1Z0BA

Crystal structure of a. fulgidus lon proteolytic domain e506a mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
203
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVAGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELELAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords Putative protease La homolog type
total genus 60
structure length 203
sequence length 206
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0bA00
2A2DA 2ZBKB 4DUZE 4JG4A 2V2VA 4DPYA 1N34E 1NHHA 2J7KA 4YHHI 2HKEA 4DR7E 3LTOA 2EFGA 4P52A 1PIEA 2UUAI 1Z5CA 3QT8A 3V5RA 4UTGA 4JI3E 2UUBE 4DPWA 4KQVA 2R42A 2UUAE 2DEIA 4B3MI 4GKKI 5A2QC 1HNWE 4DV2I 3GONA 1J5EI 3J80Q 1S4EA 3LNUA 4WUCA 2ZITA 4DV5E 4DU7A 4DR3E 4URLA 2UXDI 1KVKA 1HR0I 4YY3E 4PRVA 4DR3I 4DUZI 1RREA 3B82A 4X64E 1ELOA 3H4LA 2VF3A 2BV3A 1RR9A 4JI4I 2UUCE 4DR4E 4X62I 2VQEE 4P7AA 1FWKA 4JI8I 4LF9I 2HFSA 1N0VC 4MYTA 1J5EE 4X62E 2VQEI 4B3SI 4DV0E 3PYEA 1NHJA 3QT6A 4DV7I 4LF8E 1Z0CA 1Z0VA 2E5LE 5A2QQ 4LF5E 1XNRI 1IBLE 2WW4A 3B78A 4NXMI 4B3TE 1XNRE 2DEJA 3Q1QA 3F0NA 5L3JA 4DU8A 4FWDA 2Q2EB 4FW9A 3J7AM 1Z5AA 1HNXE 4DPTA 1H72C 1H7SA 4B3RI 4JI5E 1XMQI 5FLXC 4WUBA 4DR2I 4DPXA 1N36I 1Z0EA 4DPUA 2HHHI 5LMUE 4JI0I 2HFUA 4DV4E 4NXNE 1KKHA 1MX0A 1VISA 4LF8I 3ZKBA 2NPFA 1QZRA 5LMUI 4ED4A 1Z0BA 4PU9A 5GMDA 4B3TI 4FN5A 1FKAE 4DV6E 4YY3I 2V8PA 5BR8E 4DXLA 4DV1E 4USKA 1FWLA 1D6TA 4JI7I 4DR2E 1WUUA 3T1YI 1HNWI 4DR4I 1XNQE 4DR6I 4JI0E 3ZKDA 4Z7YA 4JI7E 3ZZUA 2HHHE 3ZZTA 1IBME 2X7IA 4DV4I 2UXCI 4KHPE 3K1JA 3K17A 2VQFI 2UU9E 1PKPA 2E1RA 3J81C 3WU5A 4DV6I 4XTJA 3JAMC 1MU5A 2X36A 1MG7A 3V2UC 4WUDA 1ZM2A 3T1YE 4LF6E 4GKJE 4JI2I 2UUBI 4LFCI 2V2ZA 4I3HA 4K0KI 1FJGI 2OI2A 4HY1A 1OJ4A 5LMNI 2A2CA 1B63A 1IBKE 5IWAI 3PYDA 2V2QA 5LMNE 1HR0E 4EMDA 1Z5BA 4X64I 3LPSA 2UUCI 4RPFA 1N36E 4GKKE 3WU6A 4AQYE 4UT4A 4LFAI 4LF9E 3J81Q 4LFCE 3QT7A 1ZM3A 1ZXMA 1S16A 4USMA 2UXBE 3OTOI 4B3SE 4OX9I 1FI4A 4HACB 2E5LI 4LFBE 3OTOE 1KIJA 4LF4E 4KHPI 4X66I 5IT9Q 4YHHE 2ZM6I 4DR5I 2VQFE 4DR1E 4NXME 4HYMA 1N34I 4DR7I 1Z0TA 1A6FA 3JAMQ 4DR5E 2HK2A 1N32I 1EI1A 4JI5I 5IT9C 4M1KA 4JYAE 4B3ME 4OX9E 2HKJA 3CWVA 4NXNI 2R3VA 1NHIA 2BM0A 2UU9I 1ZXNA 3D4JA 3PYGA 3QT5A 1BKNA 1UEKA 4JI1E 1HNZE 5IWAE 4R1FA 5FLXQ 4X66E 4LF5I 1Z0WA 1ZM4A 2F4VI 1K47A 3B8HA 5BR8I 4JI4E 1H74A 4DV3E 1FNMA 4LF7I 4X65E 1DARA 4FWGA 2CZ9A 1Z0GA 2GS8A 1XMOI 4JV5I 1N33E 4JI3I 2V34A 2XEXA 4LF7E 4JYAI 4AQYI 4LFAE 1I94E 1B62A 4DV7E 4DUYE 2UXCE 2HK3A 4JV5E 1N33I 1N0UA 3HULA 4JI6E 1I94I 3T1HI 1ZM9A 4DV5I 4LFBI 2F4VE 3WU3A 2UXDE 4JI6I 4LF4I 4FWHA 3T1HE 3WU4A 1H7UA 2ZM6E 4DR1I 1EA6A 4X65I 4MYUA 4DR6E 4B3RE 4DV3I 3PYFA 1HNXI 1IBMI 1H73A 4GKJI 2AJ4A 4Z7CA 3M6AA 3J80C 1XNQI 2BM1A 1PVGA 4DV0I 1KTVA 1IBKI 1NZ0A 5LL6R 1U2RA 5GMEA 1IBLI 4DV1I 1N32E 4PRXA 4JI2E 1Z59A 4HXZA 4JI8E 1FJGE 3J7AG 4HACA 3ZM7A 2LJPA 1XMQE 1XHKA 1XMOE 4LF6I 2UXBI 4ZVIA 4JI1I 3ZZ0A 1HNZI 4DV2E 4K0KE 4DUYI
chains in the Genus database with same CATH superfamily
1Y6ZA 2A2DA 4FW3A 2ZBKB 5K36C 4DUZE 4JG4A 2V2VA 4DPYA 1N34E 1NHHA 2J7KA 2O1TA 5C0XC 4YHHI 2HKEA 5JEAF 4DR7E 3LTOA 2EFGA 4P52A 1PIEA 2UUAI 1Z5CA 3QT8A 3V5RA 4UTGA 3M85G 4JI3E 5DRRA 2UUBE 4DPWA 1HK7A 4KQVA 3PS1A 2R42A 5FWKA 2DEIA 2UUAE 2BA1D 4B3MI 2VESA 4GKKI 5A2QC 1HNWE 4DV2I 3GONA 4IFDB 1J5EI 3J80Q 1S4EA 4OO1C 3LNUA 4WUCA 2ZITA 4DV5E 4DU7A 1YH8A 4IZJB 4IFDE 4DR3E 4URLA 3M7NG 2UXDI 2Z5CA 1KVKA 3P06A 2GO4A 1HR0I 2J65A 4YY3E 2PO2B 4PRVA 2O1WA 4DR3I 4IZKB 4DUZI 1RREA 2PNMA 3B82A 5K36D 4X64E 1ELOA 3H4LA 2JEBB 3P3GA 2VF3A 2BV3A 2Z5BA 1RR9A 3NZKA 4IFDA 1E3HA 4JI4I 2UUCE 4OZEA 4DR4E 4X62I 2VQEE 4P7AA 1FWKA 2Z5CB 4JI8I 4LF9I 2HFSA 1N0VC 4MYTA 2BA1G 4N3OA 1J5EE 4X62E 2VQEI 3B4TA 1Y5YA 4B3SI 4DV0E 3PYEA 1NHJA 3QT6A 4DV7I 4LF8E 1Z0CA 1Z0VA 2E5LE 5A2QQ 4LF5E 1XNRI 2BR2A 1IBLE 4MQYA 2JT2A 2NN6A 2WW4A 3B78A 4NXMI 4B3TE 4IZJA 1UDQA 5JEAC 2DEJA 1XNRE 2PO1B 3Q1QA 3F0NA 1Y4SA 5L3JA 4DU8A 4AM3A 4FWDA 2IOPA 2Q2EB 4IFDC 4FW9A 3J7AM 2C38B 1Z5AA 1HNXE 4DPTA 1H72C 1H7SA 4BA2B 4B3RI 3U1KA 4JI5E 1XMQI 5FLXC 4WUBA 4ISAA 4MU1A 4DR2I 2Z5EA 4DPXA 1XXEA 1N36I 1Z0EA 5EKWA 4DPUA 2HHHI 5LMUE 4JI0I 2HFUA 4OO1D 4IS9A 4DV4E 4NXNE 1KKHA 4MDTA 1MX0A 1VISA 4LF8I 3ZKBA 5C0XB 4LOMA 2PNLA 2GQ0A 2NPFA 2PO0B 1QZRA 5LMUI 4ED4A 1Z0BA 4PU9A 5GMDA 4BA1A 2C37B 4B3TI 5EL9A 4FN5A 4OKGA 4U3BA 1FKAE 4DV6E 4YY3I 2V8PA 5BR8E 4AIDA 4DXLA 3M85D 1P42A 4DV1E 4USKA 1FWLA 1D6TA 4JI7I 2PO1A 4DR2E 1WUUA 2CGEA 3T1YI 1HNWI 2CVEA 4DR4I 1XNQE 2BR2B 4DR6I 4JI0E 4FW4A 3ZKDA 4Z7YA 4JI7E 2C38A 3L7ZA 3ZZUA 2HHHE 3ZZTA 1IBME 2X7IA 4DV4I 2UXCI 2NN6E 1RHYA 3P3EA 4KHPE 3K1JA 1OYSA 3UHMA 3K17A 2VQFI 2UU9E 1PKPA 2E1RA 3J81C 4FW6A 4U3DA 3WU5A 4DV6I 4XTJA 4BA2A 3JAMC 1MU5A 2X36A 1MG7A 3V2UC 2O1UA 5JEAA 5K36E 4WUDA 3GMEA 1ZM2A 3T1YE 4LF6E 4GKJE 4JI2I 2UUBI 4LFCI 2V2ZA 4I3HA 2BA0D 4K0KI 1FJGI 3PRYA 2OI2A 2NN6D 4HY1A 4IFDF 1OJ4A 5LMNI 2A2CA 1B63A 2JE6B 1OYRA 1IBKE 5IWAI 2NN6C 2PO2A 3PYDA 3U1YA 2V2QA 2C37A 5LMNE 5DRQA 1HR0E 2AE8A 4IZKA 3CDIA 1USVA 4EMDA 2IESA 1Z5BA 3DD6A 2IERA 4X64I 3LPSA 2UUCI 2WP8A 4RPFA 3PS2A 1N36E 4GKKE 3WU6A 4AQYE 4UT4A 4LFAI 4LF9E 5JEAD 2C39B 3J81Q 3Q6NA 4LFCE 2BA0G 3QT7A 1ZM3A 1ZXMA 1S16A 4USMA 2UXBE 3OTOI 4B3SE 5DROA 4OX9I 5DRPA 1FI4A 2WNRB 4HACB 2E5LI 4LFBE 3OTOE 5K36F 1KIJA 3GLLA 4LF4E 4KHPI 4X66I 5IT9Q 4LCHA 5JEAE 4YHHE 5K36A 2ZM6I 4DR5I 2VQFE 4DR1E 1UDOA 4HYMA 1N34I 4NXME 5DNXA 2GO3A 2O3ZA 4DR7I 1Z0TA 1A6FA 2JEAB 3JAMQ 4DR5E 2HK2A 1N32I 1EI1A 4JI5I 5IT9C 4M1KA 4JYAE 4B3ME 4OX9E 2HKJA 3CWVA 5C0XF 4NXNI 2R3VA 1NHIA 5C0XA 2BM0A 2UU9I 1ZXNA 1E3PA 3D4JA 3PYGA 3QT5A 1BKNA 1UEKA 5DNLA 1HNZE 4JI1E 5IWAE 4IZJD 4R1FA 5FLXQ 4X66E 4LF5I 1Z0WA 3K85A 4LCFA 1ZM4A 4GQUA 2F4VI 1K47A 1USUA 3B8HA 2C39A 3CDJA 1Y4UA 5C0XE 5BR8I 4JI4E 1H74A 3HKMA 4DV3E 1FNMA 4LF7I 4X65E 1DARA 4FWGA 2CZ9A 1Z0GA 3HJCA 2Z5BB 2NN6F 2GS8A 1XMOI 4JV5I 1N33E 4JI3I 2V34A 2XEXA 4LF7E 4JYAI 4AQYI 2JEAA 4LFAE 1I94E 1B62A 4QNKA 4DV7E 4DUYE 2UXCE 2HK3A 4JV5E 1N33I 3P3CA 5JEAB 2O1VA 1N0UA 3HULA 4JI6E 1I94I 3T1HI 1ZM9A 4LCGA 4DV5I 1VI7A 4LFBI 2IOQA 2F4VE 3WU3A 1UDSA 2UXDE 4FW7A 4JI6I 4LF4I 4MU3A 4FWHA 5ELWA 3T1HE 3WU4A 2NN6B 2PNZA 1H7UA 1OYPA 2ZM6E 4DR1I 1EA6A 2F1DA 4X65I 4MYUA 4DR6E 4B3RE 4DV3I 3PYFA 3GCMA 1HNXI 1IBMI 1H73A 4J3DA 4GKJI 4OO1F 4OO1A 2AJ4A 3PS3A 3P76A 4Z7CA 3M6AA 3J80C 1XNQI 3Q6MA 2BM1A 1PVGA 2PNZB 4DV0I 1KTVA 4AIMA 1IBKI 4LPFA 1NZ0A 2JE6A 5LL6R 1U2RA 4OO1E 5GMEA 1IBLI 1R6MA 4MU4A 4DV1I 4OO1B 1N32E 4BA1B 4MU0A 4PRXA 1Y60A 2WP8B 4JI2E 3KRNA 1Z59A 4HXZA 2PO0A 4JI8E 4NBQA 1FJGE 4IFDD 1UDNA 3J7AG 3L7ZB 3H1CA 2CG9A 2WNRA 1R6LA 2JEBA 4HACA 5C0XD 3ZM7A 2LJPA 4QNJA 1YHCA 1XMQE 1XHKA 1XMOE 4FW5A 4LF6I 2UXBI 4ZVIA 4JI1I 3ZZ0A 1HNZI 4DV2E 4K0KE 5K36B 3M7ND 4DUYI
chains in the Genus database with same CATH topology
1Y6ZA 2A2DA 2ZBKB 4DUZE 4JG4A 2V2VA 4DPYA 1N34E 1NHHA 2J7KA 2O1TA 4YHHI 2HKEA 4DR7E 3LTOA 2EFGA 4P52A 1PIEA 2UUAI 1Z5CA 3QT8A 3V5RA 4UTGA 4JI3E 2UUBE 4DPWA 1HK7A 4KQVA 2R42A 5FWKA 2DEIA 2UUAE 4B3MI 4GKKI 5A2QC 1HNWE 4DV2I 3GONA 1J5EI 3J80Q 1S4EA 3LNUA 4WUCA 2ZITA 4DV5E 4DU7A 4IZJB 4DR3E 4URLA 2UXDI 2Z5CA 1KVKA 3P06A 1HR0I 4YY3E 4PRVA 2O1WA 4DR3I 4IZKB 4DUZI 1RREA 2PNMA 3B82A 4X64E 1ELOA 3H4LA 2VF3A 2BV3A 2Z5BA 1RR9A 4JI4I 2UUCE 4DR4E 4X62I 2VQEE 4P7AA 1FWKA 2Z5CB 4JI8I 4LF9I 2HFSA 1N0VC 4MYTA 4N3OA 1J5EE 4X62E 2VQEI 4B3SI 4DV0E 3PYEA 1NHJA 3QT6A 4DV7I 4LF8E 1Z0CA 1Z0VA 2E5LE 5A2QQ 4LF5E 1XNRI 1IBLE 2WW4A 3B78A 4NXMI 4B3TE 4IZJA 1XNRE 2DEJA 3Q1QA 3F0NA 1Y4SA 5L3JA 4DU8A 4FWDA 2IOPA 2Q2EB 4FW9A 3J7AM 1Z5AA 1HNXE 4DPTA 1H72C 1H7SA 4B3RI 4JI5E 1XMQI 5FLXC 4WUBA 4DR2I 2Z5EA 4DPXA 1N36I 1Z0EA 4DPUA 2HHHI 5LMUE 4JI0I 2HFUA 4DV4E 4NXNE 1KKHA 1MX0A 1VISA 4LF8I 3ZKBA 2PNLA 2GQ0A 2NPFA 1QZRA 5LMUI 4ED4A 1Z0BA 4PU9A 5GMDA 4B3TI 4FN5A 1FKAE 4DV6E 4YY3I 2V8PA 5BR8E 4DXLA 4DV1E 4USKA 1FWLA 1D6TA 4JI7I 4DR2E 1WUUA 2CGEA 3T1YI 1HNWI 4DR4I 1XNQE 4DR6I 4JI0E 3ZKDA 4Z7YA 4JI7E 3ZZUA 2HHHE 3ZZTA 1IBME 2X7IA 4DV4I 2UXCI 4KHPE 3K1JA 3K17A 2VQFI 2UU9E 1PKPA 2E1RA 3J81C 3WU5A 4DV6I 4XTJA 3JAMC 1MU5A 2X36A 1MG7A 3V2UC 2O1UA 4WUDA 1ZM2A 3T1YE 4LF6E 4GKJE 4JI2I 2UUBI 4LFCI 2V2ZA 4I3HA 4K0KI 1FJGI 3PRYA 2OI2A 4HY1A 1OJ4A 5LMNI 2A2CA 1B63A 1IBKE 5IWAI 3PYDA 2V2QA 5LMNE 1HR0E 4IZKA 1USVA 4EMDA 1Z5BA 4X64I 3LPSA 2UUCI 4RPFA 1N36E 4GKKE 3WU6A 4AQYE 4UT4A 4LFAI 4LF9E 3J81Q 3Q6NA 4LFCE 3QT7A 1ZM3A 1ZXMA 1S16A 4USMA 2UXBE 3OTOI 4B3SE 4OX9I 1FI4A 4HACB 2E5LI 4LFBE 3OTOE 1KIJA 4LF4E 4KHPI 4X66I 5IT9Q 4YHHE 2ZM6I 4DR5I 2VQFE 4DR1E 4NXME 4HYMA 1N34I 4DR7I 1Z0TA 1A6FA 3JAMQ 4DR5E 2HK2A 1N32I 1EI1A 4JI5I 5IT9C 4M1KA 4JYAE 4B3ME 4OX9E 2HKJA 3CWVA 4NXNI 2R3VA 1NHIA 2BM0A 2UU9I 1ZXNA 3D4JA 3PYGA 3QT5A 1BKNA 1UEKA 4JI1E 1HNZE 5IWAE 4IZJD 4R1FA 5FLXQ 4X66E 4LF5I 1Z0WA 3K85A 1ZM4A 2F4VI 1K47A 1USUA 3B8HA 1Y4UA 5BR8I 4JI4E 1H74A 4DV3E 1FNMA 4LF7I 4X65E 1DARA 4FWGA 2CZ9A 1Z0GA 3HJCA 2Z5BB 2GS8A 1XMOI 4JV5I 1N33E 4JI3I 2V34A 2XEXA 4LF7E 4JYAI 4AQYI 4LFAE 1I94E 1B62A 4DV7E 4DUYE 2UXCE 2HK3A 4JV5E 1N33I 2O1VA 1N0UA 3HULA 4JI6E 1I94I 3T1HI 1ZM9A 4DV5I 4LFBI 2IOQA 2F4VE 3WU3A 2UXDE 4JI6I 4LF4I 4FWHA 3T1HE 3WU4A 1H7UA 2ZM6E 4DR1I 1EA6A 4X65I 4MYUA 4DR6E 4B3RE 4DV3I 3PYFA 1HNXI 1IBMI 1H73A 4GKJI 2AJ4A 4Z7CA 3M6AA 3J80C 1XNQI 3Q6MA 2BM1A 1PVGA 4DV0I 1KTVA 1IBKI 1NZ0A 5LL6R 1U2RA 5GMEA 1IBLI 4DV1I 1N32E 4PRXA 4JI2E 1Z59A 4HXZA 4JI8E 1FJGE 3J7AG 2CG9A 4HACA 3ZM7A 2LJPA 1XMQE 1XHKA 1XMOE 4LF6I 2UXBI 4ZVIA 4JI1I 3ZZ0A 1HNZI 4DV2E 4K0KE 4DUYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2D A;  2ZBK B;  4DUZ E;  4JG4 A;  2V2V A;  4DPY A;  1N34 E;  1NHH A;  2J7K A;  4YHH I;  2HKE A;  4DR7 E;  3LTO A;  2EFG A;  4P52 A;  1PIE A;  2UUA I;  1Z5C A;  3QT8 A;  3V5R A;  4UTG A;  4JI3 E;  2UUB E;  4DPW A;  4KQV A;  2R42 A;  2UUA E;  2DEI A;  4B3M I;  4GKK I;  5A2Q C;  1HNW E;  4DV2 I;  3GON A;  1J5E I;  3J80 Q;  1S4E A;  3LNU A;  4WUC A;  2ZIT A;  4DV5 E;  4DU7 A;  4DR3 E;  4URL A;  2UXD I;  1KVK A;  1HR0 I;  4YY3 E;  4PRV A;  4DR3 I;  4DUZ I;  1RRE A;  3B82 A;  4X64 E;  1ELO A;  3H4L A;  2VF3 A;  2BV3 A;  1RR9 A;  4JI4 I;  2UUC E;  4DR4 E;  4X62 I;  2VQE E;  4P7A A;  1FWK A;  4JI8 I;  4LF9 I;  2HFS A;  1N0V C;  4MYT A;  1J5E E;  4X62 E;  2VQE I;  4B3S I;  4DV0 E;  3PYE A;  1NHJ A;  3QT6 A;  4DV7 I;  4LF8 E;  1Z0C A;  1Z0V A;  2E5L E;  5A2Q Q;  4LF5 E;  1XNR I;  1IBL E;  2WW4 A;  3B78 A;  4NXM I;  4B3T E;  1XNR E;  2DEJ A;  3Q1Q A;  3F0N A;  5L3J A;  4DU8 A;  4FWD A;  2Q2E B;  4FW9 A;  3J7A M;  1Z5A A;  1HNX E;  4DPT A;  1H72 C;  1H7S A;  4B3R I;  4JI5 E;  1XMQ I;  5FLX C;  4WUB A;  4DR2 I;  4DPX A;  1N36 I;  1Z0E A;  4DPU A;  2HHH I;  5LMU E;  4JI0 I;  2HFU A;  4DV4 E;  4NXN E;  1KKH A;  1MX0 A;  1VIS A;  4LF8 I;  3ZKB A;  2NPF A;  1QZR A;  5LMU I;  4ED4 A;  1Z0B A;  4PU9 A;  5GMD A;  4B3T I;  4FN5 A;  1FKA E;  4DV6 E;  4YY3 I;  2V8P A;  5BR8 E;  4DXL A;  4DV1 E;  4USK A;  1FWL A;  1D6T A;  4JI7 I;  4DR2 E;  1WUU A;  3T1Y I;  1HNW I;  4DR4 I;  1XNQ E;  4DR6 I;  4JI0 E;  3ZKD A;  4Z7Y A;  4JI7 E;  3ZZU A;  2HHH E;  3ZZT A;  1IBM E;  2X7I A;  4DV4 I;  2UXC I;  4KHP E;  3K1J A;  3K17 A;  2VQF I;  2UU9 E;  1PKP A;  2E1R A;  3J81 C;  3WU5 A;  4DV6 I;  4XTJ A;  3JAM C;  1MU5 A;  2X36 A;  1MG7 A;  3V2U C;  4WUD A;  1ZM2 A;  3T1Y E;  4LF6 E;  4GKJ E;  4JI2 I;  2UUB I;  4LFC I;  2V2Z A;  4I3H A;  4K0K I;  1FJG I;  2OI2 A;  4HY1 A;  1OJ4 A;  5LMN I;  2A2C A;  1B63 A;  1IBK E;  5IWA I;  3PYD A;  2V2Q A;  5LMN E;  1HR0 E;  4EMD A;  1Z5B A;  4X64 I;  3LPS A;  2UUC I;  4RPF A;  1N36 E;  4GKK E;  3WU6 A;  4AQY E;  4UT4 A;  4LFA I;  4LF9 E;  3J81 Q;  4LFC E;  3QT7 A;  1ZM3 A;  1ZXM A;  1S16 A;  4USM A;  2UXB E;  3OTO I;  4B3S E;  4OX9 I;  1FI4 A;  4HAC B;  2E5L I;  4LFB E;  3OTO E;  1KIJ A;  4LF4 E;  4KHP I;  4X66 I;  5IT9 Q;  4YHH E;  2ZM6 I;  4DR5 I;  2VQF E;  4DR1 E;  4NXM E;  4HYM A;  1N34 I;  4DR7 I;  1Z0T A;  1A6F A;  3JAM Q;  4DR5 E;  2HK2 A;  1N32 I;  1EI1 A;  4JI5 I;  5IT9 C;  4M1K A;  4JYA E;  4B3M E;  4OX9 E;  2HKJ A;  3CWV A;  4NXN I;  2R3V A;  1NHI A;  2BM0 A;  2UU9 I;  1ZXN A;  3D4J A;  3PYG A;  3QT5 A;  1BKN A;  1UEK A;  4JI1 E;  1HNZ E;  5IWA E;  4R1F A;  5FLX Q;  4X66 E;  4LF5 I;  1Z0W A;  1ZM4 A;  2F4V I;  1K47 A;  3B8H A;  5BR8 I;  4JI4 E;  1H74 A;  4DV3 E;  1FNM A;  4LF7 I;  4X65 E;  1DAR A;  4FWG A;  2CZ9 A;  1Z0G A;  2GS8 A;  1XMO I;  4JV5 I;  1N33 E;  4JI3 I;  2V34 A;  2XEX A;  4LF7 E;  4JYA I;  4AQY I;  4LFA E;  1I94 E;  1B62 A;  4DV7 E;  4DUY E;  2UXC E;  2HK3 A;  4JV5 E;  1N33 I;  1N0U A;  3HUL A;  4JI6 E;  1I94 I;  3T1H I;  1ZM9 A;  4DV5 I;  4LFB I;  2F4V E;  3WU3 A;  2UXD E;  4JI6 I;  4LF4 I;  4FWH A;  3T1H E;  3WU4 A;  1H7U A;  2ZM6 E;  4DR1 I;  1EA6 A;  4X65 I;  4MYU A;  4DR6 E;  4B3R E;  4DV3 I;  3PYF A;  1HNX I;  1IBM I;  1H73 A;  4GKJ I;  2AJ4 A;  4Z7C A;  3M6A A;  3J80 C;  1XNQ I;  2BM1 A;  1PVG A;  4DV0 I;  1KTV A;  1IBK I;  1NZ0 A;  5LL6 R;  1U2R A;  5GME A;  1IBL I;  4DV1 I;  1N32 E;  4PRX A;  4JI2 E;  1Z59 A;  4HXZ A;  4JI8 E;  1FJG E;  3J7A G;  4HAC A;  3ZM7 A;  2LJP A;  1XMQ E;  1XHK A;  1XMO E;  4LF6 I;  2UXB I;  4ZVI A;  4JI1 I;  3ZZ0 A;  1HNZ I;  4DV2 E;  4K0K E;  4DUY I; 
#chains in the Genus database with same CATH topology
 1Y6Z A;  2A2D A;  4FW3 A;  2ZBK B;  5K36 C;  4DUZ E;  4JG4 A;  2V2V A;  4DPY A;  1N34 E;  1NHH A;  2J7K A;  2O1T A;  5C0X C;  4YHH I;  2HKE A;  5JEA F;  4DR7 E;  3LTO A;  2EFG A;  4P52 A;  1PIE A;  2UUA I;  1Z5C A;  3QT8 A;  3V5R A;  4UTG A;  3M85 G;  4JI3 E;  5DRR A;  2UUB E;  4DPW A;  1HK7 A;  4KQV A;  3PS1 A;  2R42 A;  5FWK A;  2DEI A;  2UUA E;  2BA1 D;  4B3M I;  2VES A;  4GKK I;  5A2Q C;  1HNW E;  4DV2 I;  3GON A;  4IFD B;  1J5E I;  3J80 Q;  1S4E A;  4OO1 C;  3LNU A;  4WUC A;  2ZIT A;  4DV5 E;  4DU7 A;  1YH8 A;  4IZJ B;  4IFD E;  4DR3 E;  4URL A;  3M7N G;  2UXD I;  2Z5C A;  1KVK A;  3P06 A;  2GO4 A;  1HR0 I;  2J65 A;  4YY3 E;  2PO2 B;  4PRV A;  2O1W A;  4DR3 I;  4IZK B;  4DUZ I;  1RRE A;  2PNM A;  3B82 A;  5K36 D;  4X64 E;  1ELO A;  3H4L A;  2JEB B;  3P3G A;  2VF3 A;  2BV3 A;  2Z5B A;  1RR9 A;  3NZK A;  4IFD A;  1E3H A;  4JI4 I;  2UUC E;  4OZE A;  4DR4 E;  4X62 I;  2VQE E;  4P7A A;  1FWK A;  2Z5C B;  4JI8 I;  4LF9 I;  2HFS A;  1N0V C;  4MYT A;  2BA1 G;  4N3O A;  1J5E E;  4X62 E;  2VQE I;  3B4T A;  1Y5Y A;  4B3S I;  4DV0 E;  3PYE A;  1NHJ A;  3QT6 A;  4DV7 I;  4LF8 E;  1Z0C A;  1Z0V A;  2E5L E;  5A2Q Q;  4LF5 E;  1XNR I;  2BR2 A;  1IBL E;  4MQY A;  2JT2 A;  2NN6 A;  2WW4 A;  3B78 A;  4NXM I;  4B3T E;  4IZJ A;  1UDQ A;  5JEA C;  2DEJ A;  1XNR E;  2PO1 B;  3Q1Q A;  3F0N A;  1Y4S A;  5L3J A;  4DU8 A;  4AM3 A;  4FWD A;  2IOP A;  2Q2E B;  4IFD C;  4FW9 A;  3J7A M;  2C38 B;  1Z5A A;  1HNX E;  4DPT A;  1H72 C;  1H7S A;  4BA2 B;  4B3R I;  3U1K A;  4JI5 E;  1XMQ I;  5FLX C;  4WUB A;  4ISA A;  4MU1 A;  4DR2 I;  2Z5E A;  4DPX A;  1XXE A;  1N36 I;  1Z0E A;  5EKW A;  4DPU A;  2HHH I;  5LMU E;  4JI0 I;  2HFU A;  4OO1 D;  4IS9 A;  4DV4 E;  4NXN E;  1KKH A;  4MDT A;  1MX0 A;  1VIS A;  4LF8 I;  3ZKB A;  5C0X B;  4LOM A;  2PNL A;  2GQ0 A;  2NPF A;  2PO0 B;  1QZR A;  5LMU I;  4ED4 A;  1Z0B A;  4PU9 A;  5GMD A;  4BA1 A;  2C37 B;  4B3T I;  5EL9 A;  4FN5 A;  4OKG A;  4U3B A;  1FKA E;  4DV6 E;  4YY3 I;  2V8P A;  5BR8 E;  4AID A;  4DXL A;  3M85 D;  1P42 A;  4DV1 E;  4USK A;  1FWL A;  1D6T A;  4JI7 I;  2PO1 A;  4DR2 E;  1WUU A;  2CGE A;  3T1Y I;  1HNW I;  2CVE A;  4DR4 I;  1XNQ E;  2BR2 B;  4DR6 I;  4JI0 E;  4FW4 A;  3ZKD A;  4Z7Y A;  4JI7 E;  2C38 A;  3L7Z A;  3ZZU A;  2HHH E;  3ZZT A;  1IBM E;  2X7I A;  4DV4 I;  2UXC I;  2NN6 E;  1RHY A;  3P3E A;  4KHP E;  3K1J A;  1OYS A;  3UHM A;  3K17 A;  2VQF I;  2UU9 E;  1PKP A;  2E1R A;  3J81 C;  4FW6 A;  4U3D A;  3WU5 A;  4DV6 I;  4XTJ A;  4BA2 A;  3JAM C;  1MU5 A;  2X36 A;  1MG7 A;  3V2U C;  2O1U A;  5JEA A;  5K36 E;  4WUD A;  3GME A;  1ZM2 A;  3T1Y E;  4LF6 E;  4GKJ E;  4JI2 I;  2UUB I;  4LFC I;  2V2Z A;  4I3H A;  2BA0 D;  4K0K I;  1FJG I;  3PRY A;  2OI2 A;  2NN6 D;  4HY1 A;  4IFD F;  1OJ4 A;  5LMN I;  2A2C A;  1B63 A;  2JE6 B;  1OYR A;  1IBK E;  5IWA I;  2NN6 C;  2PO2 A;  3PYD A;  3U1Y A;  2V2Q A;  2C37 A;  5LMN E;  5DRQ A;  1HR0 E;  2AE8 A;  4IZK A;  3CDI A;  1USV A;  4EMD A;  2IES A;  1Z5B A;  3DD6 A;  2IER A;  4X64 I;  3LPS A;  2UUC I;  2WP8 A;  4RPF A;  3PS2 A;  1N36 E;  4GKK E;  3WU6 A;  4AQY E;  4UT4 A;  4LFA I;  4LF9 E;  5JEA D;  2C39 B;  3J81 Q;  3Q6N A;  4LFC E;  2BA0 G;  3QT7 A;  1ZM3 A;  1ZXM A;  1S16 A;  4USM A;  2UXB E;  3OTO I;  4B3S E;  5DRO A;  4OX9 I;  5DRP A;  1FI4 A;  2WNR B;  4HAC B;  2E5L I;  4LFB E;  3OTO E;  5K36 F;  1KIJ A;  3GLL A;  4LF4 E;  4KHP I;  4X66 I;  5IT9 Q;  4LCH A;  5JEA E;  4YHH E;  5K36 A;  2ZM6 I;  4DR5 I;  2VQF E;  4DR1 E;  1UDO A;  4HYM A;  1N34 I;  4NXM E;  5DNX A;  2GO3 A;  2O3Z A;  4DR7 I;  1Z0T A;  1A6F A;  2JEA B;  3JAM Q;  4DR5 E;  2HK2 A;  1N32 I;  1EI1 A;  4JI5 I;  5IT9 C;  4M1K A;  4JYA E;  4B3M E;  4OX9 E;  2HKJ A;  3CWV A;  5C0X F;  4NXN I;  2R3V A;  1NHI A;  5C0X A;  2BM0 A;  2UU9 I;  1ZXN A;  1E3P A;  3D4J A;  3PYG A;  3QT5 A;  1BKN A;  1UEK A;  5DNL A;  1HNZ E;  4JI1 E;  5IWA E;  4IZJ D;  4R1F A;  5FLX Q;  4X66 E;  4LF5 I;  1Z0W A;  3K85 A;  4LCF A;  1ZM4 A;  4GQU A;  2F4V I;  1K47 A;  1USU A;  3B8H A;  2C39 A;  3CDJ A;  1Y4U A;  5C0X E;  5BR8 I;  4JI4 E;  1H74 A;  3HKM A;  4DV3 E;  1FNM A;  4LF7 I;  4X65 E;  1DAR A;  4FWG A;  2CZ9 A;  1Z0G A;  3HJC A;  2Z5B B;  2NN6 F;  2GS8 A;  1XMO I;  4JV5 I;  1N33 E;  4JI3 I;  2V34 A;  2XEX A;  4LF7 E;  4JYA I;  4AQY I;  2JEA A;  4LFA E;  1I94 E;  1B62 A;  4QNK A;  4DV7 E;  4DUY E;  2UXC E;  2HK3 A;  4JV5 E;  1N33 I;  3P3C A;  5JEA B;  2O1V A;  1N0U A;  3HUL A;  4JI6 E;  1I94 I;  3T1H I;  1ZM9 A;  4LCG A;  4DV5 I;  1VI7 A;  4LFB I;  2IOQ A;  2F4V E;  3WU3 A;  1UDS A;  2UXD E;  4FW7 A;  4JI6 I;  4LF4 I;  4MU3 A;  4FWH A;  5ELW A;  3T1H E;  3WU4 A;  2NN6 B;  2PNZ A;  1H7U A;  1OYP A;  2ZM6 E;  4DR1 I;  1EA6 A;  2F1D A;  4X65 I;  4MYU A;  4DR6 E;  4B3R E;  4DV3 I;  3PYF A;  3GCM A;  1HNX I;  1IBM I;  1H73 A;  4J3D A;  4GKJ I;  4OO1 F;  4OO1 A;  2AJ4 A;  3PS3 A;  3P76 A;  4Z7C A;  3M6A A;  3J80 C;  1XNQ I;  3Q6M A;  2BM1 A;  1PVG A;  2PNZ B;  4DV0 I;  1KTV A;  4AIM A;  1IBK I;  4LPF A;  1NZ0 A;  2JE6 A;  5LL6 R;  1U2R A;  4OO1 E;  5GME A;  1IBL I;  1R6M A;  4MU4 A;  4DV1 I;  4OO1 B;  1N32 E;  4BA1 B;  4MU0 A;  4PRX A;  1Y60 A;  2WP8 B;  4JI2 E;  3KRN A;  1Z59 A;  4HXZ A;  2PO0 A;  4JI8 E;  4NBQ A;  1FJG E;  4IFD D;  1UDN A;  3J7A G;  3L7Z B;  3H1C A;  2CG9 A;  2WNR A;  1R6L A;  2JEB A;  4HAC A;  5C0X D;  3ZM7 A;  2LJP A;  4QNJ A;  1YHC A;  1XMQ E;  1XHK A;  1XMO E;  4FW5 A;  4LF6 I;  2UXB I;  4ZVI A;  4JI1 I;  3ZZ0 A;  1HNZ I;  4DV2 E;  4K0K E;  5K36 B;  3M7N D;  4DUY I; 
#chains in the Genus database with same CATH homology
 1Y6Z A;  2A2D A;  2ZBK B;  4DUZ E;  4JG4 A;  2V2V A;  4DPY A;  1N34 E;  1NHH A;  2J7K A;  2O1T A;  4YHH I;  2HKE A;  4DR7 E;  3LTO A;  2EFG A;  4P52 A;  1PIE A;  2UUA I;  1Z5C A;  3QT8 A;  3V5R A;  4UTG A;  4JI3 E;  2UUB E;  4DPW A;  1HK7 A;  4KQV A;  2R42 A;  5FWK A;  2DEI A;  2UUA E;  4B3M I;  4GKK I;  5A2Q C;  1HNW E;  4DV2 I;  3GON A;  1J5E I;  3J80 Q;  1S4E A;  3LNU A;  4WUC A;  2ZIT A;  4DV5 E;  4DU7 A;  4IZJ B;  4DR3 E;  4URL A;  2UXD I;  2Z5C A;  1KVK A;  3P06 A;  1HR0 I;  4YY3 E;  4PRV A;  2O1W A;  4DR3 I;  4IZK B;  4DUZ I;  1RRE A;  2PNM A;  3B82 A;  4X64 E;  1ELO A;  3H4L A;  2VF3 A;  2BV3 A;  2Z5B A;  1RR9 A;  4JI4 I;  2UUC E;  4DR4 E;  4X62 I;  2VQE E;  4P7A A;  1FWK A;  2Z5C B;  4JI8 I;  4LF9 I;  2HFS A;  1N0V C;  4MYT A;  4N3O A;  1J5E E;  4X62 E;  2VQE I;  4B3S I;  4DV0 E;  3PYE A;  1NHJ A;  3QT6 A;  4DV7 I;  4LF8 E;  1Z0C A;  1Z0V A;  2E5L E;  5A2Q Q;  4LF5 E;  1XNR I;  1IBL E;  2WW4 A;  3B78 A;  4NXM I;  4B3T E;  4IZJ A;  1XNR E;  2DEJ A;  3Q1Q A;  3F0N A;  1Y4S A;  5L3J A;  4DU8 A;  4FWD A;  2IOP A;  2Q2E B;  4FW9 A;  3J7A M;  1Z5A A;  1HNX E;  4DPT A;  1H72 C;  1H7S A;  4B3R I;  4JI5 E;  1XMQ I;  5FLX C;  4WUB A;  4DR2 I;  2Z5E A;  4DPX A;  1N36 I;  1Z0E A;  4DPU A;  2HHH I;  5LMU E;  4JI0 I;  2HFU A;  4DV4 E;  4NXN E;  1KKH A;  1MX0 A;  1VIS A;  4LF8 I;  3ZKB A;  2PNL A;  2GQ0 A;  2NPF A;  1QZR A;  5LMU I;  4ED4 A;  1Z0B A;  4PU9 A;  5GMD A;  4B3T I;  4FN5 A;  1FKA E;  4DV6 E;  4YY3 I;  2V8P A;  5BR8 E;  4DXL A;  4DV1 E;  4USK A;  1FWL A;  1D6T A;  4JI7 I;  4DR2 E;  1WUU A;  2CGE A;  3T1Y I;  1HNW I;  4DR4 I;  1XNQ E;  4DR6 I;  4JI0 E;  3ZKD A;  4Z7Y A;  4JI7 E;  3ZZU A;  2HHH E;  3ZZT A;  1IBM E;  2X7I A;  4DV4 I;  2UXC I;  4KHP E;  3K1J A;  3K17 A;  2VQF I;  2UU9 E;  1PKP A;  2E1R A;  3J81 C;  3WU5 A;  4DV6 I;  4XTJ A;  3JAM C;  1MU5 A;  2X36 A;  1MG7 A;  3V2U C;  2O1U A;  4WUD A;  1ZM2 A;  3T1Y E;  4LF6 E;  4GKJ E;  4JI2 I;  2UUB I;  4LFC I;  2V2Z A;  4I3H A;  4K0K I;  1FJG I;  3PRY A;  2OI2 A;  4HY1 A;  1OJ4 A;  5LMN I;  2A2C A;  1B63 A;  1IBK E;  5IWA I;  3PYD A;  2V2Q A;  5LMN E;  1HR0 E;  4IZK A;  1USV A;  4EMD A;  1Z5B A;  4X64 I;  3LPS A;  2UUC I;  4RPF A;  1N36 E;  4GKK E;  3WU6 A;  4AQY E;  4UT4 A;  4LFA I;  4LF9 E;  3J81 Q;  3Q6N A;  4LFC E;  3QT7 A;  1ZM3 A;  1ZXM A;  1S16 A;  4USM A;  2UXB E;  3OTO I;  4B3S E;  4OX9 I;  1FI4 A;  4HAC B;  2E5L I;  4LFB E;  3OTO E;  1KIJ A;  4LF4 E;  4KHP I;  4X66 I;  5IT9 Q;  4YHH E;  2ZM6 I;  4DR5 I;  2VQF E;  4DR1 E;  4NXM E;  4HYM A;  1N34 I;  4DR7 I;  1Z0T A;  1A6F A;  3JAM Q;  4DR5 E;  2HK2 A;  1N32 I;  1EI1 A;  4JI5 I;  5IT9 C;  4M1K A;  4JYA E;  4B3M E;  4OX9 E;  2HKJ A;  3CWV A;  4NXN I;  2R3V A;  1NHI A;  2BM0 A;  2UU9 I;  1ZXN A;  3D4J A;  3PYG A;  3QT5 A;  1BKN A;  1UEK A;  4JI1 E;  1HNZ E;  5IWA E;  4IZJ D;  4R1F A;  5FLX Q;  4X66 E;  4LF5 I;  1Z0W A;  3K85 A;  1ZM4 A;  2F4V I;  1K47 A;  1USU A;  3B8H A;  1Y4U A;  5BR8 I;  4JI4 E;  1H74 A;  4DV3 E;  1FNM A;  4LF7 I;  4X65 E;  1DAR A;  4FWG A;  2CZ9 A;  1Z0G A;  3HJC A;  2Z5B B;  2GS8 A;  1XMO I;  4JV5 I;  1N33 E;  4JI3 I;  2V34 A;  2XEX A;  4LF7 E;  4JYA I;  4AQY I;  4LFA E;  1I94 E;  1B62 A;  4DV7 E;  4DUY E;  2UXC E;  2HK3 A;  4JV5 E;  1N33 I;  2O1V A;  1N0U A;  3HUL A;  4JI6 E;  1I94 I;  3T1H I;  1ZM9 A;  4DV5 I;  4LFB I;  2IOQ A;  2F4V E;  3WU3 A;  2UXD E;  4JI6 I;  4LF4 I;  4FWH A;  3T1H E;  3WU4 A;  1H7U A;  2ZM6 E;  4DR1 I;  1EA6 A;  4X65 I;  4MYU A;  4DR6 E;  4B3R E;  4DV3 I;  3PYF A;  1HNX I;  1IBM I;  1H73 A;  4GKJ I;  2AJ4 A;  4Z7C A;  3M6A A;  3J80 C;  1XNQ I;  3Q6M A;  2BM1 A;  1PVG A;  4DV0 I;  1KTV A;  1IBK I;  1NZ0 A;  5LL6 R;  1U2R A;  5GME A;  1IBL I;  4DV1 I;  1N32 E;  4PRX A;  4JI2 E;  1Z59 A;  4HXZ A;  4JI8 E;  1FJG E;  3J7A G;  2CG9 A;  4HAC A;  3ZM7 A;  2LJP A;  1XMQ E;  1XHK A;  1XMO E;  4LF6 I;  2UXB I;  4ZVI A;  4JI1 I;  3ZZ0 A;  1HNZ I;  4DV2 E;  4K0K E;  4DUY I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...