1Z0BA

Crystal structure of a. fulgidus lon proteolytic domain e506a mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
203
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVAGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELELAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
molecule keywords Putative protease La homolog type
molecule tags Hydrolase
source organism Archaeoglobus fulgidus
total genus 60
structure length 203
sequence length 206
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0bA00
1FWKA 2UUAE 1FKAE 1BKNA 4MYUA 4DUYE 2X7IA 1KIJA 5FLXC 4DPYA 2EFGA 4R1FA 4JI2I 4AQYE 4X66I 1ELOA 2UUAI 1HNZE 4Z7CA 1N34I 4FWGA 5GMDA 4DU8A 3OTOI 4JV5E 3PYEA 1XNRE 3QT5A 1H74A 2F4VE 1N32I 4WUDA 4DV6E 2UU9E 4DUZE 4LF9I 1QZRA 1N33E 2ZBKB 5IT9C 2V2ZA 4DV4E 1MX0A 2AJ4A 1J5EE 1XNRI 1FJGI 1A6FA 2F4VI 4YY3I 4GKKI 4DV6I 4DUZI 1N36E 1ZM9A 2OI2A 4LFBE 1FNMA 4DXLA 3LTOA 4DV4I 4JI0I 4FN5A 1J5EI 1KVKA 4MYTA 3H4LA 1MU5A 2UXBI 4JI6I 4DV5E 3K17A 5LMUE 4LFBI 1IBKI 3JAMC 3J81C 1XHKA 3J80C 3T1HE 1NHJA 3QT8A 2HKEA 3T1YI 1Z0WA 2R3VA 4DR3I 4NXMI 4EMDA 3F0NA 5LMUI 1XMQE 4JI1I 4DU7A 1N0VC 4DPUA 2Q2EB 2VQFE 4DR7E 4B3TE 4X64I 4DV7E 4DR2E 4ZVIA 4DV0I 4PU9A 1PIEA 2V8PA 1I94I 2X36A 1XNQI 4X62E 1VISA 4FWHA 4DR5E 4FW9A 4UT4A 2UUBE 4DV7I 4DR2I 1IBLE 2DEJA 3J7AG 4YHHI 4KHPE 2HKJA 5A2QQ 4JG4A 4JI4E 2V34A 2HHHE 1N0UA 2UUBI 4KHPI 3J7AM 4X65E 4DUYI 1DARA 1Z0VA 3V2UC 4RPFA 5IWAE 4JI4I 4DV2E 3ZZUA 4P52A 1HNXE 4DR6E 4JI8E 4AQYI 4NXNE 1HNZI 4PRVA 2J7KA 1HR0E 1NZ0A 1ZXNA 1IBME 4JV5I 4K0KE 4HXZA 1KKHA 4HY1A 2UU9I 1S16A 4DR4E 2E1RA 1KTVA 4LF8E 2LJPA 1B63A 4B3ME 1N33I 2A2CA 3V5RA 1IBMI 1H7UA 1PKPA 3QT7A 4OX9E 4LF5E 3WU5A 2HFSA 2GS8A 3ZKBA 1N36I 4ED4A 5LMNE 1WUUA 3PYGA 4JI5E 4DR1E 2UUCE 4Z7YA 1UEKA 1EA6A 2HFUA 2HK3A 4PRXA 1FWLA 4JYAE 1EI1A 5A2QC 1XMOE 4JI7E 1Z0BA 1U2RA 4DV5I 4JI5I 4I3HA 1H73A 3ZZTA 3T1HI 4B3RE 4DV3E 1XMOI 4FWDA 1PVGA 1XMQI 3Q1QA 2V2QA 2VQFI 1ZM3A 4DR7I 2VQEE 3B8HA 4B3TI 1ZM4A 4UTGA 3WU4A 2UXDE 4B3SE 4GKJE 3CWVA 1RR9A 1Z5CA 4X62I 1ZM2A 2BM1A 4DR5I 2XEXA 3ZZ0A 3LNUA 1FI4A 2VQEI 4LFAE 2VF3A 1H7SA 1IBLI 1Z0TA 2UXDI 5LL6R 3GONA 4JI2E 4X66E 3M6AA 3WU6A 4B3SI 2V2VA 2BM0A 1N34E 4GKJI 3OTOE 4DV1E 2E5LE 4JI3E 2HHHI 1N32E 2CZ9A 4WUBA 4LFAI 4LF9E 1NHIA 3PYDA 3PYFA 1Z0EA 2ZM6E 2R42A 4X65I 3LPSA 3B78A 4DV1I 1FJGE 2E5LI 5IWAI 4YY3E 4GKKE 4JI3I 2DEIA 4DV2I 1HNXI 1Z0GA 4DR6I 1RREA 4JI8I 1K47A 4NXNI 4P7AA 2ZM6I 1HR0I 4K0KI 4JI0E 1B62A 4DR4I 4LF8I 4KQVA 2UXBE 4JI6E 4M1KA 4B3MI 4DPXA 1IBKE 5L3JA 4WUCA 5FLXQ 1Z5BA 4OX9I 4LF5I 1S4EA 3T1YE 2BV3A 4DR3E 5LMNI 5BR8E 4NXME 4DR1I 2UUCI 4USKA 1H72C 3B82A 1D6TA 3ZM7A 4LFCE 4LF6E 3HULA 4JI1E 4JYAI 1Z59A 2NPFA 4JI7I 4X64E 5BR8I 2WW4A 4HACB 4HACA 4DV0E 5IT9Q 3K1JA 3WU3A 4LF4E 1I94E 1Z5AA 3QT6A 3D4JA 1XNQE 1NHHA 1Z0CA 4DPTA 4LFCI 4B3RI 4LF6I 4LF7E 4DV3I 2ZITA 1HNWE 2HK2A 4DPWA 2UXCE 4HYMA 4YHHE 2A2DA 4LF4I 1MG7A 3ZKDA 4LF7I 4URLA 1HNWI 1ZXMA 4XTJA 4USMA 1OJ4A 3JAMQ 3J81Q 2UXCI 5GMEA 3J80Q
chains in the Genus database with same CATH superfamily
1FWKA 2UUAE 1FKAE 5C0XC 1BKNA 4MYUA 2C39B 4IFDE 3HKMA 4DUYE 2X7IA 3DD6A 4LCGA 1KIJA 5FLXC 4IFDA 4IFDB 4DPYA 2EFGA 2WNRB 2C38A 4R1FA 2CG9A 4JI2I 4AQYE 4X66I 1ELOA 4ISAA 2PO0B 1HNZE 2UUAI 4Z7CA 1N34I 4FWGA 5GMDA 4DU8A 3OTOI 4JV5E 3PYEA 5JEAD 1XXEA 1XNRE 4NBQA 3QT5A 1H74A 2F4VE 1N32I 4WUDA 4DV6E 2UU9E 4DUZE 4LF9I 3PS2A 1QZRA 1USUA 1N33E 2PO2A 4LOMA 5C0XF 2ZBKB 5IT9C 2BA0D 2V2ZA 4DV4E 1MX0A 4AIDA 2AJ4A 4MU3A 1J5EE 1XNRI 1FJGI 1A6FA 2F4VI 4YY3I 4GKKI 4DV6I 4DUZI 1N36E 1ZM9A 2OI2A 2PNZB 2PNZA 4LFBE 4AIMA 1FNMA 2F1DA 2BA0G 2BA1D 4OO1D 4DXLA 3LTOA 4DV4I 4JI0I 4FN5A 1J5EI 1KVKA 3Q6NA 4MYTA 3H4LA 1MU5A 2PO1B 2PO1A 2UXBI 4JI6I 4DV5E 2O1WA 2JE6A 5DNXA 3K17A 5JEAE 2JEAB 5LMUE 1Y5YA 4LFBI 2BA1G 1IBKI 3JAMC 3J81C 1XHKA 3J80C 5JEAB 3T1HE 1VI7A 1NHJA 2GO3A 3QT8A 2BR2A 2HKEA 3T1YI 1Z0WA 2R3VA 4DR3I 4N3OA 4NXMI 4LCHA 4EMDA 3F0NA 5K36A 5LMUI 1XMQE 5EKWA 1R6MA 4JI1I 4DU7A 1N0VC 2PNMA 4DPUA 2Q2EB 2VQFE 4DR7E 4B3TE 4X64I 4DV7E 4DR2E 4ZVIA 4DV0I 4PU9A 3GCMA 4AM3A 4OO1E 1PIEA 2V8PA 1I94I 2Z5CA 2IOQA 5ELWA 2X36A 1XNQI 3PRYA 4OO1B 4OO1A 3P3CA 4MDTA 1R6LA 4X62E 1VISA 4FWHA 4DR5E 4FW9A 4UT4A 2UUBE 4DV7I 4DR2I 1IBLE 2DEJA 4LCFA 3L7ZB 1Y6ZA 3J7AG 4YHHI 4MU0A 4KHPE 1E3PA 1Y60A 2HKJA 5A2QQ 3K85A 4FW5A 5JEAC 4JG4A 4JI4E 2V34A 2HHHE 1N0UA 1USVA 2UUBI 2CGEA 2C38B 4MQYA 4KHPI 3J7AM 2WP8A 4X65E 2Z5BB 2Z5BA 4DUYI 1DARA 1Z0VA 3U1KA 3V2UC 5DNLA 4RPFA 5IWAE 4JI4I 2IOPA 3NZKA 4GQUA 3M7ND 3KRNA 2NN6A 4P52A 3ZZUA 4DV2E 1HNXE 4FW7A 4DR6E 1HK7A 2O1UA 4JI8E 5K36D 4AQYI 2PO2B 4NXNE 1HNZI 1UDQA 4PRVA 2J7KA 1HR0E 1NZ0A 1ZXNA 3H1CA 5JEAF 5C0XD 1IBME 4JV5I 4K0KE 4HXZA 2J65A 4IZJA 1KKHA 4HY1A 3M7NG 1RHYA 2UU9I 1S16A 4DR4E 2E1RA 1KTVA 4LF8E 1E3HA 2LJPA 4FW6A 1B63A 4B3ME 1N33I 2A2CA 3GLLA 3V5RA 1IBMI 1H7UA 2O3ZA 1PKPA 3UHMA 5FWKA 3QT7A 4OX9E 4LF5E 2JEBB 2JEBA 2HFSA 3WU5A 2GS8A 3ZKBA 1N36I 4ED4A 4IFDC 5LMNE 1WUUA 2JE6B 3PYGA 4DR1E 4JI5E 1P42A 2UUCE 5DRPA 4Z7YA 1UEKA 2GQ0A 2O1VA 1EA6A 1Y4UA 2HFUA 4OZEA 2HK3A 4PRXA 1FWLA 2BR2B 4JYAE 1EI1A 5A2QC 5K36E 1XMOE 3B4TA 4JI7E 1Z0BA 1U2RA 3M85D 4DV5I 4JI5I 4I3HA 5C0XE 5K36B 4FW3A 1H73A 5C0XB 5C0XA 3ZZTA 3GMEA 2IESA 3T1HI 4B3RE 4DV3E 2VESA 1XMOI 4IFDF 3M85G 5DROA 2NN6D 3P06A 2O1TA 4FWDA 1PVGA 2Z5CB 1XMQI 1OYRA 4LPFA 3Q1QA 2JT2A 2V2QA 4IZJD 2VQFI 1ZM3A 4DR7I 2VQEE 3B8HA 4B3TI 1ZM4A 4UTGA 3WU4A 2UXDE 4B3SE 1OYPA 4GKJE 3CWVA 1RR9A 4MU4A 3U1YA 1Z5CA 4X62I 1ZM2A 2GO4A 2BM1A 4DR5I 2XEXA 3ZZ0A 3LNUA 1FI4A 2VQEI 4LFAE 1UDSA 2VF3A 1H7SA 1IBLI 1Z0TA 2UXDI 5LL6R 5K36C 3GONA 4JI2E 4IZKB 4IZKA 4X66E 3M6AA 3WU6A 4B3SI 2V2VA 4BA2B 2WP8B 2BM0A 1N34E 4BA2A 4GKJI 2NN6E 3OTOE 4QNJA 4DV1E 2C39A 1Y4SA 5DRRA 2CVEA 2E5LE 4JI3E 2HHHI 1N32E 2CZ9A 2NN6B 4WUBA 4LFAI 4LF9E 1YHCA 1YH8A 1NHIA 2WNRA 3PYDA 3PYFA 4OKGA 1Z0EA 2C37B 2C37A 2ZM6E 2PO0A 2R42A 4OO1C 4X65I 3LPSA 3B78A 4IZJB 4DV1I 2AE8A 1FJGE 5IWAI 2E5LI 4YY3E 4GKKE 4JI3I 2DEIA 4DV2I 1HNXI 1Z0GA 4DR6I 1RREA 5K36F 4JI8I 1K47A 4NXNI 4P7AA 3HJCA 2ZM6I 1HR0I 4K0KI 4JI0E 3PS1A 1B62A 4BA1B 4BA1A 4DR4I 4LF8I 4KQVA 2UXBE 4JI6E 4M1KA 4B3MI 1UDOA 4DPXA 1IBKE 4OO1F 3CDIA 5L3JA 4WUCA 1OYSA 3P3GA 4IS9A 5FLXQ 4FW4A 3P3EA 1Z5BA 4U3DA 5DRQA 4OX9I 4LF5I 1S4EA 3T1YE 2BV3A 4DR3E 4MU1A 2NN6C 5BR8E 5LMNI 4J3DA 4NXME 4DR1I 2UUCI 2JEAA 4USKA 1H72C 3B82A 3Q6MA 1D6TA 3ZM7A 4LFCE 4LF6E 3HULA 5JEAA 4JI1E 4JYAI 1Z59A 3P76A 3PS3A 2NPFA 4JI7I 4X64E 5BR8I 4IFDD 2WW4A 2IERA 4HACA 4HACB 4DV0E 5IT9Q 3K1JA 3WU3A 4LF4E 1I94E 1Z5AA 3QT6A 3D4JA 1XNQE 1NHHA 1Z0CA 4DPTA 4LFCI 4B3RI 4LF6I 4LF7E 4QNKA 4DV3I 2ZITA 1HNWE 2PNLA 2NN6F 2HK2A 4DPWA 2UXCE 4HYMA 3CDJA 4YHHE 2A2DA 4LF4I 4U3BA 2Z5EA 1MG7A 5EL9A 3ZKDA 4LF7I 4URLA 1HNWI 1ZXMA 1UDNA 4XTJA 4USMA 1OJ4A 3JAMQ 3J81Q 2UXCI 5GMEA 3J80Q 3L7ZA
chains in the Genus database with same CATH topology
1FWKA 2UUAE 1FKAE 1BKNA 4MYUA 4DUYE 2X7IA 1KIJA 5FLXC 4DPYA 2EFGA 4R1FA 2CG9A 4JI2I 4AQYE 4X66I 1ELOA 2UUAI 1HNZE 4Z7CA 1N34I 4FWGA 5GMDA 4DU8A 3OTOI 4JV5E 3PYEA 1XNRE 3QT5A 1H74A 2F4VE 1N32I 4WUDA 4DV6E 2UU9E 4DUZE 4LF9I 1QZRA 1USUA 1N33E 2ZBKB 5IT9C 2V2ZA 4DV4E 1MX0A 2AJ4A 1J5EE 1XNRI 1FJGI 1A6FA 2F4VI 4YY3I 4GKKI 4DV6I 4DUZI 1N36E 1ZM9A 2OI2A 4LFBE 1FNMA 4DXLA 3LTOA 4DV4I 4JI0I 4FN5A 1J5EI 1KVKA 3Q6NA 4MYTA 3H4LA 1MU5A 2UXBI 4JI6I 4DV5E 2O1WA 3K17A 5LMUE 4LFBI 1IBKI 3JAMC 3J81C 1XHKA 3J80C 3T1HE 1NHJA 3QT8A 2HKEA 3T1YI 1Z0WA 2R3VA 4DR3I 4N3OA 4NXMI 4EMDA 3F0NA 5LMUI 1XMQE 4JI1I 4DU7A 1N0VC 2PNMA 4DPUA 2Q2EB 2VQFE 4DR7E 4B3TE 4X64I 4DV7E 4DR2E 4ZVIA 4DV0I 4PU9A 1PIEA 2V8PA 1I94I 2Z5CA 2IOQA 2X36A 1XNQI 3PRYA 4X62E 1VISA 4FWHA 4DR5E 4FW9A 4UT4A 2UUBE 4DV7I 4DR2I 1IBLE 2DEJA 1Y6ZA 3J7AG 4YHHI 4KHPE 2HKJA 5A2QQ 3K85A 4JG4A 4JI4E 2V34A 2HHHE 1N0UA 1USVA 2UUBI 2CGEA 4KHPI 3J7AM 4X65E 2Z5BB 2Z5BA 4DUYI 1DARA 1Z0VA 3V2UC 4RPFA 5IWAE 4JI4I 2IOPA 4DV2E 3ZZUA 4P52A 1HNXE 4DR6E 1HK7A 2O1UA 4JI8E 4AQYI 4NXNE 1HNZI 4PRVA 2J7KA 1HR0E 1NZ0A 1ZXNA 1IBME 4JV5I 4K0KE 4HXZA 4IZJA 1KKHA 4HY1A 2UU9I 1S16A 4DR4E 2E1RA 1KTVA 4LF8E 2LJPA 1B63A 4B3ME 1N33I 2A2CA 3V5RA 1IBMI 1H7UA 1PKPA 5FWKA 3QT7A 4OX9E 4LF5E 3WU5A 2HFSA 2GS8A 3ZKBA 1N36I 4ED4A 5LMNE 1WUUA 3PYGA 4JI5E 4DR1E 2UUCE 4Z7YA 1UEKA 2GQ0A 2O1VA 1EA6A 1Y4UA 2HFUA 2HK3A 4PRXA 1FWLA 4JYAE 1EI1A 5A2QC 1XMOE 4JI7E 1Z0BA 1U2RA 4DV5I 4JI5I 4I3HA 1H73A 3ZZTA 3T1HI 4B3RE 4DV3E 1XMOI 3P06A 2O1TA 4FWDA 1PVGA 2Z5CB 1XMQI 3Q1QA 2V2QA 4IZJD 2VQFI 1ZM3A 4DR7I 2VQEE 3B8HA 4B3TI 1ZM4A 4UTGA 3WU4A 2UXDE 4B3SE 4GKJE 3CWVA 1RR9A 1Z5CA 4X62I 1ZM2A 2BM1A 4DR5I 2XEXA 3ZZ0A 3LNUA 1FI4A 2VQEI 4LFAE 2VF3A 1H7SA 1IBLI 1Z0TA 2UXDI 5LL6R 3GONA 4JI2E 4IZKB 4IZKA 4X66E 3M6AA 3WU6A 4B3SI 2V2VA 2BM0A 1N34E 4GKJI 3OTOE 4DV1E 1Y4SA 2E5LE 4JI3E 2HHHI 1N32E 2CZ9A 4WUBA 4LFAI 4LF9E 1NHIA 3PYDA 3PYFA 1Z0EA 2ZM6E 2R42A 4X65I 3LPSA 3B78A 4IZJB 4DV1I 1FJGE 5IWAI 2E5LI 4YY3E 4GKKE 4JI3I 2DEIA 4DV2I 1HNXI 1Z0GA 4DR6I 1RREA 4JI8I 1K47A 4NXNI 4P7AA 3HJCA 2ZM6I 1HR0I 4K0KI 4JI0E 1B62A 4DR4I 4LF8I 4KQVA 2UXBE 4JI6E 4M1KA 4B3MI 4DPXA 1IBKE 5L3JA 4WUCA 5FLXQ 1Z5BA 4OX9I 4LF5I 1S4EA 3T1YE 2BV3A 4DR3E 5LMNI 5BR8E 4NXME 4DR1I 2UUCI 4USKA 1H72C 3B82A 3Q6MA 1D6TA 3ZM7A 4LFCE 4LF6E 3HULA 4JI1E 4JYAI 1Z59A 2NPFA 4JI7I 4X64E 5BR8I 2WW4A 4HACB 4HACA 4DV0E 5IT9Q 3K1JA 3WU3A 4LF4E 1I94E 1Z5AA 3QT6A 3D4JA 1XNQE 1NHHA 1Z0CA 4DPTA 4LFCI 4B3RI 4LF6I 4LF7E 4DV3I 2ZITA 1HNWE 2PNLA 2HK2A 4DPWA 2UXCE 4HYMA 4YHHE 2A2DA 4LF4I 2Z5EA 1MG7A 3ZKDA 4LF7I 4URLA 1HNWI 1ZXMA 4XTJA 4USMA 1OJ4A 3JAMQ 3J81Q 2UXCI 5GMEA 3J80Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWK A;  2UUA E;  1FKA E;  1BKN A;  4MYU A;  4DUY E;  2X7I A;  1KIJ A;  5FLX C;  4DPY A;  2EFG A;  4R1F A;  4JI2 I;  4AQY E;  4X66 I;  1ELO A;  2UUA I;  1HNZ E;  4Z7C A;  1N34 I;  4FWG A;  5GMD A;  4DU8 A;  3OTO I;  4JV5 E;  3PYE A;  1XNR E;  3QT5 A;  1H74 A;  2F4V E;  1N32 I;  4WUD A;  4DV6 E;  2UU9 E;  4DUZ E;  4LF9 I;  1QZR A;  1N33 E;  2ZBK B;  5IT9 C;  2V2Z A;  4DV4 E;  1MX0 A;  2AJ4 A;  1J5E E;  1XNR I;  1FJG I;  1A6F A;  2F4V I;  4YY3 I;  4GKK I;  4DV6 I;  4DUZ I;  1N36 E;  1ZM9 A;  2OI2 A;  4LFB E;  1FNM A;  4DXL A;  3LTO A;  4DV4 I;  4JI0 I;  4FN5 A;  1J5E I;  1KVK A;  4MYT A;  3H4L A;  1MU5 A;  2UXB I;  4JI6 I;  4DV5 E;  3K17 A;  5LMU E;  4LFB I;  1IBK I;  3JAM C;  3J81 C;  1XHK A;  3J80 C;  3T1H E;  1NHJ A;  3QT8 A;  2HKE A;  3T1Y I;  1Z0W A;  2R3V A;  4DR3 I;  4NXM I;  4EMD A;  3F0N A;  5LMU I;  1XMQ E;  4JI1 I;  4DU7 A;  1N0V C;  4DPU A;  2Q2E B;  2VQF E;  4DR7 E;  4B3T E;  4X64 I;  4DV7 E;  4DR2 E;  4ZVI A;  4DV0 I;  4PU9 A;  1PIE A;  2V8P A;  1I94 I;  2X36 A;  1XNQ I;  4X62 E;  1VIS A;  4FWH A;  4DR5 E;  4FW9 A;  4UT4 A;  2UUB E;  4DV7 I;  4DR2 I;  1IBL E;  2DEJ A;  3J7A G;  4YHH I;  4KHP E;  2HKJ A;  5A2Q Q;  4JG4 A;  4JI4 E;  2V34 A;  2HHH E;  1N0U A;  2UUB I;  4KHP I;  3J7A M;  4X65 E;  4DUY I;  1DAR A;  1Z0V A;  3V2U C;  4RPF A;  5IWA E;  4JI4 I;  4DV2 E;  3ZZU A;  4P52 A;  1HNX E;  4DR6 E;  4JI8 E;  4AQY I;  4NXN E;  1HNZ I;  4PRV A;  2J7K A;  1HR0 E;  1NZ0 A;  1ZXN A;  1IBM E;  4JV5 I;  4K0K E;  4HXZ A;  1KKH A;  4HY1 A;  2UU9 I;  1S16 A;  4DR4 E;  2E1R A;  1KTV A;  4LF8 E;  2LJP A;  1B63 A;  4B3M E;  1N33 I;  2A2C A;  3V5R A;  1IBM I;  1H7U A;  1PKP A;  3QT7 A;  4OX9 E;  4LF5 E;  3WU5 A;  2HFS A;  2GS8 A;  3ZKB A;  1N36 I;  4ED4 A;  5LMN E;  1WUU A;  3PYG A;  4JI5 E;  4DR1 E;  2UUC E;  4Z7Y A;  1UEK A;  1EA6 A;  2HFU A;  2HK3 A;  4PRX A;  1FWL A;  4JYA E;  1EI1 A;  5A2Q C;  1XMO E;  4JI7 E;  1Z0B A;  1U2R A;  4DV5 I;  4JI5 I;  4I3H A;  1H73 A;  3ZZT A;  3T1H I;  4B3R E;  4DV3 E;  1XMO I;  4FWD A;  1PVG A;  1XMQ I;  3Q1Q A;  2V2Q A;  2VQF I;  1ZM3 A;  4DR7 I;  2VQE E;  3B8H A;  4B3T I;  1ZM4 A;  4UTG A;  3WU4 A;  2UXD E;  4B3S E;  4GKJ E;  3CWV A;  1RR9 A;  1Z5C A;  4X62 I;  1ZM2 A;  2BM1 A;  4DR5 I;  2XEX A;  3ZZ0 A;  3LNU A;  1FI4 A;  2VQE I;  4LFA E;  2VF3 A;  1H7S A;  1IBL I;  1Z0T A;  2UXD I;  5LL6 R;  3GON A;  4JI2 E;  4X66 E;  3M6A A;  3WU6 A;  4B3S I;  2V2V A;  2BM0 A;  1N34 E;  4GKJ I;  3OTO E;  4DV1 E;  2E5L E;  4JI3 E;  2HHH I;  1N32 E;  2CZ9 A;  4WUB A;  4LFA I;  4LF9 E;  1NHI A;  3PYD A;  3PYF A;  1Z0E A;  2ZM6 E;  2R42 A;  4X65 I;  3LPS A;  3B78 A;  4DV1 I;  1FJG E;  2E5L I;  5IWA I;  4YY3 E;  4GKK E;  4JI3 I;  2DEI A;  4DV2 I;  1HNX I;  1Z0G A;  4DR6 I;  1RRE A;  4JI8 I;  1K47 A;  4NXN I;  4P7A A;  2ZM6 I;  1HR0 I;  4K0K I;  4JI0 E;  1B62 A;  4DR4 I;  4LF8 I;  4KQV A;  2UXB E;  4JI6 E;  4M1K A;  4B3M I;  4DPX A;  1IBK E;  5L3J A;  4WUC A;  5FLX Q;  1Z5B A;  4OX9 I;  4LF5 I;  1S4E A;  3T1Y E;  2BV3 A;  4DR3 E;  5LMN I;  5BR8 E;  4NXM E;  4DR1 I;  2UUC I;  4USK A;  1H72 C;  3B82 A;  1D6T A;  3ZM7 A;  4LFC E;  4LF6 E;  3HUL A;  4JI1 E;  4JYA I;  1Z59 A;  2NPF A;  4JI7 I;  4X64 E;  5BR8 I;  2WW4 A;  4HAC B;  4HAC A;  4DV0 E;  5IT9 Q;  3K1J A;  3WU3 A;  4LF4 E;  1I94 E;  1Z5A A;  3QT6 A;  3D4J A;  1XNQ E;  1NHH A;  1Z0C A;  4DPT A;  4LFC I;  4B3R I;  4LF6 I;  4LF7 E;  4DV3 I;  2ZIT A;  1HNW E;  2HK2 A;  4DPW A;  2UXC E;  4HYM A;  4YHH E;  2A2D A;  4LF4 I;  1MG7 A;  3ZKD A;  4LF7 I;  4URL A;  1HNW I;  1ZXM A;  4XTJ A;  4USM A;  1OJ4 A;  3JAM Q;  3J81 Q;  2UXC I;  5GME A;  3J80 Q; 
#chains in the Genus database with same CATH topology
 1FWK A;  2UUA E;  1FKA E;  5C0X C;  1BKN A;  4MYU A;  2C39 B;  4IFD E;  3HKM A;  4DUY E;  2X7I A;  3DD6 A;  4LCG A;  1KIJ A;  5FLX C;  4IFD A;  4IFD B;  4DPY A;  2EFG A;  2WNR B;  2C38 A;  4R1F A;  2CG9 A;  4JI2 I;  4AQY E;  4X66 I;  1ELO A;  4ISA A;  2PO0 B;  1HNZ E;  2UUA I;  4Z7C A;  1N34 I;  4FWG A;  5GMD A;  4DU8 A;  3OTO I;  4JV5 E;  3PYE A;  5JEA D;  1XXE A;  1XNR E;  4NBQ A;  3QT5 A;  1H74 A;  2F4V E;  1N32 I;  4WUD A;  4DV6 E;  2UU9 E;  4DUZ E;  4LF9 I;  3PS2 A;  1QZR A;  1USU A;  1N33 E;  2PO2 A;  4LOM A;  5C0X F;  2ZBK B;  5IT9 C;  2BA0 D;  2V2Z A;  4DV4 E;  1MX0 A;  4AID A;  2AJ4 A;  4MU3 A;  1J5E E;  1XNR I;  1FJG I;  1A6F A;  2F4V I;  4YY3 I;  4GKK I;  4DV6 I;  4DUZ I;  1N36 E;  1ZM9 A;  2OI2 A;  2PNZ B;  2PNZ A;  4LFB E;  4AIM A;  1FNM A;  2F1D A;  2BA0 G;  2BA1 D;  4OO1 D;  4DXL A;  3LTO A;  4DV4 I;  4JI0 I;  4FN5 A;  1J5E I;  1KVK A;  3Q6N A;  4MYT A;  3H4L A;  1MU5 A;  2PO1 B;  2PO1 A;  2UXB I;  4JI6 I;  4DV5 E;  2O1W A;  2JE6 A;  5DNX A;  3K17 A;  5JEA E;  2JEA B;  5LMU E;  1Y5Y A;  4LFB I;  2BA1 G;  1IBK I;  3JAM C;  3J81 C;  1XHK A;  3J80 C;  5JEA B;  3T1H E;  1VI7 A;  1NHJ A;  2GO3 A;  3QT8 A;  2BR2 A;  2HKE A;  3T1Y I;  1Z0W A;  2R3V A;  4DR3 I;  4N3O A;  4NXM I;  4LCH A;  4EMD A;  3F0N A;  5K36 A;  5LMU I;  1XMQ E;  5EKW A;  1R6M A;  4JI1 I;  4DU7 A;  1N0V C;  2PNM A;  4DPU A;  2Q2E B;  2VQF E;  4DR7 E;  4B3T E;  4X64 I;  4DV7 E;  4DR2 E;  4ZVI A;  4DV0 I;  4PU9 A;  3GCM A;  4AM3 A;  4OO1 E;  1PIE A;  2V8P A;  1I94 I;  2Z5C A;  2IOQ A;  5ELW A;  2X36 A;  1XNQ I;  3PRY A;  4OO1 B;  4OO1 A;  3P3C A;  4MDT A;  1R6L A;  4X62 E;  1VIS A;  4FWH A;  4DR5 E;  4FW9 A;  4UT4 A;  2UUB E;  4DV7 I;  4DR2 I;  1IBL E;  2DEJ A;  4LCF A;  3L7Z B;  1Y6Z A;  3J7A G;  4YHH I;  4MU0 A;  4KHP E;  1E3P A;  1Y60 A;  2HKJ A;  5A2Q Q;  3K85 A;  4FW5 A;  5JEA C;  4JG4 A;  4JI4 E;  2V34 A;  2HHH E;  1N0U A;  1USV A;  2UUB I;  2CGE A;  2C38 B;  4MQY A;  4KHP I;  3J7A M;  2WP8 A;  4X65 E;  2Z5B B;  2Z5B A;  4DUY I;  1DAR A;  1Z0V A;  3U1K A;  3V2U C;  5DNL A;  4RPF A;  5IWA E;  4JI4 I;  2IOP A;  3NZK A;  4GQU A;  3M7N D;  3KRN A;  2NN6 A;  4P52 A;  3ZZU A;  4DV2 E;  1HNX E;  4FW7 A;  4DR6 E;  1HK7 A;  2O1U A;  4JI8 E;  5K36 D;  4AQY I;  2PO2 B;  4NXN E;  1HNZ I;  1UDQ A;  4PRV A;  2J7K A;  1HR0 E;  1NZ0 A;  1ZXN A;  3H1C A;  5JEA F;  5C0X D;  1IBM E;  4JV5 I;  4K0K E;  4HXZ A;  2J65 A;  4IZJ A;  1KKH A;  4HY1 A;  3M7N G;  1RHY A;  2UU9 I;  1S16 A;  4DR4 E;  2E1R A;  1KTV A;  4LF8 E;  1E3H A;  2LJP A;  4FW6 A;  1B63 A;  4B3M E;  1N33 I;  2A2C A;  3GLL A;  3V5R A;  1IBM I;  1H7U A;  2O3Z A;  1PKP A;  3UHM A;  5FWK A;  3QT7 A;  4OX9 E;  4LF5 E;  2JEB B;  2JEB A;  2HFS A;  3WU5 A;  2GS8 A;  3ZKB A;  1N36 I;  4ED4 A;  4IFD C;  5LMN E;  1WUU A;  2JE6 B;  3PYG A;  4DR1 E;  4JI5 E;  1P42 A;  2UUC E;  5DRP A;  4Z7Y A;  1UEK A;  2GQ0 A;  2O1V A;  1EA6 A;  1Y4U A;  2HFU A;  4OZE A;  2HK3 A;  4PRX A;  1FWL A;  2BR2 B;  4JYA E;  1EI1 A;  5A2Q C;  5K36 E;  1XMO E;  3B4T A;  4JI7 E;  1Z0B A;  1U2R A;  3M85 D;  4DV5 I;  4JI5 I;  4I3H A;  5C0X E;  5K36 B;  4FW3 A;  1H73 A;  5C0X B;  5C0X A;  3ZZT A;  3GME A;  2IES A;  3T1H I;  4B3R E;  4DV3 E;  2VES A;  1XMO I;  4IFD F;  3M85 G;  5DRO A;  2NN6 D;  3P06 A;  2O1T A;  4FWD A;  1PVG A;  2Z5C B;  1XMQ I;  1OYR A;  4LPF A;  3Q1Q A;  2JT2 A;  2V2Q A;  4IZJ D;  2VQF I;  1ZM3 A;  4DR7 I;  2VQE E;  3B8H A;  4B3T I;  1ZM4 A;  4UTG A;  3WU4 A;  2UXD E;  4B3S E;  1OYP A;  4GKJ E;  3CWV A;  1RR9 A;  4MU4 A;  3U1Y A;  1Z5C A;  4X62 I;  1ZM2 A;  2GO4 A;  2BM1 A;  4DR5 I;  2XEX A;  3ZZ0 A;  3LNU A;  1FI4 A;  2VQE I;  4LFA E;  1UDS A;  2VF3 A;  1H7S A;  1IBL I;  1Z0T A;  2UXD I;  5LL6 R;  5K36 C;  3GON A;  4JI2 E;  4IZK B;  4IZK A;  4X66 E;  3M6A A;  3WU6 A;  4B3S I;  2V2V A;  4BA2 B;  2WP8 B;  2BM0 A;  1N34 E;  4BA2 A;  4GKJ I;  2NN6 E;  3OTO E;  4QNJ A;  4DV1 E;  2C39 A;  1Y4S A;  5DRR A;  2CVE A;  2E5L E;  4JI3 E;  2HHH I;  1N32 E;  2CZ9 A;  2NN6 B;  4WUB A;  4LFA I;  4LF9 E;  1YHC A;  1YH8 A;  1NHI A;  2WNR A;  3PYD A;  3PYF A;  4OKG A;  1Z0E A;  2C37 B;  2C37 A;  2ZM6 E;  2PO0 A;  2R42 A;  4OO1 C;  4X65 I;  3LPS A;  3B78 A;  4IZJ B;  4DV1 I;  2AE8 A;  1FJG E;  5IWA I;  2E5L I;  4YY3 E;  4GKK E;  4JI3 I;  2DEI A;  4DV2 I;  1HNX I;  1Z0G A;  4DR6 I;  1RRE A;  5K36 F;  4JI8 I;  1K47 A;  4NXN I;  4P7A A;  3HJC A;  2ZM6 I;  1HR0 I;  4K0K I;  4JI0 E;  3PS1 A;  1B62 A;  4BA1 B;  4BA1 A;  4DR4 I;  4LF8 I;  4KQV A;  2UXB E;  4JI6 E;  4M1K A;  4B3M I;  1UDO A;  4DPX A;  1IBK E;  4OO1 F;  3CDI A;  5L3J A;  4WUC A;  1OYS A;  3P3G A;  4IS9 A;  5FLX Q;  4FW4 A;  3P3E A;  1Z5B A;  4U3D A;  5DRQ A;  4OX9 I;  4LF5 I;  1S4E A;  3T1Y E;  2BV3 A;  4DR3 E;  4MU1 A;  2NN6 C;  5BR8 E;  5LMN I;  4J3D A;  4NXM E;  4DR1 I;  2UUC I;  2JEA A;  4USK A;  1H72 C;  3B82 A;  3Q6M A;  1D6T A;  3ZM7 A;  4LFC E;  4LF6 E;  3HUL A;  5JEA A;  4JI1 E;  4JYA I;  1Z59 A;  3P76 A;  3PS3 A;  2NPF A;  4JI7 I;  4X64 E;  5BR8 I;  4IFD D;  2WW4 A;  2IER A;  4HAC A;  4HAC B;  4DV0 E;  5IT9 Q;  3K1J A;  3WU3 A;  4LF4 E;  1I94 E;  1Z5A A;  3QT6 A;  3D4J A;  1XNQ E;  1NHH A;  1Z0C A;  4DPT A;  4LFC I;  4B3R I;  4LF6 I;  4LF7 E;  4QNK A;  4DV3 I;  2ZIT A;  1HNW E;  2PNL A;  2NN6 F;  2HK2 A;  4DPW A;  2UXC E;  4HYM A;  3CDJ A;  4YHH E;  2A2D A;  4LF4 I;  4U3B A;  2Z5E A;  1MG7 A;  5EL9 A;  3ZKD A;  4LF7 I;  4URL A;  1HNW I;  1ZXM A;  1UDN A;  4XTJ A;  4USM A;  1OJ4 A;  3JAM Q;  3J81 Q;  2UXC I;  5GME A;  3J80 Q;  3L7Z A; 
#chains in the Genus database with same CATH homology
 1FWK A;  2UUA E;  1FKA E;  1BKN A;  4MYU A;  4DUY E;  2X7I A;  1KIJ A;  5FLX C;  4DPY A;  2EFG A;  4R1F A;  2CG9 A;  4JI2 I;  4AQY E;  4X66 I;  1ELO A;  2UUA I;  1HNZ E;  4Z7C A;  1N34 I;  4FWG A;  5GMD A;  4DU8 A;  3OTO I;  4JV5 E;  3PYE A;  1XNR E;  3QT5 A;  1H74 A;  2F4V E;  1N32 I;  4WUD A;  4DV6 E;  2UU9 E;  4DUZ E;  4LF9 I;  1QZR A;  1USU A;  1N33 E;  2ZBK B;  5IT9 C;  2V2Z A;  4DV4 E;  1MX0 A;  2AJ4 A;  1J5E E;  1XNR I;  1FJG I;  1A6F A;  2F4V I;  4YY3 I;  4GKK I;  4DV6 I;  4DUZ I;  1N36 E;  1ZM9 A;  2OI2 A;  4LFB E;  1FNM A;  4DXL A;  3LTO A;  4DV4 I;  4JI0 I;  4FN5 A;  1J5E I;  1KVK A;  3Q6N A;  4MYT A;  3H4L A;  1MU5 A;  2UXB I;  4JI6 I;  4DV5 E;  2O1W A;  3K17 A;  5LMU E;  4LFB I;  1IBK I;  3JAM C;  3J81 C;  1XHK A;  3J80 C;  3T1H E;  1NHJ A;  3QT8 A;  2HKE A;  3T1Y I;  1Z0W A;  2R3V A;  4DR3 I;  4N3O A;  4NXM I;  4EMD A;  3F0N A;  5LMU I;  1XMQ E;  4JI1 I;  4DU7 A;  1N0V C;  2PNM A;  4DPU A;  2Q2E B;  2VQF E;  4DR7 E;  4B3T E;  4X64 I;  4DV7 E;  4DR2 E;  4ZVI A;  4DV0 I;  4PU9 A;  1PIE A;  2V8P A;  1I94 I;  2Z5C A;  2IOQ A;  2X36 A;  1XNQ I;  3PRY A;  4X62 E;  1VIS A;  4FWH A;  4DR5 E;  4FW9 A;  4UT4 A;  2UUB E;  4DV7 I;  4DR2 I;  1IBL E;  2DEJ A;  1Y6Z A;  3J7A G;  4YHH I;  4KHP E;  2HKJ A;  5A2Q Q;  3K85 A;  4JG4 A;  4JI4 E;  2V34 A;  2HHH E;  1N0U A;  1USV A;  2UUB I;  2CGE A;  4KHP I;  3J7A M;  4X65 E;  2Z5B B;  2Z5B A;  4DUY I;  1DAR A;  1Z0V A;  3V2U C;  4RPF A;  5IWA E;  4JI4 I;  2IOP A;  4DV2 E;  3ZZU A;  4P52 A;  1HNX E;  4DR6 E;  1HK7 A;  2O1U A;  4JI8 E;  4AQY I;  4NXN E;  1HNZ I;  4PRV A;  2J7K A;  1HR0 E;  1NZ0 A;  1ZXN A;  1IBM E;  4JV5 I;  4K0K E;  4HXZ A;  4IZJ A;  1KKH A;  4HY1 A;  2UU9 I;  1S16 A;  4DR4 E;  2E1R A;  1KTV A;  4LF8 E;  2LJP A;  1B63 A;  4B3M E;  1N33 I;  2A2C A;  3V5R A;  1IBM I;  1H7U A;  1PKP A;  5FWK A;  3QT7 A;  4OX9 E;  4LF5 E;  3WU5 A;  2HFS A;  2GS8 A;  3ZKB A;  1N36 I;  4ED4 A;  5LMN E;  1WUU A;  3PYG A;  4JI5 E;  4DR1 E;  2UUC E;  4Z7Y A;  1UEK A;  2GQ0 A;  2O1V A;  1EA6 A;  1Y4U A;  2HFU A;  2HK3 A;  4PRX A;  1FWL A;  4JYA E;  1EI1 A;  5A2Q C;  1XMO E;  4JI7 E;  1Z0B A;  1U2R A;  4DV5 I;  4JI5 I;  4I3H A;  1H73 A;  3ZZT A;  3T1H I;  4B3R E;  4DV3 E;  1XMO I;  3P06 A;  2O1T A;  4FWD A;  1PVG A;  2Z5C B;  1XMQ I;  3Q1Q A;  2V2Q A;  4IZJ D;  2VQF I;  1ZM3 A;  4DR7 I;  2VQE E;  3B8H A;  4B3T I;  1ZM4 A;  4UTG A;  3WU4 A;  2UXD E;  4B3S E;  4GKJ E;  3CWV A;  1RR9 A;  1Z5C A;  4X62 I;  1ZM2 A;  2BM1 A;  4DR5 I;  2XEX A;  3ZZ0 A;  3LNU A;  1FI4 A;  2VQE I;  4LFA E;  2VF3 A;  1H7S A;  1IBL I;  1Z0T A;  2UXD I;  5LL6 R;  3GON A;  4JI2 E;  4IZK B;  4IZK A;  4X66 E;  3M6A A;  3WU6 A;  4B3S I;  2V2V A;  2BM0 A;  1N34 E;  4GKJ I;  3OTO E;  4DV1 E;  1Y4S A;  2E5L E;  4JI3 E;  2HHH I;  1N32 E;  2CZ9 A;  4WUB A;  4LFA I;  4LF9 E;  1NHI A;  3PYD A;  3PYF A;  1Z0E A;  2ZM6 E;  2R42 A;  4X65 I;  3LPS A;  3B78 A;  4IZJ B;  4DV1 I;  1FJG E;  5IWA I;  2E5L I;  4YY3 E;  4GKK E;  4JI3 I;  2DEI A;  4DV2 I;  1HNX I;  1Z0G A;  4DR6 I;  1RRE A;  4JI8 I;  1K47 A;  4NXN I;  4P7A A;  3HJC A;  2ZM6 I;  1HR0 I;  4K0K I;  4JI0 E;  1B62 A;  4DR4 I;  4LF8 I;  4KQV A;  2UXB E;  4JI6 E;  4M1K A;  4B3M I;  4DPX A;  1IBK E;  5L3J A;  4WUC A;  5FLX Q;  1Z5B A;  4OX9 I;  4LF5 I;  1S4E A;  3T1Y E;  2BV3 A;  4DR3 E;  5LMN I;  5BR8 E;  4NXM E;  4DR1 I;  2UUC I;  4USK A;  1H72 C;  3B82 A;  3Q6M A;  1D6T A;  3ZM7 A;  4LFC E;  4LF6 E;  3HUL A;  4JI1 E;  4JYA I;  1Z59 A;  2NPF A;  4JI7 I;  4X64 E;  5BR8 I;  2WW4 A;  4HAC B;  4HAC A;  4DV0 E;  5IT9 Q;  3K1J A;  3WU3 A;  4LF4 E;  1I94 E;  1Z5A A;  3QT6 A;  3D4J A;  1XNQ E;  1NHH A;  1Z0C A;  4DPT A;  4LFC I;  4B3R I;  4LF6 I;  4LF7 E;  4DV3 I;  2ZIT A;  1HNW E;  2PNL A;  2HK2 A;  4DPW A;  2UXC E;  4HYM A;  4YHH E;  2A2D A;  4LF4 I;  2Z5E A;  1MG7 A;  3ZKD A;  4LF7 I;  4URL A;  1HNW I;  1ZXM A;  4XTJ A;  4USM A;  1OJ4 A;  3JAM Q;  3J81 Q;  2UXC I;  5GME A;  3J80 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...