1Z0BA

Crystal structure of a. fulgidus lon proteolytic domain e506a mutant
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
203
Chain Sequence
YKLFITEGYEVGRVNGLAVIGESAGIVLPIIAEVTPSMEGRVIATGRLQEIAREAVMNVSAIIKKYTGRDISNMDVHIQFVGTYEGVAGDSASISIATAVISAIEGIPVDQSVAMTGSLSVKGEVLPVGGVTQKIEAAIQAGLKKVIIPKDNIDDVLLDAEHEGKIEVIPVSRINEVLEHVLEDGKKKNRLMSKFKELELAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protease La homolog type
publication title Atomic-resolution Crystal Structure of the Proteolytic Domain of Archaeoglobus fulgidus Lon Reveals the Conformational Variability in the Active Sites of Lon Proteases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 60
structure length 203
sequence length 206
ec nomenclature ec 3.4.21.53: Endopeptidase La.
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1z0bA00
3V2UC 4HXZA 5LMNE 1HR0I 3J7AG 1N32I 2UUBE 4LF6E 2V8PA 2F4VE 3PYEA 4DV3I 4LF9E 4JI4I 1XHKA 4JI6E 3ZZ0A 1HNZI 2UUCI 4YY3I 1IBLE 1N33I 3CWVA 5A2QQ 1K47A 3HULA 4HACA 2BM1A 3ZKBA 1N34E 4GKJE 4EMDA 2DEJA 1XMOE 4X64I 4URLA 3WU6A 4DV6I 4JV5E 4FW9A 4DPTA 4HACB 2BM0A 5LMUE 4LFAE 1I94I 3OTOE 1FWKA 4JI7E 4DR5I 3ZM7A 4DR3E 4JI2I 2UUAE 1Z0CA 2V2VA 2HHHE 2HK2A 4KHPI 4DR2E 3QT8A 4OX9E 1ZXNA 1S16A 4KQVA 1NHJA 2UU9E 1H74A 4MYTA 2VF3A 4B3TI 3K1JA 4JI1I 1N0VC 1KVKA 1IBKE 4LF5E 4NXNE 3QT7A 4GKKI 1OJ4A 4DV4I 4DV5E 3WU5A 1FKAE 4JI0I 3ZZUA 1XNQI 3B8HA 1KKHA 4LFBE 1J5EE 1ZM2A 4XTJA 2HK3A 3PYDA 4DPWA 3B82A 4JI3I 2UXBE 4RPFA 4DUZI 3T1HI 2WW4A 1FJGI 4I3HA 4LF8I 4JYAI 4B3ME 4X66I 4YHHI 5GMEA 2VQEI 4AQYE 4X62E 4B3RI 1KIJA 1HNXE 1KTVA 3H4LA 1DARA 1FNMA 4DXLA 4LF7I 4P52A 2VQFE 5LMNI 3J80C 1H7UA 4HYMA 5IWAE 3ZKDA 2OI2A 1B62A 1IBMI 4DV1I 1PKPA 1NZ0A 4JI6I 2HFUA 4FWGA 2J7KA 5FLXC 2NPFA 4DR7E 4DV7E 5LMUI 4LF4E 4DUYI 4UT4A 1QZRA 4DV2I 4JI5E 5BR8E 3LTOA 2V2ZA 2DEIA 2LJPA 3JAMC 4OX9I 1Z0EA 1HR0E 2E5LI 1D6TA 4DPYA 4DV0I 1N32E 1N36I 4DR1I 4DV3E 2E1RA 4JI4E 2ZITA 1HNZE 3LPSA 4DR6I 1UEKA 2UUCE 4WUBA 4YY3E 4X65E 3J81C 1N33E 4NXNI 1EA6A 1XNRI 1ZM3A 4ED4A 4X64E 1N0UA 1S4EA 1XMQI 4DV6E 3T1YI 1EI1A 2UXDI 1I94E 2CZ9A 4LFBI 4DR4I 4DR5E 4JI8I 3PYFA 4DU8A 4B3SE 2UXBI 4MYUA 5A2QC 4B3MI 4PRXA 1HNWI 2ZM6I 3J80Q 4USMA 3V5RA 4AQYI 4LFCI 4JI1E 3GONA 4WUCA 1MU5A 4PRVA 1Z0WA 4GKKE 4DV4E 3M6AA 2UXCI 4K0KE 3J7AM 4JI0E 4WUDA 1XNQE 4NXMI 4HY1A 4DPUA 5LL6R 5IWAI 1ZXMA 1ZM4A 4JI3E 4DUZE 1MG7A 1FJGE 3QT5A 2UUBI 4LF6I 2F4VI 3K17A 4X66E 4LF9I 4YHHE 1NHHA 1WUUA 2VQEE 2V34A 4DV7I 1Z5AA 4B3RE 1IBLI 1N34I 4GKJI 1XMOI 1NHIA 3WU4A 4JV5I 4P7AA 4ZVIA 2A2DA 4LFAI 3OTOI 5IT9C 1Z0TA 1Z0BA 4JI7I 4Z7YA 3WU3A 4DR3I 2UUAI 2HHHI 2X36A 1IBME 4DR2I 4DV1E 4Z7CA 2X7IA 1FWLA 1ELOA 4X65I 2UU9I 3D4JA 4PU9A 1U2RA 3LNUA 2XEXA 1IBKI 4LF5I 4DUYE 1BKNA 1ZM9A 4DU7A 2Q2EB 5GMDA 4DV5I 1H72C 4DV2E 4B3SI 3B78A 1H73A 1J5EI 3QT6A 4JI2E 2E5LE 4DV0E 4FWDA 4R1FA 1N36E 4DR1E 4KHPE 1FI4A 5L3JA 2A2CA 1RR9A 3ZZTA 2EFGA 4DR6E 4X62I 4USKA 1XNRE 4B3TE 2HKJA 4K0KI 1HNXI 1PIEA 3Q1QA 1XMQE 3T1YE 2UXDE 2HKEA 1Z0VA 4DR4E 4JI8E 2VQFI 5FLXQ 2HFSA 1Z5CA 1RREA 2R3VA 1A6FA 2AJ4A 2GS8A 5IT9Q 1Z59A 1HNWE 4FWHA 4M1KA 1VISA 2ZM6E 4UTGA 2R42A 3T1HE 2ZBKB 1Z5BA 4FN5A 3JAMQ 4LF8E 4JYAE 1H7SA 4LFCE 2BV3A 4DR7I 1MX0A 1PVGA 1Z0GA 4LF4I 2UXCE 1B63A 4JI5I 4NXME 4JG4A 5BR8I 4DPXA 3J81Q 3PYGA 3F0NA 2V2QA 4LF7E
chains in the Genus database with same CATH superfamily
1RHYA 4AM3A 3V2UC 3L7ZB 4HXZA 5LMNE 1HR0I 4OKGA 2Z5CA 4FW7A 3J7AG 5C0XD 1N32I 2UUBE 4LF6E 2V8PA 2F4VE 3PYEA 4DV3I 2Z5CB 4LF9E 4JI4I 1XHKA 4JI6E 3ZZ0A 1HNZI 3M85G 2UUCI 4YY3I 5FWKA 1IBLE 1N33I 3CWVA 5A2QQ 4IFDE 1K47A 3HULA 4HACA 2BM1A 3ZKBA 1N34E 4MQYA 4GKJE 4EMDA 2DEJA 1XMOE 4X64I 1USVA 4IFDA 4URLA 2C38A 3WU6A 4DV6I 4JV5E 4FW9A 4DPTA 4HACB 2BM0A 5LMUE 4LFAE 1I94I 3OTOE 4IFDB 1FWKA 2C38B 4JI7E 4DR5I 3ZM7A 4MU1A 4DR3E 4JI2I 2Z5EA 1OYPA 2UUAE 1R6MA 1Z0CA 4LCHA 2V2VA 2HHHE 2BA1G 2HK2A 4NBQA 2NN6F 4GQUA 4KHPI 4DR2E 3QT8A 4OX9E 2IOPA 1ZXNA 1S16A 4MU0A 4KQVA 1NHJA 2UU9E 5EKWA 1H74A 4MYTA 1Y4UA 4FW3A 2VF3A 4B3TI 3K1JA 4JI1I 1N0VC 1KVKA 1IBKE 4IZJA 4MDTA 5JEAA 4LF5E 2Z5BA 4NXNE 4QNKA 3GCMA 3QT7A 4GKKI 4OO1D 1OJ4A 4DV4I 4DV5E 3WU5A 4IZJB 2CGEA 5JEAB 1FKAE 2Z5BB 4U3DA 4JI0I 3ZZUA 1XNQI 3B8HA 2BA0D 2NN6E 1KKHA 4LFBE 1J5EE 1ZM2A 5DNXA 4XTJA 2HK3A 3PYDA 4DPWA 3GMEA 3NZKA 3B82A 4JI3I 2UXBE 4RPFA 4DUZI 3T1HI 2WW4A 1FJGI 4I3HA 2WP8A 4LF8I 5DNLA 4JYAI 4B3ME 2J65A 4X66I 2WP8B 1HK7A 4YHHI 1E3PA 5GMEA 4LPFA 1Y60A 2VQEI 2O1UA 4X62E 4AQYE 4B3RI 2O1VA 4MU4A 5K36D 1KIJA 1HNXE 1KTVA 3H4LA 1DARA 2C39A 1FNMA 4DXLA 3HJCA 5EL9A 4LF7I 2C39B 4P52A 2VQFE 3PS3A 1Y6ZA 1UDOA 4IZKA 5LMNI 3J80C 1H7UA 4HYMA 5IWAE 2O1WA 4LCGA 3ZKDA 4BA2A 2OI2A 4OO1C 1B62A 1IBMI 2F1DA 4DV1I 1PKPA 1NZ0A 4JI6I 2GO3A 2HFUA 4AIMA 1XXEA 4FWGA 5DROA 2J7KA 5FLXC 3Q6MA 2NPFA 2NN6C 3HKMA 4DR7E 4DV7E 5LMUI 4LF4E 4DUYI 4UT4A 1QZRA 5JEAF 4DV2I 4JI5E 5C0XA 5BR8E 3LTOA 3P3GA 2V2ZA 2DEIA 2LJPA 3JAMC 2CG9A 4OX9I 5C0XB 5K36C 3P3CA 1Z0EA 1HR0E 1YH8A 5DRQA 1UDNA 2E5LI 1D6TA 4DPYA 4DV0I 1N32E 1N36I 4DR1I 4DV3E 2JE6A 2E1RA 4JI4E 1OYSA 2ZITA 1HNZE 3LPSA 2C37A 3M7NG 1UEKA 4DR6I 2UUCE 4WUBA 4YY3E 4X65E 3J81C 1N33E 4NXNI 1EA6A 2JE6B 1XNRI 1ZM3A 4ED4A 4X64E 2C37B 5JEAE 1N0UA 1S4EA 2PNMA 4DV6E 1XMQI 3T1YI 1EI1A 2UXDI 3CDIA 4IZJD 5DRRA 1I94E 2CZ9A 4LFBI 4U3BA 4DR4I 4JI8I 4DR5E 3PYFA 2WNRA 2O1TA 4DU8A 2JEAA 4B3SE 2UXBI 2PNZA 4MYUA 5A2QC 2WNRB 4B3MI 4PRXA 4FW5A 1HNWI 2ZM6I 1VI7A 2IERA 2IESA 4USMA 3J80Q 3V5RA 4LOMA 2NN6D 4IFDC 4J3DA 4AQYI 1Y4SA 4OO1A 1Y5YA 3K85A 4LFCI 3M85D 4JI1E 3GONA 4WUCA 1MU5A 1E3HA 4PRVA 4QNJA 1Z0WA 4GKKE 4DV4E 3M6AA 3CDJA 2UXCI 4K0KE 3J7AM 4JI0E 4WUDA 1XNQE 4NXMI 1YHCA 2CVEA 4HY1A 3UHMA 4DPUA 5LL6R 3H1CA 5IWAI 1ZXMA 1ZM4A 5C0XF 3PRYA 2BA1D 4JI3E 4DUZE 1MG7A 1FJGE 5JEAC 3QT5A 2UUBI 4LF6I 4IZKB 2F4VI 3K17A 4X66E 4IS9A 4LF9I 4YHHE 1NHHA 1WUUA 2VQEE 2V34A 4DV7I 1Z5AA 4B3RE 4BA2B 1IBLI 1R6LA 1N34I 4GKJI 2VESA 1XMOI 4LCFA 1NHIA 1USUA 3WU4A 4JV5I 4P7AA 4ZVIA 2JT2A 2A2DA 4ISAA 4LFAI 3OTOI 5IT9C 1Z0TA 1Z0BA 5C0XE 2BA0G 4JI7I 4Z7YA 3WU3A 4DR3I 2UUAI 4IFDD 3Q6NA 2HHHI 2JEBA 1P42A 2X36A 1IBME 4DR2I 4DV1E 4Z7CA 2X7IA 1FWLA 2JEBB 1ELOA 4X65I 2UU9I 3D4JA 4PU9A 1U2RA 2O3ZA 3U1YA 3LNUA 2XEXA 2BR2A 4OO1F 1IBKI 4LF5I 4DUYE 1BKNA 3GLLA 1ZM9A 4DU7A 2Q2EB 5GMDA 2BR2B 4DV5I 1H72C 4DV2E 4B3SI 3B78A 3PS2A 1H73A 2IOQA 5JEAD 1J5EI 3QT6A 4MU3A 4JI2E 2E5LE 4OZEA 4DV0E 4FWDA 4R1FA 1N36E 4DR1E 4KHPE 1FI4A 5L3JA 2JEAB 3PS1A 2A2CA 1RR9A 2PNZB 1UDQA 3ZZTA 4OO1E 2EFGA 4DR6E 5K36F 4X62I 5C0XC 4BA1A 4USKA 1XNRE 4B3TE 2HKJA 4K0KI 1HNXI 1PIEA 3Q1QA 3U1KA 2PO0A 3KRNA 4BA1B 1XMQE 4OO1B 3T1YE 2UXDE 2HKEA 1Z0VA 4DR4E 2PO0B 4JI8E 2VQFI 2NN6A 5FLXQ 2HFSA 1Z5CA 1UDSA 5DRPA 1RREA 3DD6A 2R3VA 1A6FA 2AJ4A 2GS8A 4FW4A 1Z59A 2NN6B 5IT9Q 1HNWE 4FWHA 4M1KA 1VISA 2ZM6E 4N3OA 5ELWA 4UTGA 5K36E 2R42A 3B4TA 3T1HE 2GQ0A 2ZBKB 1Z5BA 3P76A 3P3EA 4FN5A 3JAMQ 4LF8E 4JYAE 2PO1A 5K36A 1H7SA 4LFCE 3M7ND 1OYRA 2BV3A 2PO2A 3P06A 4DR7I 2PO1B 5K36B 4FW6A 1MX0A 1PVGA 1Z0GA 4LF4I 4IFDF 2UXCE 2PNLA 2PO2B 1B63A 4AIDA 2GO4A 4JI5I 4NXME 4JG4A 5BR8I 3L7ZA 4DPXA 3J81Q 3PYGA 2AE8A 3F0NA 2V2QA 4LF7E
chains in the Genus database with same CATH topology
3V2UC 4HXZA 5LMNE 1HR0I 2Z5CA 3J7AG 1N32I 2UUBE 4LF6E 2V8PA 2F4VE 3PYEA 4DV3I 2Z5CB 4LF9E 4JI4I 1XHKA 4JI6E 3ZZ0A 1HNZI 2UUCI 4YY3I 5FWKA 1IBLE 1N33I 3CWVA 5A2QQ 1K47A 3HULA 4HACA 2BM1A 3ZKBA 1N34E 4GKJE 4EMDA 2DEJA 1XMOE 4X64I 1USVA 4URLA 3WU6A 4DV6I 4JV5E 4FW9A 4DPTA 4HACB 2BM0A 5LMUE 4LFAE 1I94I 3OTOE 1FWKA 4JI7E 4DR5I 3ZM7A 4DR3E 4JI2I 2Z5EA 2UUAE 1Z0CA 2V2VA 2HHHE 2HK2A 4KHPI 4DR2E 3QT8A 4OX9E 2IOPA 1ZXNA 1S16A 4KQVA 1NHJA 2UU9E 1H74A 4MYTA 1Y4UA 2VF3A 4B3TI 3K1JA 4JI1I 1N0VC 1KVKA 1IBKE 4IZJA 4LF5E 2Z5BA 4NXNE 3QT7A 4GKKI 4DV4I 4DV5E 1OJ4A 3WU5A 4IZJB 2CGEA 1FKAE 2Z5BB 4JI0I 3ZZUA 1XNQI 3B8HA 1KKHA 4LFBE 1J5EE 1ZM2A 4XTJA 2HK3A 3PYDA 4DPWA 3B82A 4JI3I 2UXBE 4RPFA 4DUZI 3T1HI 2WW4A 1FJGI 4I3HA 4LF8I 4JYAI 4B3ME 4X66I 1HK7A 4YHHI 5GMEA 2VQEI 2O1UA 4X62E 4AQYE 4B3RI 2O1VA 1KIJA 1HNXE 1KTVA 3H4LA 1DARA 1FNMA 4DXLA 3HJCA 4LF7I 4P52A 2VQFE 1Y6ZA 4IZKA 5LMNI 3J80C 1H7UA 4HYMA 5IWAE 2O1WA 3ZKDA 2OI2A 1B62A 1IBMI 4DV1I 1PKPA 1NZ0A 4JI6I 2HFUA 4FWGA 2J7KA 5FLXC 3Q6MA 2NPFA 4DR7E 4DV7E 5LMUI 4LF4E 4DUYI 4UT4A 1QZRA 4DV2I 4JI5E 5BR8E 3LTOA 2V2ZA 2DEIA 2LJPA 3JAMC 2CG9A 4OX9I 1Z0EA 1HR0E 2E5LI 1D6TA 4DPYA 4DV0I 1N32E 1N36I 4DR1I 4DV3E 2E1RA 4JI4E 2ZITA 1HNZE 3LPSA 4DR6I 1UEKA 2UUCE 4WUBA 4YY3E 4X65E 3J81C 1N33E 4NXNI 1EA6A 1XNRI 1ZM3A 4ED4A 4X64E 1N0UA 1S4EA 2PNMA 4DV6E 1XMQI 3T1YI 1EI1A 2UXDI 4IZJD 1I94E 2CZ9A 4LFBI 4DR4I 4DR5E 4JI8I 3PYFA 2O1TA 4DU8A 4B3SE 2UXBI 4MYUA 5A2QC 4B3MI 4PRXA 1HNWI 2ZM6I 3J80Q 4USMA 3V5RA 4AQYI 1Y4SA 3K85A 4LFCI 4JI1E 3GONA 4WUCA 1MU5A 4PRVA 1Z0WA 4GKKE 4DV4E 3M6AA 2UXCI 4K0KE 3J7AM 4JI0E 4WUDA 1XNQE 4NXMI 4HY1A 4DPUA 5LL6R 5IWAI 1ZXMA 1ZM4A 3PRYA 4JI3E 4DUZE 1MG7A 1FJGE 3QT5A 2UUBI 4LF6I 4IZKB 2F4VI 3K17A 4X66E 4LF9I 4YHHE 1NHHA 1WUUA 2VQEE 2V34A 4DV7I 1Z5AA 4B3RE 1IBLI 1N34I 4GKJI 1XMOI 1NHIA 1USUA 3WU4A 4JV5I 4P7AA 4ZVIA 2A2DA 4LFAI 3OTOI 5IT9C 1Z0TA 1Z0BA 4JI7I 4Z7YA 3WU3A 4DR3I 2UUAI 3Q6NA 2HHHI 2X36A 1IBME 4DR2I 4DV1E 4Z7CA 2X7IA 1FWLA 1ELOA 4X65I 2UU9I 3D4JA 4PU9A 1U2RA 3LNUA 2XEXA 1IBKI 4LF5I 4DUYE 1BKNA 1ZM9A 4DU7A 2Q2EB 5GMDA 4DV5I 1H72C 4DV2E 4B3SI 3B78A 1H73A 2IOQA 1J5EI 3QT6A 4JI2E 2E5LE 4DV0E 4FWDA 4R1FA 1N36E 4DR1E 4KHPE 1FI4A 5L3JA 2A2CA 1RR9A 3ZZTA 2EFGA 4DR6E 4X62I 4USKA 1XNRE 4B3TE 2HKJA 4K0KI 1HNXI 1PIEA 3Q1QA 1XMQE 3T1YE 2UXDE 2HKEA 1Z0VA 4DR4E 4JI8E 2VQFI 5FLXQ 2HFSA 1Z5CA 1RREA 2R3VA 1A6FA 2AJ4A 2GS8A 5IT9Q 1Z59A 1HNWE 4FWHA 4M1KA 1VISA 2ZM6E 4N3OA 4UTGA 2R42A 3T1HE 2GQ0A 2ZBKB 1Z5BA 4FN5A 3JAMQ 4LF8E 4JYAE 1H7SA 4LFCE 2BV3A 3P06A 4DR7I 1MX0A 1PVGA 1Z0GA 4LF4I 2UXCE 2PNLA 1B63A 4JI5I 4NXME 4JG4A 5BR8I 4DPXA 3J81Q 3PYGA 3F0NA 2V2QA 4LF7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2U C;  4HXZ A;  5LMN E;  1HR0 I;  3J7A G;  1N32 I;  2UUB E;  4LF6 E;  2V8P A;  2F4V E;  3PYE A;  4DV3 I;  4LF9 E;  4JI4 I;  1XHK A;  4JI6 E;  3ZZ0 A;  1HNZ I;  2UUC I;  4YY3 I;  1IBL E;  1N33 I;  3CWV A;  5A2Q Q;  1K47 A;  3HUL A;  4HAC A;  2BM1 A;  3ZKB A;  1N34 E;  4GKJ E;  4EMD A;  2DEJ A;  1XMO E;  4X64 I;  4URL A;  3WU6 A;  4DV6 I;  4JV5 E;  4FW9 A;  4DPT A;  4HAC B;  2BM0 A;  5LMU E;  4LFA E;  1I94 I;  3OTO E;  1FWK A;  4JI7 E;  4DR5 I;  3ZM7 A;  4DR3 E;  4JI2 I;  2UUA E;  1Z0C A;  2V2V A;  2HHH E;  2HK2 A;  4KHP I;  4DR2 E;  3QT8 A;  4OX9 E;  1ZXN A;  1S16 A;  4KQV A;  1NHJ A;  2UU9 E;  1H74 A;  4MYT A;  2VF3 A;  4B3T I;  3K1J A;  4JI1 I;  1N0V C;  1KVK A;  1IBK E;  4LF5 E;  4NXN E;  3QT7 A;  4GKK I;  1OJ4 A;  4DV4 I;  4DV5 E;  3WU5 A;  1FKA E;  4JI0 I;  3ZZU A;  1XNQ I;  3B8H A;  1KKH A;  4LFB E;  1J5E E;  1ZM2 A;  4XTJ A;  2HK3 A;  3PYD A;  4DPW A;  3B82 A;  4JI3 I;  2UXB E;  4RPF A;  4DUZ I;  3T1H I;  2WW4 A;  1FJG I;  4I3H A;  4LF8 I;  4JYA I;  4B3M E;  4X66 I;  4YHH I;  5GME A;  2VQE I;  4AQY E;  4X62 E;  4B3R I;  1KIJ A;  1HNX E;  1KTV A;  3H4L A;  1DAR A;  1FNM A;  4DXL A;  4LF7 I;  4P52 A;  2VQF E;  5LMN I;  3J80 C;  1H7U A;  4HYM A;  5IWA E;  3ZKD A;  2OI2 A;  1B62 A;  1IBM I;  4DV1 I;  1PKP A;  1NZ0 A;  4JI6 I;  2HFU A;  4FWG A;  2J7K A;  5FLX C;  2NPF A;  4DR7 E;  4DV7 E;  5LMU I;  4LF4 E;  4DUY I;  4UT4 A;  1QZR A;  4DV2 I;  4JI5 E;  5BR8 E;  3LTO A;  2V2Z A;  2DEI A;  2LJP A;  3JAM C;  4OX9 I;  1Z0E A;  1HR0 E;  2E5L I;  1D6T A;  4DPY A;  4DV0 I;  1N32 E;  1N36 I;  4DR1 I;  4DV3 E;  2E1R A;  4JI4 E;  2ZIT A;  1HNZ E;  3LPS A;  4DR6 I;  1UEK A;  2UUC E;  4WUB A;  4YY3 E;  4X65 E;  3J81 C;  1N33 E;  4NXN I;  1EA6 A;  1XNR I;  1ZM3 A;  4ED4 A;  4X64 E;  1N0U A;  1S4E A;  1XMQ I;  4DV6 E;  3T1Y I;  1EI1 A;  2UXD I;  1I94 E;  2CZ9 A;  4LFB I;  4DR4 I;  4DR5 E;  4JI8 I;  3PYF A;  4DU8 A;  4B3S E;  2UXB I;  4MYU A;  5A2Q C;  4B3M I;  4PRX A;  1HNW I;  2ZM6 I;  3J80 Q;  4USM A;  3V5R A;  4AQY I;  4LFC I;  4JI1 E;  3GON A;  4WUC A;  1MU5 A;  4PRV A;  1Z0W A;  4GKK E;  4DV4 E;  3M6A A;  2UXC I;  4K0K E;  3J7A M;  4JI0 E;  4WUD A;  1XNQ E;  4NXM I;  4HY1 A;  4DPU A;  5LL6 R;  5IWA I;  1ZXM A;  1ZM4 A;  4JI3 E;  4DUZ E;  1MG7 A;  1FJG E;  3QT5 A;  2UUB I;  4LF6 I;  2F4V I;  3K17 A;  4X66 E;  4LF9 I;  4YHH E;  1NHH A;  1WUU A;  2VQE E;  2V34 A;  4DV7 I;  1Z5A A;  4B3R E;  1IBL I;  1N34 I;  4GKJ I;  1XMO I;  1NHI A;  3WU4 A;  4JV5 I;  4P7A A;  4ZVI A;  2A2D A;  4LFA I;  3OTO I;  5IT9 C;  1Z0T A;  1Z0B A;  4JI7 I;  4Z7Y A;  3WU3 A;  4DR3 I;  2UUA I;  2HHH I;  2X36 A;  1IBM E;  4DR2 I;  4DV1 E;  4Z7C A;  2X7I A;  1FWL A;  1ELO A;  4X65 I;  2UU9 I;  3D4J A;  4PU9 A;  1U2R A;  3LNU A;  2XEX A;  1IBK I;  4LF5 I;  4DUY E;  1BKN A;  1ZM9 A;  4DU7 A;  2Q2E B;  5GMD A;  4DV5 I;  1H72 C;  4DV2 E;  4B3S I;  3B78 A;  1H73 A;  1J5E I;  3QT6 A;  4JI2 E;  2E5L E;  4DV0 E;  4FWD A;  4R1F A;  1N36 E;  4DR1 E;  4KHP E;  1FI4 A;  5L3J A;  2A2C A;  1RR9 A;  3ZZT A;  2EFG A;  4DR6 E;  4X62 I;  4USK A;  1XNR E;  4B3T E;  2HKJ A;  4K0K I;  1HNX I;  1PIE A;  3Q1Q A;  1XMQ E;  3T1Y E;  2UXD E;  2HKE A;  1Z0V A;  4DR4 E;  4JI8 E;  2VQF I;  5FLX Q;  2HFS A;  1Z5C A;  1RRE A;  2R3V A;  1A6F A;  2AJ4 A;  2GS8 A;  5IT9 Q;  1Z59 A;  1HNW E;  4FWH A;  4M1K A;  1VIS A;  2ZM6 E;  4UTG A;  2R42 A;  3T1H E;  2ZBK B;  1Z5B A;  4FN5 A;  3JAM Q;  4LF8 E;  4JYA E;  1H7S A;  4LFC E;  2BV3 A;  4DR7 I;  1MX0 A;  1PVG A;  1Z0G A;  4LF4 I;  2UXC E;  1B63 A;  4JI5 I;  4NXM E;  4JG4 A;  5BR8 I;  4DPX A;  3J81 Q;  3PYG A;  3F0N A;  2V2Q A;  4LF7 E; 
#chains in the Genus database with same CATH topology
 1RHY A;  4AM3 A;  3V2U C;  3L7Z B;  4HXZ A;  5LMN E;  1HR0 I;  4OKG A;  2Z5C A;  4FW7 A;  3J7A G;  5C0X D;  1N32 I;  2UUB E;  4LF6 E;  2V8P A;  2F4V E;  3PYE A;  4DV3 I;  2Z5C B;  4LF9 E;  4JI4 I;  1XHK A;  4JI6 E;  3ZZ0 A;  1HNZ I;  3M85 G;  2UUC I;  4YY3 I;  5FWK A;  1IBL E;  1N33 I;  3CWV A;  5A2Q Q;  4IFD E;  1K47 A;  3HUL A;  4HAC A;  2BM1 A;  3ZKB A;  1N34 E;  4MQY A;  4GKJ E;  4EMD A;  2DEJ A;  1XMO E;  4X64 I;  1USV A;  4IFD A;  4URL A;  2C38 A;  3WU6 A;  4DV6 I;  4JV5 E;  4FW9 A;  4DPT A;  4HAC B;  2BM0 A;  5LMU E;  4LFA E;  1I94 I;  3OTO E;  4IFD B;  1FWK A;  2C38 B;  4JI7 E;  4DR5 I;  3ZM7 A;  4MU1 A;  4DR3 E;  4JI2 I;  2Z5E A;  1OYP A;  2UUA E;  1R6M A;  1Z0C A;  4LCH A;  2V2V A;  2HHH E;  2BA1 G;  2HK2 A;  4NBQ A;  2NN6 F;  4GQU A;  4KHP I;  4DR2 E;  3QT8 A;  4OX9 E;  2IOP A;  1ZXN A;  1S16 A;  4MU0 A;  4KQV A;  1NHJ A;  2UU9 E;  5EKW A;  1H74 A;  4MYT A;  1Y4U A;  4FW3 A;  2VF3 A;  4B3T I;  3K1J A;  4JI1 I;  1N0V C;  1KVK A;  1IBK E;  4IZJ A;  4MDT A;  5JEA A;  4LF5 E;  2Z5B A;  4NXN E;  4QNK A;  3GCM A;  3QT7 A;  4GKK I;  4OO1 D;  1OJ4 A;  4DV4 I;  4DV5 E;  3WU5 A;  4IZJ B;  2CGE A;  5JEA B;  1FKA E;  2Z5B B;  4U3D A;  4JI0 I;  3ZZU A;  1XNQ I;  3B8H A;  2BA0 D;  2NN6 E;  1KKH A;  4LFB E;  1J5E E;  1ZM2 A;  5DNX A;  4XTJ A;  2HK3 A;  3PYD A;  4DPW A;  3GME A;  3NZK A;  3B82 A;  4JI3 I;  2UXB E;  4RPF A;  4DUZ I;  3T1H I;  2WW4 A;  1FJG I;  4I3H A;  2WP8 A;  4LF8 I;  5DNL A;  4JYA I;  4B3M E;  2J65 A;  4X66 I;  2WP8 B;  1HK7 A;  4YHH I;  1E3P A;  5GME A;  4LPF A;  1Y60 A;  2VQE I;  2O1U A;  4X62 E;  4AQY E;  4B3R I;  2O1V A;  4MU4 A;  5K36 D;  1KIJ A;  1HNX E;  1KTV A;  3H4L A;  1DAR A;  2C39 A;  1FNM A;  4DXL A;  3HJC A;  5EL9 A;  4LF7 I;  2C39 B;  4P52 A;  2VQF E;  3PS3 A;  1Y6Z A;  1UDO A;  4IZK A;  5LMN I;  3J80 C;  1H7U A;  4HYM A;  5IWA E;  2O1W A;  4LCG A;  3ZKD A;  4BA2 A;  2OI2 A;  4OO1 C;  1B62 A;  1IBM I;  2F1D A;  4DV1 I;  1PKP A;  1NZ0 A;  4JI6 I;  2GO3 A;  2HFU A;  4AIM A;  1XXE A;  4FWG A;  5DRO A;  2J7K A;  5FLX C;  3Q6M A;  2NPF A;  2NN6 C;  3HKM A;  4DR7 E;  4DV7 E;  5LMU I;  4LF4 E;  4DUY I;  4UT4 A;  1QZR A;  5JEA F;  4DV2 I;  4JI5 E;  5C0X A;  5BR8 E;  3LTO A;  3P3G A;  2V2Z A;  2DEI A;  2LJP A;  3JAM C;  2CG9 A;  4OX9 I;  5C0X B;  5K36 C;  3P3C A;  1Z0E A;  1HR0 E;  1YH8 A;  5DRQ A;  1UDN A;  2E5L I;  1D6T A;  4DPY A;  4DV0 I;  1N32 E;  1N36 I;  4DR1 I;  4DV3 E;  2JE6 A;  2E1R A;  4JI4 E;  1OYS A;  2ZIT A;  1HNZ E;  3LPS A;  2C37 A;  3M7N G;  1UEK A;  4DR6 I;  2UUC E;  4WUB A;  4YY3 E;  4X65 E;  3J81 C;  1N33 E;  4NXN I;  1EA6 A;  2JE6 B;  1XNR I;  1ZM3 A;  4ED4 A;  4X64 E;  2C37 B;  5JEA E;  1N0U A;  1S4E A;  2PNM A;  4DV6 E;  1XMQ I;  3T1Y I;  1EI1 A;  2UXD I;  3CDI A;  4IZJ D;  5DRR A;  1I94 E;  2CZ9 A;  4LFB I;  4U3B A;  4DR4 I;  4JI8 I;  4DR5 E;  3PYF A;  2WNR A;  2O1T A;  4DU8 A;  2JEA A;  4B3S E;  2UXB I;  2PNZ A;  4MYU A;  5A2Q C;  2WNR B;  4B3M I;  4PRX A;  4FW5 A;  1HNW I;  2ZM6 I;  1VI7 A;  2IER A;  2IES A;  4USM A;  3J80 Q;  3V5R A;  4LOM A;  2NN6 D;  4IFD C;  4J3D A;  4AQY I;  1Y4S A;  4OO1 A;  1Y5Y A;  3K85 A;  4LFC I;  3M85 D;  4JI1 E;  3GON A;  4WUC A;  1MU5 A;  1E3H A;  4PRV A;  4QNJ A;  1Z0W A;  4GKK E;  4DV4 E;  3M6A A;  3CDJ A;  2UXC I;  4K0K E;  3J7A M;  4JI0 E;  4WUD A;  1XNQ E;  4NXM I;  1YHC A;  2CVE A;  4HY1 A;  3UHM A;  4DPU A;  5LL6 R;  3H1C A;  5IWA I;  1ZXM A;  1ZM4 A;  5C0X F;  3PRY A;  2BA1 D;  4JI3 E;  4DUZ E;  1MG7 A;  1FJG E;  5JEA C;  3QT5 A;  2UUB I;  4LF6 I;  4IZK B;  2F4V I;  3K17 A;  4X66 E;  4IS9 A;  4LF9 I;  4YHH E;  1NHH A;  1WUU A;  2VQE E;  2V34 A;  4DV7 I;  1Z5A A;  4B3R E;  4BA2 B;  1IBL I;  1R6L A;  1N34 I;  4GKJ I;  2VES A;  1XMO I;  4LCF A;  1NHI A;  1USU A;  3WU4 A;  4JV5 I;  4P7A A;  4ZVI A;  2JT2 A;  2A2D A;  4ISA A;  4LFA I;  3OTO I;  5IT9 C;  1Z0T A;  1Z0B A;  5C0X E;  2BA0 G;  4JI7 I;  4Z7Y A;  3WU3 A;  4DR3 I;  2UUA I;  4IFD D;  3Q6N A;  2HHH I;  2JEB A;  1P42 A;  2X36 A;  1IBM E;  4DR2 I;  4DV1 E;  4Z7C A;  2X7I A;  1FWL A;  2JEB B;  1ELO A;  4X65 I;  2UU9 I;  3D4J A;  4PU9 A;  1U2R A;  2O3Z A;  3U1Y A;  3LNU A;  2XEX A;  2BR2 A;  4OO1 F;  1IBK I;  4LF5 I;  4DUY E;  1BKN A;  3GLL A;  1ZM9 A;  4DU7 A;  2Q2E B;  5GMD A;  2BR2 B;  4DV5 I;  1H72 C;  4DV2 E;  4B3S I;  3B78 A;  3PS2 A;  1H73 A;  2IOQ A;  5JEA D;  1J5E I;  3QT6 A;  4MU3 A;  4JI2 E;  2E5L E;  4OZE A;  4DV0 E;  4FWD A;  4R1F A;  1N36 E;  4DR1 E;  4KHP E;  1FI4 A;  5L3J A;  2JEA B;  3PS1 A;  2A2C A;  1RR9 A;  2PNZ B;  1UDQ A;  3ZZT A;  4OO1 E;  2EFG A;  4DR6 E;  5K36 F;  4X62 I;  5C0X C;  4BA1 A;  4USK A;  1XNR E;  4B3T E;  2HKJ A;  4K0K I;  1HNX I;  1PIE A;  3Q1Q A;  3U1K A;  2PO0 A;  3KRN A;  4BA1 B;  1XMQ E;  4OO1 B;  3T1Y E;  2UXD E;  2HKE A;  1Z0V A;  4DR4 E;  2PO0 B;  4JI8 E;  2VQF I;  2NN6 A;  5FLX Q;  2HFS A;  1Z5C A;  1UDS A;  5DRP A;  1RRE A;  3DD6 A;  2R3V A;  1A6F A;  2AJ4 A;  2GS8 A;  4FW4 A;  1Z59 A;  2NN6 B;  5IT9 Q;  1HNW E;  4FWH A;  4M1K A;  1VIS A;  2ZM6 E;  4N3O A;  5ELW A;  4UTG A;  5K36 E;  2R42 A;  3B4T A;  3T1H E;  2GQ0 A;  2ZBK B;  1Z5B A;  3P76 A;  3P3E A;  4FN5 A;  3JAM Q;  4LF8 E;  4JYA E;  2PO1 A;  5K36 A;  1H7S A;  4LFC E;  3M7N D;  1OYR A;  2BV3 A;  2PO2 A;  3P06 A;  4DR7 I;  2PO1 B;  5K36 B;  4FW6 A;  1MX0 A;  1PVG A;  1Z0G A;  4LF4 I;  4IFD F;  2UXC E;  2PNL A;  2PO2 B;  1B63 A;  4AID A;  2GO4 A;  4JI5 I;  4NXM E;  4JG4 A;  5BR8 I;  3L7Z A;  4DPX A;  3J81 Q;  3PYG A;  2AE8 A;  3F0N A;  2V2Q A;  4LF7 E; 
#chains in the Genus database with same CATH homology
 3V2U C;  4HXZ A;  5LMN E;  1HR0 I;  2Z5C A;  3J7A G;  1N32 I;  2UUB E;  4LF6 E;  2V8P A;  2F4V E;  3PYE A;  4DV3 I;  2Z5C B;  4LF9 E;  4JI4 I;  1XHK A;  4JI6 E;  3ZZ0 A;  1HNZ I;  2UUC I;  4YY3 I;  5FWK A;  1IBL E;  1N33 I;  3CWV A;  5A2Q Q;  1K47 A;  3HUL A;  4HAC A;  2BM1 A;  3ZKB A;  1N34 E;  4GKJ E;  4EMD A;  2DEJ A;  1XMO E;  4X64 I;  1USV A;  4URL A;  3WU6 A;  4DV6 I;  4JV5 E;  4FW9 A;  4DPT A;  4HAC B;  2BM0 A;  5LMU E;  4LFA E;  1I94 I;  3OTO E;  1FWK A;  4JI7 E;  4DR5 I;  3ZM7 A;  4DR3 E;  4JI2 I;  2Z5E A;  2UUA E;  1Z0C A;  2V2V A;  2HHH E;  2HK2 A;  4KHP I;  4DR2 E;  3QT8 A;  4OX9 E;  2IOP A;  1ZXN A;  1S16 A;  4KQV A;  1NHJ A;  2UU9 E;  1H74 A;  4MYT A;  1Y4U A;  2VF3 A;  4B3T I;  3K1J A;  4JI1 I;  1N0V C;  1KVK A;  1IBK E;  4IZJ A;  4LF5 E;  2Z5B A;  4NXN E;  3QT7 A;  4GKK I;  4DV4 I;  4DV5 E;  1OJ4 A;  3WU5 A;  4IZJ B;  2CGE A;  1FKA E;  2Z5B B;  4JI0 I;  3ZZU A;  1XNQ I;  3B8H A;  1KKH A;  4LFB E;  1J5E E;  1ZM2 A;  4XTJ A;  2HK3 A;  3PYD A;  4DPW A;  3B82 A;  4JI3 I;  2UXB E;  4RPF A;  4DUZ I;  3T1H I;  2WW4 A;  1FJG I;  4I3H A;  4LF8 I;  4JYA I;  4B3M E;  4X66 I;  1HK7 A;  4YHH I;  5GME A;  2VQE I;  2O1U A;  4X62 E;  4AQY E;  4B3R I;  2O1V A;  1KIJ A;  1HNX E;  1KTV A;  3H4L A;  1DAR A;  1FNM A;  4DXL A;  3HJC A;  4LF7 I;  4P52 A;  2VQF E;  1Y6Z A;  4IZK A;  5LMN I;  3J80 C;  1H7U A;  4HYM A;  5IWA E;  2O1W A;  3ZKD A;  2OI2 A;  1B62 A;  1IBM I;  4DV1 I;  1PKP A;  1NZ0 A;  4JI6 I;  2HFU A;  4FWG A;  2J7K A;  5FLX C;  3Q6M A;  2NPF A;  4DR7 E;  4DV7 E;  5LMU I;  4LF4 E;  4DUY I;  4UT4 A;  1QZR A;  4DV2 I;  4JI5 E;  5BR8 E;  3LTO A;  2V2Z A;  2DEI A;  2LJP A;  3JAM C;  2CG9 A;  4OX9 I;  1Z0E A;  1HR0 E;  2E5L I;  1D6T A;  4DPY A;  4DV0 I;  1N32 E;  1N36 I;  4DR1 I;  4DV3 E;  2E1R A;  4JI4 E;  2ZIT A;  1HNZ E;  3LPS A;  4DR6 I;  1UEK A;  2UUC E;  4WUB A;  4YY3 E;  4X65 E;  3J81 C;  1N33 E;  4NXN I;  1EA6 A;  1XNR I;  1ZM3 A;  4ED4 A;  4X64 E;  1N0U A;  1S4E A;  2PNM A;  4DV6 E;  1XMQ I;  3T1Y I;  1EI1 A;  2UXD I;  4IZJ D;  1I94 E;  2CZ9 A;  4LFB I;  4DR4 I;  4DR5 E;  4JI8 I;  3PYF A;  2O1T A;  4DU8 A;  4B3S E;  2UXB I;  4MYU A;  5A2Q C;  4B3M I;  4PRX A;  1HNW I;  2ZM6 I;  3J80 Q;  4USM A;  3V5R A;  4AQY I;  1Y4S A;  3K85 A;  4LFC I;  4JI1 E;  3GON A;  4WUC A;  1MU5 A;  4PRV A;  1Z0W A;  4GKK E;  4DV4 E;  3M6A A;  2UXC I;  4K0K E;  3J7A M;  4JI0 E;  4WUD A;  1XNQ E;  4NXM I;  4HY1 A;  4DPU A;  5LL6 R;  5IWA I;  1ZXM A;  1ZM4 A;  3PRY A;  4JI3 E;  4DUZ E;  1MG7 A;  1FJG E;  3QT5 A;  2UUB I;  4LF6 I;  4IZK B;  2F4V I;  3K17 A;  4X66 E;  4LF9 I;  4YHH E;  1NHH A;  1WUU A;  2VQE E;  2V34 A;  4DV7 I;  1Z5A A;  4B3R E;  1IBL I;  1N34 I;  4GKJ I;  1XMO I;  1NHI A;  1USU A;  3WU4 A;  4JV5 I;  4P7A A;  4ZVI A;  2A2D A;  4LFA I;  3OTO I;  5IT9 C;  1Z0T A;  1Z0B A;  4JI7 I;  4Z7Y A;  3WU3 A;  4DR3 I;  2UUA I;  3Q6N A;  2HHH I;  2X36 A;  1IBM E;  4DR2 I;  4DV1 E;  4Z7C A;  2X7I A;  1FWL A;  1ELO A;  4X65 I;  2UU9 I;  3D4J A;  4PU9 A;  1U2R A;  3LNU A;  2XEX A;  1IBK I;  4LF5 I;  4DUY E;  1BKN A;  1ZM9 A;  4DU7 A;  2Q2E B;  5GMD A;  4DV5 I;  1H72 C;  4DV2 E;  4B3S I;  3B78 A;  1H73 A;  2IOQ A;  1J5E I;  3QT6 A;  4JI2 E;  2E5L E;  4DV0 E;  4FWD A;  4R1F A;  1N36 E;  4DR1 E;  4KHP E;  1FI4 A;  5L3J A;  2A2C A;  1RR9 A;  3ZZT A;  2EFG A;  4DR6 E;  4X62 I;  4USK A;  1XNR E;  4B3T E;  2HKJ A;  4K0K I;  1HNX I;  1PIE A;  3Q1Q A;  1XMQ E;  3T1Y E;  2UXD E;  2HKE A;  1Z0V A;  4DR4 E;  4JI8 E;  2VQF I;  5FLX Q;  2HFS A;  1Z5C A;  1RRE A;  2R3V A;  1A6F A;  2AJ4 A;  2GS8 A;  5IT9 Q;  1Z59 A;  1HNW E;  4FWH A;  4M1K A;  1VIS A;  2ZM6 E;  4N3O A;  4UTG A;  2R42 A;  3T1H E;  2GQ0 A;  2ZBK B;  1Z5B A;  4FN5 A;  3JAM Q;  4LF8 E;  4JYA E;  1H7S A;  4LFC E;  2BV3 A;  3P06 A;  4DR7 I;  1MX0 A;  1PVG A;  1Z0G A;  4LF4 I;  2UXC E;  2PNL A;  1B63 A;  4JI5 I;  4NXM E;  4JG4 A;  5BR8 I;  4DPX A;  3J81 Q;  3PYG A;  3F0N A;  2V2Q A;  4LF7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...