1Z0DA

Gdp-bound rab5c gtpase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGLERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords Ras-related protein Rab-5C
total genus 56
structure length 165
sequence length 165
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0dA00
2J5XA 4TL7A 3HWSA 1E9AA 1UEIA 1E3MA 2N46A 1KI9A 4NYJQ 4B34A 1PLLA 1G1MA 3WHLA 4PZYA 4FN5A 1W0KA 3IO3A 3L0SA 2BKEA 3EAQA 3U3OA 1HA3A 2CDNA 2VF8A 1N6LA 5C4GB 3GP8A 3IQWA 2BCGY 2QTVB 4RKEA 2IUUA 2NZJA 4HB3A 1F2UA 4C0JA 4D0NA 4JLBA 3U44A 3VQTA 1DAHA 2ATVA 4JKIA 3SU8A 5J4KA 3T61A 1A4RA 4R71A 4U02A 5HCIA 2R8RA 3A36A 2O8BA 2J0SA 2QTHA 4A8JC 4TL8A 2ORWA 3VFDA 3DMDA 1KJYA 2GEDA 3GLFA 3R7WB 4GP6A 2ZRCA 2ZRAA 1OH5A 1G5PA 3Q7PA 2QUZA 1PUJA 4DCNA 5L3VA 4NU0A 5JEEA 2GJSA 421PA 4Y0AA 4WA7A 1N6NA 3WMEA 1MRSA 1GG2A 4KFSA 1MO6A 3NDBB 2QT1A 2ODNA 4M9ZA 4BASA 5DLQC 3P32A 4JBXA 4X8MA 2XGJA 2XITA 1OFUX 2J7PD 4DRZA 4F93B 1LNZA 5L3RA 4NYIQ 4LBYA 1YR6A 1Q44A 3LNCA 2FWRA 3KJGA 3LAWA 4JVMA 3WY9A 2GKSA 5CIWA 4DLXA 3ASZA 4IEIA 4M1YA 4CEIA 4DLTA 3K0EA 5JWRA 1NMYA 2WSSD 1U81A 1W5TA 1Z0DA 2H57A 2UVQA 3B9QA 4ARZA 2BV3A 2FV8A 4MRRA 3NHBA 5FBLB 3ICQB 3FHCB 1XCPA 1T9HA 5SZIA 3FMIA 1P4SA 3T34A 4ABYA 1F5NA 1IM2A 4RFSB 1KMHB 2ZRNA 3EZ2A 2H17A 4OYHA 3FHTA 1ZVQA 2G0TA 5UKDA 2IXEA 4TSFD 1Z06A 5CK4A 1SVSA 2W6ID 1H8HD 1ZJ6A 2EFCB 1RKBA 4K8OA 3BERA 2W6IA 2ZAMA 4ZO4A 1I4TD 3TJZA 2ZJZA 3PEVA 4RCZA 3K0FB 2GJKA 2V6IA 4DCSA 1NL3A 4OQMA 3IQXA 1AZSC 2JJ2D 3CW2A 3NH9A 2GJ9A 2AK2A 1SVWA 2GZAA 2YJTD 3AVWA 5DYIA 1KI6B 1E79D 3U7GA 1VKJA 2QL6A 1GRQA 2CK3D 4C3ZA 1RYFA 4O0MA 4F92B 2ZRJA 3OEHD 2P65A 2QQ0A 1ZRHA 3FMPB 3PEYA 3LW8A 1Q1BA 1Z5ZA 2F43B 4Q4AA 3NH6A 2N1BA 4ACBA 2CVHA 1XD9A 2VF7A 3JZMA 2HF8A 5FTLA 2RGNC 3B60A 3TVTA 2D7DA 3HU2A 1SZPA 3QY0A 4GFDA 1DG3A 5DI9A 1RJ9B 3IIMA 1KNXA 4BLTA 1XJCA 5JCZA 2XAUA 3HR8A 3DVLA 5JHHB 3VNUA 4B33A 4FD2A 2RGNA 3H4MA 1QHGA 3TH5A 1CJTC 1BMFD 1E2PA 5JRZA 3AM1A 1UBFA 2ODBA 5FPTA 4IHQA 1ETUA 4DSNA 2YC4C 1W4RA 2PL3A 2UZIR 2QPAA 1Q3TA 2A30A 3NG1A 4RVCA 3RABA 2Q3FA 3WP1B 1ZC4A 2VH5R 4ASUA 2ZU0C 2J0QA 4Q9JA 5B57C 4EQ6A 2YVUA 3Q72A 1F3OA 4BZQA 5GVSA 1NNEA 1X8JA 2RB4A 2QE7D 4EFLA 3AVTA 2EWWA 3QKRB 2JDID 2GXSA 1OKKD 4A0GA 1HV8A 4CDGA 4GZMA 1IN5A 2OCAA 3BXZA 5FUVA 2GF9A 2NO1A 4LBZA 3AUXA 3RS3A 3U7HB 1A7JA 5AUQA 3C16C 2GDJA 4IDHA 1CIPA 3C41J 4LV8B 4FMCB 3VX3A 3PQCA 4B75A 5AUOB 1DARA 3P4XA 4HI0E 1Z0FA 4M4SA 4NP6A 1OF1A 1QDEA 3HU3A 4BFYA 4LPKA 3L8YA 1UKZA 2GCNA 2OM2A 4RY2A 3V4RA 4I4LA 4IDPA 4ZCLA 4DLSA 3U60B 1GUAA 2I3BA 2XZPA 4HATA 2C04A 2P67A 4F38A 1W36D 4QGGA 3AGPA 1OFIA 2YWEA 1SULA 2D4HA 2IYVA 4B71A 2HJGA 2EWVA 3EARA 5AUNB 4C4PA 4JLDA 3QF4A 4KJZA 4TLBA 4MRSA 4AKGA 3DMNA 2ZXUA 5TXGA 4JYCA 1N6KA 4W7SA 4MKIA 1IY0A 1MKYA 1OV4A 1PUIA 4OHWA 1OSNA 1QHXA 4JLJA 4ZDJA 3AF3A 1TF2A 1UAAA 5D3MB 3NBXX 3B1YA 4Z51A 4QKQA 1YU9A 2NQ2C 3RDPA 2CJWB 1TEXA 1TF7A 2JLWA 4G3XA 2JLSA 2FU5C 2GBLA 5C4MA 1P62B 4PO9A 3UG7A 1P2UA 2P5TB 2XTZA 1V5WA 3AVVA 4O2LA 5CYPA 1EX7A 3SFZA 4B3CA 2ZI3A 1KTVA 2W00A 4AYXA 1R7RA 3OFND 5KUTA 2IYTA 1S1CA 2OXCA 4PAMA 4QHTA 4Z8YA 3BBPA 5ANRB 4HLUC 5J4HA 4N3NA 1J90A 5AJXA 1IXRC 3ZVMA 5FFMA 2AWOA 5KU1A 3PEWA 4HZUA 3ZLJA 5KNDA 2NGRA 3I4LA 4NONA 2OCPA 2WJHA 2CJWA 4QC2A 2K5UA 2XX3A 1R5NA 1P9RA 4Q4HA 2G77B 3SJBA 5KYKA 1LB1B 1EK0A 1ODFA 5E4FA 2KBEA 4D0GA 3CONA 3NKVA 2QEQA 1Z0KA 3CNOA 3N2IA 1XEFA 4QFMA 4PZZA 4CEJB 4KFUA 1D2EA 3BAFA 5CJ2A 4LYFA 1M7BA 3Q3JB 3KKOA 4G0NA 5JCPA 2CVFA 1ZU4A 1ANKA 1QBKC 4DCUA 3AVQA 1F2UB 3KTAA 3OE7A 4URVR 1E9DA 2ZI9A 2QP3A 2Q3HA 5L3QA 4LC0A 5FL7D 4R2IA 3QIAA 4XIGS 4MITA 4Q4JB 4DSTA 4BGDA 5CK5A 1XPOA 4XTRA 1EFHA 3R7WA 1G9XA 1GDDA 4HDQB 2WIAA 2XOKD 4PHHA 2IYXA 2FG5A 3VR3A 3ZS8A 4B3XA 2V55B 1DS6A 4ERNA 4HZIA 4QGHA 1E94E 3L43A 5DYGA 4UNRA 3ND8A 1DBSA 4P4UA 1AM4D 4M1MA 4XOIA 1KI8A 4AKEA 4D80A 5CM8B 1OXXK 3KX2A 1XMSA 4Q01A 4KO8A 3T1TA 4LYHA 3AVYA 1EGAA 2BJVA 4A6XA 3HU1A 4LJYA 3SR0A 3M1IA 4ZPXA 2CLSA 2E1RA 4GMDA 4PQRA 3EIEA 2ATXA 2QMOA 1JJ7A 1D8TA 4BQSA 3K9HA 1DG1G 4UXIA 1TQ6A 1SXJE 4PPFA 3QBTA 3LQQA 4XVQA 3SC3A 3PIRA 4DT1B 3DO6A 1SVOA 1R8SA 1FZQA 1NIJA 4B3BA 1E9EA 3FMOB 5H1YA 1S0UA 4JLNA 1W2GA 1ZCAA 4US0R 1QG2A 1ZNXA 1OIWA 2VIIA 4Q1EA 4TYQA 5JMTA 4JJKA 2WJJA 2IL1A 1XMIA 2J45A 4WZ6A 1NY6A 3BJIC 4Q7LA 4NKRA 2ZANA 1HH4A 3IPYA 4I1SA 4M9XA 3UG6A 2XJ9A 5IRCD 4LDJA 3FGNA 4OHVA 1TMKA 4XVRA 3EASA 5BW8A 2GJAA 3C8UA 1W0JD 3LFUA 3GJ8A 5P21A 1AKEA 4Y0VA 1SXJC 5EXXA 2DWPA 2XTNA 5DN6D 1U2RA 3QEJA 1U0JA 3OIWA 2OCBA 4IVRA 4KFTA 4PC1A 3EZ7A 1E98A 4NYMR 2XZOA 4YMSA 1HUQA 2D2EA 1KI7A 5TDHA 1E0KA 3C7KA 1XB2A 1LV7A 3DDCA 1TUEA 3DM5A 3SEAA 4JMPA 2VYFA 621PA 5E7IA 3LA6A 3G82C 2IYYA 2MSEB 2XSZD 1QHHB 3IHWA 2ZEJA 2Q9CA 1E2FA 2P2LA 5K8TA 3RRYA 3MD0A 1ZP6A 3B85A 3TAHA 5KO2A 1X1RA 2KB0A 4TYWA 1FX0B 4II7A 3EW9A 1ZMXA 4CEHA 2WKPA 3BORA 1CU1A 3CF6R 2QBYA 3IPXA 3A1VA 1ZUHA 2HF9A 2OAQ1 4W5HA 4ZIRA 2PJRA 1EG7A 3W90A 1E1RA 2OFWA 5LBIA 3X2SA 3ZVRA 1E9SA 2JIZA 3SOPA 1T8UA 2WWHA 4Q03A 4C30A 1YZTA 2QMHA 2XNDA 2PCLA 3TUJC 2YNMA 1H8EA 4EPTA 4MYTA 5L8VA 2JCSA 4B3DA 2J7PA 5HE9A 1HT2E 1I4LD 2IS1A 3CH4B 3OFNA 3FFAA 4BFSA 4WOPA 3FMFA 2H7VA 1YZGA 1YZUA 4L4UA 3ZQ6A 1XWIA 2DBYA 4PR0A 4AKHA 1KDRA 3EA0A 5A4JA 2JEOA 1IOZA 1XTIA 2WSSA 3B9PA 1WE2A 1TX4B 121PA 3UKDA 1Z0AA 3THWB 5EP1A 1Z2AA 4HUQA 1FMLA 1NVUQ 1E2KA 3QKRA 2BDTA 2VSXA 5LB2A 3CPHA 4LI0A 3IO5A 4UXJA 4BRUA 3VR4A 3CX7A 5EE5B 4TTRA 1CXZA 2ZITA 4M53A 3AH8A 1CLUA 5TV2A 2QAGA 1VHTA 1YRBA 4YDSA 5E3HA 4DLWA 1LTQA 2ZJ5A 4X8LA 2IYUA 1Z0JA 1JPNA 4PC3A 2O8DA 2BEKA 2NO9A 1W1WA 2ZI7A 2G9NA 4FCWA 2Z5FA 3RVBA 1G3IA 4NCHA 1W2HA 1WQ1R 3THXA 2F1HA 2HLDA 1ZNYA 1DAFA 3GLFB 1MV5A 4YXWA 1IN7A 1JECA 3FVQA 1KJWA 5IK2A 1XRJA 3A8TA 2QM8A 5CYOA 4D26A 1JR3A 3QKSB 1MO3A 3U3RA 1FNMA 3QENA 1KO5A 1C9KA 1OIVA 1E2NA 1FTSA 2X19A 1KO8A 1U90A 5HE8A 5SZHB 1IY1A 1M74A 1E2DA 3KJHA 3AF1A 1PV4A 2DWOA 4E5UA 2HEIA 4JBWA 2FSIA 4A2WA 2Z43A 3NXSA 3NBYC 4P4SA 3U2QA 1NSFA 2FEOA 2QQEA 3AF2A 4QBGB 1KIMA 1CS4C 4BFUA 1E0AA 1XJQA 3CRW1 5B30A 2OCYC 3WRXC 1S96A 1KZ7B 3PUZA 1EFTA 4LJ5A 4BEBA 1K6MA 4TQUS 2ZE7A 4FXPA 4AKIA 5HKKD 5DSZA 1KKMA 2OBLA 2C9CA 2IA5A 3Q8XB 1J2JA 1M2OB 3MWYW 5LB4A 3DEFA 1OFTA 3K0SA 2V7QA 1JBKA 2B21A 3GCGA 2PLRA 4OJKA 2JLVA 3HYTA 3ZH9B 1U0HC 5CIQA 3NEYA 4P0TA 3AVUA 3C14C 3MUFA 4UJ3A 4MKGA 3VR1A 4AYTA 2ZTSA 4KVAA 4Q19A 2ONKA 4WZBE 3VKGA 4DHEA 4FI3C 4BFWA 2ZRDA 1P3JA 2WKQA 1EX6A 1ZYUA 3R8FA 3W34A 2ZE5A 1OKKA 2KBFA 3L82B 4BLSA 3A1TA 5JI2E 3U6KA 4JLAA 5KSOA 4URYR 3IEUA 1NVVR 3O8RA 1KDPA 1FP7A 1G6HA 1YKSA 1W4AA 1W49A 3ECCA 4HAVA 4IRUB 3SFVA 2RHMA 3FE2A 3AVOA 3WBJA 4A9AA 2NPFA 2AL7A 4MYCA 3K0FA 2GNOA 2V54A 4N1AA 4JS0A 3IGFA 1RIFA 4QBIA 2NOAA 5EP3A 2IYWA 1OLOA 3GLGA 3MSXA 4BLPA 2WOJA 1BOFA 2PX3A 1V43A 4B43A 1RE0A 4PHGA 1SVMA 4OQLA 3W6PA 1IBRA 4U00A 1NJFA 3BGWA 1ZINA 1OXVA 2XXAB 1Z6AA 2O0KA 4I81A 2LCFA 3ZJYA 1XZQA 4C0HA 3KTAB 2ZYWX 2A9KA 1N5LA 4Q47A 1E4YA 1ZD9A 2BIFA 2J9RA 2ZROA 2V4ZA 4WXPA 4LHVA 5IF9A 5JJLA 4N0EA 1A1VA 3U7FB 2DWQA 4C0QC 4CGZA 1NKSA 4DSOA 1ZBDA 5F2EA 2QI9C 1A5TA 2VL7A 3NC1C 4KBFA 2QRNA 1KY3A 2IK8A 4LPSA 2AKYA 2J0UA 3VAAA 1W44A 1JJVA 2Z83A 5JBQA 5F3WB 4F4JA 2QE7A 2P5SA 1JNYA 1XD2B 1AGRA 1W47A 1XFAA 3RS4A 2BBTA 2AHOA 3D31A 3QE0A 4ZKDA 1KI2A 2GBLC 2W2TA 5G40A 5CDFE 1KOFA 3I72A 2DFLA 4L9SA 3ICEA 4FMDF 2Q21A 4I1VA 3BD9A 1DAMA 2WWFA 2P3SA 4US1R 4EPXA 2FSGA 1IJEA 1EFUA 1R10A 4D4JA 5KSZA 1X8LA 1EWRA 3RWMB 1AGPA 3T1VA 5DNYB 2X1VA 2RAPA 5FUXA 3SJCA 2VHTA 4L16A 5DN6A 4CT4B 3EZ9A 2D7CA 5TVKA 3DZ8A 5GADl 5IDVA 2MSDB 4AURA 4BUJA 2MMGA 2PJZA 4MH0R 3LBHA 3PUYA 3VR5A 1OXUA 4BRWA 2G1KA 3ND9A 3ONWA 2BMEA 2HYIC 4PSKA 3AQ4A 5FPKA 2HUPA 4OK5A 2ECKA 5CB8A 2GESA 4UJ5A 5JHGB 1WMSA 1SKYB 5K8IA 4LJ6A 3LX8A 4X8HA 5FBRB 1U9IA 5KNBA 1SGWA 2H8KA 5FBQB 4P33A 4V0LA 3NIBA 4HB0A 3VU9B 1FP6A 1IAQA 1NN1A 2QRZA 1X3SA 2Z0MA 2DR3A 4A36A 1Q3HA 1ZU5A 2ZJYA 3W5JA 2QY9A 5TB5A 3UWOA 3KFVA 2CK3A 3FFBA 4NE2A 4PAQA 2RKOA 4IVPA 2JJ1A 2QPTA 4IOLA 4A82A 4IVQA 2Y8EA 5FTMA 1SXJD 2WM9B 4Q1CA 3ZD7A 4QGAA 4DJTA 1YHNA 4URUR 1IY2A 1CRPA 3FPAA 1H65A 1HQCA 2WWGA 1QHNA 2W0SA 1I4DD 1AN0A 4TMZA 4AD8A 3ZS9A 4RKFA 3ADCA 2GZDA 4E09A 2X2EA 4HDOB 1VG8A 1FOEB 2OHFA 3FHOA 2ZSFA 4IDOA 4P3YA 3WYGA 2ANCA 1RRGA 5JZVA 3GJ3A 1NSTA 1YR7A 2QA5A 2EYQA 5TARA 4IOKA 3T35A 4C0KA 2GXAA 1G8HA 2QBYB 3VTKA 1II8A 4FMBB 2GCPA 1KGDA 3A6PC 4Q02A 5A5GA 3K9LA 3CRMA 1X8KA 4TTPA 1GRNA 3QF7A 2FPMA 1NBMA 3PUWA 4GBMA 4GPTA 3C5CA 2ZJOA 1XMVA 4V02A 1CULC 2R44A 3CX6A 3TUIC 4ZDKA 1OE0A 2ZVPX 2BMFA 4A2QA 4GMXA 4OK6A 3FTQA 2IF2A 2IBMA 4HB4A 1FTNA 1XZPA 4Q4HB 1CJUC 1XEXB 3OEEA 3VKWA 2D74A 2A3RA 1W5SA 1NVXQ 2ZYTX 1XCMA 5IT5A 3Q7QA 2GAOA 4Z8XA 4EDHA 2YV5A 5CJPA 4NCKA 1E79A 2AXPA 1G7TA 1VMAA 1XEWX 2F6RA 4UQOA 4P4TA 5AJWA 3EX7C 2GHIA 4DDTA 2JLUA 1Z08A 2ZIAA 3RYTC 1I2DA 2YWHA 2OEPA 1EWQA 3E2IA 3R20A 3Q9LA 2BM0A 3LW7A 2P6RA 4QJ4A 2ZRMA 5L3QB 4KV9A 4V0NA 4M1SA 2GXQA 2H92A 2QAGB 2QENA 5HPYB 2ODWA 4KYUA 1R6BX 4MKHA 1W36B 4HAYA 2XXAA 3BH0A 3N5CA 1MO5A 1LS1A 1JAHA 4RD6A 2QNRA 3I5YA 4QOSA 1GP2A 3THYA 3QPVA 1G64A 2ZSEA 3RNLA 5BYJA 3KXKA 4MGYR 1UDXA 4LGMA 3TSWA 2ZRPA 3ZQJA 1CP2A 4HUTA 3U44B 3DKVA 1T3HA 4HAUA 3RRZA 3X1YA 4D81A 3K9GA 2ZYVX 1G3MA 1HEIA 2ZRIA 4URXR 3W6NA 4K81B 2ZQ5A 5EZ5A 2KSQA 4UNNA 5H68A 3V9PA 4C2TA 4HAZA 4MQBA 1ZM9A 2J3EA 3AUYA 2KJQA 2CBZA 1XPRA 1HYQA 1AA9A 1JQJC 1A2KC 1RW4A 2BBSA 4HDCA 2PZFA 4P4SB 2GK6A 3WNDA 4QM6A 5JJKA 2QU8A 2ORIA 2JDIA 1CJMA 1KMHA 1TNDA 5H8WA 3R9WA 2BKUA 4KITB 3RC8A 4R9UC 4B74A 5BXQC 3VR2A 4V0MA 4Q9HA 3GLGE 3SN6A 5B2ZA 1I2MA 4O3MA 2OILA 1KMQA 3S1AB 1TEVA 2IUTA 2C77A 2YWFA 4BLOA 2VHUA 2C98A 2BWJA 3DKPA 1S9DA 4KFRA 4MKFA 3VU9A 4CIDA 2ZUDA 1GITA 1WF3A 4PQYA 4A8JB 4B2PA 1T0JB 1QRAA 3SE0A 1NP6A 3P27A 3H1TA 3KKPA 3KQNA 4JLOA 4C0AC 4TMXA 2OV2A 1RPZA 2VP4A 4F4IA 4JLVA 1RC8A 1ZM3A 3UMRA 3AV0B 2WWIA 3FYHA 2ZRLA 3B1ZA 4MGZR 5JFGA 4GRAA 2F1IA 1VHLA 1G291 2VHJA 4M1TA 1XXHB 4G5RA 4NDZA 5JSZB 3IIKA 1E6CA 5AWFC 4PANA 3NVAA 3GMTA 2CCKA 3D6TB 2FH5B 3QXHA 4B76A 4DLUA 1YR9A 1AKYA 2IF0A 4V0KA 1Q0UA 4EFMA 1DVRA 1TQDA 4DZZA 1E32A 3W3AA 5FUWA 5CITA 1IONA 1UBCA 4M1OA 1R0WA 2P0EA 1DAIA 1NY5A 3NBFA 3O8DA 1XP8A 2NO0A 4JVSB 3CRVA 1QHHA 2V3CC 4DB4A 3U3KA 3GLIE 1Z6TA 2R6CA 1AIPA 3PVSA 2GCOB 3L8ZA 3C5HA 2WPDA 4QBFA 3CZPA 1VTKA 2FE4A 2WPDD 5JJIA 1ZNWA 3CR8A 2FFBA 2ZJAA 3G5UA 5KDLA 1HY3A 1NN3A 3TGPA 2WTUA 4Q4JA 3TRFA 1KI1A 4DUGD 1VG0B 1A82A 2VSFA 4ON9A 2PZEA 4WW0A 2VTKA 3LY5A 3HDTA 3LWNA 1XX6A 3CPEA 3F8TA 2ERXA 1Y3AA 2GJ8A 2HCBA 1DOAA 1NBMD 1E69A 3TE6A 4HUQB 1YE8A 3U6BA 1TQ4A 4RZUA 5IHPA 2JLXA 2FDCA 3ADDA 3K70D 3KKMA 4D0LB 2F55A 2ZS8A 2FGKA 2FPKA 4GI7A 4AY2A 2IWHA 3K0AB 1FNNA 1OXTA 4NYJR 4PHFA 2W2VA 1VCNA 3B2EA 1E9CA 2X77A 1KDTA 4IJMA 1KSHA 1TUIA 4GSYA 3BFVA 5EP2A 3SQWA 1JAIA 2ZRHA 4MUBA 1D6JA 3IDQA 5FPSA 5EE9A 4W5WA 2REOA 2WKRA 2C8VA 3MWLA 2WVJA 1XCGB 2HT1A 1L2TA 4R98A 3ZIAD 4NL4H 5BN4A 3I5XA 5DHFA 3TW8B 1UKYA 2D2FA 4LWZA 2IS2A 5DI3B 1YQTA 3QVUA 3VHXA 1FL9A 5DISB 4NCNA 4BFXA 3NHAA 4UKDA 4NZYA 5DI3A 1GKIA 2FFAA 3N2EA 3ZZTA 2O8DB 2VO1A 1MR3F 2CNWA 4RD2A 2QGNA 1TU3A 4YLGA 3LDAA 2J0VA 4OQNA 1KO4A 1YVDA 1R2QA 5FOXA 1S9HA 3W5IA 1F6BA 1ZIPA 3HJNA 4E22A 1C1YA 2QP4A 3PCRB 1Q57A 1QVAA 2ZR9A 5AJYA 4DLYA 1WXQA 1CRQA 2BCJQ 3F0TA 5EXSA 1XTRA 3L0PA 1YJ5A 2GWHA 4WVFA 5AR1A 2Z6VA 8OHMA 1MO4A 2OZEA 1Z3IX 1Q1QA 1G19A 2C5LA 4QHYA 2HXSA 4WBSA 1NF3A 1RZ3A 3ZYCA 3AF4A 3QG1A 2XNSA 3CNNA 5K8LA 2VP2A 2FMXA 4ZKEA 5EUMA 1L4UA 1SQ5A 4EPVA 2BEJA 3GEHA 2XNDD 4XH9B 3LO5A 2HJVA 2WV9A 3WXMA 3D7MA 3I3SR 2VBCA 2O8EA 3VNVA 1II9A 3CKLA 1XXHA 3IBYA 1P6XA 3IHLA 3HPRA 3D8BA 4FINA 2AKAB 2DPXA 4PPGA 3O8CA 3LH5A 2FA9A 1AS3A 4LZZA 1P75A 2YWGA 3TQCA 3CWZA 2Q6TA 4OHXA 3CM0A 3SI7A 3B6EA 1MABA 5B58C 3CF0A 3TW4A 5E7MA 4M8NE 4EPYA 1P61B 1ZC3A 3K1JA 3EC1A 5DH9A 3EG5A 2PCJA 3GFTA 4LUCA 5BN5A 2BVNA 2DCUA 1G16A 4JYBA 1X86B 4L15A 2Z4SA 3KKNA 1ZUNB 1DPFA 1E2MA 3P20A 4MYUA 1DELA 1IN8A 2HCJB 1B23P 2NMVA 1JALA 4Q18A 5J4VA 3CIOA 5JEDA 3P4YA 3PITA 3THOA 1XF9A 3THYB 3RS2A 2R6DA 3B8HA 1XDBA 4MUAA 4W5JA 3AP1A 4D4KA 4W9MC 1P60A 5FOSA 3DM9B 4JZKA 1U99A 5C46F 3LVRE 2IYSA 2XB4A 3MWKA 4JKYA 4PPNA 2JJ1D 4Q7MB 3I61A 1VYVA 2XTMA 2A5GA 4JL6A 4MYHA 3A1UA 4F91B 1NBME 1CKEA 3CNLA 1BKDR 1XNJA 4GP7A 4M0LA 1OH8A 4LJ8A 2HLDD 3EPLA 5GJBA 3RLFA 1VPLA 5DO9A 2HYDA 1XU4A 4B2IA 1T4GA 4YMVA 4NPHA 1EXMA 2ZR7A 4Q1AA 1D2NA 2WJIA 3SYKA 2OLKA 3M4YA 721PA 2IT1A 4TN1A 4DKXA 3SZRA 3BC1A 2PEYA 2YOFA 2IEYA 3KKQA 1U94A 4WXRA 1OYWA 4Q7JB 1G3QA 1N3BA 4NHOA 4EQ6B 2PBRA 2G0NA 1CR0A 1US8B 1H8ED 2NPIA 2F1RA 1GIAA 2CL7X 2EQBA 2WMOB 1N5IA 3AGQA 3UATA 1T0HB 2QP9X 2ANBA 3CPJB 3UWKA 2F9MA 1KK1A 2VP6A 3UXMA 1KI4A 5GVRA 3U4QB 1XD2A 1GL7A 4QJ5A 3X1DA 2OAP1 1NLZA 1T3SA 1IHUA 2HXYA 4LCBA 5HTKA 1Z28A 3FDIA 2IWRA 3DOEA 1E99A 2PH1A 1U8ZA 4C2UA 1KAOA 2ZM5A 4LV5B 2GEUA 4OQFA 2AFHE 4G5GA 1X1SA 2FEMA 3E70C 4UNPA 3SBDA 3MGCA 4CT5A 5GJWC 4KXFB 3M0EA 4MGIR 2YC2C 3UANA 1JR3E 4ZDIA 3P26A 1LY1A 2OT3B 4LHXA 4Q9LA 4EJSA 2DHRA 1TL7C 3AKEA 3P1JA 1ZM2A 2RCNA 4JL8A 3TSZA 3B7GA 4FMCF 1NG9A 4QG7A 1N25A 1R0ZA 2FNAA 1G20E 2RGGA 2ZVQX 4XVUA 2ZUBA 4PSAA 3RSLA 1E9BA 4LJ9A 3SJAA 1FW6A 2AD5A 1Y63A 2GVDC 3QPWA 2AR7A 4Q9KA 2NIPA 4ZI2A 4MRNA 1N0WA 3B1WA 4A15A 2JATA 2ZRKA 4BFTA 2A7QA 2TMKA 2NO7A 5J5CA 4RZ3A 1GWNA 1M7HA 4NYMQ 4B32A 4BPBA 2HDNB 2FX3A 1UKEA 1EFRA 2G3YA 1W0KD 3QKTA 1XTSA 4OL0A 1WBDA 1QF9A 2HT6A 1CJVC 4TLEA 1KI6A 2GTPA 1VYTA 1WB9A 2A5YB 4GNKA 4BEJA 1QZXA 5HR5A 1BYIA 3C15C 2J59A 3PUXA 3T06B 2P6NA 4TYNA 1NI3A 4ZIRB 1T6NA 4TT3A 4DEYA 2VRWA 1G3RA 2H18A 5HKKA 5G41A 5FPHA 4PO8A 2VPPA 4TTQA 3QEOA 3F3YA 3EZFA 3X1WA 1R4AA 1E2GA 2RH5A 3B1XA 4CVNA 4YQFA 4F4CA 2J46A 1P2SA 4OI2A 4XTCS 3U3JA 3GLHB 2ZRFA 4NBSA 1R0YA 1ELOA 4IOMA 3TSOA 2IC5A 1G17A 1NLFA 5D3MA 2XB2A 4PQFA 5JWOA 1G3UA 3TR0A 3BRWD 4Q4AB 4D6PA 4TZ0A 1E1RD 2EW1A 3QSYA 2GCOA 4PO1A 2V7QD 2WHXA 1EFCA 1UF9A 1SVLA 2F1JA 3AEZA 3CH5A 2O8EB 3SNHA 2Q9AA 3SBEA 4YDHB 1QHSA 5BN3A 4L5BA 3GFPA 2VSOA 2RGEA 5G53C 5FH9A 1KNQA 3K53A 3Q85A 2C99A 2IS4A 2CLDX 2JIZD 4D2IA 2F3RA 1E0SA 3MG9A 1YZLA 1KZGB 3BB1A 3FKSA 3K8YA 2QROA 4BLRA 4S35A 4AC9A 3U5ZB 4E07A 2EU8A 1QHIA 2DFNA 2YOHA 2ZE8A 3LRPA 3A1WA 4ZCMA 4HLCA 2GZHA 4ACAA 2O52A 2L0XA 4PX9A 4QBHA 1G4UR 3CR7A 4TQAA 3TK1A 4A4DA 1J8YF 1W0JA 2B8WA 4UNSA 3DHWC 1OH7A 2UZ3A 3MLEA 2F3TA 1AQYA 2H16A 3KJIA 3REGA 2AX4A 5TMPA 4URZR 5KNCA 2H1LA 1W4CA 5K8UA 3HPQA 1EESA 2GVZC 4NCJA 1C4OA 5FBWB 2DFKB 1M1YE 4V0ME 1Z29A 5DGXA 2SHKA 3K0CA 2RGDA 3KB2A 1E2QA 2X2FA 4OHZA 1US8A 1CBUA 5FOVA 4BFVA 2ZUCA 3BS4A 5JI3E 4ESVA 4I99A 1VDZA 4JIMA 4OK3A 2BBWA 2UKDA 5KTYA 4RFVA 4TMKA 4DXAA 2O8FA 2N42A 1N6RA 4L9WA 2DB3A 2OO7A 3T12A 3A1SA 4YMWA 3I8SA 4KYIB 3TR5A 3G0HA 4KSBA 2KE5A 4TL6A 4D82A 1XBTA 4H9GA 1B0UA 1Z83A 1GSIA 5FOTA 3BH7A 4HB2A 3BFXA 4CEIB 1DE0A 3QVVA 5IK2D 3E1SA 2WWWA 1F48A 3SQXA 4QXAA 1KK2A 3I1FA 3CX8A 3MRSA 3H84A 3B78A 4OI1A 3ZDQA 1BIFA 4LHZA 1COWD 4A6PA 2IXFA 3EC2A 2A5DA 2VQSA 2F7SA 4DDVA 1GFIA 4LHYA 1T5LA 4B3GA 4JJZA 1XEWY 2ZJ8A 5FUYA 3IILA 3WMGA 221PA 2C03A 4KAXA 4LJAA 1T3LA 4C0LA 4PHTA 5FR1A 4H1UA 1SHZA 4ZV4A 2G1JA 4Q21A 2RGAA 2FFQA 5GJVC 2PZGA 5DIFA 4V03A 1CJKC 1SKQA 5CLLA 4Q7KA 3WRYC 4TLDA 1OB2A 5B64A 2YZ2A 1NKTA 4I1UA 4YMTA 1KDOA 3GJ6A 1D9XA 4LV6A 3E5HA 4QGFA 3CBQA 4DLZA 3BIFA 1IXZA 4ITRC 4Q1FA 2ZI4A 1OYYA 4PXAA 5F9FA 1E2HA 2G6BA 3NWJA 1Q21A 2A78A 3A4LA 1W46A 1IN6A 2V1XA 4RD3A 3EA5A 1OB5A 2AN9A 3OE7D 2CE2X 3WBKA 4Z1MD 5M04A 1TQ2A 2OESA 4TLCA 4UXHA 4Z1MA 1U98A 2QN6A 3QKUA 2QSYA 3OESA 4Q48A 3KXIA 2R65A 1S1MA 1P9WA 1XMJA 3W8RA 2QM7A 4DEXA 1LFDB 1S4QA 2CXXA 1SXJA 1UBEA 1VYUA 521PA 3W8NA 4DB2A 3OIVA 2CHGA 5FL3A 4QJ3A 4C0SA 1G8YA 5G3YA 3EIHA 4HLQB 2JGNA 1NJGA 1SXJB 2CNWD 4TYPA 1BMFA 1R0XA 3VR6A 2CLCX 5KPDA 1SVIA 3GLGB 1RJ9A 3RAPR 3B13B 4Q5IA 3PENA 4E03A 4MRPA 4NYIR 1G8PA 5FTJA 1Q22A 4UNQA 4OQXA 2BHRA 3REFA 1GRRA 3KB1A 4AWXA 3K09A 5CLQA 1GKYA 2CL0X 2IHYA 4LRWA 4Q00A 1VCMA 3EIQA 4MDFA 3NEJA 5F9HA 5EJEA 5C1BA 4O25A 4RJLA 4D4MA 4TL9A 1GAJA 4R7ZA 4QRHA 1Z63A 2J1LA 2ZU6A 3L2OB 4GZLA 3ZD6A 4URWR 2GXUA 1DO2A 1N0UA 2WJYA 3CRRA 5CM9C 1DO0A 3GJ5A 1CR4A 4G5SA 4PZLA 4DSUA 2WWXA 1OT3A 2QMUA 1GNPA 2WSMA 5SZJA 4PSVA 1AQUA 1ZM4A 5HZKA 4HLDA 3W3ZB 3TKLA 5JRJA 4Q4LA 4XSHA 6Q21A 1G18A 3KJEA 5LDDC 3EPJA 5D3QA 3SS8A 1T5IA 3GLFE 3OIYA 4XD7A 4IOJA 3AB3A 2OFOA 2D62A 2IEZA 2PEZA 4EKDA 3B82A 4LOAA 4ZI3A 2QSZA 4A2PA 1G6OA 4RD1A 4GOXA 1Z8FA 2G88A 1ZNZA 1PLKA 1XTKA 2CCGA 3CB4A 3GLIA 5ELXA 3I92A 2PMKA 1W4BA 2O0JA 3BH6A 2AD1A 3CF2A 3GLIB 1CEEA 2QAJA 2BC9A 5KOYA 2B6HA 5EE0A 2ZAOA 1P73A 1ESMA 1RRFA 1SVKA 4C9BA 3O8BA 3DOFA 1Z6GA 3CRQA 1ZCBA 1II0A 3DL0A 4O2RA 1RYHA 3PG5A 5HCNA 3TIFA 4QL3A 2DFTA 3DZDA 3LQRA 4LYJA 1F60A 2C95A 1Z22A 1KK3A 4AI6A 3RSOA 3WNCA 1MRNA 1HT1E 2AFIE 3QI2A 4TWZA 5J40A 3RS5A 5F98A 5G3ZA 2MMCA 4EAQA 3KZ1E 4IW3B 3EPKA 4G01B 3QXXA 1GILA 4GOKA 4LJ7A 3U7EB 3RC3A 1ZIOA 2JASA 3ZZ0A 1LF0A 1WDTA 5CB6A 1FQJA 3O47A 1P5ZB 1F2TA 3AVPA 1XPUA 3IIJA 5FL7A 1PJRA 2FN4A 1JR3D 2BM1A 4N0DA 4NH0A 2DY1A 1COWA 1O87A 2R6AA 2PT7A 3GJ0A 3MAAC 2VA8A 4JVNA 4PC7A 1DAEA 2FSHA 1Z0IA 2YKGA 1KK0A 3IUYA 3NBZC 2EYUA 3K09C 5L3SA 3H2YA 3RS0A 1P72A 4JLPA 4MDEA 2O0HA 4TMVA 4DIEA 2V8OA 2REBA 3R8CA 1J70A 3A4MA 1OPXA 1NVVQ 5FTKA 5E95A 1T91A 3K0CC 2MSCB 4A1FA 2BJWA 1KAGA 2ORVA 1UPTA 5EP4A 3T1QA 1ZD1A 2ZYUX 1FPMA 1GKUB 3TAUA 3LV8A 1Z2CA 4B35A 2ZS9A 1ZD8A 3AF0A 3TBKA 3ZVNA 2I1QA 4KLNA 2C9YA 4Q9IA 1GNRA 3UPUA 4OHYA 2OSBA 1G7RA 4G5OA 4B44A 1D9ZA 1XD8A 2WOOA 4BZXA 5L3SB 4QHSA 2W0MA 4M9SA 4LK2A 4TMTA 5JWHA 3RANA 3TMKA 3VMFA 4B6FA 4US2R 4RSGA 4OKSA 1D2MA 1VECA 3K0AA 3AKDA 3OAAA 4G5QA 4RD0A 4C7OA 2VLIA 5EE3A 3ZIAA 1E4VA 1NN5A 3PFIA 5J4LA 5HZHA 1JQLB 5EUQB 3V4FA 3KQHA 1MT0A 3GJ4A 1UJ2A 1E96A 1ONBA 3AP3A 3BB3A 3LLMA 2OBMA 2RGCA 5FI1B 1D5CA 3EXAA 1DAKA 2B7BA 2FFHA 2RMKA 2OFXA 4QNRA 2CCJA 2GETA 2EFEB 2LKCA 3RS7A 3W9YA 5FI0B 2QMEA 2QG6A 4OI4A 4DWJA 2KWIA 4PC2A 5AJVB 2FOLA 4B3FX 1BS1A 5KDDA 4C0BA 2C96A 4MA4A 3FWYA 2WJGA 2W83A 4JBYA 4EPRA 2A2ZA 2R6FA 1KI3A 2B92A 1IQPA 2CE7A 4HSEA 1GL6A 1AZTA 1ESNA 1NMZA 2ODEA 2J7KA 3I8XA 3MJRA 3QPUA 3U4QA 5J4YA 2CHQA 2WAXA 2WZQA 2PMDA 2LWIA 3LBNA 2VP5A 3A4NA 3KXLA 4PFSA 2Q3MA 1Q12A 5AK0A 1RRCA 3PJRA 1A2BA 2IW3A 3FKQA 4IKEA 3K70C 1JEDA 4PAOA 1GM5A 2AWNA 3FKSD 5KSPA 1MH1A 2CMKA 2WAYA 1BH2A 1PLJA 2C78A 4M1KA 4NCIA 2F9LA 4A0FA 1WRBA 4B6EA 4RFSA 5A0FA 2WIBA 2W2XA 4EJSB 1ZW6A 3QQ5A 1DAGA 1QHYA 1GL9B 3OIUA 4HLUA 1M8PA 1WCV1 4DLRA 2BMJA 1G8GA 1KSJA 3BOSA 4YONB 2R6GA 2ZPTX 4CZ2A 5JLJA 4DT1A 2JJ8A 1G5RA 1OFHA 3MJHA 4KU4A 4DIDA 3L0OA 4DDWA 3T5DA 4DLVA 821PA 2WMNB 1W7AA 3BWDD 2E9SA 2OG2A 4M21A 1W36C 2FPLA 5LPNA 1YZKA 3LLUA 4IDQA 4MGKR 3W6OA 1KYIA 4TSFA 4TT3D 2PT5A 2ZRGA 3BFKA 3JVVA 4YC7A 4A8JA 4GL2A 2ASEA 2BOVA 2YOGA 2ZS7A 3L0IB 3ZVLA 3ADKA 5H70A 3TVDA 2EVWX 4POAA 3KL4A 1N0VC 2XJ4A 4Z54A 5FBVB 2F43A 4U7DA 2OBNA 2PLFA 2VHCA 3AKYA 4LJ4A 1N6IA 4QM7A 2WWYA 1S3GA 2ZI5A 2FZLA 4I1OA 5LD2C 3LBIA 1QG4A 1OJLA 3IBGA 3HP1A 4KI0A 1E1QA 3WP0A 1LW7A 1N5KA 2GAAA 4IXNA 5JSZA 3KFXA 1II8B 3VX4A 4AIIA 5FPYA 1IXSB 2NZ8A 3GQBA 2J87A 2NTYC 2D06A 3BK7A 4A92A 1HE1C 5AJZA 3MFYA 4FWIB 4V0OA 3TLXA 3JZAA 2R2AA 3HR7A 4BWYA 1OW3B 5FR2A 1U9IC 2XOKA 1KY2A 1Q1EA 4XWKA 1G41A 1R5BA 1TU4A 2IS6A 1Z07A 1DEKA 2I1VB 4LYAA 5KHOC 5J47A 1XJ0A 3I32A 2HV8A 4JSTA 1UDWA 4KODA 3WHKA 4FCTA 4Q66C 4DDUA 1E2EA 4CRWB 1FX0A 4DUGA 5JS7A 1L8QA 1LVGA 1P2VA 4XWAA 1FQKA 1E9RA 4LBVA 1FUUA 2IYRA 4JLKA 2ERYA 3K70B 4DCVA 1NN0A 2YHSA 3UMSA 1KJZA 3IKJA 2VEDA 2IYZA 2C9OA 3QG5A 4CW7A 2J0UB 1GVNB 4HYYA 1R5OA 1K8RA 3T15A 4CEJA 2JAQA 3KDSE 1GNQA 2B8TA 3N70A 3MMPA 1UM8A 3NC0C 1G8FA 3LD9A 5FTNA 3ZZUA 4KLZA 2QPOA 1BYUA 4HAWA 1HE8B 3Q5DA 3H86A 1S8FA 2FSFA 2FZ4A 3BB4A 4FCVA 5JS8A 2A5JA 2V6JA 3OAAD 2KI5A 2QZ4A 4GDFA 1NIPA 2ZJBA 1T8TA 2CL6X 3PEUA 4PC6A 3THWA 1U8AA 3OZXA 1U8YA 2VHQA 2XZLA 3CLVA 2GRJA 4BECA 4R2HA 1GOTA 1GZSA 2REXB 5EZ6B 2O8BB 3KUCA 3U61B 1UADA 4KSCA 1VIYA 1P9NA 1VG1A 2IUSA 3LX5A 3I62A 2B7CA 3R9XA 1CF4A 1E1QD 1R8QA 3QBVA 3RRNA 1PVOA 2V1UA 2R9VA 3OF5A 2Z4RA 1KHTA 2R62A 4PPQA 1HTWA 4B47A 2DYKA 1AS2A 2PX0A 4M1WA 2I4IA 1WP9A 2W58A 2BBOA 1VCIA 2ZR0A 4K46A 1Z6YA 3ASYA 3QNUA 4G1UC 4MRVA 4FWTA 3U3MA 1M6NA 2NG1A 1E2LA 3QF4B 4S2EA 4DBLC 4IFBA 4HAXA 4IFEA 4LBWA 2OLJA 4XWOA 2IX3A 3R9IA 1IJFA 1JB1A 1N6PA 1RFLA 3T1OA 3TQFA 2ZRBA 3EZ6A 1J99A 4RZXA 5EXTA 5C2JB 1SKYE 2JLRA 3QUSA 5EQTA 4EIWA 2W6JA 3T5GA 3FB4A 2RGXA 5BQ5A 3QKSA 2XSZA 4ESHA 4J0QA 1SHKA 3IEVA 3SYNA 4IEEA 5KPJA 3GEEA 2QAGC 5DHAA 3SJZA 4ASUD 4JVLA 2C2HA 3Q5EA 3PXGA 4F7WA 1X6VA 3CUEF 3EPHA 4OJQA 3ZGXA 3GD7A 1Z6XA 2J41A 3A58B 4KVGA 5C18A 1MABB 2V9PA 1RRPA 4M9QA 3PUVA 1TF5A 3RHFA 3QJYA 1GTVA 1J7KA 1JXMA 1NMXA 2OE2A 2P6UA 4YMUA 4XSGA 3DPUA 4RCYA 3J81k 3GJ7A 4A0HA 3MCAA 4XD7D 5EE1A 2O8CA 1G21E 2GEVA 3OHMA 1HQYE 2EFGA 2JLZA 3GLHE 2YYZA 2IYLD 2GILA 3CO5A 2FF7A 2ZI6A 1E2IA 1K5GA 1JEEA 1EFRD 4GOJA 1JPJA 2IXGA 4B73A 5KSYA 2OUKA 2ZSAA 4HZUB 3LVQE 4A0RA 2GK7A 4WZAE 4D25A 1HURA 1H8HA 3BE4A 3EWAA 4HEJA 2RGBA 3UK6A 1G4AE 2BMDA 3X1XA 1WBBA 4LX0A 4Q1BA 4LY6A 3VHLB 3B5JA 1PZNA 2JLYA 4JT4A 1FUKA 5FOWA 3X1ZA 1OIXA 3CZQA 3NDPA 4C7OB 4EJSC 2XEXA 4M2LA 2ZSDA 4DCTA 3ADBA 2JJ2A 1ZM7A 4H1VA 1JXOA 1NLYA 1LS6A 1CTQA 4NMMA 2ZJ2A 4IXMA 4L8GA 1E2JA 5KDOA 2ZSBA 3M6AA 1VCOA 3SDZA 3AKCA 1YRAA 1XTQA 1ZAKA 1IN4A 1NVWQ 2FGJA 3LXRA 4TYYA 2FJUA 3EWSA 2O8FB 2LKDA 4B2LA 1AK2A 2D3WA 3AP2A 3KQKA 3D3QA 3TUZC 1E9FA 2AXNA 4LHWA 1QVRA 1N6OA 1U0LA 3KQUA 4LC1A 3K9NA 4RD4A 2QGZA 4EUNA 4BZPA 2GA8A 4FMDB 1OHHA 2G83A 1KO1A 1CR2A 3WYFA 5SZKB 1OH6A 4DVGA 1J8MF 1Q20A 1MOZA 2CEAA 5E7JA 5AUPB 4RZ2A 3S1AA 1E0JA 5DE3A 1CR1A 2GF0A 2YINC 3H0KA 2IYQA 1DTSA 1Z47A 5GJCA 1FFHA 5FOUA 4KCGA 3V00A 1Q1ZA 3GFOA 2O5VA 1XTJA 3QXSA 4ILEA 3MWJA 2VP0A 4KHZA 1VIAA 3NTUA 2WJVA 1YR8A 3B1VA 5EXPA 3KUDA 4AYWA 3UMFA 5BWMA 4XJXA 3RWOA 1TADA 3THXB 1AS0A 1N2CE 1FMJA 1G7CA 3PV0A 4PTLA 4WAUA 4DC9A 1JR6A 2OXRA 3QOFA 4ZDWA 3I73A 4CYMA 3SHFA 4BE7B 4JSYA 4D4LA 5BYKA 1G7SA 4ARZB 3LXXA 3ETLA 4M22A 3QXJA 2ZE6A 4P31A 3KQLA 5LD2B 4KBGA 3WMFA 1WA5A 1VG9B 3OEHA 2EFDB 2Q9BA 5CDFA 2A5FA 4QNMA 3FOZA 4LSGA 3GJXC 4AG6A 4YXWD 4TMWA 1DADA 2H5EA 3F5FA 2JLQA 4JLMA 1NG1A 4EFNA 3C4JA 1RVDA 2QORA 2EFHB 1AJEA 3GEIA 4GT1A 2VP9A 1M7GA 1KSGA 1KKLA 1O3YA 2QTFA 3WYAA 1UKVY 1P2TA 4Q1DA 4AK9A 5JECA 2NO6A 3HYRA 2WBLC 3PR1A 1TAGA 1W48A 1L4YA 1L7VC 1UBGA 4JT2A 1N6HA 2Q0HA 2JA1A 2ZETA 2QT0A 1F2TB 1UEJA 3VKHA 2X8AA 3UIEA 2W6JD 1G5TA 2WICA 3GPLA 4JL5A 1YZNA 4NTZA 3GLHA 4FW9A 4B48A 1K5DA 1OHHD 1N5JA 2IHBA 3CWQA 1M34E 1XXHE 4TLAA 3AVXA 4OBEA 4U5XA 2AK3A 1S3SA 3RRMA 1P7CA 1TPZA 4TZ6A 1JI0A 4P32A 2ONJA 3WNBA 4EPWA 4CEHB 4AG5A 4CF7A 4IDNA 1KSFX 3OEED 2ZREA 1ZUIA 1NRJB 1YZQA 3A37A 4FIDA 4BLQA 3JVUA 4TQ9A 2O8CB 3TNFA 1LF5A 3SYLA 1TTTA 1BO6A 5TY0A 1KO7A 4BFZA 1OXSC 2E87A 1UFQA 4WIAA 2CHVA 4ZCIA 3SHWA 2RHDA 3QXCA 1XEXA 4X8OA 1S2MA 4OI0A
chains in the Genus database with same CATH superfamily
2FUCA 2QUBA 4U0KA 1V9LA 2J5XA 3VO8A 2Z9BA 2ZZNA 1ZK3A 4BY9E 4E2ZA 2VT3A 3EEYA 2N46A 5K0ZA 3OQPA 1G1MA 5ED0A 3KAKA 3D4PA 1VXRA 5BY2A 5K2MA 4Z86A 4JASB 1P8JA 4MIKA 4YJFB 4BPRA 3U3OA 1GCOA 4GXQA 4A23A 1LLQA 2FPPA 4JXZA 3HBMA 1NWCA 2FRVA 4R7GA 1EVLA 1FTQA 1ZK1A 3KKKA 4DA7A 5AD1A 2P4QA 1CUZA 2C2MA 2JKVA 5AOVA 3GP8A 3IQEA 2WU1A 2QTVB 1AY0A 4FX5A 4GXRA 4PSUA 4MO2A 4TSKA 1F2UA 2JIOA 4D0NA 4F5ZA 4KR3A 3U44A 4ZQFA 2PN1A 3RHSA 4GKJB 4B3RB 3SU8A 3T7CA 5T4FA 3HZOA 3KXDA 4U02A 2R8RA 3JR3A 4LC9A 2HM7A 5IJ9B 2J0SA 1RLJA 4TL8A 4DAEA 2R4QA 4O29A 4ZYYA 3H9EO 1QANA 1P0IA 3NYWA 4X66B 1SIWA 3GLFA 5F33A 1IHYA 3CUWA 4Q05A 2ZRAA 1UC4B 2HHCA 3Q6NA 1G5PA 1W5BA 2I65A 2O2DA 1A5SB 4KYTA 4RPCA 2AJTA 2HFJA 4F8JA 1PUJA 2KLBA 3AFHA 4MMYB 1E6MA 5K3FB 3GFFA 3PQEA 4N3CA 3ZGVA 2HZBA 2JH9A 5IVKA 421PA 4Y0AA 5IYZB 1N6NA 2C4NA 1TCVA 2EZ9A 1NM5A 2WY2D 3RBXA 5FOUA 1ECGA 4IJVA 4JFRA 1MO6A 4GYWA 5KYWB 2YL2A 4G1MB 2Q0SA 2H3HA 2ODNA 3PNOA 4M9ZA 4P4GA 4BASA 4F5DA 3DOHA 5DLQC 3K8QA 3DZFA 4NSNA 1GGHA 3VYTB 4Z4IA 1Q83A 1ZRMA 4HQRA 1Q14A 1YVPA 3HY6A 4IO1A 4G41A 5A7HA 1UFKA 3C6MA 3ENVA 4F93B 5L3RA 3E15A 2H59A 5FBQB 4ZOLF 2DLNA 4BX2A 4JVMA 4K1XA 2GKSA 3OSZA 1EJ0A 4WPGA 2HK6A 3G8CA 2QM0A 3MTAA 1SC3A 3LYHA 1MA0A 4R81A 2H9IA 1Z0DA 4ARZA 1HYGA 3B9QA 5TGTA 3SQLA 5FDFA 1ODSA 3KYBA 3KSDO 3MM4A 3FHCB 1DFGA 3DEJA 3ZWNA 1TO6A 5F73A 4ZAZA 5SZIA 5DEIA 3RKUA 3P2EA 3WB9A 4OV6B 5IMBA 1F5NA 4ABYA 1GLNA 3OKCA 2IELA 2RHRA 3DP7A 4HNAA 1IMOA 3B9RA 4CKBA 4AU1A 5AVUA 2AI3A 3OU2A 3TDNA 3T4XA 2H17A 5TX7A 2G0TA 3HVUA 4P38A 4BATA 3OJWA 4KW7A 4FZ3A 4PRLA 3JPWA 1SVSA 2A0FA 1GUZA 1SPBS 3JQFA 4C6HA 1T6ZA 1ZJ6A 5AVWA 3K71B 3DE0X 2P9GA 2ZAMA 1MVLA 2CLHB 1H94A 2ZJZA 1V48A 1DFIA 2PJUA 1JDNA 1ZITA 1PJQA 3FMGA 3LT4A 3OT4A 3PEVA 4K9LA 4ND5A 1SURA 1HR0B 4BJHB 1CUVA 1PD1A 1X38A 5AKJA 3K0FB 3RG2A 1S2NA 3M8KA 2V6IA 4UU0A 1W5FA 4DCSA 2W6NA 3PCXA 3RS4A 5HJEA 1X0VA 1E6LA 1JLKA 1XC7A 2P0AA 4FQ7A 1VSVA 2WJZB 3RIHA 2AUTA 3UCEA 1BAPA 2P40A 3NH9A 2ZJFA 2E3JA 5FBKA 4BE9A 4I6GA 2OP0A 1SVWA 2YJTD 4N9QA 4OQZA 5DYIA 1QWOA 5GOTA 1F2VA 3E7XA 4LNAA 4S3MA 4UD2A 1HWYA 5CAEA 1NP7A 1VKJA 2I5PO 3ZKWA 5TNXA 4FOTA 3TTSA 2ARKA 4C3ZA 3EPPA 1FRQA 1JGTA 4DV0B 1BU5A 2P65A 2IZ6A 2Q5OA 4HH3C 5DFAA 3L4KA 1A95A 2F43B 1Z62A 4Q4AA 5E0OA 1G21B 3NH6A 4QDKA 2N1BA 4Z9BA 3E3LA 5IT0A 1XD9A 2VF7A 3UKJA 3W2GA 2RGNC 3B60A 1Z5UA 2GAFA 3R3UA 4N7BA 3DLTA 4NMWA 4S1WA 3U3DA 4OLHA 4AB1A 2B1RA 3HKCA 4KMRA 1NZDA 4PQEA 1Q11A 1J56A 2ZTUA 4AF6A 2H4FA 1RQLA 2P6OA 1HPLA 3EXEA 1Q7RA 3ZX5A 1T9ZA 1KNXA 2LE0A 4I55F 4XWGA 3DCNA 1IH8A 2IYPA 3CLSD 3USES 1M72A 3AL2A 1HRDA 3VNUA 3GLQA 4FD2A 1N77A 1O94D 4YX9A 3WIBA 2RGNA 5EINA 3QLEA 2J85A 4U7WA 3INTA 2UYCA 1BMFD 1E2PA 4JB2A 5CLIA 1H0KA 4UUAA 3SXUB 4YJ3A 2VUUA 5BP7A 5DX0A 3HXLA 3K6RA 1QCYA 1WOYA 4TS4A 4BNJA 1GPYA 1T2EA 3FGPA 4NBTA 3RW9A 3UNXA 4CM3A 4YCMA 4B4UA 2C7RA 2I6UA 4UVIA 3U7QB 3PNSA 4I3GA 4U2KA 1FMTA 3HRHA 4UULA 3WLKX 1P17A 2BI4A 2ZJ1A 4BC1A 1JMVA 2Q3FA 3FFWA 4G4SP 3WP1B 4EHKA 5JVDF 3G17A 1Q92A 3SVZA 3VZBA 3PQ4A 3EWNA 5BSGA 4FYPA 4KWCA 1Y1QA 2HDOA 3SEFA 1F3OA 5C5DA 1TKCA 4BQQA 3OTOB 4EFLA 4X7PA 3X2FA 1C30A 2AOVA 3B6ZA 4MDHA 1JLRA 3B7WA 4QAQA 1Y8ZA 5C5IA 3ST7A 4A0GA 1HV8A 3LUPA 3DS8A 3ZHRA 3UC9A 3FJOA 1IN5A 4IFTA 4NOJA 1FC0A 4C4XA 5DCLA 4AZ3A 3U7HB 1VL1A 1Z2OX 4GQAA 2K6GA 2NM0A 1S7GA 4PYMA 4ONEA 5HVNA 4CKCA 1K98A 4CMIB 6CHYA 3JQAB 1DARA 4F2WA 1QB7A 4TLMB 4ZARA 1USWA 1RWBA 1Z0FA 2FR0A 4M4SA 4KKXB 1QDEA 3S8YA 1XZIA 4IG9A 3LBAA 1HLPA 3L8YA 1VHWA 3ZGYA 2OM2A 3VO1A 4KV7A 3CKMA 4I4LA 1QTIA 1IOWA 3TRIA 2PUVA 4MUXA 3PNQA 2H11A 4BJ6A 3DAPA 5LLTA 1LZLA 5SICE 2IH2A 1SUEA 3FPKA 1AZWA 3AHJA 1GUAA 2XZPA 1AQIA 2P3QA 2P67A 5GZ1A 4F38A 1W36D 4QGGA 1LH0A 1OFIA 2YWEA 3GZNB 2NU8A 4CFSA 2HWWA 5E38A 4KXNA 3EARA 2Q5HA 1PFYA 3WNQA 4I14A 4JLDA 5H9VA 2Y1FA 3E9CA 4BNIA 2OYRA 3HJHA 4AKGA 3DMNA 3NJRA 2JFHA 3N0XA 1G5FA 1RMTA 4PG7A 5TXGA 3ZW7A 1YTLA 1UJ6A 5BOSB 1TYCA 1QB8A 4LWPA 1GG5A 1MKYA 4HDNB 2C7QA 2XNHA 3A6GA 5LYYA 1OSNA 1FFSA 2CFRA 4O4HB 2LR0A 3L6CA 3R3HA 4BNDA 5D5PA 5LDGA 4BKPA 3MRVA 2UUBB 3ZDXB 4ZAVA 2PKYX 3ZHVA 3L0YA 1ULTA 2B4KA 3ZPXA 4DYDA 1YU9A 1WUKS 4PEVA 4LOHA 5ES3A 3UHJA 3VU1A 5KYUB 1PG5A 1N7JA 3ML1A 4IUYA 2FU5C 4MAFA 4TV9F 3OZUA 4QWMA 5C52B 3SZUA 1RADA 1P62B 5EKDA 1P2UA 1O95A 4LJRA 2XTZA 5J9FA 2FXVA 1FNCA 2OLEA 3L8CA 4XDGA 3UUWA 3H87A 1EX7A 2CHEA 2ZBGA 2VRCA 2YXPX 2IYTA 1PNOA 4PAMA 3ZCUA 1TMYA 4ZWNA 1TW2A 5JXWA 4Z8YA 4PPYA 3GNSA 1M2WA 1MX1A 1U5BA 2W2QA 4GI1A 4EX6A 3TRKA 5CFLA 1MN6A 3Q40A 2YZKA 4N3NA 3BDAA 4E32A 3F4LA 4ZI7A 4BNDB 2VDWB 5FFMA 3VMMA 4LDQA 2AWOA 1IQUA 3PL1A 5DHQA 1PZHA 2F1KA 3HWWA 4N65A 5KNDA 3ZLJA 1GEEA 2BLNA 2Q50A 3I4LA 4HEA6 4NONA 4NPCA 4OXRA 1ZR2A 4QC2A 2K5UA 3I6ZA 1LRJA 4B46A 1E9VA 3LPLA 4OQEA 1SA0B 4AKSA 3V4LA 1V1MA 3IRVA 2JBAA 1ODFA 2XCOA 1RCFA 2KBEA 2Y99A 4E7OA 4ZAYA 5HFNA 1YV9A 1T0IA 2FMKA 1W9HA 2RHHA 4W8GA 3LXMA 5E6UA 4CEJB 1JX6A 2B94A 3BAFA 3E7WA 1K8XB 5C31A 1PRYA 2H2DA 3JASB 3UENA 2IKSA 3D6MA 3Q3JB 2RARA 1P1FA 2QXYA 2O2YA 2CVFA 2NQTA 3IVMA 4O1HA 1QBKC 4LDZA 1TMOA 2BP7A 1RM3A 3GFGA 5CLGA 5A6VA 1F2UB 2GA9A 3JQBA 2ZI9A 2QP3A 4FHCA 5AKGA 2BFEA 1CDOA 4PYQA 3CISA 4L1KA 2QTLA 1D03A 1GZ7A 1X80B 5B3KA 3QIAA 4XIGS 4Q4JB 3HN7A 4DSTA 4BGDA 5IJ9A 2JC3A 4FE3A 2DZDA 3R4CA 3KDPA 4J1SA 1EFHA 2AXEA 4GMHA 3ZCQA 4QD3A 1XPOA 1G9XA 2QD2A 4PHHA 1ESDA 1TYBE 2P9EA 3SF8B 2I7CA 1YS6A 1PR2A 1MJGM 2R6JA 2A9RA 3FWZA 3TS1A 5IFKA 3ZXYA 3TZBA 3MXTA 1OC4A 1DBSA 4L8LA 2VJAA 4UNIA 4XOIA 1KI8A 4CG0A 4D80A 3U19A 3G1TA 1NRIA 4DNQA 3HRKA 1SQSA 2XEDA 4KO8A 4Q01A 1YI8A 1OX5A 2F8LA 4A6XA 2OD7A 4QZVA 4UDOA 3SR0A 3M1IA 4ZPXA 2CLSA 4PQRA 1VMIA 3M81A 1TM2A 5FPQA 3HL0A 5HDBB 3VU3A 2B9VA 2FKNA 2GPBA 1YC2A 1TQ6A 1SXJE 3AI1A 5FHQA 3LQQA 4XVQA 4WLUA 2X7XA 4YECA 4BV9A 3P5SA 2JK0A 3QOYA 1ZXLA 1U2EA 3SX2A 5JC1A 4W1RA 2CD7A 3I2YX 1A76A 2P4EA 1RKQA 3FBGA 5F9MA 4EY3A 1FZQA 3P19A 1I32A 2ZIXB 4I2VA 1KDYA 3VKFA 2IOFA 2CGEA 3AJDA 4RW0A 5EESA 3N86A 1BX1A 2CL5A 2VIIA 2AG0A 3NHZA 1Z4KA 4HPXB 4MW7A 1YFZA 3ORRA 4EBFA 2WJJA 5JMTA 4BUZA 2J45A 4CHGA 4P34A 2MINA 2PWPA 3LQ1A 5ARBA 4WZ6A 1NY6A 5K99A 4WD3A 4XGQA 3E3NA 3HJTA 4Q7LA 1U1IA 4KH0A 4WXHA 3IPYA 2X8LA 4M9XA 3V46A 5IRCD 3H18A 1U1DA 4J0JA 4LDJA 5G4KB 3RT9A 1T5HX 1TMKA 1O08A 1SELA 5H5JA 3WGTA 2M6SA 1XXLA 4AF7A 1UDBA 3SS7X 2PBLA 3C8UA 3GJ8A 1SRRA 3GBSA 3PPIA 1T5SA 5KTOA 1SC4A 3EQ8A 3KWFA 2FY8A 1IMJA 1PT7A 2DWPA 2G8LA 3EZNA 4ATNA 4ZOAA 3B48A 3IEMA 4QDXA 5WRFA 4NYMR 4CETA 5IWCA 4YMSA 3MYRA 1U3UA 1JYEA 1HUQA 4DV2B 4N47A 4PE5B 1XQ9A 3C7KA 1JQDA 2VQ6A 1DV1A 1Y9DA 4LFAB 1NUSA 3G7SA 621PA 3VR3D 1AB5A 3KVVA 1E1CB 2YX1A 3CIFA 2V5UA 4PZAA 5K3SA 5K8TA 2P2LA 4KIGA 2M32A 1PK9A 1FVFA 3K92A 3CH6A 3L1UA 3LWDA 5EIAA 3MD0A 3RRYA 3TDKA 3NPMA 4QDJA 2ADOA 5EJ8A 1CUXA 1XR3A 2BFMA 2XUJA 4RJIA 2I2CA 4EY4A 3VVCA 1RAAA 2XDQB 1DPGA 1DQRA 4BDTA 4CEHA 1ODKA 2HKIA 3JQGB 2PFKA 2I33A 5L4NA 1AKTA 1WDMA 1Q0LA 4O1MA 1ZUHA 4ZIRA 1BXKA 3DKIA 1RYDA 5CDUA 1A7AA 3P9RA 2HNBA 3OOWA 4PONA 1HX7A 3KLNA 3SQNA 1AXEA 4I5FA 1MUUA 1VE3A 1YQXA 4KE9A 3V4OA 4A10A 3TUJC 1BXRB 1H8EA 2ZBFA 5JZOA 3LPAA 3G8AA 1DIRA 1IYZA 5ERYA 2J7PA 2NVOA 3H9UA 2VOEA 1DHRA 2IU6A 1AMUA 1FFXB 4KQ2A 4KLRA 2EG5A 4KUGA 2ICAA 3KLMX 4AJLA 2GSDA 5IKPA 5I8WA 3ADOA 4AKHA 2H4XA 3D5EA 1GZUA 5D84A 1ETHA 2HPZA 4QU8A 1PL7A 1RWVA 3P2OA 4X95A 4ME6A 1T36B 2GM9A 1Z0AA 1E5DA 2PPVA 2VJCA 1PT8A 4L95C 2VHZA 1Z2AA 2YVLA 4HUQA 3AOEC 3NAMA 1M1XB 2BDTA 4P08A 3EF3A 3CPHA 3ZLVA 4QXQA 4H3KB 3CXRA 4G8JA 5EOVA 1Q1NA 1YCHA 4B81A 2VJLA 1OVMA 4N6NA 4FFVA 1CLUA 4RV9A 2X22A 3QX3A 4JP1A 1ILWA 4GX2A 1GAWA 1VHTA 1YRBA 1TU0A 3O3MB 3HJBA 2OHVA 4MOWA 4WKGA 2P8SA 3OQIB 4KRXA 4P82A 4AO8A 5KQLA 4N41A 1W94A 2YWCA 4X8LA 2IYUA 1JPNA 4CM7A 4IQFA 3LJKA 2DY0A 1W1WA 2ZI7A 4IXWA 5HHTA 2BFEB 2UVPA 4MUYA 3SYRA 3STVA 4UAUA 1V8OA 3E4CA 2IFTA 4NFSA 4II3A 4ZALA 3THXA 2VUHB 3NFRA 1E5TA 2F1HA 2HLDA 1ZNYA 1EGMB 2AI2A 2DTDA 1DAFA 2ZCUA 3KHKA 1MV5A 5F23A 4J0EA 4Y6OA 4YXWA 3TRJA 2FMTA 4R1NA 1KJWA 2CNOA 2ZJ0A 3ET4A 5IK2A 2J09A 2QM8A 3AEKB 4GUAA 3X1JA 4AP5A 4KZPA 1HNNA 2FRDA 5GWXA 4JHLA 2VDUE 1D6SA 1H4VB 4LSWA 1SZCA 1KO5A 2HQRA 3RSGA 3GCZA 4MVJP 4OEHA 2H52A 1VL2A 1PR4A 2IZ1A 3GELA 4BNYA 4R2WA 5CB4B 1FTSA 2X19A 5HE8A 1UT5A 3IV7A 2QL7A 4LF9B 1A1SA 1E2DA 3PRHA 1X1AA 5BWNA 4LYYA 1R6VA 2V96A 4HDNA 2YNMC 1VLHA 1KVSA 3QVOA 5BQFA 3VVLA 4A2WA 2DT5A 4A3SA 3NBYC 1ENOA 1HDRA 3IHKA 4JYMA 4FS8A 4JJEA 4Y2QA 2JG3A 1E0AA 1KIMA 4BFUA 1S96A 4LJ5A 4CDMA 3A0RB 4BEBA 3G0CA 4HSGA 4TQUS 5T64A 1JSRA 1KKMA 3S4YA 1E7MA 2C9CA 2IA5A 2JGAA 3Q8XB 2ZB7A 3G2QA 4YRNA 3DEFA 4HVAA 1VJGA 2V7QA 2IY8A 2B21A 5H7XA 5J43A 1TD1A 2XDWA 1Y1TA 1Y5NA 4PYRA 5I9MA 3ZH9B 2CHUA 4S04A 2C3YA 2BFBA 1B41A 3N8HA 4JN6B 4JJIA 4JUCA 4MSUA 1QMGA 4HDMB 1NXTA 4TUYF 1WD5A 1W29A 3VSAA 3BWEA 3H9QA 5EJ2A 3P2JA 4AECA 3RASA 3VR1A 4AYTA 1J06A 2BEVA 1Y7TA 3CTMA 4Q19A 5EL0A 3HA5A 4MS4A 4QYSA 4DHEA 4BFWA 1QO7A 2JW5A 1XRSB 4QVKA 1B00A 2P11A 1ZRSA 3K6SB 1SBHA 2B6NA 2AE1A 3OEYA 2NU9B 1OKKA 2A94A 4KK4A 4MJ7A 3NDJA 4BIIA 4BLSA 4F2PA 1H2RS 3MA0A 5JFOA 1CB0A 5K0BA 3O8RA 3ECCA 2C4UA 2OD9A 3R7AA 4YUZA 3RAJA 4NBVA 3VM6A 4F6CA 1DWQA 4MQUA 5K5EA 3N87A 2ZIVB 2PZMA 4BCDA 1Z35A 4Z4FA 2JBAB 4X3OA 1Z0SA 4JS0A 3U4HA 3UAXA 1E1CA 2X6QA 3F8WA 5BUCA 1RIFA 2NOAA 3QUBA 5EP3A 2XDAA 2XOEA 1JHPA 2YYYA 5ALNA 2ZUTA 5BW5A 1DKRA 2W6CX 4BLPA 3UJNA 2WOJA 4O0LA 1IBKB 5ESRA 1ZZEA 2OMEA 3F47A 1PJBA 3WRXA 1N33B 1X7YA 1NJFA 2HIHA 1HSZA 3BGWA 4FGZA 1WL8A 2H4YA 3IT3A 3AWIA 5IG2A 5HGXA 4PRYA 1M6WA 5HDQA 1IZZA 1V4VA 1PT6A 2YXNA 4NK4A 4XX0A 3B8EA 3RAEC 2NNWB 2OBXA 4F4DA 1X1BA 2J9RA 2BIFA 5LQSA 4LHVA 5JXJA 2PZ8A 1LD3A 1PUXA 3QXGA 5JJLA 2DWQA 2WD8A 1UAYA 1NKSA 3BWYA 4CGZA 1EWKA 3TBHA 4L50A 4C4SA 1IWOA 1L7OA 2FPIB 1A5TA 4MGHA 3UWPA 3EA4A 3VI3B 4ZZIA 3NC1C 1WW2A 5JXHA 4QYMA 3OZFA 4I5GA 4MIYA 3R7LA 5CFPA 2G8NA 3HA2A 3KOUA 1JNYA 1XD2B 1XFAA 1W47A 3DOCA 4X60A 2A0XA 2NACA 3H5AA 3D8NA 3RYCB 4G23A 4J1NA 2BBTA 3NJ4A 2AHOA 1RWOA 1EFAA 1P9OA 4OG2A 5DCYA 1C30B 2X15A 1CUGA 1KI2A 2ORED 5ENDA 2GBLC 2OO5C 4A0SA 2C97A 4Q3CA 4R3WA 3RTBA 3I72A 2DFLA 4L9SA 4BMOB 3ICEA 5B6PA 3QEAZ 4I1VA 4M0PA 3BMNB 4K26A 3UFXA 1PKXA 4KGVA 1DAMA 2WWFA 4RVDA 4X7MA 3IXQA 1FJ2A 4HXYA 1CETA 1A8QA 1DZ3A 5JAQA 2YZ7A 1OI7A 1EWRA 3U7RA 5EJ4A 3KYCA 5I4KA 5JPDA 2W4MA 3L05A 3UH0A 5C8YA 1RBMA 4AS3A 5CT9A 3AUUA 3SJCA 2ZPAA 2VHTA 4IS2A 4XLTA 5TS2A 3ANMA 3DZ8A 4NABA 3SKVA 4YRAA 2Y68A 3RTEA 4AURA 5PNTA 3N0WA 3DSRA 1SQ0A 1MAVA 2PJZA 1EP1B 2GAJA 4RJTA 1OXUA 5A03A 4BRWA 4JDUA 1P6QA 3ND9A 4MEBA 3TF5A 2VKQA 1U0BB 1KMIY 1IK4A 4GAEA 3B53X 1JHRA 1QZUA 2YV1A 3PQFA 5IC6A 3BXGA 5CB8A 1YH3A 2Z08A 3A9SA 3VV3A 4YRGA 3Q4GA 5COBA 5JHGB 5FOQA 1TZBA 3C3CA 2FSSA 4X8HA 4ZAWA 4YRRA 3B6JA 1DQNA 2H8KA 3L92A 2VDJA 5CA1F 1MJHA 3U40A 4TGLA 3IKTA 3G23A 1B6RA 1IAQA 1NN1A 4OLJA 2GNAA 3SKXA 4WXMA 4J94A 4X94A 2G63A 1Q3HA 1ZU5A 3WMRA 4QOJA 2QY9A 5IM4F 3TE7A 5JNLA 2CXNA 2Q07A 3CVWA 1HEYA 3ROKA 3PU6A 3KFVA 3WLOA 1D0IA 1LDGA 3FFBA 4H3HB 2JJ1A 1KORA 4X85A 3EVBA 2D0IA 1VP3A 1Z73A 3LLSA 1T0BA 5FTMA 1SXJD 3OEWA 4X63A 2GERA 4EHLA 3ZD7A 1XTBA 5ALZA 3HZRA 3QH4A 2ZTLA 3FPAA 1H65A 1CF9A 1HQCA 1RE1A 2DH6A 2WWGA 1B1AA 3K5HA 3I37X 2FB9A 3HGQA 2FPOA 3LUGA 2J48A 2Z5VA 4XEUA 5ULLA 3KDAA 1FFAA 1FP4B 2JAOA 3B1FA 4PINA 4OX9B 5KQGA 3TCKA 2X2EA 4HDOB 1QO0A 4RTJA 3TX6A 1A71A 1FDTA 1FOEB 2ZSFA 4IJQA 1E6WA 2IIQA 3JAKB 2WFZA 1GAEO 2ANCA 1RRGA 5DJ5A 4MULA 4M3NA 4C88A 5M5BA 4EB3A 1NSTA 1TTHA 1W5AA 2QA5A 3CF4G 4C0KA 2Z1NA 1ECJA 3JQGA 4LNHA 4WKOA 2N75A 2WIFA 1II8A 1R4NB 1IRIA 4Q02A 1G0OA 4RANA 5A5GA 2A92A 2OO3A 2C4TA 3HLKA 1FFEA 3AI2A 4TTPA 1LRKA 2YR0A 3EFHA 3QF7A 2H2WA 4Q6WA 4WEOA 1NX6A 3PUWA 3SMQA 5B1YA 3OU6A 4FNGA 3PGMA 1ND5A 4I4NA 4V02A 1U2PA 1CUAA 2ZVPX 3KB8A 5DX1A 1RIIA 5CVDA 1AGXA 1L4BA 3FTQA 3MC1A 3N0RA 1EU1A 3GT0A 1Q0SA 4N0PA 1VBFA 3LK6A 1X7WA 2CVZA 5JR3A 1KFKB 1XG5A 3LUJA 4O63O 4UEOA 1U4SA 1WAMA 3LDFA 3WB1A 2OHOA 4Z8XA 4BKRA 2C83A 1D2GA 4LYEA 1G9SA 1DUIA 3QJ5A 4F2GA 1E5QA 2COEA 1T36A 1ZOOA 1UM9B 1S7CA 4DMGA 3OJOA 4RF2A 2H51A 3AM5A 3H2KA 3IALA 4KE7A 4E5YA 3G5AA 2OGZA 3BPSA 3F6SA 4D74A 3SLRA 3IPRA 3EX7C 2JLUA 1ZDMA 3RYTC 5KTMA 2YWHA 4KDRA 1JHZA 1JFFB 3HUEA 5HRCA 3R20A 1EWQA 2BM0A 1Z74A 3C7DB 3DD1A 2PLWA 3CN9A 1T9AA 1UBOS 3MCWA 4GF5A 4JBIA 2Q6VA 5CLHA 1HLGA 1RWXA 3B1KA 2ODQA 4L9AA 1A88A 4KYUA 2VF2A 1YS9A 4MPTA 2QPLA 1MO5A 3FZYA 3KPVA 1TKRA 2C5SA 2QNRA 1RAHA 1GP2A 3DCYA 3I1YA 1KJQA 3I8OA 1NQAO 3ITDA 4Y6LA 1GCIA 2RHJA 5T41A 4ENVA 2H29A 3TSWA 2PUCA 5KWSA 4I50F 1I3OA 1R6XA 3NTVA 5M7EA 3ONFA 3U44B 3KKLA 3VZSA 3RRZA 4D3ZA 3STWA 2ZYVX 1G3MA 1XT6A 2PZJA 2ZRIA 3FPCA 4FUQA 3TKAA 3S3TA 3OKFA 2ZQ5A 5EZ5A 3AEKA 5IAEA 1B3RA 1OZHA 3A10A 3EG9B 5H68A 3ZZMA 4BV8A 4C2TA 3GY0A 2CZQA 4MQMA 2YFHA 2KJQA 5JS1A 3DLAA 4EL5A 3NALA 5KX5F 1AA9A 1ND6A 1HDZA 2ONCA 3NM5A 4KOEC 3SYMA 3DV0A 2G80A 2BBSA 3IT1A 2PZFA 4KUHA 5DNVA 3SEQA 4QM6A 1IAVA 1RWWA 2QU8A 2WI8A 1VKNA 3J7AC 3CUTA 3HYCA 4L85A 4DL9A 1N2OA 1CJMA 5JXGA 3V7UA 5F52A 4RULA 3GP5A 3GRAA 4KDFA 2OGTA 2ZSIA 4J6EA 4CCWA 3AILA 2QYHA 4B74A 1PYGA 1D4ZA 1VSBA 3ROPA 4BTVA 4LMPA 4JENA 4D43A 1JTEA 3ZLTA 1BKYA 4LOJA 1NTRA 3OOSA 2DM6A 1S3IA 3SNKA 3QV1A 1KMQA 1IK6A 2IUTA 2C77A 4M99A 1PGOA 4MRMB 1CNEA 2VHUA 1T25A 2C98A 1XLWA 3CVYA 1S9DA 4MKFA 4NU6A 1K3TA 5AW2A 1UZMA 2ZUDA 1E7WA 2VH2A 1GSOA 1FJHA 4ZT5A 4ZYVA 3KOOA 4A8JB 2BPOA 1H6CA 4C06A 1NF2A 3LO8A 2ZIUB 4KIFA 3UPDA 1EVEA 3P27A 3HVIA 6REQA 1DJQA 3FCXA 4LVUA 1GV1A 2O23A 4XW2A 5LNK6 1B6SA 1U3WA 2L42A 3H9GA 3K30A 4JLOA 3IMCA 2DH5A 3K0KA 4FHFA 4MI9A 5TMDA 4JLVA 3M89A 1CYEA 3UMRA 3QW4B 1K2VN 3OZGA 4RUKA 4UEJA 1DU4A 3FCUB 3IVCA 3VDRA 4BX0A 3ZBQA 4S0XA 2HZ7A 1E4EB 2VWGA 3HUDA 1JRLA 1G291 4P7FA 1O96A 2BSAA 1XXHB 1NPTO 5FOXA 4RTNA 3IIKA 1YFLA 5AWFC 1F7UA 2IJGX 4PANA 3ZCVA 3IP9A 1IE3A 1X3LA 3MAJA 4AY4A 2IODA 4B76A 3OPXA 1YR9A 1AKYA 2D5LA 3Q8KA 4WK0B 1W0CA 1ZOPA 4G0PA 1TQDA 5K8JB 3I1IA 4FILA 1E32A 3W3AA 2GSWA 3LK7A 4DZZA 4BFCA 5ECGC 4TTJA 2I0FA 1UBCA 1IONA 1KYWA 1CY1A 1DXQA 2YBEA 4UOQA 1F8FA 2P0EA 3LLCA 1NY5A 3IAEA 3NBFA 4HX2A 2R60A 4LXGA 1WCWA 2NYVA 4IH1A 1I6MA 3OM1A 4A73A 4F4FA 4MQLA 2RJNA 2IHVA 3GLIE 3CLKA 1JKFA 1RQNA 4AT1A 3ZDFA 4AXXA 1KC3A 1WEHA 5EGSA 1PWZA 4P81A 4QUBA 2JZNA 1OWLA 3L8ZA 4QBFA 5AOAA 3HVRA 2QVZX 1M73E 3WYEA 1UQUA 1BEUB 2D3TA 3HI4A 5DT2A 1OWMA 1TM5E 4BE4A 5BURA 4WKPA 2O6HA 3TRFA 4GLJA 1BXGA 1A82A 3S5JA 4ON9A 3QFTA 3UK2A 1O9HA 2VJPA 2NTNA 3RUDA 1VLLA 4DJFC 2F4VB 3PR2B 1XX6A 2DUNA 3F8TA 3H2HA 2GJ8A 2WR8A 2WP8J 3FRHA 4JAVC 3U3XA 5BR8B 3GBPA 4HUQB 8LDHA 3MZ0A 5T67A 2DECA 1I0ZA 3LSYA 1TJ4A 2Y1LA 4RZUA 5G0SA 1A5BB 3ZXXA 4WBNB 5JRDS 3K70D 2FDCA 1CK4A 3ADDA 4BVGA 4GI7A 1MW8X 3H3JA 2ZXFA 3K0AB 3ROZA 4OHBA 1OXTA 4P9NA 3W6UA 4NYJR 4X00A 4FFRA 1TVCA 4L08A 3MJ4A 5KMGA 1LPNA 1SU8A 2Q2OA 2R85A 3CLHA 4DIMA 1T9GR 2FMUA 4GZ5A 4IJMA 3BFVA 2VYNA 2C2ZA 1JAIA 2VHEA 3FGOA 3KS9A 4M8SA 4D4IA 4DTCA 1RYYA 5E1MA 4C2BA 1U28C 2W93A 3G8BA 4Y9TA 5EE9A 3N2LA 1M2NA 2C8VA 4JQYA 4MUHA 4W9NA 4ZK2A 4CU2A 1LDNA 2BR3A 4BEWA 5AHXA 4NL4H 1FMCA 1I3CA 3TW8B 1K66A 1PQYA 2WW8A 2LBPA 3DUFA 2XIQA 2EARA 2GAIA 1YQTA 3U7IA 3VSBA 1UBLS 2B2XA 3QVUA 1VPVA 4JC5A 3VHXA 2V59A 5DISB 4B6PA 3JRWA 3R9XB 4ZTZB 2VJKA 5LCXA 3TRHA 3NHAA 4JR2A 1GZ6A 3NFYA 3WB2A 1GGKA 2HIMA 3UKOA 4LXHA 1RKUA 4WJKB 1GKIA 3CLUD 4ND2A 1FS6A 3WGUA 2PRIA 3VZDA 3RGGA 2CNWA 4L2IB 4RD2A 1G20A 2QGNA 1TU3A 3QLJA 1KOLA 4CIWA 5LP1A 3N7UA 1QP0A 4OQNA 4KHPB 1JHUA 4BN5A 4R5HA 3PLAE 5K1ZA 3W5IA 4U8GA 5ICEA 1ZIPA 4MLPA 4ZT7A 2DPGA 4GKKB 1DRKA 1N5DA 2QP4A 2WILA 3KXPA 3USZA 4RZSA 3PCRB 2ZR9A 4UEWA 5AJYA 5DGHA 1P7YA 4J7CA 4DLYA 4BNTA 5IAGA 3F0TA 3FDJA 2BGTA 3S99A 3L5OA 5T57A 1JR4A 2ON6A 3W5AA 3ER8A 2GWHA 4XWTA 2J9YB 3L8DA 5CVTA 1D4AA 1MO4A 1ZRNA 2DHDA 3K0BA 2JCGA 3UJCA 2PUTA 4YAFA 3V3KA 3AR9A 1MD9A 4N3BA 1Q1QA 2H1OA 4QHYA 2YW2A 2CHFA 5TJ9A 3ZYCA 2O5EA 1PTKA 4PXSA 1YJBA 4EI9A 1OU4A 2OXIA 3GUYA 4WL0A 3M2TA 4ZKEA 3W06A 5ILOA 4PQGA 4HADA 7REQB 1IVSA 1SQ5A 4ETNA 2QMZA 3HGMA 4UMVA 2XNDD 2ZYSA 4J03A 2HJVA 4ZCTA 1NUTA 5DM70 1PL0A 2XPCA 3VNVA 1ACJA 2RIPA 1C7FA 2X0JA 3NTRA 3IBYA 1M34A 3JQ8A 1GL3A 1P6XA 4RU1A 3ZWQA 1FSPA 3D8BA 2GBFA 5FUQA 1TECE 4JUIA 4PPGA 4U2BA 4ZMSA 3O8CA 1NJ1A 3MHPA 2O3QA 2AQKA 1AS3A 4LZZA 1O95D 3I09A 2VDMB 3UAOA 1IG3A 2QUHA 1JZSA 2Q6TA 4TV9B 4ZQCB 3DTNA 3KR1A 1N2ZA 3RIEA 4QO8A 1O9GA 2ZT7A 2W71A 3CF0A 5B58C 1B16A 4KO3S 3IUEA 1WXDA 4EPYA 1P61B 3WAKA 2IPAB 3OTHA 5BN5A 3KZNA 2PCJA 4LUCA 1PK8A 2NSDA 2BVNA 2DCUA 2GARA 2DR0A 4X62B 4Y67A 1JHOA 3E82A 1SBCA 3PBKA 3VSEA 1X86B 1PQPA 3I2IA 1SHJA 4RPHA 2Z4SA 3KKNA 3UBTA 3D6UA 3NHPA 3D4BA 3Q3HA 2X0IA 3OVMA 1IN8A 2X3UA 1XZKA 3JWGA 2OCDA 1JALA 4AVYA 1B23P 1A4UA 1TFUA 4MQEA 4YGYA 5J4VA 3N5KA 3P4YA 3H4IA 3B8HA 4OCZA 3ZK8A 3GPCA 2E89A 3CSDA 3TSCA 3DM9B 4FS3A 3Q6IA 4R83A 4UHCA 3DB1A 3LVRE 4IFIA 4NY1A 4X20A 4JP8A 4IRXA 4JL6A 4WZBB 4ZZ3A 3I61A 2BP7B 3A1UA 3IMKA 5LP6F 1WCIB 1NBME 2W5UA 4M0LA 4BOYA 4Z0HO 3H3XA 3RLFA 4BTLA 2HYDA 3K05A 1UJCA 4JDPA 5JO9A 3D6AA 1S2OA 3HKBB 1O8BA 1EXMA 1ZL2A 2PV7A 2GEKA 1HORA 2WJIA 1XTTA 3FN4A 3L6RA 3OURA 4Q1AA 2J33A 4F0JA 1MEJA 3VU8A 1QO0D 3AHDA 1PVVA 3SZRA 1IBMB 1B3BA 1OFGA 2PEYA 1SXHA 1TM7E 4HDAA 4QG3A 1X7HA 4REQB 1U94A 3EG9A 3RVMA 2X5XA 3I6MA 5AHOA 5U9CA 5JJKA 1C1DA 1DAPA 2A0WA 3BEOA 2PBRA 2VSYA 1US8B 3PXCX 4GZ3A 4U7HA 1E1YA 2KS6A 2Q8NA 2XMCA 3R74A 4DRYA 2I78A 1GXSA 4KWEA 4PIPA 4ZEXA 2P1RA 3UXMA 3IS3A 4U7PB 4QJ5A 3ODGA 2IVZA 1TYZA 2Z8XA 3CHYA 4IGAA 1NLZA 5HTKA 1Q0ZA 4D8TA 4W6ZA 1GU1A 1BE6A 4I0WB 3NHWA 3FUVA 4Y2RA 2PH1A 3ZU6A 2HGZA 2E4VA 3QE3A 1WQ3A 3N6RA 3OIFA 4I55A 4HRAA 3OOEA 1UFVA 3SBDA 5C8YB 1N8TA 2AFHE 5HKKA 2JGFA 3E70C 4CKCB 1QYIA 1X9HA 3MGCA 5BO5A 1H2YA 4M86A 5GJWC 2XGOA 3GWGA 1XVIA 2YC2C 3M0EA 4ZYTA 5IJ0B 2PVSA 4KB5A 4RETA 4Y2TA 3P26A 1W4ZA 2XVXA 2ZIXA 2VYND 2DHRA 2QUJA 2FSVC 3FYDA 1ZM2A 3Q15C 4B85A 3I42A 2ST1A 4FMCF 2YY6A 2C9ZA 4QG7A 3WVNA 3A6ZA 1R0ZA 2PA0A 4LSMA 4Q24A 1XYYA 4XVUA 3KVOA 3OF2A 5KJEA 1NW6A 4ZT3A 2AD5A 3TO5A 1Y63A 4CDNA 5KOJA 4CKYA 1UINA 4CMEC 4X0EA 1SCUB 2H2GA 1KVUA 2JATA