 1MT0A 2WZQA 4PC6A 5KPDA 4CEHB 1KO4A 6Q21A 4KI0A 2CVFA 4LV6A 2QAGB 2G1JA 3RWOA 4EUNA 4IFBA 1AQUA 3C5CA 3PEUA 1DAEA 2PJRA 4V03A 3SYKA 2PJZA 3A36A 4JSYA 2BVNA 2DY1A 1E0JA 4B75A 1R4AA 2G1KA 3B9QA 3TE6A 3WYGA 3KQKA 2QN6A 1FP6A 2GZDA 1I2DA 4DSTA 1JPJA 4U7DA 5JWHA 4MKGA 4FMBB 2QPOA 1E1RD 1EX7A 1R7RA 2QTFA 2OCPA 1KJYA 2W6JD 4B32A 2VPPA 3P1JA 3TMKA 1X3SA 1GAJA 1FUUA 4MRRA 2WPDD 3CRW1 2QUZA 2FE4A 4G5GA 5L3VA 5TY0A 1OV4A 2AWNA 1C1YA 3CX6A 4J0QA 4TZ0A 2OG2A 4E03A 1PLJA 3JVUA 4OL0A 2GAOA 4RCYA 1QG4A 2V1XA 1KZGB 2KWIA 2OM2A 1QHSA 4RKFA 2VSXA 3BD9A 1E96A 4B2PA 1JI0A 1XCMA 3Q9LA 1QHIA 5J4LA 2O52A 3GLHE 2PT5A 4L16A 2ZE7A 2JCSA 4XIGS 4B33A 3ZD7A 2BEJA 2OEPA 2WJJA 1J70A 2VHUA 4Z8YA 4R98A 2VBCA 4L9SA 1GWNA 1W4CA 4DWJA 4TYQA 2ZJBA 4I1OA 1NG9A 4WBSA 4PSAA 1S9DA 2BKEA 2D7CA 2P0EA 3Q7PA 4GRAA 1TADA 2O0HA 2B8TA 2A7QA 2RGCA 1K5DA 3IO3A 3L82B 4TN1A 4AKIA 3FFAA 4KU4A 1OYWA 1E9DA 3ZH9B 2P67A 5A4JA 5E3HA 3CZPA 4IVQA 3K0AA 3CNLA 1W44A 3Q72A 4Y0AA 3TR0A 5J40A 1X6VA 2OLKA 1KTVA 1OYYA 4F4CA 1HE8B 1M74A 5CDFE 1E1QD 3CF2A 3AGPA 4R2HA 4HEJA 4IDHA 4A1FA 4JKIA 4TYNA 4HAVA 4M9QA 1OB5A 4TTPA 1TTTA 4TSFD 4F93B 1G19A 1SXJB 2LWIA 5DSZA 4WZ6A 1WBBA 4I81A 2ZRDA 2F1IA 3AVYA 3KKOA 1T5LA 2OHFA 1UM8A 5FPSA 3E5HA 5P21A 4HUQA 5KU1A 2IS4A 1Z0DA 3QPVA 2ZS9A 4LCBA 1KK0A 3FDIA 1OXTA 3AF2A 4MUBA 3TSOA 2YWEA 3EXAA 3QXJA 2OCAA 4XVRA 1G4AE 1NLZA 3DKVA 5JJIA 2BMDA 2LKCA 2QT0A 3T61A 1M2OB 1G41A 3IBYA 4JIMA 2GXQA 1Q20A 4KCGA 1YVDA 2IYLD 2BWJA 1VMAA 2ZRKA 3WY9A 4NCJA 4BLOA 5KHOC 1YZLA 5L3SB 3EG5A 2FV8A 2BMEA 2ZUCA 2BMFA 4TL6A 3KB1A 1ZW6A 3NXSA 2OXCA 4BASA 4MYCA 2F3RA 3R7WA 4Q9HA 5JHHB 2X2FA 2VHCA 3QXSA 4DLWA 2A2ZA 2J7PD 4OQFA 2FPMA 3NG1A 4L5BA 4MYHA 1XEXB 5F2EA 4EPXA 1KI6B 5SZKB 3PIRA 2CEAA 2GJ8A 4PHFA 2EQBA 3SBEA 2XITA 4ZPXA 3VKWA 3HP1A 2QU8A 3R8CA 5CIQA 1E2GA 2IK8A 3RNLA 4A92A 5DHFA 5FBQB 2AHOA 3ZS8A 4CVNA 2J0UA 1G8FA 2YNMA 1QHYA 1VG0B 3VHLB 1MKYA 3B1XA 3CX8A 5LB2A 2JLYA 3G82C 2AK2A 4Q47A 4GOKA 2RHMA 3VTKA 4A6XA 5JEEA 3OE7D 4QNMA 2PCLA 3DEFA 1FOEB 4KJZA 5KDLA 4KO8A 3PITA 3QEJA 3GLFA 3IGFA 2AD1A 4KSBA 1CP2A 3FHCB 2EW1A 1KMHB 2WHXA 2AL7A 5C18A 1G21E 5FUYA 2QM7A 2AFIE 4AK9A 1Q1ZA 3U5ZB 3LBNA 4ARZA 1Y3AA 3IPXA 2PEZA 3ZLJA 1UKEA 2IW3A 1Q3TA 5AR1A 2FN4A 3DHWC 2GVDC 3NBXX 4OJQA 3TQCA 4R71A 3I92A 2BKUA 1F2UA 3RLFA 4DEYA 3GLIE 2QTVB 2E87A 5J4VA 1N6OA 4NU0A 2I1QA 1KJZA 4QHYA 4EPWA 4NYJQ 3ZZTA 2XSZD 2NO1A 5FI1B 1KI2A 4DDTA 4RJLA 2QQEA 2ATXA 1J2JA 4B3DA 2Q3FA 1NIPA 4H9GA 5EZ6B 3A1SA 1NBMD 1OFUX 1UBFA 3QVVA 4BUJA 3QF4B 1ZMXA 2WJVA 3LBHA 4MYTA 1KNXA 1N5IA 2QRNA 4I4LA 1WP9A 1Q1BA 1XEXA 5JCZA 2AXPA 2GESA 2C96A 4XVUA 4Q4JA 5TDHA 2H1LA 3THWA 2XGJA 4JBXA 1N6LA 5BN3A 4FINA 3GJ5A 5E7IA 1ESMA 4QNRA 3K70D 4DLVA 2FSHA 2QSZA 4WZAE 4E22A 1Z2AA 1ODFA 3AF0A 4QRHA 4D0NA 3O8CA 3AVPA 1PUJA 2NO6A 4ITRC 1KK1A 1DARA 5TB5A 1TUEA 5IK2D 3R7WB 1U98A 1ZUNB 2QPTA 2R6FA 2ZI4A 3A58B 4BECA 2D62A 3U60B 3AEZA 4OI0A 1S4QA 1XD2B 2WV9A 4Q1BA 4PANA 4UJ3A 2W83A 3SHFA 4FD2A 3O8DA 1Q22A 4TLCA 4DSNA 3KZ1E 2ZRIA 2ZAMA 2FEMA 5G3YA 4DIDA 4B47A 2XZPA 1QG2A 1UKVY 3ECCA 4P33A 2J46A 4EPVA 4O2RA 1IXSB 4DT1B 1LY1A 2HF8A 2ZSEA 4PZYA 4GP6A 1HV8A 3HYTA 4ZDWA 3RVBA 4W9MC 2BM1A 4EPYA 4DCVA 2RAPA 1N5JA 4P0TA 4FWIB 5E7MA 5CITA 5DN6D 3JVVA 1OB2A 3QY0A 1KOFA 2IYXA 3MJRA 2NPFA 3W5JA 4BGDA 4HAWA 2ZI7A 1T5IA 2B6HA 4GNKA 3DL0A 1CR1A 5KUTA 3ADBA 3V4FA 4D2IA 1ZIOA 2ZREA 4V02A 4QJ3A 5C4GB 1EESA 4P4SB 1KKMA 2ZI5A 4KITB 4DLZA 4Q4JB 1F6BA 3ZVNA 1OH6A 2DPXA 1TU4A 3M0EA 1XWIA 2YOFA 4NCHA 5AUQA 1F2UB 4ZV4A 1NN0A 2HT1A 1G8PA 4LUCA 3X1ZA 1AS0A 4BLPA 3CZQA 4TL9A 4RKEA 3KFXA 3X1DA 1YJ5A 2ZRLA 4JKYA 2ZJOA 2QRZA 2BJVA 2F43A 3I8XA 5BYJA 1KNQA 4Q7JB 5L3SA 3MMPA 4O25A 2FJUA 3FKSA 1ZIPA 2E9SA 2QP3A 4B6FA 1BOFA 3U7FB 1E9CA 3GLIA 1OJLA 4LV8B 4W5JA 4NYJR 2R44A 2BIFA 2WPDA 4MGKR 1KY2A 4C0AC 5KDDA 4I1SA 4JS0A 4EPRA 3GFPA 3AVUA 1SKYE 1AZSC 4PHHA 3NTUA 1CEEA 1E99A 2ZJAA 4CRWB 1JEEA 2H16A 1II8A 1XMVA 3FKQA 3NKVA 2V1UA 1IN4A 1NN3A 2VL7A 5H8WA 1CBUA 2WWWA 2XB4A 2WIAA 3ASYA 4JLPA 3EAQA 4BFXA 2EYUA 2JLWA 1WMSA 2YINC 5FTLA 1OFTA 4OQNA 4CEJB 4GZMA 1S96A 3I61A 3I3SR 2P3SA 5JRJA 1YHNA 2ZYTX 4NL4H 2CVHA 1JJVA 2GVZC 4LC1A 4WA7A 1C4OA 2NO0A 4GDFA 3L8ZA 4QXAA 4Q9IA 1G291 1NY5A 2VF7A 3REFA 2FFQA 1R0YA 3ZD6A 3K09A 1KMHA 4ABYA 3C7KA 1TF7A 3RS4A 2VHJA 1Z47A 3B8HA 1SHKA 5AJYA 5JSZA 5DIFA 1E9AA 1DAKA 4NPHA 3KL4A 3P4XA 4KV9A 4IOKA 4M53A 1UDWA 2GEDA 5CDFA 4D80A 2VA8A 3BK7A 2P6UA 2VP5A 1NSTA 4JJKA 3LLMA 4NE2A 2Z5FA 2QMUA 5JI2E 5JS7A 1FUKA 3MWKA 4Q02A 3TAUA 4JSTA 3NH6A 1DS6A 1T8UA 1T91A 1Z06A 4OHXA 1NVWQ 1JBKA 4FMCF 4O3MA 2CHVA 2MMGA 3BIFA 4OHVA 2AFHE 5DH9A 4CT5A 2C78A 1I2MA 1P60A 1EFUA 3MWJA 4N0DA 5EXSA 1VKJA 2ODBA 3CLVA 2PBRA 4DCTA 1U94A 4JLAA 3EPHA 3RYTC 3QKUA 5CM9C 4C7OB 5G40A 1TQDA 2R6DA 4XTRA 1TF5A 2J7PA 4MITA 4Q18A 5B57C 2W6ID 4PQRA 4TWZA 2R8RA 3GD7A 4G5RA 3UWOA 3RSLA 3W9YA 3THWB 3ICQB 1E9EA 3RANA 1FMLA 1U0HC 1R0XA 3TSWA 2HF9A 1D8TA 4UXJA 3CW2A 1WBDA 4JLMA 1UF9A 5FOWA 1N6RA 2OV2A 1SKQA 4GSYA 1N0UA 2ZETA 4ZI3A 5C4MA 4F38A 2D4HA 4Q9LA 4ZI2A 4JL5A 1CJKC 1NLFA 1JR3D 1CRPA 2VHTA 1E1RA 2EFHB 5F9HA 1Z6XA 2IYSA 1CLUA 4PO9A 4LBWA 4HAYA 2PMDA 2QSYA 2BMJA 1GM5A 4PAOA 3LW8A 1OIXA 5FBLB 2ERYA 5AUPB 1L8QA 3K0CA 3CRMA 5J4KA 1L7VC 1BMFD 2ZEJA 1GNPA 1II8B 1GOTA 2FEOA 1G8GA 3PENA 4TL7A 4A8JB 4CEHA 2NTYC 1P2SA 4HATA 3VR3A 2JJ8A 3K9HA 1V43A 3B82A 2ORWA 3EC1A 4U00A 3UXMA 1FTSA 3WBKA 1GDDA 3C41J 3KJIA 1P5ZB 1SHZA 3SU8A 5AUOB 2QNRA 4URVR 4C0JA 3KB2A 3KKQA 3HPQA 3TUJC 2BC9A 5GADl 2X77A 2NZJA 4ZCIA 1QVAA 2ZANA 4DLXA 1Z0IA 2WVJA 3I1FA 5J4YA 3HJNA 4P4SA 1QHNA 5EQTA 3U3OA 3GP8A 3K0SA 3KJHA 3LAWA 5FL7D 3I5XA 4G01B 5GJVC 4PSKA 1NMZA 4NYIQ 1E0SA 4UNRA 2XNDD 3QI2A 2L0XA 2IL1A 2PLRA 3KKMA 1GSIA 2FU5C 1X1RA 1JXMA 4AYTA 3MWYW 2HJVA 1Z5ZA 2B92A 1K5GA 4LC0A 1FL9A 2IEZA 2WM9B 3BFVA 1SVSA 2XJ4A 2ZSFA 3EZ9A 1QHXA 4Q66C 5KNBA 5KO2A 1KK3A 4X8MA 1LFDB 3BH7A 4OBEA 3ZVLA 3ZVMA 2GWHA 2IBMA 1FP7A 4XWKA 4A6PA 1Z2CA 4P32A 2OO7A 4Q4HA 4QL3A 3IUYA 1KO7A 2N1BA 3IKJA 2GA8A 1BIFA 2WJIA 4YXWA 2FFBA 4AKEA 2IUTA 5LBIA 3HU1A 2HXSA 1DADA 1KO5A 2FH5B 4RZ3A 3EZ7A 1DAMA 1PUIA 2EFEB 2GJ9A 1GIAA 2V54A 5CLQA 1R10A 1UBEA 4LYJA 4K8OA 2QBYA 1MO5A 5FOTA 4QFMA 2YV5A 2WSSA 4A2WA 1Z0KA 4GOXA 5C2JB 3IBGA 4B76A 1GRNA 1ZD9A 5GJCA 1HT1E 4YDSA 5JWOA 1XJQA 3KXLA 2PH1A 3N2EA 3Q5DA 2JLZA 3M6AA 4B3XA 2ZSBA 3B5JA 3TKLA 3BH6A 3T12A 1JQJC 1EFRA 2VEDA 2PZFA 3L0OA 4MKFA 5D3MB 1UPTA 1J8YF 4UQOA 3CONA 1D5CA 3SQXA 4PC7A 4HI0E 4QM6A 1NVXQ 1XX6A 1RVDA 2JASA 5LPNA 1WDTA 1OXSC 1W47A 2JGNA 4Q01A 1OXUA 1E2PA 2NGRA 1VTKA 1W49A 3EIQA 4R7ZA 1OH8A 4A36A 2R9VA 3PCRB 2Z4SA 2FF7A 2BBTA 1IJEA 3MFYA 2IF0A 4BEJA 2FX3A 2WWIA 2O8DB 4LBYA 5HTKA 1JEDA 2GCNA 5EP2A 1Y63A 2LCFA 1A2BA 2QG6A 4URZR 4Z54A 3FGNA 4LRWA 5HKKA 3THXB 1P2TA 4QGFA 4GOJA 5BYKA 2KJQA 2I4IA 1P9NA 1W36C 1SVMA 2IXEA 5FR2A 1SZPA 4G5QA 4RD6A 4ZDJA 1A1VA 4JVSB 1YR7A 4NCIA 4V0MA 5AJVB 3V4RA 1OLOA 3BRWD 2Z0MA 3GCGA 3SJZA 3RABA 3NC1C 2QBYB 1E94E 2FZ4A 4LHXA 5DHAA 3BB3A 3RAPR 3BJIC 3QBTA 2W0MA 2K5UA 2OAP1 1P72A 3SS8A 1XNJA 1JALA 1FX0B 1ZM3A 2WWGA 1E9RA 3FB4A 4YC7A 3RRZA 5FBWB 5KTYA 4RVCA 2REBA 3U7HB 2JJ2A 1GRRA 3KJGA 3QXCA 3KX2A 4MKIA 3R20A 1W0JA 1A7JA 4N3NA 2GAAA 1DBSA 2QAGC 2WJGA 3QNUA 1G6OA 3GMTA 4FW9A 1E2HA 4PQYA 4RD4A 2OSBA 4UXIA 1E2QA 3U7EB 2QZ4A 3NBFA 3B9PA 4RD2A 3SDZA 1NN1A 3RWMB 4HAZA 4FCWA 3PEYA 3RS0A 3RRYA 1HUQA 1PJRA 1XPRA 4OQLA 1IN5A 5FTMA 2IXFA 3ZGXA 1EFTA 3WMEA 1CJVC 2G77B 3F0TA 1E9FA 2OBNA 4Q7KA 3WBJA 2VQSA 5DGXA 1SKYB 4LV5B 4Q19A 4KSCA 3BOSA 2DCUA 3UIEA 3FMOB 2W2XA 5C46F 5EE0A 1W0JD 4LK2A 1XTIA 1HEIA 2JJ2D 3NBYC 1R0WA 1RKBA 1TF2A 1U0JA 2CE2X 2C77A 3LVQE 1QBKC 2IF2A 3B85A 2DFNA 1VHLA 4FIDA 2R6GA 1W0KD 3GEIA 3GLGA 4YXWD 3RSOA 3BB1A 4HUTA 4FMCB 4UXHA 3TVDA 1T0HB 4MGZR 3TSZA 2B8WA 3SFVA 1ZAKA 3LVRE 4HAUA 1GKIA 1E2NA 2KI5A 4QBGB 2C98A 3ADDA 1ZUIA 3LXXA 3HU3A 2O8DA 3OAAA 3CRQA 4V0ME 4PC3A 1OPXA 1P7CA 2GXAA 2A3RA 1FX0A 721PA 1N6IA 1CR0A 1YR8A 2IUSA 3EPLA 3U3RA 3GPLA 3PG5A 1KI7A 4HDQB 4D4LA 2WBLC 3KXKA 4A8JC 1F2TA 2FFHA 3OZXA 4CYMA 2O8CA 4UNSA 4DIEA 3KJEA 1F3OA 2QT1A 1D9ZA 4LYFA 3KXIA 1GILA 1JXOA 4IVPA 2B21A 3B7GA 2P65A 3VKGA 1W5TA 4NCNA 5C1BA 1UEIA 2ZI3A 4B35A 4A9AA 5UKDA 4TTRA 1KKLA 2A9KA 4AG6A 3PUXA 4TL8A 4V0OA 3CB4A 3EA5A 5FUVA 3A37A 1NVUQ 1Z29A 5K8LA 3B6EA 1ZNWA 2BOVA 2NZ8A 2QMEA 2YJTD 3W3ZB 4BEBA 4DHEA 3B1ZA 2F1RA 2OAQ1 1AIPA 2ZE6A 4WVFA 5GJWC 3W34A 4D26A 4JYCA 2O8FA 4CT4B 1TU3A 4W7SA 3T34A 4I99A 1Q12A 1GL9B 3DDCA 2OT3B 1VECA 3WRYC 3KQHA 1U81A 3T1TA 3PEWA 1R8QA 3LX8A 5A5GA 1T6NA 4NHOA 1SXJE 4LWZA 5TMPA 3U6KA 4RY2A 3FMFA 4FWTA 2V3CC 1DAHA 3R9WA 2I3BA 1MABA 2NMVA 2CJWB 2FG5A 1YR6A 3KKPA 4OI4A 3AP2A 3IIKA 3HWSA 1W4AA 2ZRCA 3KUCA 3L8YA 3OF5A 3C16C 4FMDB 3AVTA 3UATA 1KI4A 2PCJA 2O8BA 4LBVA 4MA4A 3VR6A 5IK2A 3IEUA 2MSDB 1T9HA 1OXVA 1NVVR 4FMDF 5H70A 3BH0A 1FZQA 1P2VA 5GVSA 2C5LA 2ZVQX 3EPKA 1HQYE 1SXJC 4IVRA 5AJXA 4LZZA 421PA 2Q9AA 1PLKA 3Q5EA 4NBSA 3DMDA 4IRUB 1VDZA 4ZCLA 3ETLA 1P6XA 3U3KA 1LTQA 1GKUB 4Q1CA 4B2LA 3THXA 3H4MA 1RE0A 1XEWY 4POAA 3QBVA 2YVUA 2ZRPA 2R6CA 3MSXA 4BLTA 2J87A 2XNDA 4OHWA 2QGZA 1G17A 1O3YA 3PV0A 1UKYA 3BAFA 2RGEA 4JLNA 2OBMA 3CNOA 4MRVA 4YLGA 3ZJYA 4A0FA 2BBWA 5HKKD 5JI3E 3LO5A 3OHMA 3TUZC 1ZC3A 2R6AA 1OH7A 2NO9A 3B1WA 4PXAA 4M2LA 2O8CB 3V00A 1S9HA 1D2NA 4XWOA 1OIWA 1M34E 2IUUA 3EX7C 3QSYA 4OHZA 2TMKA 2D2EA 3CRRA 4IOJA 2C9OA 3LH5A 5HPYB 1FQKA 5AWFC 4B3BA 4OK5A 3H1TA 2QPAA 4RCZA 4IKEA 2VLIA 4ARZB 2A5JA 1JR3E 2BDTA 3KQUA 2W0SA 4LBZA 4WXRA 1GRQA 3P26A 3MAAC 5F98A 3GQBA 4DDVA 4P31A 2BHRA 3CIOA 2KSQA 3CKLA 3G5UA 4B3FX 4DZZA 3THOA 1XTKA 2XSZA 2P6NA 4BFTA 2Z4RA 4AKGA 2WTUA 2G3YA 1NN5A 3C8UA 4OI1A 4DXAA 3U3MA 3TW4A 2ZYWX 2QL6A 4MRNA 1ZNXA 4TQ9A 3UMFA 4O2LA 2ZJYA 3P20A 1ZM4A 5B2ZA 1ZM7A 1VCMA 2RGBA 1G3MA 2ZJ2A 3D31A 1SVKA 1GFIA 1MO6A 3I8SA 4QGHA 4TLAA 2ZRFA 4HLUA 3AKEA 1RFLA 3VNVA 3B1YA 1J99A 1LS6A 3LRPA 4CIDA 2IX3A 1DOAA 1UDXA 1XTSA 3RS5A 2NQ2C 4FCTA 2UZIR 3OESA 4RFSB 1Z8FA 2G0NA 4QHTA 3IHLA 3L0SA 1W7AA 3QG5A 4BFYA 1Z0FA 4LJYA 2A30A 3CNNA 4P4TA 2J0VA 3AB3A 4EQ6B 4BPBA 5F9FA 1P73A 4H1VA 1G3RA 2XZLA 2ORVA 3SJAA 4A0HA 5JJLA 1QF9A 4MDEA 3FHOA 1EFRD 4TYWA 1N6HA 2CCKA 4BQSA 1RRFA 2NO7A 1LF5A 3T06B 4Q4HB 3NHBA 3BC1A 1HTWA 2ZPTX 4MGIR 2JATA 2GCOB 4JLOA 4LPKA 1CTQA 2C99A 1Q1QA 2HLDA 1KSJA 1CRQA 4M1SA 3DM9B 2NIPA 2ZYVX 2X8AA 1X8KA 3DM5A 3NBZC 4BFWA 4A8JA 1Z6TA 1OE0A 4X8HA 3EARA 4B74A 5G3ZA 5JLJA 3L0PA 4DLRA 5BN4A 5JBQA 2KBFA 1U0LA 1N5KA 2FMXA 1ZYUA 3SI7A 4B73A 4KYUA 1QHGA 4JLBA 5KOYA 3SR0A 2J5XA 1KAOA 4LGMA 3TRFA 1KDTA 1S2MA 4YMVA 2DYKA 5EUMA 5FL3A 1NG1A 3OE7A 3VMFA 2PZEA 5SZJA 1W36B 1DO2A 4KAXA 2C95A 3Q85A 2ONJA 2RGXA 4EFMA 3WMFA 2QP9X 2W6IA 1WE2A 4M9SA 4DLYA 2HLDD 5E4FA 1MABB 1W4BA 1M7BA 5FUXA 1S3SA 4CF7A 3W6PA 4H1UA 3K70B 3K9LA 1CJMA 3RDPA 4EKDA 3P27A 1HY3A 3R9IA 4UKDA 1U99A 2JLQA 3W90A 5DYGA 1T3HA 3AVWA 4BE7B 2O8BB 4URYR 3WHLA 3EA0A 3DZ8A 3PUYA 2GEUA 2OLJA 5L3QA 3VR4A 4QC2A 1IN8A 4V0LA 4ZKDA 5CYPA 1XRJA 2DFTA 3JZMA 2GJSA 2IYZA 3L0IB 5EXPA 4Z8XA 2WMNB 3D3QA 5EE5B 4NKRA 4HB4A 2RGNA 5CK5A 1Q21A 4Q1EA 2GTPA 3GJ0A 2D3WA 1ZM2A 2G88A 2WWYA 4UNNA 3MCAA 1E4YA 1M7GA 4PX9A 4KODA 3X1YA 5LD2B 1FW6A 1DE0A 2WMOB 4P4UA 5HZHA 1KHTA 2V9PA 2ZSDA 4HLDA 3QKRA 3MD0A 4Q1FA 1KI9A 1ZNZA 1JR6A 2RCNA 2WSMA 2D2FA 2GRJA 1NF3A 1N5LA 3AVOA 1G18A 2WICA 1P4SA 3EZFA 1IQPA 1KI1A 4LJAA 1BS1A 4WXPA 2WOJA 3B60A 5BN5A 1G3IA 1YE8A 1MO3A 4JLJA 1QZXA 5JWRA 3OIUA 4L15A 1OIVA 4C2UA 1BO6A 4QJ4A 3FMIA 1DTSA 1KI3A 1Z6YA 3QG1A 2AX4A 1ELOA 4LYAA 1CR4A 1N3BA 4I1UA 2IYTA 1H65A 1L4YA 4Y0VA 3AM1A 1W2HA 4QKQA 1TNDA 2C9YA 1W36D 4A2PA 1IM2A 4JLDA 1UADA 4EDHA 3A6PC 1OHHD 1JAHA 3GFTA 1Z3IX 3TJZA 2MSCB 3OEHA 2HCJB 3LX5A 3T35A 1AS2A 2W58A 1DPFA 221PA 4US1R 4PHTA 1E69A 1SXJA 3HPRA 5DNYB 2DWOA 2IYUA 1KAGA 2Q21A 3A1WA 4KLZA 3P4YA 3S1AA 3K1JA 1G7CA 2Z43A 1XCPA 3C4JA 1DVRA 5CM8B 1N0WA 2E1RA 2OFWA 2QENA 3W6NA 3N70A 2YWHA 4V0KA 2AXNA 5F3WB 5K8IA 4NDZA 2G9NA 3AQ4A 4WOPA 3AGQA 2Q3MA 3AVVA 2DWQA 4IEIA 4Q7MB 4TMTA 2P5SA 2ZAOA 2EYQA 3EASA 5DI9A 1VYUA 2D74A 4Q9JA 1XPUA 1A5TA 2XNSA 3QQ5A 2FOLA 1CJTC 2GBLA 4WIAA 2XB2A 2ERXA 1OHHA 1M8PA 1GP2A 2CL7X 3U44B 3X2SA 4XOIA 3E2IA 4ZIRA 1SVLA 3VX3A 1XZQA 3REGA 2AD5A 1VG9B 3B2EA 4US2R 1LF0A 1AS3A 2H18A 2GBLC 1AKEA 1TL7C 4GMDA 1VIAA 4AG5A 3J81k 3MLEA 4OKSA 4XSGA 1DELA 1D2EA 1EFCA 2WIBA 1E4VA 1K6MA 2VYFA 3B13B 3EIHA 2NOAA 4GPTA 3UMSA 4AKHA 2ZROA 2Z6VA 3EPJA 3CF6R 4A0GA 3CO5A 4M22A 4CW7A 3A1UA 5SZHB 3U4QB 2BCGY 2F6RA 4LDJA 3AKDA 1ZVQA 1CJUC 3T15A 1W5SA 1EXMA 3K9GA 4ZCMA 2XZOA 4KFTA 2NG1A 4KXFB 2ZRHA 1AA9A 2XTMA 1JQLB 3U61B 3RC8A 3AKCA 5DYIA 5DN6A 1OT3A 4AC9A 2OILA 1KSFX 3GJ8A 2W2TA 1EK0A 1F5NA 2OE2A 3SEAA 3GLFB 2IC5A 1FFHA 2EFDB 4TQUS 1XZPA 3TR5A 4Z51A 2ZUBA 4DC9A 4M21A 3VAAA 3WNDA 2ZJZA 5JMTA 5IRCD 3KDSE 1XEFA 1YZGA 4HUQB 3THYA 2YKGA 2O8EA 3IDQA 4OHYA 5JSZB 2BEKA 2C04A 2HT6A 4JYBA 4UNQA 1UJ2A 2AKAB 4LSGA 2BJWA 3P32A 1YRBA 5AJWA 1YU9A 5AUNB 1IY0A 1VYVA 5JECA 4OI2A 2ANBA 2O5VA 2ZVPX 1P61B 2JLXA 1WCV1 4LOAA 3CUEF 1R2QA 4TMZA 4YDHB 4YMUA 4HDCA 1P9RA 4PQFA 4GP7A 4Q00A 4PPQA 1P62B 5DI3A 4XSHA 1F2TB 5BXQC 4AI6A 3TQFA 1Z07A 2YC2C 1AKYA 4KBGA 1G3UA 2GETA 1M1YE 5LB4A 2A5FA 1G1MA 4UNPA 2QTHA 2W6JA 2GHIA 2GZHA 4QGAA 5IHPA 3I72A 1C9KA 3MUFA 3KFVA 3QJYA 4OQMA 1AGRA 1BH2A 2A5GA 1NRJB 2ANCA 2B7CA 2ZE8A 3QOFA 1E2LA 4IDQA 4XD7D 3TAHA 4S35A 3QKRB 4C0QC 2REXB 4WW0A 1OFHA 2QGNA 2B7BA 1P2UA 2AKYA 4KVAA 1CS4C 1NMXA 1TEXA 2ZRNA 1CXZA 3WYAA 4JMPA 2CLSA 1P3JA 3T1QA 4M1YA 1KY3A 3BE4A 5BQ5A 3SQWA 3MGCA 3QXHA 1TPZA 3WNBA 4HB0A 1MH1A 3U2QA 2SHKA 3LY5A 1RRCA 4DKXA 1S1MA 5J47A 5HZKA 2ZRAA 4N0EA 1G7SA 4JT4A 1U9IA 4ACBA 2HUPA 2OUKA 3THYB 1UAAA 4EJSB 3AH8A 1ZC4A 4JT2A 1E6CA 1E9BA 2DB3A 1XDBA 1TAGA 5IF9A 5JS8A 2MSEB 2IYQA 4Q21A 1DAGA 5GVRA 3LFUA 4IOMA 1BYUA 1XXHB 2XJ9A 3TVTA 3B78A 3IQXA 4LI0A 2WAXA 4NYMR 3X1WA 1N6PA 4PSVA 2F3TA 3CH5A 3K9NA 1N2CE 2HXYA 1IJFA 3CRVA 3IPYA 5B64A 2WKQA 1XB2A 1MV5A 2RGDA 2O0KA 4PO1A 3SE0A 1YQTA 5K8UA 3TK1A 1X1SA 5KSZA 3LQQA 1V5WA 3ASZA 2VIIA 1XMIA 1E2FA 4M1WA 2JEOA 4E07A 3WXMA 1L4UA 2DFLA 4C2TA 4AYWA 2X19A 4EFNA 2ZR0A 2XOKA 2MMCA 3C15C 3CBQA 2R65A 3JZAA 2HCBA 2VP4A 2O8EB 2FA9A 4EIWA 4CEIB 1T0JB 3EW9A 3WP1B 1IBRA 1CR2A 2OCYC 4TMVA 4M9XA 3ONWA 2IWHA 3W8NA 1G20E 4BLSA 2GDJA 3D6TB 3WRXC 1OKKA 1R5NA 4RFSA 1QHHA 1RRGA 2EFCB 3CWZA 4LHWA 2WWXA 2PZGA 4KFSA 1H8HA 5FR1A 2ONKA 4NH0A 1MR3F 4M8NE 4QM7A 4HLCA 4DSOA 3Q3JB 4OK6A 3I5YA 1GZSA 2G83A 2GEVA 3I62A 4DRZA 2XX3A 2ZRBA 4LY6A 1S3GA 3AVQA 2UKDA 5DI3B 3U3JA 1RPZA 4BLQA 3TGPA 3Q8XB 4L4UA 4BZXA 4MDFA 5M04A 2QEQA 1YZQA 2Q6TA 3BORA 4TLDA 4PPGA 2GCOA 1VCOA 2ZJ8A 3PUWA 2FGKA 3MWLA 1KGDA 4L9WA 1XD2A 1SQ5A 1S0UA 4MUAA 1IN7A 1YR9A 3ADKA 3GFOA 2XOKD 3UWKA 3K0EA 4DCUA 1IONA 1XP8A 1KI8A 4Q7LA 1XXHA 3RS3A 1XJ0A 1ZP6A 4HSEA 1XMSA 2XXAB 1IN6A 4DT1A 1S8FA 4JVLA 1E1QA 1G9XA 3SYNA 4BRWA 4LJ6A 1CIPA 2V8OA 4W5WA 1ZINA 1ZUHA 1ANKA 3BXZA 2Q0HA 4II7A 1Q3HA 4NYMQ 5FBRB 5FOSA 3AVXA 2CCGA 3RRMA 2CMKA 4IEEA 2F7SA 3K09C 1XF9A 3CX7A 4F7WA 4G5SA 2ZR7A 2NPIA 3QEOA 3NDPA 2KE5A 3DOEA 4XTCS 1RYFA 3VR1A 1RRPA 4WZBE 2IYWA 4K46A 1FNMA 2JJ1A 1R6BX 2FZLA 2OCBA 3BS4A 4C0HA 2JLUA 1HA3A 1SXJD 2Y8EA 5FOUA 1II9A 2WJHA 1CU1A 3CR7A 4C30A 2J7KA 4BZPA 2ATVA 2QM8A 1VPLA 1YRAA 2ZRJA 1NLYA 2F43B 2QE7A 3IIJA 4OJKA 1VHTA 2JA1A 1U2RA 2FSGA 3I73A 1Z63A 1I4LD 5K8TA 3FFBA 2CHQA 1UBGA 1XMJA 2V7QD 1JAIA 1R0ZA 1LB1B 4PPNA 2CDNA 4TMXA 4NYIR 2PMKA 4GI7A 4TSFA 3GJ3A 3NVAA 4ASUA 2D7DA 4QHSA 1Z22A 5TVKA 3LW7A 2WWHA 1KI6A 4LYHA 4DCSA 4GT1A 4BRUA 4CDGA 3C14C 4BZQA 4D0GA 2IS2A 2VH5R 4HDOB 4I1VA 4D81A 2C03A 1FPMA 1TMKA 4DJTA 3K53A 3BWDD 1T3SA 2CLDX 4ON9A 5KSPA 4D4MA 2XXAA 3IEVA 2FPKA 4D4KA 4MGYR 1G5RA 3AP1A 2AWOA 2ZI9A 3NHAA 3CPHA 5FPYA 1HT2E 3WYFA 2O8FB 3AUXA 3OEEA 4KYIB 4TT3D 4BLRA 3PVSA 1KYIA 5L3RA 1G8YA 2PL3A 1NL3A 2DBYA 3PQCA 1ONBA 4W5HA 4UJ5A 2F1JA 4P3YA 4ZDIA 2X2EA 4JVMA 2VSOA 1Q57A 1U8AA 5DE3A 5JCPA 2QMHA 3SOPA 3UMRA 2IS1A 1ZD1A 1OF1A 2ECKA 2JDID 2ZI6A 2UVQA 2WJYA 5FPTA 5CB6A 4F91B 3SFZA 2REOA 5BW8A 1IOZA 1VG1A 3UKDA 2C9CA 5JFGA 3U7GA 2ZS7A 1ZD8A 5EP4A 4IXMA 2EWVA 5DLQC 2IYYA 2OESA 1I4TD 1E79A 1PV4A 821PA 1GITA 1DAFA 2ORIA 3EIEA 3H2YA 5J4HA 2J1LA 4E5UA 3KUDA 5L3QB 2PT7A 5ELXA 4D4JA 2VO1A 4DVGA 2F9LA 1GTVA 3QF4A 4N1AA 3FYHA 1XXHE 2ZTSA 1NNEA 1W46A 5JEDA 2CK3D 5G53C 3T1VA 4DLSA 2GNOA 1SULA 2JAQA 1KO1A 4OQXA 2GF0A 3O47A 4X8LA 1IY1A 3RRNA 3VNUA 1EX6A 4MYUA 2A5DA 3QXXA 3BFXA 4JLKA 4C3ZA 1DO0A 3UK6A 2JDIA 3GLGB 4E09A 4C0LA 1UBCA 2GJKA 2CCJA 1BYIA 1LW7A 2JLVA 1LV7A 3U44A 1WA5A 5FPKA 1R5BA 1NP6A 4ZIRB 1GL7A 3EWAA 5HCIA 2ZU6A 4IW3B 1ZNYA 4A82A 1YZUA 2OBLA 2KB0A 3KKNA 1TUIA 4QBFA 2FPLA 3BB4A 1CULC 5IT5A 4IFEA 5FTNA 3KQLA 1COWD 2ZSAA 2FDCA 1QVRA 5EJEA 4PZZA 3RHFA 5FTJA 3CPEA 1N25A 4DLTA 1WRBA 4LJ7A 1KO8A 3F8TA 1F60A 1IHUA 1KDPA 4BFUA 3U4QA 2H57A 2FFAA 4QBHA 3CH4B 3PUVA 4ZO4A 5AJZA 4NCKA 3LDAA 2ZS8A 2RGNC 3LXRA 4OYHA 3ZQJA 1ZRHA 2JIZA 4Q1DA 2A78A 2CLCX 4NP6A 1JPNA 1WB9A 1H8ED 2ZITA 2KBEA 3GLHA 3TNFA 1VIYA 3WMGA 3EZ6A 2QE7D 1QDEA 3BERA 3KTAB 4RD3A 2YHSA 3VHXA 5BWMA 2QA5A 2PX0A 3EC2A 4D6PA 1P75A 3CM0A 4AURA 1E2IA 4HZIA 1IY2A 3PFIA 3ZDQA 4C0SA 5KNCA 2WKRA 4D82A 5AK0A 1Z6GA 2CL6X 2GF9A 1OSNA 1G64A 3MG9A 4HYYA 3SBDA 1GNQA 2ZR9A 3ND9A 5HCNA 1W0KA 2EU8A 3SNHA 4KLNA 1VG8A 1HQCA 2CJWA 4B3GA 2FSFA 3W6OA 4M1KA 4DB4A 3DVLA 3PUZA 4B2IA 4CZ2A 3AF4A 4BWYA 3F5FA 3ND8A 1DG1G 3CWQA 4QOSA 2HJGA 4RZUA 3SYLA 4GMXA 3VX4A 4AYXA 1XTQA 3OFNA 2H7VA 2R62A 4GL2A 1W48A 1L2TA 2Q9CA 1GVNB 1EG7A 3I4LA 5LDDC 2ZU0C 1Q1EA 5HE8A 3PXGA 4KHZA 1H8EA 2WAYA 2ZYUX 1G8HA 3X1XA 2UZ3A 3GLIB 4KFRA 3A1TA 3ADCA 3A1VA 5FBVB 4TMWA 3W5IA 3BGWA 4RSGA 4F92B 2IWRA 3V9PA 3MJHA 1FTNA 4PFSA 4C9BA 4KVGA 3PEVA 3VU9B 5KSYA 2VTKA 4M1TA 1ETUA 2YC4C 1TQ2A 1ZCAA 2W00A 1RZ3A 4NTZA 2R2AA 2IHBA 8OHMA 4RZ2A 4TZ6A 1E2EA 4C4PA 2V55B 2PLFA 4KFUA 2HDNB 3VR2A 3ZIAA 1YZKA 2HYIC 2RHDA 3K0FB 4Q1AA 2BV3A 2EFGA 4M1MA 3KTAA 1IAQA 2ZRGA 4IHQA 2ZXUA 2I1VB 4JBWA 4PPFA 1Z83A 1G7TA 2O0JA 2PEYA 2QQ0A 2CNWD 2VHQA 3T5GA 3WNCA 2DR3A 1WF3A 1E32A 2XAUA 5D3MA 3NDBB 2QORA 1JNYA 1XU4A 1WQ1R 1ZM9A 2Q9BA 3LA6A 4M1OA 1WXQA 1AZTA 1JB1A 2H8KA 1NSFA 4IOLA 3VR5A 3DZDA 4Z1MA 1E3MA 2QI9C 2XTZA 4TYYA 1NBME 1RJ9A 5CJ2A 5EE3A 2JJ1D 3WHKA 1B23P 1AQYA 1CF4A 2GXSA 4GBMA 4TLEA 1JJ7A 3FE2A 4HZUA 2XEXA 3B1VA 3ZIAD 2OFXA 2GCPA 1NMYA 2ZQ5A 3IIMA 5J5CA 1EWRA 4DLUA 5CB8A 5G41A 1VYTA 1D6JA 4ILEA 4KBFA 4NMMA 4XVQA 4C7OA 1NI3A 4WAUA 3HR7A 3GEEA 4CEIA 3ICEA 4FN5A 2BBOA 1COWA 4AWXA 2DHRA 1TX4B 5E7JA 5LD2C 2Z83A 1XD9A 1P9WA 2HV8A 1NVVQ 3FWYA 1GL6A 1ESNA 3RS2A 3ZVRA 1U8YA 3IHWA 4MKHA 3FHTA 1EWQA 3G0HA 3IO5A 3HR8A 1JECA 4TMKA 5KNDA 2XTNA 3FPAA 3OIVA 2RH5A 3R9XA 4Z1MD 4HLQB 4QBIA 4TQAA 2WKPA 2AR7A 2AK3A 3T1OA 4EQ6A 1HURA 4R2IA 3FMPB 2ZUDA 2ZJ5A 4TYPA 5IDVA 4Q9KA 3QPWA 4B44A 3AKYA 3PJRA 5TARA 3RS7A 1T8TA 1W1WA 3SC3A 1FMJA 1KDRA 1SVOA 4C0BA 3NH9A 4K81B 5H68A 3EZ2A 2YYZA 4DSUA 2CK3A 1A4RA 3GJ7A 4DUGA 4JJZA 5JRZA 1GUAA 2DFKB 2QROA 3ZYCA 1KDOA 3IILA 4IJMA 4ASUD 2Q3HA 1Z28A 4A4DA 4URXR 3K8YA 4EJSA 4AIIA 5JJKA 1G16A 4LJ4A 3SHWA 5TXGA 4ESVA 4Q4AB 1O87A 2VRWA 1ZJ6A 1Z0JA 1LVGA 4QJ5A 1E2DA 3GLFE 3DMNA 2VP9A 4HZUB 3K0FA 3N5CA 1S1CA 4BFVA 3SN6A 2H17A 3GLHB 4U5XA 2CL0X 2HYDA 2G6BA 4FI3C 5D3QA 3IQWA 3DKPA 5CJPA 2YOGA 1LNZA 3QIAA 3CF0A 4HB2A 1DG3A 2VP0A 1E0AA 5FH9A 3T5DA 4HAXA 3D7MA 1KK2A 1MRSA 1XFAA 2GXUA 4URWR 2YWGA 1N6NA 3H86A 3Q7QA 3A8TA 1N6KA 1D2MA 2RGGA 4YONB 4Q5IA 4BFZA 3M4YA 5EE1A 2C2HA 3QF7A 1R8SA 5FUWA 4MH0R 4MRPA 4PO8A 1QHHB 3WP0A 1YZTA 3TUIC 2GILA 4TLBA 4DEXA 4G0NA 4JVNA 3VKHA 4JL8A 4MRSA 4Q03A 4A15A 3DPUA 2W2VA 2CHGA 1BKDR 3H0KA 4Q4LA 4JZKA 1KSHA 3DOFA 2V4ZA 3AF1A 3A4LA 1HYQA 2FGJA 2JLRA 2IT1A 2BBSA 2J9RA 4XJXA 5E95A 5EP1A 4DBLC 2D06A 2N46A 2WWFA 3O8BA 1R5OA 3LV8A 2P5TB 3LNCA 3NEYA 3UG7A 1AN0A 2J0SA 2CXXA 4V0NA 4XWAA 5HE9A 5FPHA 4B34A 3TW8B 4ERNA 4QGGA 4G1UC 1E2MA 3OFND 3QKSA 5EE9A 5HR5A 2C8VA 2VP2A 4Q4AA 5FFMA 3I32A 3ZZUA 2IYRA 3LBIA 1XPOA 1KJWA 1Z08A 3N2IA 621PA 3BBPA 4YQFA 1T3LA 3E70C 2IS6A 4RFVA 4ZDKA 1ZU5A 4B6EA 2J59A 2ODEA 1E2KA 1TQ6A 1XCGB 2AN9A 1AK2A 1RC8A 2J0QA 1U8ZA 2GKSA 1Z0AA 1Q0UA 5CLLA 1D9XA 1EFHA 1ZBDA 3A4MA 5SZIA 1OKKD 2X1VA 3LLUA 3ZS9A 1DEKA 1VCNA 3FKSD 3CPJB 2VF8A 3W8RA 5B30A 3QENA 5EZ5A 2P6RA 1NJFA 1ZCBA 2H92A 2PX3A 521PA 4TTQA 1KMQA 1LS1A 4O0MA 1G4UR 5FL7A 1RJ9B 1SGWA 3EWSA 1OH5A 1DAIA 2IYVA 5H1YA 4CGZA 3OEED 3FVQA 5EXXA 4IDNA 4TT3A 1G5PA 1XBTA 2JLSA 4LHYA 4GZLA 2QAJA 1RYHA 5A0FA 4FXPA 121PA 5KSOA 2WSSD 4YMWA 3S1AB 1EGAA 3M1IA 4PAMA 2CBZA 2VSFA 3AUYA 1X8JA 2OXRA 4R9UC 4RZXA 2ODNA 2LKDA 1G5TA 2RMKA 1IXRC 2ZIAA 4M4SA 2ZM5A 2J45A 2ZRMA 3UPUA 1M6NA 2ODWA 2VP6A 1KZ7B 5KPJA 4S2EA 4ZKEA 1PVOA 3QUSA 3W3AA 2GZAA 2GK6A 3BFKA 3GJXC 4B71A 1H8HD 1PLLA 4OK3A 2FNAA 2EVWX 3UANA 3HU2A 2GK7A 1NJGA 4LJ5A 3GJ6A 1K8RA 3OAAD 2HEIA 1W4RA 1X8LA 3R8FA 5FTKA 2RKOA 2H5EA 1NKTA 3AF3A 3L2OB 1G7RA 4RD1A 5DISB 2P2LA 1OXXK 3TBKA 1N0VC 1RW4A 3AP3A 1UKZA 3OIYA 2FSIA 3QVUA 1E2JA 1NKSA 4B43A 5FOXA 1W2GA 2CNWA 1X86B 4M0LA 4LHZA 2QMOA 3SZRA 2IXGA 4B48A 4M9ZA 4PTLA 3MRSA 1HE1C 3OIWA 4NZYA 1OFIA 3SJBA 5L8VA 1AJEA 1XTJA 2YOHA 5FI0B 1FQJA 1US8A 4F4IA 1E98A 2G0TA 3VFDA 2OFOA 1GG2A 1MRNA 3NIBA 2WOOA 3QKSB 4DUGD 5B58C 4AD8A 1ZU4A 2RB4A 3HDTA 4L8GA 3K0AB 1RIFA 5ANRB 1J7KA 4IDPA 1XD8A 3ZQ6A 3QKTA 3GJ4A 4LJ9A 2J41A 4C0KA 4F4JA 5JHGB 4DB2A 5EP3A 1OW3B 2EWWA 1M7HA 1FNNA 3FOZA 2ZE5A 2IHYA 2V6JA 1XTRA 3HYRA 5CK4A 4CEJA 1NY6A 4ESHA 5KDOA 2F1HA 5TV2A 1J8MF 3NEJA 1KIMA 3AV0B 1IXZA 4ACAA 1U90A 4LPSA 4JBYA 4D0LB 3TH5A 2ASEA 4PC1A 2BM0A 4LHVA 4LX0A 5CIWA 5EUQB 1KSGA 1AGPA 1NBMA 2V7QA 4DDUA 3LD9A 1TEVA 2OZEA 4JLVA 3TIFA 1AM4D 3PR1A 4HLUC 1GNRA 4PHGA 4EPTA 3O8RA 3E1SA 1J90A 4A2QA 1GKYA 4HB3A 3K70C 4DCNA 4GFDA 3D8BA 3FTQA 1TQ4A 4D25A 3OEHD 1MOZA 1T4GA 4G3XA 5DO9A 2QAGA 4XD7A 1E9SA 1A82A 1F48A 3A4NA 4PC2A 5CYOA 1YKSA 1Q44A 1MO4A 3NWJA 1JR3A 1UFQA 1XEWX 3L43A 2N42A 1HH4A 1E79D 2QP4A 4QG7A
chains in the Genus database with same CATH superfamily
1EJ2A 1NULA 2LGJA 2PSEA 3B1FA 2DPLA 1GTJ1 1SVWA 2ZIGA 4Z2YA 3DBIA 3FX2A 1NIJA 1U6KA 3GEHA 2EKBA 4RVGA 4YAOA 4BU1A 3I37X 1U0NA 2Q2NA 4FHGA 5F7OA 1FNBA 1LDMA 1OBHA 2X0IA 2BTOA 2D6FA 1RAIA 5KQGA 1ZUD1 1TJ3A 4UBJA 1W76A 1EFPA 5B3JA 1QIFA 4YP7A 4HFRA 3HNRA 4UZFA 3LZDA 4QIHA 4BKRA 1CKEA 1NGSA 1PZNA 1O6GA 2XT6A 2CE7A 2VT7A 4MQBA 3JARA 2QPLA 1NJ5A 1U2PA 4HD8A 4RPCA 1FRNA 1QFMA 4ZAFA 3CR8A 3RJ5A 2X22A 2BRUA 1MG5A 2GUWA 4DDWA 2RGAA 3LO8A 3MUOA 2AI3A 2IIVA 4X8OA 1PNRA 4XQGA 3SJCA 3U6BA 2ZIWB 4ZCTA 1CWUA 1G3QA 2ORED 4H7PA 1H66A 4ETNA 2IA5A 1J21A 2J08A 3DP7A 3HZRA 2ZG6A 3WB9A 4AN0A 2UUBB 4R2XA 3PHIA 4YMTA 1W9HA 3HWWA 4KXUA 2YZ2A 2AT1A 1T8PA 2RJNA 1ACLA 3IOMA 2JFUA 2R6HA 2C3OA 2G07A 2YWFA 1A7AA 3GDGA 1MT0A 2WZQA 3HXPA 5ALNA 3OT1B 3UT0A 6REQA 1GQQA 4CEHB 1L7QA 4P86A 1KO4A 6Q21A 3KSBC 2HBYA 4KI0A 4EY4A 4O02B 2CVFA 3B20A 2X13A 2QAGB 4NCXA 4B6GA 5IKMA 3L7CA 1KZHA 2MOKA 3S5UA 4EELA 3HXOA 3AHJA 1XQVA 3A0UA 3UPDA 2YMPA 2H65A 5AM4A 3KSUA 1CCWA 5FFNA 3LYAA 4CKWB 1D6SA 1T10A 2YFKA 5KYTA 1IEQA 4W1PA 1M6EX 3TE6A 3WYGA 1GN9A 2QN6A 1DGQA 3AUUA 5AOVA 1FP6A 1DINA 1SWVA 3IAAA 4JUFA 3HDQA 1B74A 5DLPA 4AL4A 2OO5A 2AC2A 3IEXA 4FMBB 1JDJA 2QPOA 4H6WA 1E1RD 1JLMA 2BEVA 2B1QA 4XAQA 5DHUA 4MO2A 4AJ2A 2IKSA 2Q3JA 1EK5A 3HKEB 3PC8C 5AI8A 4F6LA 1R7RA 2AN5A 2PN1A 1KJYA 2W6JD 2X0RA 3NFYA 2VPPA 3P1JA 2ZZKA 2PT9A 4XFJA 5ER6A 4F4FA 3CRW1 2QUZA 2AJ8A 2FE4A 4G23A 4G5GA 1RACA 2GD1O 3UFXA 3CVUA 1XROA 2AWNA 1C1YA 3G8AA 4TZ0A 2PPVA 4E03A 4YVFA 4OL0A 2CB9A 5IAGA 2O0LA 2ILTA 3EY4A 2KWIA 1QHSA 5BSGA 1NBAA 5AVVA 3ROTA 1E96A 2EGGA 2F48A 5HRAA 1JI0A 2GERA 2IODA 2JB9A 3T7CA 4CMEA 3RAJA 5CLFA 1PCXA 4WX2B 1QHIA 1BDIA 1SZJG 4M0DA 4H6VA 2R8OA 4L16A 4LXIA 4QGSA 2Q41A 3MT9A 4XIGS 4Y9DA 4P7JA 3ZD7A 2OEPA 5AK3A 3LFTA 3RT9A 2AOWA 1QQ7A 2VHUA 4FNMA 4R98A 4NBLA 3VYRB 3R5HA 1TZJA 3DBVO 4TYQA 2ZJBA 4I1OA 1PEKE 2ALJA 3VSBA 1NG9A 4WBSA 3D02A 4K9OA 1HG0A 3Q7PA 1P8AA 2O0HA 3IO3A 4ND1A 4PCVA 4Z4FA 3L82B 3WMXA 3KZMA 4AKIA 3FFAA 4QJIA 3HJTA 1E9DA 2P67A 3EB9A 3MT0A 4K9KA 2XUKA 1LPOA 1OAAA 2FX2A 2RK3A 3BRSA 1QH1A 3IAS6 2G7MC 2K2QB 3K0AA 3Q7TA 4UBLA 1W44A 3KB6A 3MD9A 3C7DB 4IG4A 3ESAA 3Q72A 1F8FA 4RZHA 4HN2A 4TXHA 4Z0PA 5B58T 5J40A 3TR0A 3RYCA 3B5EA 1PSDA 4MQMA 1RE1A 4ZFNA 1PS8A 4EG6A 2VJPA 2IEDA 1P2FA 1M74A 1ESCA 1GPAA 1ZL2A 2A9JA 2W6NA 1HYEA 4HAVA 4M9QA 4F93B 3D7KA 5FLXA 4G1CA 4FNOA 3MLBA 2AR9A 2PZJA 4WZ6A 5CDUA 2CHEA 2YMQA 2I33A 1BU5A 1BA2A 4AUMA 4S1OA 1GAWA 3PGLA 3HI6A 1EVIA 3D7RA 1T5LA 3VPAA 4QOJA 3UWDA 4LQDA 3OOJA 4LZAA 4TMFA 5FPSA 2P2GA 4HUQA 2P9EA 1BFKA 2V0CA 1GL3A 3QPVA 2CDCA 1UOQA 2J3JA 3C3DA 1DCTA 4F3NA 3BWBA 4P2GA 1VM6A 1ULHA 4LCBA 1KK0A 3FDIA 1OXTA 3E7FA 4DJFC 2XUJA 5T4EA 4RE5A 2CXQA 2QX4A 1D6NA 1G4AE 4FNAA 3RUIA 1NLZA 2BY4A 1WLSA 3LC1O 3M4XA 3L7AA 5AI0A 3WSVA 1EXWA 3T61A 1M2OB 1G41A 4E32A 3IBYA 3QOYA 4FYIA 1SXHA 3QSGA 4O4JF 1Q20A 3C0KA 4UHKA 3DC2A 3ESYA 5KHOC 1NYLA 4RGYA 1DRJA 4ZU1X 4E5NA 4RTJA 2HA2A 2JH3A 4WFKA 1OLSA 1XZCA 3DMTA 4F6CA 2BMEA 2IU4A 2BMFA 2Q2OA 1DKNA 2ONZA 3NXSA 1MFZA 2NU7B 1NXTA 5ALRA 1UIRA 2VUSA 3E0XA 3SGLA 2F3RA 1TYZA 2X2FA 1N2SA 1RMTA 1UJ4A 2QJTA 2R96A 1M75A 4YJFA 1KJNA 1R0SA 3JQ7A 3NG1A 1IZYA 1G1AA 2W2PA 2Q28A 2I34A 4LNHA 3VKVA 3PIRA 2XXBA 4CPDA 2IH4A 3GFRA 1ZGAA 1WXEA 1TLLA 2EQBA 2YMMA 4MWDA 1QP8A 1ZN8A 3HP1A 2QU8A 3DDSA 3R8CA 3PNOA 3RNLA 2IK8A 4FBGA 4HDSA 4A92A 4DSOA 1ZK0A 1UBNA 2VYVD 4TLLB 4NOKA 3UWMA 4AX8A 3L7BA 4ND2A 2J0UA 4X62B 5CEEA 2DF8A 2HRZA 5EIWA 5LB2A 2JLYA 2XBMA 4U7WA 4D42A 3RTBA 3CSUA 4U2CA 2OBBA 1G6Q1 4IS3A 3BJEA 3PFBA 3FVWA 1XZ8A 4F2HA 4IBOA 2YV2A 3IGFA 2AD1A 1NZJA 4J43A 1NT4A 2P9ZA 1N2BA 1Z88A 2EW1A 4KSBA 2H5JA 3LECA 3MTDA 3Q87B 6CHYA 1G21E 1X15A 1V16A 5FYDA 3U17A 5J9FA 1GVHA 1FUYB 1F4LA 4HGRA 2ILVA 1BW9B 4Y1RB 1Y3AA 1ADCA 5CW2A 5AR1A 1Q3TA 2H1IA 4M1QA 5FI5A 3TQCA 1E1CB 3FKJA 5ALTA 1DB3A 1Y7IA 4ARCA 3D8RA 1UM9A 2XECA 1ORVA 1C3OB 2BKUA 1F2UA 3I92A 4FEAA 4YQYA 2XT9A 2LIVA 1Q0ZA 2QTVB 3EDCA 4LCJA 2NU8B 1SBYA 3WS7A 1N6OA 4M0EA 1KJZA 2VZLA 4EPWA 2EV9A 3DE5X 4NYJQ 4AX4A 2B0JA 2NO1A 1CSEE 3PNQA 3F5QA 4RJLA 4DDTA 1OAKA 2ATXA 2ZIXA 1A50B 2HXGA 2UVDA 3DG9A 2FHPA 2N0SA 1F0PA 1YR1A 1PWEA 3A1SA 5EZ6B 5FBHA 3QVVA 4BUJA 1GD1O 3KQPA 3O03A 4BFCA 3LBHA 4MYTA 3IRVA 5K0NA 3IALA 1N5IA 2I7DA 2QRNA 4I4LA 5BSMA 2HIAA 1WCYA 3ZR4B 5C3MA 2G9UA 2QMZA 3NT5A 4Q24A 2E21A 4M0UA 3JAWB 2CB0A 3NM4A 3V1TC 3L9XA 5HOQA 4XVUA 5EMHA 5BVGA 1E6EA 2ZKLA 3GEBA 4GSKA 4L02A 4D57A 2Z98A 2ZBPA 5BN3A 4FINA 3GJ5A 3MMNA 1P80A 5E7IA 1NXXA 3KM0A 2C4TA 1FRZA 2ZATA 3V8NA 2FSHA 2NZWA 2Y92A 3I01A 2M6KA 4NVRA 1N4DA 1YS2X 2WTAA 4AQYB 1I01A 3AF0A 3S1SA 4QRHA 1ND5A 4N39A 2R5WA 5THKA 4F6RB 3HVJA 5C34B 4ML3A 1AV6A 1PUJA 1N8TA 1XVAA 2NO6A 3IBFA 3L8FA 1KVRA 4JY7A 5HS6A 2WK1A 4BWYA 5TB5A 1TUEA 3JD2A 3R7WB 1U98A 1TA0A 1Z0ZA 4UAUA 4EYGA 1VMIA 3B3GA 1C2TA 5F1PA 1OILA 2D62A 4K9PA 2MTBA 3U60B 3HFJA 4OI0A 1S4QA 1XD2B 3F3SA 4MHSA 3GMIA 3O8DA 1Q22A 4GBGA 4TVBA 2OECA 1HSZA 3KZ1E 5G3YA 4Y9TA 1A4IA 3X3HA 1UKVY 3ECCA 4BO7A 5L4LA 4EPVA 1FTWA 1IXSB 1AZLA 2P7HA 4HP8A 4YCSA 4ZDWA 4EYQA 1H6AA 1HV8A 2YH2A 3A2LA 5KOJA 4W9MC 3AKZA 5B7GA 3VPDA 1QGDA 2NXJA 3LDGA 4FWIB 5E7MA 4CNQA 2XYQA 1OB2A 2GEKA 4UPVA 1VKRA 1QH9A 1KOFA 1WXGA 1Z8DA 1UUFA 2PQ6A 4EB8A 3GIDA 4GOLD 3W5JA 2I1LA 2IYFA 1TE2A 4BGDA 2I4LA 1JT2A 1T5IA 1EGMB 1HYGA 2W6MA 1IZZA 3BIOA 4RF3A 1ZZGA 5TQJA 2WHYA 4QYWA 3ADBA 3V4FA 4CCYA 3VPSA 4G36A 2ZREA 4V02A 1U7DA 4EA7A 5JXWA 1PT7A 3ZY6A 3PWZA 1L5RA 4KKXB 3VNQA 4YY3B 1NFQA 1WDMA 3RVQA 4P34A 3LKBA 4NK5A 1OH6A 3C6KA 1M76A 2DPXA 4H35A 3RAEC 2YOFA 4WY8A 4C87A 3JWPA 4MVJP 2ACKA 3QK7A 1XYYA 4K9QA 1G8PA 3BDIA 3VV3A 1O97D 2YQ5A 3UT5B 4BLPA 1QH8A 2BZGA 1TZMA 1DBIA 3G0GA 1LNQA 1YJ5A 4X20B 1SQGA 3AOEC 3DEZA 4DMGA 1Y8QB 5KC8A 4FB5A 2HRQA 5CR9A 5BYJA 1XAJA 1HXHA 5L3SA 3MMPA 1P6QA 5FX2A 3E84A 1VKOA 1OTYA 2E9SA 3U1BA 2E5LB 1DAPA 2ODPA 5HKOA 4S1PA 1IWBB 2QTWB 2WU0A 4BNIA 3OPNA 1MOQA 4F45A 1R0CA 4KDRA 1NF8A 3NOXA 4GYWA 2WF5A 4ENSA 3H5OA 2BMVA 2PSDA 4I5IA 2SECE 1PZHA 2GHRA 3L4JA 1O95C 4ZODA 4W5RA 2GN0A 4EKGA 4E0BA 4MGKR 4BCDA 1RYMA 4JS0A 3UYKA 2Y4NA 1V1RB 3GFPA 2X0DA 5KNBH 3R0QA 3AVUA 5JMOA 1V9CA 2BFBA 4Q3OA 1HF3A 5G0SA 3NKVA 3D3EA 3GAZA 1EIWA 1Z56C 4FDVA 1SK9A 1XZNA 3QVGB 4GSLA 2RE8A 4KRYA 3H05A 2BN4A 3LLSA 3CN9A 1JNXX 4MP8A 2YJ6A 1MQ9A 4FZ5A 2H6EA 2E6KA 3U4HA 2YINC 3U39A 2TMDA 1OFTA 5JPIA 2PG3A 1WEKA 5F1YA 2K4MA 2JIRA 5IN5A 1HI9A 1Q11A 2P9QA 5I9SA 2IDZA 2NO4A 3EN0A 3I04A 2EX4A 4FK8A 1JJVA 4NL4H 1OFGA 4WA7A 4BGIA 2B4YA 5CFRA 4EI8A 5HP4A 4BXOA 1WSDA 1RWWA 4QXAA 4Q9IA 3K1YA 1G291 2QVYX 3REFA 5CA1A 1YC5A 2FFQA 2FZCA 3PNKA 4BE4A 4ABYA 1YUBA 3OIGA 1AY0A 1TF7A 2FZWA 1S2NA 1VLHA 1NNLA 5HIJA 2VHJA 1Z47A 3RS4A 5JASA 5AJYA 4R9SA 1E9AA 2O2GA 4M53A 2GKOA 2H7YA 1MX3A 3IULA 4UHCA 5LP6B 4MXDA 5AKGA 4JJKA 1WMAA 1TYEB 4K05A 2QMUA 4RTNA 1I1OA 2QLFA 3MB5A 4EW2A 1M0EA 1Z4PX 4H2DA 3QFHA 4Q02A 5I7UA 4JSTA 1DS6A 2CFIA 1T8UA 1GG5A 3MCWA 1Z06A 4I6EA 4OHXA 3IQIX 3H0CA 3DOIA 5ALJA 1B14A 3IQEA 3CNEA 4E1AA 1EFVA 1ZJZA 2AFHE 3I0NA 2HSWA 5DH9A 1L5FA 2POQX 3KPYA 1XP5A 3WAKA 2YYAA 3E9NA 4UREA 3MWJA 3JPWA 4WBNF 4N0DA 1KAMA 4Y2JA 3DCJA 4RTSA 2GKGA 3H5LA 2ZCVA 1J0XO 3CLVA 1SCUA 2G9RA 4R6XA 3R23A 2VQEB 1U9ZA 2RAUA 3IAM1 5DWVA 1FSFA 1IHDA 2AF4C 2J9FA 1U2DC 2GFQA 2VUIB 4C04A 3L4BA 5B6PA 4DS3A 1UWVA 4Y2TA 1RHKA 1H4QA 1E1NA 1UBKS 2R8EA 3AV3A 1FFAA 4Y9SA 3V1LA 4EK9A 5B57C 3GD7A 4G5RA 2AYZA 1EVJA 3GT3A 4Q1VA 1W8DA 3UA4A 1JBQA 2GN9A 2A9OA 1M5TA 2Q45A 3JVIA 4YJGB 1LPBB 1R0XA 3TSWA 1DV2A 4OHOA 3WIOA 1D8TA 1N6RA 4A6EA 1A2QA 4GSYA 1N0UA 2ZETA 4F38A 3AJRA 3F9IA 1JHUA 4ZI2A 2C57A 5JOQA 4GH5A 1JR3D 1TI7A 4IH9A 2O2IA 1E1RA 1C0IA 1CLUA 4RV5A 3QX8A 1LXCA 1F6DA 4LBWA 4HAYA 2QSYA 2BMJA 3NCTA 1GM5A 3W5BA 2OK7A 3NRJA 4FOLA 4QEZA 3G2JA 5JQGA 2B78A 5FBLB 4GGMX 3V46A 2OBFA 4ZT4A 4NECA 1B4DA 2VRCA 3GMSA 1M3SA 1E1MA 4Z4IA 2J5QA 3JR7A 2VYND 1LI7A 3HS3A 4KBYA 3F78A 1Z33A 1UP6A 2FEOA 4WLNA 3DV2A 1W85B 3VOBA 1CUXA 2C8JA 4F8EA 5GV7A 1W4LA 4UD6A 2GBIA 2XWSA 4D3DA 4E2WA 1SUBA 3AEKA 2Q7XA 4FSXA 4REQA 5DLYA 3VR3A 3U48A 5I3CA 1YDGA 3COJA 1M0WA 2I3DA 4U39A 5DNEA 3I9V1 4G67A 1FTSA 4QVKA 3JXEA 4O2BB 5C37A 1NMQA 4IJQA 1B41A 4LSZA 3KJIA 1KH2A 3AEQB 5H81A 4FKMA 3SU8A 2J09A 5AUOB 2QNRA 4URVR 4C0JA 5JS1A 5DTMA 1JSXA 4C0XA 1HLPA 5AHKA 3HPQA 5A7HA 3A14A 3AB7A 3PHHA 1EVKA 1VQ1A 2D2XA 3U4GA 1D0IA 2OCIA 2ACWA 4QXPA 1GGVA 3KJFA 5KYYB 3GJZA 2QG9A 1U0GA 2OHGA 4UE6A 2X4IA 3NRCA 1Q83A 3TTYA 3GP8A 3E9YA 4FFBB 4OLJA 4XX0B 2DE0X 5EJMA 3WLFA 2JJMA 4FLEA 3QELA 4G01B 4CV3A 4DRYA 1S89A 4PSKA 1I10A 1EX9A 4HNSA 1N0IA 3NGLA 4YJGA 1ML4A 2PAAA 4GLFA 2Z2JA 3QI2A 4H0FA 1E6LA 1ISPA 2FU5C 1DX4A 3PKJA 1K7FB 1JXMA 4AYTA 1ID8A 4AY3A 1QO7A 3MWYW 1KYXA 1Z5ZA 4OGKA 5CH5A 4ARAA 5EYPB 2R84A 4A0QA 3GEPA 5CVTA 1FL9A 1U0OC 2P62A 3HCDA 4NE9A 4A8TA 1RCUA 1U2EA 1Y5NA 3BFVA 4Q66C 4UCXA 5MGNA 1QHXA 2QXTA 1H0HA 1KPHA 3EQ7A 4X8MA 2RHWA 3OLCX 3LCJA 4OBEA 3O75A 3NP7A 1FP7A 3SEFA 1JG3A 5KWIA 4P32A 1RBMA 4DM7A 4QL3A 3IUYA 4QPDA 2N1BA 2X7XA 1AVTA 1K3UB 2GA8A 3BTSA 1QGUB 4RKRA 5I8ZA 5BWCA 1E3WA 2FFBA 5D7BA 4XIIA 4AP9A 4DBLE 4JI5B 3HU1A 2HXSA 2X5KO 3CEJA 4RZ3A 3GZTB 3TNJA 5FJIA 5J58A 1PUIA 4JQCA 3E48A 3QMMA 4L8WB 4CMEC 2XVXA 2DTEA 3AEUA 1BN6A 1FF9A 1UBEA 2VT3A 4LYJA 4XWYA 4Z99A 4YB8A 4RA9B 1C8KA 3AXTA 2JFQA 5FOTA 1JWBB 1KBZA 2FPIA 4QFMA 4EF4A 3ND6A 2CT8A 4H4EA 4B76A 1J49A 5BWLA 2HI0A 5LQSA 5LL6P 2DKOA 3ASUA 5JVDF 2PY6A 4AMZA 2ZSBA 4J03A 3G9ZA 5FWYB 1EM8B 1MDBA 1EFRA 4BN4A 3IB6A 1N7IA 2VEDA 2VEOA 1S8NA 1Q95A 3I9FA 2PZFA 4L5YA 3AXSA 4MKFA 3PC8A 2IUYA 1FVHA 3HN7A 4RK0A 1PZMA 3IDZA 4O4IF 4AM8A 3FYDA 4EO9A 5DNCA 2PBLA 3KWFA 1NURA 4R8KA 3AR7A 1WPGA 2GN6A 2H1FA 3ZW9A 4P4NA 3AWDA 2E4ZA 2Z95A 3AVXA 1DPGA 3CT6A 3SQLA 1I3CA 1H4VB 1W47A 3FYUC 7ADHA 1V8DA 1SVNA 4RW0A 4KDFA 2C2WA 1W49A 3K2BA 1ONSA 3KSMA 4ZP1A 4NBTA 5KJEA 4KFCA 2R9VA 1QYDA 2VJNA 3TRHA 2FF7A 1IJEA 4L9AA 5B1EA 3DTVD 4FBMA 4AZ0B 2CV0A 4P2BA 2Q8PA 3RIYA 4C2AA 2PO7A 2GCNA 3A9SA 2HBQA 2QG6A 5EP2A 3J80A 1N4AA 2WFMA 4HLNA 3T3DA 2I71A 4ARIA 2DT8A 3PLAE 4NQZA 5L40A 2OBYA 3QUQA 3BGVA 4GOJA 4YRJA 4M89A 1J1UA 4OEHA 3Q8KA 2I4IA 1MHTA 1E1KA 4MK4A 2R4UA 1XDWA 4QE3A 1GQOA 2NV0A 3D4OA 3IJEB 4X1YB 3ETNA 3SDSA 2I87A 1OX4B 2C2XA 4OH7A 1A1VA 4JVSB 2Y0PA 1E7WA 5EQJB 3TTVA 4EY6A 1YVRA 1Y5MA 4P08A 4V0MA 3OCVA 5AJVB 5E0OA 4BKUA 1OLOA 1S4MA 2FMHA 1OT5A 3LT0A 4YFYA 1L5MA 2HJWA 5JROA 1C9EA 2YXNA 5JMPA 1TA9A 3CVXA 4YBZA 4XIYA 5C5CA 4HYQA 3NC1C 3QJ5A 2QBYB 4LHXA 1ZJJA 4Z86A 4JCCA 5LXTF 1FP4A 4HQNA 2FN9A 2Z1MA 2FSSA 5EKUA 2XRYA 5IMBA 2OOKA 6LDHA 3SS8A 4E5PA 5IUNC 4KMOA 3JCZA 5BUSA 1QP4A 3UTDA 3PVZA 4NG5A 3FB4A 1E9RA 5F3DA 1RZUA 2AJDA 3LQ1A 2JJ2A 1GRRA 3GEDA 1X1BA 3KX2A 2EEZA 5AM0A 1CR6A 1W0JA 1A7JA 3S2FA 3QV2A 4L2IA 3DMRA 4R8RA 4FLFA 3SVLA 2YVKA 4TWAA 1DFHA 3R9IA 1LK5A 3I5UA 3L02A 2OSBA 2PQ0A 3G6WA 5PNTA 2Z8YA 1GFWA 4KB5A 3U7EB 2QZ4A 2PMBA 2Y0BA 3EXHB 3LTNC 4JXKA 1GQ2A 3EYWA 2P2SA 2XNJA 4MB2A 3RWMB 3N2KA 2C82A 1CQJB 4JEUA 1HUQA 3I8OA 5MDHA 3QYPA 2ID7A 2OGZA 1YK0A 3PZRA 4M1EA 1EFTA 1NBHA 1CJVC 3WMEA 3QUAA 5AM3A 1L5HA 3PI6A 5KOIA 3IAEA 4OJNA 4QPZA 3WBJA 5DGXA 3BRWA 1EI9A 1ZA2A 2A57A 1XU7A 3WLEA 5COAA 1IDN1 3BOSA 4KR7A 3UIEA 3VUFA 1KEEB 4UTXA 3VPCA 1PNOA 4J90A 5HKAA 3OA2A 3R3HA 1BHSA 1KYWA 3P9SA 4JJ8A 4E88A 1TF2A 4FYYA 4XIFA 3BSFA 2F64A 2P1ZA 3LVQE 4FLMA 1RQGA 1THGA 1WABA 2ZDQA 3H2SA 1E8MA 1ZHHA 3ZWDA 3MYYA 3GLGA 1P2GA 3BB1A 3OE5A 2IITA 2J3DA 3EFBA 4EG1A 4FMCB 1GZ4A 3TVDA 3R6DA 4MGZR 2JD2A 4KQWA 3IP5A 1BDJA 4LYEA 4O59O 3ETJA 4MGHA 3LVRE 3AT1A 5LMUB 1GKIA 1E2NA 1LX7A 2KI5A 1JLLA 3CZ4A 1MAHA 3NI2A 4OHCA 4RVUA 3VTAA 3VNBA 1Y8QA 5BNTA 5F5XA 3OAAA 2DLNA 4ND6A 2VJMA 4JI3B 4PC3A 1P7CA 3DDNA 1UJMA 1N0HA 1PHRA 1OTHA 3V7YA 3QLEA 5BV1A 1E58A 1IOWA 1KI7A 1PE0A 3PG5A 2P9CA 4DMHA 4L8FA 1RS0A 3H7AA 1DWOA 2HHJA 3KXKA 2ZRQA 3CLTD 2P5YA 5A9SA 4XYGA 4UNSA 1M6HA 4DIEA 3KJEA 4XW2A 4EHNA 3EA4A 5JCOC 2C8KA 1E7RA 1D09A 1I5OA 3AHDA 1U7XA 2FOXA 3C39A 3HVIA 5IKOA 2P65A 4NCNA 1TQHA 1KQNA 5C1BA 2ZI3A 1QGUA 2BF7A 2O4UX 1U3GA 3GNTA 4A9AA 1QIIA 5UKDA 2X76A 3S5JA 3FWZA 4UUOA 3VO9A 3CB4A 1IBKB 2X5XA 2ASVA 3A37A 1NVUQ 4F5WA 1MV8A 3OLWA 1XYVA 3AEUB 4RHTA 4ZZ2A 4XGIA 2JIBA 1ZNWA 5LIPA 3DLHA 1W1UA 1DRVA 2QMEA 2YJTD 4Y2GA 3OZBA 1GLVA 3B1ZA 4BEBA 1SQ6A 4MW4A 1AIPA 2ZE6A 1PZGA 2NACA 1L5OA 1AMOA 1GA4A 2O8FA 1TU3A 4W7SA 5J2UA 3EIOA 2OT3B 1VECA 2XDAA 3CC8A 3WRYC 3E7PA 1N2GA 2AC7A 4CM9D 1Y7PA 1U0RA 2VJAA 5TC4A 1MXFA 4TKZA 4PX5A 5A5GA 5AESA 4NHOA 1DJMA 4LWZA 4YWJA 4BE9A 5KI6A 4O8ZA 4C5BA 5EWLA 4FWTA 2QXUA 1IXYA 3ETDA 2ZB8A 3OM0A 5HGXA 4G5YA 3R9WA 1MABA 2NMVA 5HYVA 2FG5A 4I9UA 4MQ6A 3M9XA 5CGQB 4J2TA 4MUHA 3OT1A 4RTRA 2FWPA 2RGUA 3MHTA 1JDNA 3KUCA 3L8YA 4MVJH 1LZKA 2OC4A 3A25A 2CKDA 3D2BA 1WZEA 4D41A 3VR6A 4DLNA 1XQ9A 1NUSA 3I9LA 4FFPA 3T7AA 4A10A 1E6UA 1PG2A 1OXVA 4NNOA 1UQTA 1Q7RA 2OGWA 2Z57A 3I01M 3EUAA 2CUKA 4NV3A 5H70A 3UNXA 2IFTA 3DT8A 1F7VA 5GVSA 4O4LA 3GPCA 1DJQA 2EGHA 3GAMA 1X1AA 2P1DA 3B1JA 4BEWA 3E4DA 1KA9H 2YTZA 3L0CA 4MV3A 5AJXA 4LZZA 4HGNA 3IOEA 5DMXA 4M86A 1UBHS 3SICE 4NBSA 3CSDA 3K5WA 3H9QA 3PE4A 5E1BA 1CPYA 4WOCA 1P6XA 2I80A 3TOZA 1I7SB 5EJ5A 4UCWA 3NPAA 4OA8A 3H5TA 3URKA 1G4HA 2G40A 3THXA 1CNEA 2J5KA 1RE0A 3H4MA 1REQB 2DVMA 1N3YA 1P0IA 2PO5A 3KE8A 3N3AC 4POAA 3W5DA 2A1UB 3GVCA 4HGPA 4F0JA 1Z26A 2PV7A 3R7FA 1UANA 2G04A 2HWUA 5BSKA 1C3JA 3O9VA 4BCCA 4U4AA 2ROQA 5IJ0B 3A1EA 3PV0A 2JRLA 2RGEA 1L9XA 2XB8A 3CNOA 3CUTA 5HKKD 2IYOA 4H77A 5JI3E 1EUCB 2IOFK 3A10A 2X0FA 1H2WA 1LV8A 2Y2VA 4ROSA 3SSAA 5IBRA 4KQGA 1I36A 1KWGA 2QHXA 1OZAA 4PXAA 1T2AA 3G3EA 4M2LA 4PWYA 5I7AA 5I9IA 2Z04A 2PUDA 1R18A 1HLDA 1RWNA 3LSTA 4KX5A 1MTZA 5TF4A 2I2BA 1M34E 4Z3DA 2NUBA 2X9VA 4FFWA 3D64A 3GXBA 2TMKA 3O31A 5T8KA 2C9OA 4LQ4A 1NRXA 3UK7A 5AWFC 5I9LA 1RWKA 1H5UA 2WA2A 4YK7A 5FBZA 2O7VA 4ZRMA 2QPAA 2HIHA 4ZARA 4IKEA 2VLIA 3E18A 5DX1A 1JKIA 1ODCA 2A5JA 3BMCA 3EFOB 4U5QA 2I3GA 4ZEOA 3EEQA 3V42A 2ZIFA 3QMVA 1FDUA 1OZ0A 2OQRA 3KQUA 3K73O 2R87A 1WMBA 3P26A 4HXGA 5F98A 3FI9A 4DQKA 2Z08A 2X1LA 1M2GA 3O4GA 4INOA 2GN4A 3VH2A 2BHRA 2JCBA 3CIOA 2GZ3A 4MKXA 3CKLA 2ACVA 1GGKA 4DZZA 2O3RA 4Y1GA 3ZE1B 1T4BA 2HUNA 2HSGA 4LFAB 4AKGA 2WTUA 3RVPA 2G3YA 2M6RA 2YBDA 2FPPB 4PIMA 1NN5A 1HK7A 1S2OA 4KVFA 1AF7A 5TNXA 1FNCA 3TKAA 3P19A 2ZYWX 4K3VA 4MRNA 3DOOA 2IEAA 3K6SB 3UMFA 4OMCA 2YIVX 5CYFA 1R64A 3KYCA 1WULS 1PL0A 3MTQA 4EYSA 1DI0A 4O2LA 4EUHA 4MAAA 3KEOA 5TMBA 3OZRA 2RGBA 1B93A 1OLUB 4MHOA 2PWPA 1OGJA 1X1EA 2YFQA 4Y1EA 3EF3A 3D31A 1IC6A 1GFIA 5E6SB 4HLUA 3AKEA 4R05A 3C8HA 3B1YA 2NN3C 3LRPA 3HO8A 2IX3A 3NVDA 1UDXA 1XTSA 4D74A 1CEYA 2CVZA 1KQPA 3NDRA 4FCTA 2VOEA 1EFAA 2QK4A 4RFSB 1Z8FA 5BMOA 2G0NA 2C61A 4HN9A 2WEKA 3IHLA 2H1OA 3N6XA 5LBUA 4DKJA 3B89A 4NU5A 1O8BA 3L0DA 3WLSA 1XNGA 2A30A 5EYPA 3ZE8A 3DKRA 3AESA 1DKOA 3ETCA 4HKTA 1QH0A 4IIXA 4JLSA 4M55A 5GWXA 5HSGA 2DHEA 1MPTA 1XZAA 4H1VA 5IDWA 2WHPA 2XLCA 3T7SA 4NY1A 4KPUB 3H42B 4JR0A 4P3OA 4WLVA 1MUUA 2JCXA 4CTKA 1EFRD 4G0XA 3EXEB 2CCKA 2QMYA 2NO7A 2QIPA 3T06B 1RRVA 3L04A 4QUDA 3W4KA 1FXUA 2XE8A 3B7WA 1HTWA 1JAZA 1H9BA 4LOJA 4MGIR 2JATA 2GCOB 2ONYA 4XQEA 4ND4A 2DUMA 3OJXA 2C88A 1RTTA 1KSJA 1Z4KA 3PPVA 4CIXA 5BY2A 3L49A 5K0TA 2XUZA 3JYQA 1LC0A 3LYLA 3O82A 2NIPA 3N8HA 3WGYA 4IIBA 1CYDA 2XCIA 1XKXA 2W5UA 3EWNA 1X8KA 2VXCA 3IUQA 4M0MA 4PWZA 3VZDA 5I9NA 4KGXA 1IB6A 1T26A 2F67A 1NVAA 1XRPA 2QYHA 3TEMA 4V2UA 3ILVA 2E55A 3L0PA 4B6QA 4C08A 4DLRA 4ER0A 1VA4A 5A2QA 2X40A 5JBQA 3DE1X 2HO5A 2IZZA 1N5KA 1NNUA 2FMXA 2H2IA 1QHGA 3ZC3A 1Z8NA 5TIIA 1TK9A 2HMWA 4RVHA 4OHUA 5DEIA 3PQ7A 1YHYA 3GLTA 4LGMA 4EHAA 2BGJA 4OQYA 3LT2A 1S2MA 3UKJA 2DYKA 1LI4A 1U0EA 2DQZA 4LJSA 1VJGA 2WD7A 5AKJA 2PZEA 2GB4A 1W36B 4FSDA 1HNNA 2C95A 3Q85A 3AIKA 4ZQIA 2KW5A 3IQZA 5GGYA 5JT1A 3K0HA 2Y9PB 4QJBA 3ELYA 3PTAA 4HRYA 4PO3X 4XXHA 5EZYA 3ZWAA 3HHPA 5FUXA 5CFOA 4QXOA 6NULA 1H9AA 3GJTA 4WGGA 1ZK2A 4H27A 3RVKA 3M49A 3K70B 1CS0A 1CJMA 1LRKA 3ZV4A 1HY3A 1V3QE 3GPDG 3EGCA 4XFDA 2E5WA 2XH8A 5IVKA 2BTEA 4M6WA 3BFPA 4BE7B 3AVWA 4BMDA 2O8BB 4URYR 4QDUA 1LVUA 2VJBA 1HM5A 1C7FA 3HJRA 2GEUA 3PUYA 4JQZA 1TCVA 4IH4A 1VHJA 1YOVB 4QC2A 4RXUA 1KYZA 4LZJA 4ZKDA 5CYPA 1XRJA 3IUBA 2IPAB 3PKZA 5B6IA 1WXHA 4I4TB 5L53A 3MN1A 5EXPA 3D6FA 1ZEJA 3NT4A 4NKRA 2RGNA 4G81A 1O4WA 1Q21A 4Q1EA 3GJ0A 2C4WA 2D3WA 1M33A 3C3MA 3CV3A 3CUWA 2X9NA 4FOTA 3MAJA 1IZ8A 4GF5A 3RRXA 4D8YA 4L0MA 1DUIA 1OI2A 1M7GA 2ZUFA 3WGKA 4MW0A 2W48A 4NMXB 1A69A 2AEEA 3ER8A 2YWCA 2QLJA 2WMOB 2G4VA 2VCHA 1KHTA 4JLUA 5HZHA 2UZ4A 4B6JA 4YACA 1KVSA 2FW1A 2N9UA 1JR6A 4P3NA 1KI9A 1ZNZA 2QUBA 4J7UA 3A4YA 1Y3HA 1EYZA 1N5LA 1NF3A 4MS4B 3K71B 1K3FA 3EZFA 1KI1A 1WQ4A 2NT4A 3A3YA 1J23A 4QUHA 4BO3A 4KUHA 4AMGA 2OCXA 5G1NA 1QZXA 1VRVA 2OYCA 1RQLA 3WLTA 3ZU5A 5JAZA 2XMCA 1AO3A 1SBQA 3FMIA 1Z6YA 1XOIA 3R5XA 4W4TA 4WK0B 4BAGA 5HIAA 5JAIA 2ZWIA 4I1UA 1H65A 4EABA 4OJMX 2OCLA 3ZIUA 1YS9A 4Y0VA 3JR3A 1S2GA 5ER9A 1EP3B 2LCIA 4QKQA 1YWGO 2DWCA 2Q5HA 4WNAB 3NIGB 3R6WA 4IDBA 4EKEA 2CUZA 4CKZA 1YJCA 4MRMB 1T9GR 3AY6A 3F74A 4JLDA 5IJ9B 3QE3A 4F56A 2JC3A 2I6GA 2B1RA 3T95A 1Z3IX 2NXEA 3MRVA 2MSCB 4KLRA 3OEHA 3LX5A 1BXKA 3H5IA 4XPIB 2V65A 4NEHB 2IXAA 4MR9B 3BMOA 4JA0A 1JSZA 1DPFA 5ESRA 2H1VA 3D0OA 3B9RA 1HT0A 3V4ZA 4EGCB 1E2UA 4C4TA 1E69A 4UOZA 3HPRA 4KIJA 4WKOA 4HNUA 1CIVA 4KR2A 2AOTB 2Q21A 3A1WA 4C7OB 3OX1A 4D1YA 3L79A 2F3PA 4RM3A 4D5EA 5WRFA 3OU2A 2ZVDA 1W52X 2E1RA 5CM8B 3WIUA 2OFWA 5KNCH 4AY6A 5GM2A 3N70A 4V0KA 2VPWA 3BQNB 1SM4A 4NMLA 2ZPAA 2G9NA 2W4QA 2Y66A 4HEQA 4NJOA 4UATA 2OBXA 2Q3MA 4GZ6A 4ZQGA 5DYYA 2OHVA 5EJ2A 3ROQA 4Q7MB 3G02A 5JE8A 4TMTA 2JLCA 2ZAOA 3UMCA 4B44A 5DI9A 1U1IA 5AQ1A 1IUKA 1HE3A 3OTIA 4Q9JA 3WKDA 2XNSA 2XB2A 1CJTC 3O4IA 3S0JA 3VSDA 3WGIA 4CF4A 2ERXA 1PZXA 1OHHA 1T4MA 4DZTA 3RTGA 4IS2A 5K4GA 2CXSA 4JEHA 3E3AA 4UUQA 3DNMA 3BD8A 3H1FA 3Q2KA 5AQEA 3REGA 1XZMA 2AJLI 1JMKC 1VG9B 2GCGA 2J5RA 2H18A 1AS3A 1C3XA 4M7PA 4AG5A 1JDPA 4CL0A 1VIAA 1CUGA 5KWJA 4I1PA 3QLVC 1DELA 5KTKA 2PRYA 3DMTC 4M7RA 1EFCA 5FWXA 2WIBA 4YRGA 2A58A 3PICA 4HWSA 7MHTA 1Z6PA 2VYFA 3B13B 3RE1A