1Z0FA

Gdp-bound rab14 gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB14, member RAS oncogene family
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0fA01
3RC8A 5FOWA 4L16A 2CVFA 2OO7A 2WWWA 4KVGA 3WRXC 4CGZA 4IKEA 2DY1A 3ICEA 4LJYA 1EFCA 2R62A 2XZPA 1HTWA 3TSWA 4LC1A 2PLRA 5AUQA 4LBYA 1JI0A 3O8CA 2R2AA 4IEIA 3MSXA 5JRZA 3A36A 4NCJA 3RNLA 1G8YA 4FMDB 5IDVA 1LVGA 4WZBE 1KYIA 4ZI2A 1MOZA 5HCNA 4M1SA 4JYBA 1W4RA 2D2EA 1SULA 2IXGA 2V54A 3VU9A 2IYQA 3C16C 4YONB 4G5OA 2ZUDA 4M2LA 3TSOA 2CNWD 4OQFA 2J87A 3LNCA 2VSFA 2JASA 1OSNA 3FFAA 1OHHA 2ZJBA 3QG5A 3CUEF 4Q00A 1E9CA 5GJBA 2HDNB 5AJZA 1A7JA 3SOPA 3SZRA 2XITA 1H8HA 2IXEA 3GJ3A 5G3ZA 4IHQA 4II7A 1HE1C 1VIAA 4QFMA 1S1MA 1CJUC 4QC2A 4FMCB 4JL6A 4IW3B 2NO7A 3Q7QA 5JLJA 3NBZC 3KXLA 3NEJA 4KYIB 3FWYA 4K8OA 2QMOA 4DWJA 1RPZA 4HAWA 1E98A 3Q3JB 4CEHB 2OCBA 4M4SA 1FP6A 4NPHA 2GJSA 4IDOA 4NH0A 4PO9A 5B2ZA 2HYIC 2Z83A 2ZU0C 3W5JA 1ETUA 4DCSA 3IIMA 3TNFA 3O8DA 1Q20A 4KHZA 2RHMA 5LB2A 4A0GA 2QBYA 1LW7A 5EZ6B 5BWMA 3A4MA 4UXJA 4H9GA 3NBXX 2BEJA 1NMYA 5F3WB 3Q72A 2C04A 4QOSA 1D2EA 4HSEA 3AVWA 3QKSA 3MUFA 1XZQA 2ZRDA 3PEWA 2QT0A 5G53C 3NKVA 2WKPA 3LW7A 3OF5A 4GSYA 1EESA 5DN6A 1N5LA 2ZI9A 1EX7A 4CZ2A 4M1YA 1G8FA 2Z5FA 3EX7C 4NBSA 5JHGB 3KUDA 1Q0UA 2QEQA 2WWGA 2YHSA 3LA6A 2Q3MA 2ZSFA 5FOXA 3SC3A 1T3LA 1BS1A 1SXJA 1TAGA 3CZQA 3KKMA 2FH5B 2ZJZA 1QDEA 3LW8A 4MRPA 1WXQA 1TX4B 1W1WA 5AK0A 2MSDB 1F2TB 3U4QB 3TRFA 5J4YA 3AUYA 1ZNXA 1QHHB 2OT3B 4LHWA 4P32A 1RRCA 1H8HD 4RCYA 2VL7A 3SHFA 1YRBA 1G7TA 2C9YA 2ODNA 1Z0JA 4WVFA 1UEIA 3VHLB 4CEJB 2D3WA 5CLQA 2TMKA 2IXFA 5DGXA 1R0YA 4U02A 1XJ0A 4JMPA 4TTQA 1EX6A 4DT1B 8OHMA 4WIAA 2X77A 4IXNA 1GKUB 4I1VA 3U44A 1NLZA 1GP2A 2ZRFA 3F8TA 4M1MA 3GJ7A 2ZI7A 1XCPA 1C1YA 3KJGA 3RS2A 1G3RA 4KXFB 3FMFA 2UKDA 4I4LA 4DC9A 2WAXA 2BMDA 4N1AA 3AF0A 2RGNA 1E9SA 4B6EA 5JI3E 1J99A 4HZUB 1T4GA 4W5HA 3KL4A 1OIWA 3N5CA 5JWHA 4B34A 4EFMA 4HB0A 4D2IA 2VH5R 4JIMA 2DB3A 1KI9A 1E6CA 3K8YA 3O8BA 3U7FB 3EAQA 1BH2A 4PANA 1E9AA 1AS0A 5DN6D 5KSYA 3W90A 1G7SA 3MAAC 3GLIE 2NQ2C 3I61A 3AQ4A 3QY0A 2IYVA 5FTLA 2WAYA 2J46A 2CBZA 4Q7LA 5CB6A 3EC1A 2WWIA 1TUIA 1IJEA 5EUMA 1SXJD 3OAAD 1D2MA 3FVQA 1AM4D 4W9MC 3A8TA 1F6BA 3AP2A 2PLFA 2QGNA 2BJWA 1CRQA 4Q48A 4XVRA 2NGRA 2I3BA 2J45A 2P6UA 4Y0VA 3W3AA 4HDOB 2R6DA 4OI2A 2SHKA 1K8RA 1G5PA 1ONBA 4OK5A 3THOA 3U3KA 2GESA 4FCVA 2AK2A 4RCZA 1G291 3BB3A 3KTAB 1RKBA 2OCAA 5A5GA 1MRNA 1DO2A 2G77B 2JDIA 3CRMA 1D2NA 3BH0A 4HDCA 3TGPA 5DHFA 1XMIA 2AL7A 3ZZ0A 4V0KA 2LKCA 1VCIA 4Q1EA 3DDCA 1U8ZA 1EWRA 1SVOA 4A9AA 1JB1A 1GIAA 1XD2B 2ZJYA 5UKDA 4DDUA 3KKOA 1U9IC 1RW4A 4RFSA 4PXAA 1XEXA 4JLOA 5ANRB 1SVSA 4CEIA 4KITB 2B7CA 4C0QC 2YWGA 2Y8EA 2YYZA 4PSAA 4X8LA 1JEEA 3T1OA 3ND8A 5DISB 4JBYA 3DPUA 2FZLA 5FPYA 1KNQA 3CNLA 1XJCA 2MMCA 2F1RA 4TWZA 1E69A 4XWKA 2GNOA 3OFNA 3WNBA 4DUGA 4V0MA 2FFQA 2J0VA 4G5GA 4Q01A 2JLWA 2QQEA 1JNYA 3D7MA 3FB4A 1SKQA 3C8UA 2X2EA 4BEJA 1DAIA 2DFKB 1T9HA 4URYR 2IUUA 4YMTA 1N0WA 1G20E 1CJMA 4EPTA 3CX8A 2GA8A 4AD8A 3UANA 1JR3A 1X1RA 1E2PA 2LKDA 5LDDC 1E1RD 5FL7D 3TIFA 1DARA 3JZMA 5JJKA 1G5RA 3WYAA 2Q9AA 4Q7KA 2ZTSA 3V00A 3KQKA 5LPNA 4AY2A 1KGDA 3QVUA 3C4JA 3EZ2A 3UPUA 2ODEA 5IF9A 3WMGA 3W8NA 3TUIC 3UMRA 3TUZC 4PPNA 1M1YE 4XIGS 1E2LA 1KY3A 1XCGB 4DLSA 4UNRA 3U60B 4ESHA 4WBSA 3BC1A 2W0SA 3RS5A 2VP2A 3W8RA 2QTFA 4RD3A 3EASA 3NBYC 4L5BA 4IOJA 3UWOA 4KLZA 4PQFA 1FX0A 1JQLB 2ZRLA 2VEDA 3S1AB 2OILA 1CR0A 1M6NA 1XTIA 2ZJAA 3CR8A 2WMNB 3NVAA 2ZYVX 1VYTA 5KUTA 3M1IA 1MKYA 2AFIE 1DG3A 4BLSA 4Q1FA 2ZVQX 3W6NA 2IBMA 4IVQA 4LV5B 1NL3A 4MUAA 5FTJA 5KNBA 5KSZA 2W6IA 4CF7A 3VKWA 4Q4LA 1GNQA 1WF3A 2PL3A 3REFA 2XZOA 2BCGY 5JFGA 2MSCB 1U98A 5F98A 4LYHA 4HYYA 4OKSA 3VQTA 1T3SA 1TEXA 2QAGC 3OFND 4DUGD 1X86B 3P1JA 1LS6A 1T91A 2VP5A 3K0FA 3QPWA 5C18A 4M1OA 2VIIA 2VRWA 2W0MA 3K70D 1CKEA 5AR1A 1XX6A 4LHYA 1W5TA 4CW7A 4LHZA 4F92B 1JR3D 3PCRB 2ZE8A 3E70C 5KPJA 2V3CC 5EE9A 2QP4A 3LRPA 4V0LA 3BWDD 1QHYA 2IYZA 2QN6A 2WKQA 4GP6A 1BYIA 1VCMA 3FKQA 4N0DA 4NZYA 3A58B 1BMFD 1U8AA 2OG2A 4M22A 4UJ3A 1CP2A 2ZI6A 5KPDA 5CIWA 1P9NA 1ZNWA 1SHZA 4X8HA 5AUOB 3DOFA 4QHYA 5J4LA 3WP0A 2Z0MA 4LDJA 3G0HA 3CONA 1ZD9A 2W2VA 4ERNA 1N6NA 1R5NA 2GBLC 4PC3A 4JLNA 1TL7C 1H8ED 2J7KA 4NONA 1JXMA 5L8VA 3CR7A 3GLGE 1U81A 2W00A 3CPJB 5DI3A 2XB4A 1G3IA 1Q1QA 4MDFA 2CCJA 2QQ0A 4PZYA 1G3QA 1NP6A 3TW8B 3U5ZB 4NKRA 2IYRA 2PEZA 3SBDA 2C95A 1QF9A 1P72A 2W6ID 4B71A 4Q1BA 4F38A 4L8GA 4UXIA 3IGFA 4URWR 4CEJA 1HT1E 1UDWA 2WWXA 2FE4A 1ELOA 1S9HA 4OK3A 1GRQA 3OEHA 3TQFA 2GAAA 4KFTA 2FFBA 3BIFA 1A1VA 1F2UA 2XZLA 5C46F 4LJ9A 1TTTA 2KBEA 2YOGA 1RE0A 2ZI4A 4MKGA 4MRRA 1J8MF 3SJBA 3TW4A 1SHKA 3CF2A 4IOLA 1ZAKA 2R44A 4YDHB 3TH5A 1OIXA 3X1DA 3B1ZA 3N2IA 4C7OB 2JLYA 4PPGA 4DBLC 1IONA 2UZ3A 3P20A 4HZUA 2ZRIA 2V8OA 5AJWA 2B8TA 1B0UA 3EPHA 1YZQA 1WDTA 2BMEA 3UXMA 2ZXUA 1A2BA 1Z07A 4Q4AA 4LPKA 4TL9A 1U99A 1JJ7A 5SZKB 1S3GA 1TU4A 3U3MA 2JCSA 1BIFA 2FSIA 3GP8A 1AS2A 2GCNA 1NVWQ 4Z8XA 3L2OB 4BLTA 4DB2A 1MO5A 4KV9A 4AKEA 3U6BA 3FGNA 4YXWA 1L4UA 2BC9A 2ZS8A 3A1SA 4P4SB 4A0HA 1OT3A 2NTYC 2CVHA 4A82A 2OM2A 4DLZA 4WW0A 2ZROA 1IY2A 4ZV4A 1NRJB 1E2EA 2PBRA 1D6JA 4MYUA 2XTNA 3ZLJA 4GRAA 1KHTA 1UADA 4KSBA 3AF1A 5JCPA 1LTQA 4ITRC 1GNRA 5H1YA 1E99A 4EQ6A 4NYIQ 3T5DA 3KB2A 1KDRA 1X8KA 1KO4A 1NIPA 2CCKA 1XTSA 4NYMQ 3IPYA 4IRUB 2ODBA 1ZVQA 2C99A 3KTAA 4QGHA 4W5JA 4GMXA 4OHYA 1NG1A 3Q85A 3GJ5A 1AN0A 3F5FA 1JEDA 3KXKA 1XB2A 4WXRA 3QIAA 1M34E 3P32A 1G3MA 1ZM4A 3AGPA 1DE0A 5AJVB 3EA5A 2IUTA 2ZJ8A 1W2GA 1P60A 1JALA 4GBMA 2OAQ1 1XTQA 4PHGA 4TMWA 3ZH9B 1CXZA 3X1ZA 4ILEA 4D6PA 3QI2A 2XXAA 1MABB 3TUJC 4A8JA 1GNPA 2O8DA 3Q7PA 2CHVA 2Q9BA 5DO9A 3RRNA 4QGAA 5KU1A 1DTSA 1GITA 121PA 5EE5B 4A36A 1IXSB 1DADA 2IT1A 3DVLA 4JBWA 4HLUA 3B1WA 4ZPXA 3OZXA 2NO9A 1Z0AA 1ZUHA 1QRAA 2ZETA 2JIZA 1R10A 1DS6A 1E2MA 2F7SA 1EFUA 4L9WA 4E09A 4YXWD 5C2JB 6Q21A 3FYHA 3OE7D 1E0JA 3KKNA 4JLAA 1G4UR 2H57A 4EPVA 3L0OA 1WB9A 4EDHA 3AH8A 1OV4A 3EZ9A 3N2EA 1XEWY 1UKVY 221PA 3KKPA 4ZDWA 3H2YA 3IO5A 4EPWA 1E3MA 2FWRA 2ORIA 2REOA 2F43B 1X3SA 4QGGA 3W3ZB 3ZS9A 1BKDR 4M1WA 4PC2A 4LRWA 4DT1A 1P5ZB 1KAGA 5CYPA 1XF9A 4JLBA 1T8TA 1KMQA 4QJ5A 1ZIPA 3P4XA 4JVNA 1VG8A 1E0SA 2KE5A 4LJAA 1E1QA 3TQCA 1D9XA 2GJKA 2HUPA 2MMGA 1D9ZA 4KFUA 1G7CA 2O8CB 1OFTA 2HCBA 3LO5A 1W4CA 4MGKR 5JS7A 4RD1A 4I81A 4H1VA 4C4PA 3T35A 4IOKA 4JLVA 1HUQA 3K9LA 4NU0A 1SZPA 1G8GA 1Z0KA 3GJXC 4QRHA 3RWOA 3FPAA 3U6KA 3SS8A 1HT2E 2QTHA 1OH6A 2WICA 3B6EA 2ZSAA 2J1LA 3X1YA 1L2TA 1OXUA 2QMHA 2A9KA 5SZJA 1UBEA 4TYNA 1P2VA 4LOAA 2J0UA 3SYKA 4G3XA 3D8BA 3WP1B 3ADCA 4US1R 2QA5A 4BLPA 2BJVA 2PCJA 3QF7A 2OUKA 2OFOA 3NH9A 3GJ0A 4AI6A 1Q3TA 1NBMA 1E2DA 2JIZD 5FL3A 1PUIA 3PEUA 4M9QA 4QL3A 4URXR 2C2HA 4YMUA 4JBXA 4RJLA 5M04A 3SJCA 5JHHB 1X6VA 2JAQA 2ZREA 2IHYA 1KJWA 5EP2A 2ONJA 2ORWA 2IWRA 2CLSA 5EE3A 1E2KA 5FTMA 2WOOA 4EJSC 3K0EA 2QENA 3K9GA 4IVPA 2QPAA 1KI1A 1T0JB 4JLMA 1Z6YA 2ZAMA 1NI3A 4A0RA 4D0GA 2O8BA 4ZCMA 4UNNA 2RGEA 1KTVA 4KCGA 2PCLA 5L3RA 3T5GA 1ZM3A 3AF4A 5EXXA 5EP4A 2C9CA 3MWKA 3HR7A 2F55A 1IQPA 3BRWD 4G5SA 4WA7A 1VHTA 3WHLA 1MT0A 3J81k 3TVDA 2AD1A 2ZRKA 1E1QD 4D4MA 3VR3A 4OJQA 4DDTA 1YRAA 2N42A 3C5HA 2VPPA 3HP1A 3VHXA 1WA5A 2V1UA 2XB2A 3ZDQA 1LF5A 3TE6A 4PFSA 2QNRA 1KSGA 1NLFA 2GCOB 3GLHE 4BEBA 4NHOA 4CVNA 3GFPA 1NMXA 2KJQA 4B2LA 4PSKA 1X1SA 1BOFA 1D8TA 4YC7A 2XGJA 3N70A 5C4MA 2B6HA 1HY3A 1ZU4A 1QHXA 5D3MA 1E4VA 4NYIR 1G6OA 3B9QA 1CJTC 3A1UA 1FMJA 2FEOA 2VBCA 2WHXA 1T8UA 4LX0A 4ACBA 2ZRGA 1CLUA 1NBMD 4AKHA 5IRCD 4DIDA 5CDFE 5JJIA 4LJ7A 4TZ6A 1RZ3A 3CPEA 4XVQA 3HYTA 5AJXA 4UNQA 3GLFA 2A30A 1MO4A 4IVRA 3H1TA 4LHVA 1CS4C 4BASA 1GRNA 2Z6VA 1J2JA 4JLJA 1N0UA 3MD0A 4QM7A 3RVBA 1NSTA 1N6HA 2EYUA 4L4UA 4LI0A 2VTKA 2ZI5A 5JEEA 4QBFA 3RWMB 1XXHA 2I1QA 1W49A 5AWFC 1I2DA 3RC3A 4YMSA 4DCVA 4C9BA 2E1RA 4ZKEA 3RYTC 5L3SB 5JJLA 4FW9A 4MITA 1XPRA 1U0JA 1AKEA 1DBSA 3LLUA 3MGCA 1KMHB 3FHTA 2X1VA 2PEYA 4RFVA 4HUQB 5G40A 2RGGA 1ZCBA 2R8RA 1P9WA 2FPKA 1W4BA 3GLGB 3KX2A 4PAQA 2W2TA 4M8NE 2IWHA 4E22A 1E2HA 4MKHA 5EQTA 2IF2A 4DSTA 3R7WB 5EXTA 2A78A 4TMZA 3BORA 4HAXA 3CB4A 5GADl 2XOKA 2BVNA 3MRSA 1HE8B 4LBZA 5FTKA 1OFIA 1IAQA 2GF9A 2WOJA 3IBYA 2ZRBA 4DCNA 5CK4A 1ODFA 1DELA 1VDZA 4D26A 3CIOA 4FIDA 3CKLA 4IDPA 1KI6A 1VG0B 1YR8A 5KDDA 1L7VC 2HJGA 2NO0A 1KDPA 2IC5A 1AZSC 1NSFA 4TYPA 2O0JA 2OBMA 4JJZA 1VYVA 1JBKA 1J90A 1KZ7B 3PFIA 4KSCA 4Q9HA 1Q12A 1CULC 2OBNA 4FXPA 2VF8A 1J7KA 1XCMA 1ZM9A 3AM1A 2O8EB 1OB2A 2JJ2A 3LQQA 2QSYA 3AEZA 2CL7X 5FFMA 4D25A 2ZSBA 4HAUA 3O8RA 1MR3F 1GAJA 3B13B 3M4YA 1R0WA 1YR7A 4K81B 3KQUA 1UDXA 3KXIA 4OHXA 5BN3A 5GVRA 3L8YA 1GUAA 2X19A 4DB4A 2EFGA 4S2EA 1Z6AA 2QRZA 2VYFA 3QENA 1EFTA 1DAGA 2GXSA 3PUWA 1ZJ6A 2CDNA 4PO8A 2LWIA 2DBYA 2OEPA 3FDIA 3A6PC 2HF9A 3K0CC 1U9IA 1FZQA 2BM0A 2VP0A 4XSHA 2GHIA 3B7GA 1GSIA 4LC0A 2J7PA 1LB1B 4ZIRB 4ABYA 4AG6A 1JECA 1ZD1A 2IS1A 3OAAA 1P4SA 2XOKD 4KU4A 2EU8A 4PO1A 2BBOA 3KZ1E 1OYYA 2QZ4A 3I72A 1LS1A 4OQMA 5KDLA 2QRNA 2PX3A 2QTVB 5FR2A 4D82A 4PTLA 5CIQA 3UG7A 1G6HA 3LVQE 3P27A 2HXYA 3NXSA 3PV0A 3IIJA 3Q8XB 4HLQB 1P2UA 4TYYA 3I8SA 3THWA 2A5YB 3VX3A 2ZI3A 1U2RA 1CJKC 2REXB 1G1MA 5EXSA 2G88A 3GJ4A 1NLYA 1QVAA 3KQHA 2WV9A 4KVAA 4AYTA 5HCIA 2WTUA 3RRYA 3HU2A 1Z83A 1YJ5A 1G17A 1DEKA 3PUXA 2V6JA 3H86A 2JJ2D 2XTZA 2FU5C 1KO7A 5DI9A 3TAHA 3CF0A 1NMZA 3ZYCA 1IN8A 1MO3A 1G18A 3L0PA 5TVKA 1Z63A 3R9WA 2D74A 2Z43A 2OESA 2PT5A 4KODA 2NPFA 1N5JA 4JKYA 3NDPA 1NG9A 3VNUA 1CJVC 1R8QA 4RKFA 2IUSA 2FDCA 5L3QA 2F6RA 1YZLA 1P62B 4NCNA 5FBRB 1XTRA 1ZUNB 4Q9IA 5FOTA 1S2MA 3AP1A 4Q4JA 4U5XA 1YKSA 3WMFA 5B58C 5FBWB 2AFHE 3QF4A 2P67A 3W34A 5HTKA 5EP3A 1ZW6A 4EAQA 1O87A 1Z5ZA 2J7PD 3DOEA 4O25A 2RGCA 2FJUA 2DHRA 2O8FB 3U7GA 2B7BA 1W4AA 1E1RA 3K0AA 2QE7A 1PLJA 4TL7A 5FL7A 3FOZA 2O52A 4QNRA 3THYB 2BOVA 3A4LA 5LB4A 2ZANA 3A1VA 5FBQB 2QAGA 2REBA 2ATXA 3SYLA 2C96A 2D2FA 4LYJA 1AKYA 4P4UA 2JJ1A 4C0JA 2B92A 2V55B 3NTUA 4C0AC 1HQYE 1YZUA 4TL6A 4GOXA 4G01B 4Q9KA 3TR0A 2CL0X 2DPXA 5B57C 2FGJA 2CMKA 4OBEA 1AIPA 2GCOA 2OLJA 2ZR0A 3BFXA 4NDZA 2WIAA 1F3OA 2GDJA 3C5CA 1SXJE 4EJSB 1GTVA 3U7HB 2F3RA 2YWFA 1E9EA 1Z47A 2IW3A 2QM7A 1AS3A 5HKKD 4DJTA 4MRSA 5HE8A 1Z8FA 5J4KA 3BBPA 4UXHA 4C30A 5GJCA 5L3VA 1PLLA 2CJWB 1E96A 1R8SA 3IQWA 4LPSA 1II8A 2GZDA 2F3TA 2WWFA 2GJAA 4FMDF 4G5RA 4GNKA 4Q21A 4Q9JA 2GBLA 2ZAOA 2ZITA 5IHPA 5JECA 1VTKA 2OLKA 3FFBA 1UBCA 3LXRA 4I1OA 3MCAA 2HJVA 3GPLA 2NO1A 1E4YA 3B1VA 1R4AA 2ATVA 4ZCLA 3AVTA 2YV5A 4EUNA 3AKCA 4NCIA 5FBLB 1IN6A 2EFDB 1W0KA 3K0SA 1DAKA 3K9HA 4OI4A 4PZZA 4OYHA 4AURA 4CT4B 1TF5A 4LGMA 2ZPTX 2QE7D 3LBHA 4RKEA 4TYWA 4Z51A 2RGAA 2ZRJA 4TL8A 4AYXA 2OAP1 1NN3A 1BMFA 5K8UA 1FOEB 2EQBA 3CRW1 2WKRA 3IHWA 3OEEA 3RSLA 3AF2A 3WBJA 2IYUA 2KBFA 3MWLA 4KBFA 4B75A 4JT2A 4C2TA 4Q19A 2JJ1D 4AC9A 2OCPA 5KHOC 1QG4A 2YVUA 5CITA 1UBGA 4I1UA 3NBFA 4HUTA 3G5UA 4JVMA 2IEYA 1E94E 2FZ4A 5EP1A 3T1VA 4DSNA 1NVXQ 1QZXA 1FP7A 3LH5A 1UPTA 4RY2A 1E9DA 1US8B 2NOAA 4A2QA 1NJFA 2AHOA 4LBWA 4R98A 2ZR9A 4NCKA 1H8EA 1YE8A 1Q3HA 2YWHA 4F91B 1RIFA 4PPQA 2Q3HA 4Q18A 1YVDA 4CYMA 4RZ2A 4JVLA 4F4IA 2QI9C 2JEOA 3H0KA 3I1FA 3R20A 1RC8A 3LD9A 4GP7A 4F7WA 4DZZA 4BZPA 1KI3A 5CM8B 1XJQA 4BFVA 2ECKA 3SFVA 4JJKA 1CU1A 5P21A 3QXJA 1KKLA 4R2HA 1GL7A 1RRGA 1K5DA 3ND9A 3DKPA 5K8LA 3SQWA 5B64A 2BMJA 4N0EA 1FQJA 1G5TA 2BIFA 2KWIA 3EZ7A 4BE7B 3VR1A 4CEHA 1R0XA 4D0NA 4ZDKA 5JBQA 1G3UA 2VLIA 3OIVA 4I1SA 5DE3A 1KJZA 5F9HA 5CK5A 1W0KD 1U0HC 2WJJA 2O8EA 3ZQJA 1W7AA 3LWNA 1FTNA 5DYIA 3FMPB 3PENA 2R9VA 1XEFA 1HEIA 4LYFA 1SVIA 2D4HA 3QBVA 1XP8A 3U7EB 5FPTA 1VMAA 3RS0A 3ETLA 4A1FA 1KSHA 1P73A 3OEED 5EUQB 3R8CA 2IS6A 3ECCA 4TSFD 1E9BA 2J9RA 3T61A 3PUVA 3BH6A 3LY5A 3E2IA 4TZ0A 4TMXA 1RRFA 3P4YA 4V0ME 2H7VA 5E95A 3TR5A 1CF4A 4G5QA 1XBTA 3WY9A 3HU1A 2A5FA 3P26A 1PLKA 4B76A 1NVVQ 5HZKA 3SYNA 3OIYA 3BE4A 2WMOB 4MKIA 2Q6TA 5JWOA 3IEVA 4JVSB 2XNDA 1G4AE 4WAUA 1Z2AA 2QG6A 4BRUA 3U4QA 1F2TA 2NMVA 4X8OA 3CRRA 1QHHA 4P4TA 4TMKA 4DCTA 2IX3A 3ZIAA 2H16A 2JGNA 3PUYA 4N3NA 4BFSA 1VKJA 3ZVRA 3EIEA 2Q9CA 2CCGA 421PA 1VG1A 4D4JA 2IS4A 4LUCA 4PZLA 3BD9A 2AWNA 4F4CA 3VNVA 4RVCA 3THXB 1NF3A 1OJLA 4BFZA 4C3ZA 5KDOA 3NC0C 3BJIC 2BBSA 2N46A 2A5JA 2ONKA 2GK6A 4JYCA 4POAA 4R7ZA 2GVDC 2OHFA 4B3GA 5JMTA 3EPKA 1AZTA 2ANCA 1HYQA 5HZHA 1CRPA 5FPHA 3LV8A 3DZDA 3BB1A 3B82A 3EWSA 4GOJA 2VSXA 1WMSA 1MH1A 1IBRA 1Q1BA 1RFLA 4EKDA 1TU3A 1ZC3A 3F3YA 2EVWX 2ZYUX 4RD4A 4AKIA 2ZR7A 3KQLA 2H17A 2DFLA 1WP9A 1KK2A 4OQNA 5EE0A 4CRWB 4URZR 4PQRA 3OIUA 4WXPA 1KI2A 3CO5A 4MQBA 3AVXA 2FN4A 2ZEJA 2ZQ5A 4Z1MD 3OE7A 2RGDA 4FN5A 4LBVA 2XNDD 4BFXA 3WXMA 3QSYA 3CH4B 3K09A 5GJWC 4MUBA 5BYJA 4B35A 3LAWA 4F4JA 4UNSA 5J5CA 5BYKA 4HDQB 3ZIAD 1HA3A 4ASUA 1IM2A 1W46A 3ZS8A 5KNCA 2HXSA 2WJIA 1Q44A 1I4DD 5E7JA 2NG1A 4DKXA 4KJZA 3VR5A 1WBDA 5AUPB 3VKGA 3NWJA 3AF3A 4HZIA 1XD8A 3AUXA 1VIYA 3Q5EA 2HF8A 3PEVA 4YMVA 4TLAA 3KDSE 5F2EA 5TV2A 5DNYB 3VU9B 1N5KA 4JLDA 4NE2A 1S4QA 3PXGA 1Q21A 2VHJA 1NKSA 2AD5A 2Q0HA 1XD2A 3KJHA 5DHAA 721PA 2B8WA 4HLCA 3TBKA 2BBWA 1NIJA 2LCFA 1YZTA 5IK2A 4Q1CA 1Q1ZA 3ASYA 2A3RA 4CIDA 4KBGA 1NNEA 4OHVA 1LF0A 2OZEA 4LJ4A 4V0NA 4XD7A 2CJWA 2GXQA 4UNPA 1A5TA 1GKIA 4MRNA 2JJ8A 1XEWX 4QGFA 2OE2A 1JJVA 2GZHA 3GLIB 2IF0A 3GJ8A 5GJVC 3A1WA 4A4DA 2D7DA 1W48A 3H84A 3VX4A 4B2PA 4LV8B 2CE2X 3KFXA 1AJEA 2WBLC 3B60A 2QBYB 3EXAA 3IDQA 3Q9LA 2C77A 2RHDA 3B78A 3ASZA 3QPUA 1EG7A 2P5TB 3ZD7A 2O5VA 3LX8A 4IDHA 5ELXA 4BECA 3V4FA 4NYJQ 3FHCB 2P6RA 2FGKA 1Z28A 3DL0A 2FSFA 1AK2A 1O3YA 1JPNA 4E5UA 2ZRPA 2WWHA 3V9PA 1KOFA 3QKSB 3ONWA 1CR4A 1SVKA 1PUJA 4IOMA 3IIKA 4TYQA 1V43A 1N6LA 1UKEA 4CT5A 4ASUD 2PZFA 3KFVA 1YQTA 3QEJA 1Z6TA 2A5DA 1TNDA 2OXCA 2YOFA 3O47A 3HWSA 1M74A 4Q47A 3CNOA 5SZHB 5KTYA 1VECA 3IQXA 1R6BX 4TMVA 2G9NA 3EZ6A 3NHBA 1AQYA 4JL5A 1J8YF 2KI5A 3TVTA 1NY6A 3GEEA 5JRJA 3ZVLA 3BFVA 1RYFA 1W47A 1SXJB 1NVVR 1IXRC 2D7CA 2PT7A 3HR8A 5KO2A 4HLDA 4BLRA 4BFYA 3S1AA 2HV8A 2ZRNA 4XSGA 3DHWC 4HEJA 4Z54A 821PA 5IK2D 3KJEA 4LSGA 5H70A 2JA1A 3SE0A 3L43A 4XD7D 1TMKA 4DRZA 1RVDA 3QPVA 4MYTA 1X8LA 1P6XA 3OIWA 3RANA 5KYKA 3SI7A 2UVQA 4IFEA 3RAPR 2GEDA 4C0KA 4GZLA 1ZCAA 3U44B 1M8PA 2ZRMA 2D06A 4PR0A 4OQLA 4PQYA 1G16A 1BO6A 1E2FA 1H65A 2GTPA 3D6TB 3IILA 4NTZA 4BUJA 3F0TA 4A15A 3EPLA 3WMEA 1XMJA 3IO3A 2ORVA 3A1TA 2QMEA 4B73A 1Z3IX 1OH7A 4LJ5A 4NP6A 2IYWA 4PHFA 4V02A 1NN5A 1E9RA 2B21A 1U90A 5J4HA 2ODWA 4R2IA 5DIFA 2FFHA 3TMKA 1LV7A 3CW2A 3T1TA 1ANKA 4Q7MB 2G0NA 3QXSA 3VR6A 4A6XA 3ADBA 2UZIR 3LVRE 4X8MA 1OKKD 2WJGA 2BWJA 2HT6A 3IEUA 3M6AA 2G3YA 3TLXA 1L4YA 3L0IB 1CR1A 3K53A 1N6PA 2CK3A 2RGXA 3AP3A 4BFWA 3SU8A 4DIEA 1KDOA 3ADKA 1W2HA 1IOZA 1Z0FA 3TK1A 3SJAA 3I8XA 1G21E 2VHCA 4TLBA 1AA9A 1Q57A 1G7RA 3LX5A 3M0EA 2F9MA 1N2CE 1SVMA 2QPTA 4RD6A 4A2WA 2HEIA 1OE0A 1UFQA 1VYUA 2ZYWX 2E9SA 2ZJOA 1YZNA 5JS8A 5DYGA 3RS3A 1OXVA 1YR6A 2ZVPX 3CX7A 3ADDA 2DCUA 3FMIA 3ZQ6A 5BXQC 4OL0A 2J0QA 1U94A 4MGZR 1CEEA 1W5SA 2XTMA 5EJEA 2GAOA 2BMFA 1C4OA 3K0CA 1QG2A 2IYTA 3G82C 3NHAA 3QKUA 3BFKA 2RH5A 1FNNA 4JSTA 4Y0AA 3EIQA 2EFEB 2XJ4A 3RRZA 3RRMA 1ZM2A 2AN9A 1F60A 1RJ9B 2QORA 4RFSB 1XEXB 3B1XA 2DWQA 2C98A 1JQJC 2PH1A 3VFDA 4CEIB 4C7OA 5KOYA 2ZIAA 2OV2A 1DG1G 2AKAB 1KNXA 4B43A 2P65A 4IFBA 4OK6A 3I32A 2OXRA 2H1LA 4JT4A 4FCTA 2WPDA 4Q03A 4TLEA 2V9PA 2QL6A 1YZGA 4P31A 1KO5A 4V0OA 1E9FA 2IYYA 3MLEA 4D0LB 2L0XA 1R0ZA 1P7CA 1GILA 1FMLA 1P61B 1U0LA 2J41A 2YZ2A 4WOPA 4WZ6A 3BB4A 4QHTA 4TMTA 1NBME 5E7IA 4M9ZA 1II0A 1QHNA 3IUYA 3KKQA 4E03A 1XTJA 2CK3D 4P4SA 3BOSA 5FUYA 3JZAA 4P0TA 1EGAA 4B6FA 3CWZA 4XOIA 2IYLD 5LD2C 3FTQA 4NYJR 3TSZA 3HJNA 4B3XA 3MFYA 1SVLA 2VP9A 2P3SA 2QU8A 1UBFA 3Q5DA 4HB2A 3CX6A 2QM8A 2G0TA 2QGZA 1TQ4A 3AVPA 1ZD8A 3EARA 2H5EA 4FCWA 3DM9B 3AGQA 4QKQA 3LXXA 5FUXA 3MJHA 4BLOA 4TT3D 2QT1A 1YR9A 1DOAA 4G1UC 5B30A 5E4FA 1KZGB 4FI3C 2XJ9A 2X8AA 1VHLA 1KKMA 5DSZA 1AGPA 1WCV1 1FX0B 5J4VA 1Z6XA 3EPJA 3U3JA 1HV8A 1KSFX 5AUNB 3W5IA 4BWYA 1P3JA 4FWIB 2R65A 4ZDJA 4HI0E 4R71A 2KB0A 3U3OA 2ZUBA 3QE0A 1GL6A 1MABA 1QHGA 2G6BA 1TADA 1TF7A 5DH9A 4HAVA 2E87A 1E32A 5HE9A 5JZVA 2WPDD 2QROA 2GRJA 4OQXA 2V7QD 5EZ5A 1JXOA 4DSOA 3AVVA 2GKSA 5D3QA 1XDBA 2WJHA 1ESNA 2ZE7A 1KY2A 5JI2E 1ZMXA 4P33A 3T15A 1TF2A 3GLIA 3K0FB 3WNDA 3IBGA 2CLDX 1A4RA 3GQBA 4M9SA 1WRBA 4IEEA 1FFHA 2RKOA 1VPLA 2WJYA 2BM1A 3BXZA 4DDVA 1UEJA 3CM0A 4J0QA 1WQ1R 4AKGA 3GLFE 4Q5IA 3HDTA 4RSGA 5TB5A 1IN5A 4DHEA 1OFUX 3PJRA 2WM9B 3B8HA 4NMMA 5IT5A 3QNUA 5J40A 1L8QA 3L8ZA 4OHWA 2R6AA 5G3YA 3AKYA 1XXHE 1A2KC 2Z4SA 3UMFA 3R9XA 2J59A 4MH0R 2VA8A 1S96A 1XMVA 2F43A 3REGA 3FE2A 1GKYA 1K6MA 2R6FA 3PR1A 4D81A 1ZNZA 1CBUA 2GCPA 3B85A 2VF7A 2O8CA 2JLZA 3LBIA 3ZD6A 4G0NA 2ZU6A 4LYAA 5DI3B 3JVUA 1NJGA 1OHHD 4H1UA 1J70A 2ZS9A 1GRRA 4AG5A 1OF1A 3QKRB 5TDHA 4O0MA 2P2LA 1D5CA 4TTRA 2YKGA 2EFHB 3PITA 4URVR 1M2OB 2VHUA 3LQRA 5HR5A 3BERA 4XH9B 5HKKA 2GXUA 4JLKA 4OI0A 3I62A 5EXPA 1JAIA 4IDNA 1KSJA 4W7SA 2ERXA 1XPUA 1F2UB 4GT1A 4O2LA 5FI0B 4AYWA 2QSZA 4LK2A 1Z0IA 4B44A 4A2PA 2IA5A 1OH8A 1ZYUA 4LV6A 2GF0A 1KI7A 3BS4A 2A2ZA 1XRJA 2PJZA 4Q4HB 1SKYE 4DLVA 4MRVA 3U2QA 3GJ6A 1R5OA 2VP4A 3EWAA 4DLYA 3SR0A 1GZSA 4TTPA 1OXXK 4PC1A 2IS2A 5E7MA 4Q4AB 4MDEA 1LNZA 3GD7A 4P3YA 1R5BA 1TQ6A 1F48A 5C4GB 1CTQA 1IN7A 4K46A 2G1JA 4QHSA 5BN4A 1G19A 2CHGA 4UQOA 1E2GA 2IHBA 1DAHA 2C78A 2FSHA 4KFRA 1GM5A 1TPZA 1FL9A 2QP9X 2F1HA 3BGWA 2G83A 3HPQA 3MWJA 4XJXA 3RDPA 3VTKA 4DEYA 5HPYB 1NN1A 2NZJA 1T5IA 1FNMA 3PIRA 1XNJA 1ZC4A 2RAPA 2YJTD 3CPHA 4HAYA 4BQSA 3GFOA 2V6IA 3WBKA 4EQ6B 3QUSA 2FA9A 4DDWA 4DVGA 1ZBDA 3UIEA 4TQAA 2D62A 3D31A 2J0SA 2GWHA 1GVNB 4YLGA 2H92A 3RHFA 3SN6A 3C41J 3WYGA 2RCNA 2EFCB 2ZJ2A 4ZO4A 3LDAA 1IHUA 1TQ2A 4IJMA 3UWKA 1OFHA 5CJ2A 3FKSA 4B48A 3W6PA 4U00A 5SZIA 4OI1A 3SNHA 4BGDA 2IL1A 4XVUA 1N0VC 3EZFA 4WZAE 1UAAA 1GG2A 5G41A 3DEFA 3E1SA 2FF7A 2DFNA 1RJ9A 3OESA 2C8VA 2XXAB 1ZINA 3MG9A 4ACAA 3GCGA 2IEZA 4A8JB 5CM9C 1SXJC 5CJPA 5CB8A 4YMWA 1ESMA 2O8DB 4PX9A 3SJZA 1Q22A 2FNAA 1KI4A 1MO6A 2BV3A 1U8YA 4LY6A 5L3SA 4DLTA 5K8TA 5J47A 4FMCF 1XMSA 4TSFA 5H68A 1E2JA 4PC6A 2V4ZA 2WWYA 3AVQA 1KMHA 1N6RA 1LFDB 1PJRA 1T5LA 4DLXA 1GFIA 3DM5A 3HPRA 3L82B 4JSYA 4HUQA 4FINA 3GLGA 4M53A 1RYHA 2W83A 3GLHB 4S35A 3X2SA 5KSPA 2P5SA 3MJRA 4Q1DA 1DAMA 3R8FA 4L15A 1UKYA 3R7WA 1S0UA 2OFXA 1N6KA 1ZP6A 4OJKA 2RGNC 2FG5A 2WZQA 2CHQA 3AVYA 3AV0B 3I4LA 4M1TA 5A4JA 2HLDA 1XTKA 3EA0A 5FBVB 1UM8A 2JLRA 2CEAA 1FQKA 1OLOA 1VG9B 4ZDIA 2XNSA 1W36B 2JDID 2R6CA 4B3BA 2DYKA 3KJIA 2GEUA 2Q21A 3FKSD 1F5NA 4QBIA 2ZRAA 4EPXA 3DKVA 2WSSA 5KSOA 3UMSA 3RLFA 4US2R 4EPRA 1S8FA 4I99A 4QJ3A 4MYHA 1NY5A 1Q1EA 5LD2B 4C0LA 1Z22A 3A4NA 4RZUA 2OCYC 4QM6A 4QBHA 3CNNA 5FOUA 2BEKA 5TMPA 3VAAA 1ZUIA 4XWAA 3SBEA 3K1JA 1CR2A 2P0EA 4D4KA 2J0UB 4HB3A 5BQ5A 1KI8A 2W6JA 1VCNA 4XWOA 5K8IA 3MWYW 3VR2A 4PHHA 2FOLA 3CH5A 2A7QA 4JZKA 3QG1A 2F1JA 4TQUS 4B74A 5FH9A 1T0HB 4EPYA 1FUKA 2W2XA 2ZYTX 1HQCA 1I4LD 2A5GA 2JATA 3IHLA 4DXAA 4C2UA 2CLCX 1EXMA 4M9XA 4O2RA 5JSZB 3EW9A 2Q3FA 2J3EA 1JR3E 3AKDA 3CRQA 3LFUA 1XWIA 1KJYA 4Z1MA 1KK0A 1AGRA 2QUZA 4ARZB 4ZIRA 2YNMA 4BZQA 1QHSA 2O8BB 2MSEB 1IN4A 2XEXA 5BW8A 2BKUA 3PEYA 2N1BA 3SEAA 2AKYA 3PUZA 4DCUA 2HLDD 3BAFA 4AWXA 1TUEA 3KUCA 3WNCA 3WYFA 2HYDA 5KNDA 3PVSA 2F1IA 3SHWA 621PA 1EWQA 1T3HA 1HH4A 3ICQB 2ZE6A 2R6GA 2VQSA 1DPFA 2O0KA 2WSSD 2FSGA 4JLPA 2ZE5A 3LLMA 2FEMA 2ZSDA 4IDQA 4MA4A 3NDBB 5CYOA 3K70C 4EIWA 3I5XA 1GOTA 2AXNA 4LWZA 4GI7A 1P2TA 1N3BA 4AK9A 1XPOA 1SGWA 3QKRA 3BK7A 3KQNA 1COWA 2I4IA 3QJYA 3QBTA 4LJ6A 4GDFA 1IXZA 4B33A 2VO1A 4ZI3A 3SQXA 3EIHA 4Q66C 1XU4A 1DAFA 2EWVA 4MGIR 5D3MB 2VP6A 1Z29A 1KDTA 4LHXA 4C0SA 1WE2A 1V5WA 1M7HA 2GK7A 5H8WA 2W6JD 2DFTA 2KSQA 3NG1A 4RD2A 4BFTA 4C0BA 5E3HA 1FW6A 2FPMA 4GPTA 4QJ4A 2PJRA 5TARA 1R2QA 4V03A 1N5IA 2XX3A 1G8PA 1JPJA 4US0R 1YHNA 2GJ9A 1Y63A 1OPXA 3BH7A 3VR4A 5C1BA 4HAZA 3I5YA 3L0SA 1G41A 1N6OA 4JKIA 4DLRA 1Z06A 4DLWA 4Q4HA 3SFZA 1W0JA 1ZNYA 3DZ8A 2GJ8A 3GLFB 4TLDA 1K5GA 2XSZA 3DMDA 3UG6A 4XTRA 5GVSA 3QXXA 2DWOA 2QMUA 2O8FA 2G1KA 2PZEA 4A6PA 3CF6R 3HU3A 3CRVA 2HCJB 1XXHB 1KIMA 4OHZA 2BCJQ 2DWPA 3TAUA 4NCHA 3THYA 1XFAA 1KK3A 4U7DA 1NKTA 1QBKC 2O0HA 2VSOA 5DLQC 2XAUA 3DMNA 4O3MA 2NIPA 4BZXA 4HATA 2CL6X 3WHKA 2YC2C 2IYSA 1XZPA 1R7RA 2K5UA 3A37A 4XTCS 4JS0A 3I3SR 1S9DA 2GILA 4DLUA 4ZCIA 1DVRA 4KI0A 4JL8A 2QPOA 2GEVA 2CXXA 3X1XA 1C9KA 1KAOA 2ANBA 3B2EA 4EJSA 1COWD 3B1YA 4UJ5A 2AK3A 1SQ5A 4HB4A 4PPFA 1II9A 4Q1AA 4URUR 5FOSA 2V1XA 2ZRHA 2OFWA 4BPBA 2BHRA 2ZRCA 2Z4RA 3T06B 1E2NA 4LCBA 3C14C 4MGYR 1KO8A 1KI6B 2C03A 3OEHD 1N6IA 2BBTA 2NPIA 3UKDA 5FOVA 3SDZA 4TLCA 4Z8YA 1Z2CA 3I73A 4GL2A 2AWOA 3HYRA 1OH5A 1PVOA 1JR6A 1DO0A 4KFSA 2ERYA 1FUUA 1W0JD 4ON9A 1SKYB 1A82A 2XSZD 4PAMA 3GEIA 2PMDA 2RB4A 4CDGA 2AX4A 2ZS7A 1E2IA 1QHIA 2GVZC 4TQ9A 3W9YA 3AB3A 2H18A 1OYWA 3H4MA 1UF9A 2JLSA 2C9OA 4B47A 3ZZTA 4B32A 2ZM5A 2FMXA 2GZAA 1Z08A 1TEVA 2IYXA 4KYUA 4PHTA 4RD0A 5FR1A 4C0HA 4BRWA 3QXHA 4QXAA 2ZSEA 4DSUA 3VKHA 4M1KA 5FPSA 5CLLA 1EFRA 4YQFA 3B5JA 4KAXA 1OKKA 1P9RA 2FX3A 4PC7A 1OXTA 3ZZUA 3DO6A 1FPMA 2RGBA 1US8A 2BDTA 4Q9LA 2DR3A 2AR7A 3GLHA 4KLNA 3UK6A 3E5HA 3OHMA 4AIIA 4QBGB 4L9SA 2VHQA 4BLQA 4LZZA 3K9NA 3X1WA 3NEYA 2WJVA 2QY9A 2YINC 3AVOA 1S3SA 2FV8A 4R9UC 1JAHA 1BYUA 3JVVA 1CIPA 4B3CA 1NVUQ 1GL9B 5JEDA 3THWB 1E0AA 1E79A 3QXCA 4B3FX 1RRPA 3QQ5A 3EG5A 4KO8A 1EFHA 4NL4H 1I4TD 1VCOA 4YDSA 2JLUA 4EFLA 2IK8A 3CBQA 1S1CA 1E2QA 4GZMA 3GMTA 3QVVA 4TN1A 5CDFA 3R9IA 3RSOA 1YZKA 3EC2A 2YWEA 2ZUCA 1GWNA 5TY0A 3ZVNA 3GEHA 1P75A 1P2SA 3CLVA 2P6NA 3QEOA 3RS7A 5TXGA 2QAJA 1G64A 2EYQA 1KK1A 1I2MA 1G9XA 1GDDA 5JWRA 3NIBA 3CZPA 2OBLA 3K09C 5FUWA 4B2IA 5AJYA 3U61B 3CWQA 4GMDA 2C5LA 1X8JA 2H8KA 1E0KA 3LBNA 2GXAA 3T34A 1T6NA 4ESVA 3IKJA 5EE1A 2F9LA 3FMOB 4MKFA 2NZ8A 4FD2A 3TJZA 5L3QB 3U3RA 3PQCA 4D4LA 1EFRD 2J5XA 5A0FA 1PZNA 3FHOA 4F93B 4Q4JB 3RS4A 4Q02A 1KO1A 4UKDA 4W5WA 3QF4B 4GFDA 4DEXA 3QKTA 5JSZA 3MMPA 3NH6A 1OW3B 4LJ8A 1MV5A 2NO6A 4RZ3A 1NN0A 2JLQA 2PZGA 4B3DA 4RZXA 4ARZA 3K0AB 4E07A 1ZIOA 2BKEA 1N25A 3UATA 1IY1A 5JCZA 1PV4A 2FFAA 3T12A 3IPXA 1Y3AA 2CE7A 1UJ2A 1LY1A 1Z6GA 1WBBA 3I92A 3QOFA 2QAGB 4A8JC 1Z0DA 1IY0A 1E79D 5FI1B 3C7KA 3W6OA 1W36D 2EW1A 2QP3A 2WIBA 3AKEA 4PAOA 4FWTA 1B23P 4FMBB 2WSMA 3KB1A 4QNMA 2JLVA 4HLUC 3ZJYA 1ZU5A 2W58A 4EFNA 1QVRA 4TT3A 2YOHA 3B9PA 3VMFA 4QG7A 4D80A 521PA 3THXA 3AVUA 1TQDA 2X2FA 4PSVA 2VHTA 1XD9A 2YC4C 1W44A 5FUVA 3C15C 1M7GA 3GFTA 1ZM7A 1EK0A 3ZGXA 2CNWA 1OIVA 2I1VB 2EWWA 4GOKA 1M7BA 5FTNA 2JLXA 2PMKA 5FPKA 1G8HA 2ZJ5A 3RABA 5LBIA 2WVJA 1OB5A 4A92A 1FTSA 1UKZA 4Q7JB 2GETA 5BN5A 2ASEA 1AQUA 2FPLA 4M0LA 3WRYC 1II8B 2HT1A 4A0FA 4NYMR 1IJFA 2V7QA 4MYCA 2RMKA 1DAEA 4BFUA 2AXPA 4M21A 1ZRHA 1HURA 3D3QA 1OXSC 4IXMA 1YU9A 1W36C 3K70B 2OSBA 3V4RA 3T1QA 5F9FA 2PX0A 1SVWA 1MRSA 3TKLA 3PG5A 4ZKDA 3ZVMA 3NC1C
chains in the Genus database with same CATH superfamily
4UUOA 3ONEA 1EDEA 2CVFA 2WWWA 1IBCA 4LMPA 5ICEA 3FTNA 1BWPA 1U0GA 3FPEA 1PK8A 3H42B 4IKEA 5ER9A 5H3LA 1PFQA 3TLZA 3SIPA 1LZKA 2C84A 3TGWA 3F98A 2P0AA 2ATEA 3CN7A 3D1VA 4D41A 1USGA 3LF2A 5H9VA 1WW3A 3I05A 4H17A 4QPPA 2Q29A 2PD3A 4CIBA 1FNBA 1R27A 5DSXA 2ZTUA 3A36A 4DLPA 3OE1A 1Z7WA 5AVUA 3D43A 3PC7A 4WV3A 1LVGA 1AQ6A 2QRJA 1BQ4A 2OUIA 2P75A 4WZBE 4LF6B 2QVYX 1QQ5A 4P86A 1U7OA 2R8ZA 4M1SA 1X7YB 3DF9A 4JB2A 3ZHSA 1W4RA 1GCAA 3JTEA 1V1RA 3RAGA 3FRJA 2IYQA 3LY9A 4IO1A 4YONB 4K28A 4C3OB 3C3YA 3BJEA 3QY9A 3W5VA 1TCCA 2A7XA 3ESQA 3WLLA 4YX9A 2ZJBA 4YBZA 4Q00A 1KGSA 2HDNB 2BFDB 4EUKA 2BGMA 1PDWA 1A7JA 5A6SB 4WRRA 1BXRA 1ZUD1 3AX6A 1Y81A 2IXEA 3ISJA 5KS2A 2AJCA 3NOOA 4QFMA 1GPBA 4B84A 4TKZA 1CUCA 1G8AA 4FMCB 2PL5A 5C7OO 4C4AA 3IAS6 1H85A 3LQKA 3VI4B 4KYIB 3FWYA 4MARA 4RY8A 4K8OA 5SY6A 1R3DA 4DWJA 4HQLA 3C6YA 4AW9A 5DU2A 4O1MA 2WJPA 1E98A 3Q3JB 4CEHB 3AFIA 2GO7A 4M4SA 4NPHA 2GJSA 4IDOA 4PO9A 5FWYB 1FTWA 1POWA 4I2VA 4WOJA 4DCSA 1JIUA 4IFIA 3PJDA 1DV2A 3O8DA 1Q20A 4D8WA 3PXAA 4R1OA 5BW5A 2HDHA 1L9KA 1LPSA 4KPGA 1Z5OA 4UXJA 4H9GA 1L3BA 3DF7A 3DYIA 3DZGA 3FCXA 3NBXX 4H0NA 5F3WB 2JVKA 2QXUA 3FKJA 3RVDA 2XWSA 2HADA 3RSHA 2M2IA 1D2EA 1SU6A 3D9QX 4KQ9A 1CY8A 3QKSA 3R0IA 3RUPA 5JXIA 3MHTA 3TFOA 4MVJF 4QYIA 4RIHA 3PEWA 3UW1A 4FHCA 1VLHA 2QT0A 4BMPB 3D54D 1KEPA 4BUZA 2P6PA 2JCGA 2WKPA 4TWJA 3ZV5A 4GSYA 3JQRA 4ARUA 4CM7A 1V16B 3TLBA 1N5LA 2FPOA 2ZI9A 3OIDA 1PJAA 4MS4B 4PR3A 4YCJA 1Z88A 1BQ3A 3SM9A 2IJGX 3DBRA 1U8FO 4IIVA 3W3AH 1K3UB 1Q0UA 4HX9A 1X39A 2Z1MA 4M0DA 2XUPA 3I04A 4GMFA 2ZSFA 4RJKA 1T3LA 3JD4A 2AUMA 1R0LA 3SC3A 2ADOA 3PJFA 5A9TA 5T3YA 1SXJA 2IYNA 1TAGA 4TKMA 1V8FA 5GINE 4KOAA 2Z2XA 1QDEA 2ZJZA 4MRPA 1LSJA 2QJOA 3SY8A 3LHDA 1F2TB 1ZNXA 4QIHA 3VPBA 4IAOA 3BKXA 5ALFA 1RRCA 1H4QA 2C2GA 1PZGA 1U6KA 2FMFA 2UYYA 4RCYA 3T95A 1J97A 2WSBA 4BGVA 1PO7A 1G7TA 3HKDA 2ODNA 2NUPA 2WZCA 3DZCA 2XYGA 2IPOA 2P9CA 3H7AA 5HIMA 2ON6A 3F71A 4G63A 4R9RA 4W1QA 3LWDA 5CVJA 3FGPA 2AI3A 2CKMA 2Q3BA 4JMPA 4LXTA 1EX6A 1L8LA 4HF7A 4WIAA 4E6PA 3DDNA 3GT0A 1J1ZA 3ROEA 3WDLA 3U44A 1R5JA 3I09A 1UPFA 1OLUA 1M6WA 3F8TA 3JQ6A 4BQIA 5DF1A 2IZ5A 1GO2A 3ICOA 1H5QA 3BMCA 4KXFB 1F5SA 2UKDA 1SU7A 4I4LA 3GUCA 2CXQA 2RK3A 5K0CA 1ZGCA 2WAXA 3OF3A 4L5JA 4GL4A 4QWWA 1E9SA 1KDVA 1L5RA 1NXTA 3IP6A 3QHAA 3WKBA 3RFCA 4C6SA 5JI3E 1U3GA 4HZUB 4W5HA 3QFRA 4EFMA 4EH1A 3F67A 4OY3A 4JCOA 4HB0A 3SZGA 3RC9A 3WJ2A 4F2DA 4BO4A 3PSAA 1LC3A 1HETA 1GZ6A 3NHLA 3H2HA 1KI9A 3JAWB 2PU5A 5A3JA 3EAQA 2PQMA 3N8KA 5I7UA 5KSYA 4G5YA 3QELA 4XEUA 2IY9A 3MAAC 2FEXA 1S01A 2ABWA 1D1TA 1Y98A 3ZU5A 2NQ2C 2C4MA 4MQ6A 3WYDA 3M6LA 1IWOA 4E4RA 2IYVA 2GBCA 2WAYA 3DMRA 4DA8A 5CB6A 2QM3A 1PU2A 2I2FA 2QD2A 3QV2A 5U1PA 2B8NA 4MW9A 1LWOA 3IEPA 3KQMA 3LWBA 1Q50A 4W9MC 1UOPA 2JBAB 5MHTA 5IWCA 2BFMA 1CLEA 1MPTA 1T1EA 4V24A 4QQNA 3NHFA 1T34A 2I4NA 2BJWA 1CRQA 2XZTA 3DZBA 3K15A 1ZCZA 4Q48A 5ADUS 2NGRA 2I3BA 2J45A 2WIJA 4R2KA 4Y0VA 4OI2A 1D1SA 2R6DA 3GLGE 1QGYA 2SHKA 3H75A 4NFSA 1K8RA 2PSJA 4CKEA 3THOA 3OP1A 1FP4A 4LWPA 2GESA 3Q2IA 1U0FA 4FCVA 2JA2A 4K9OA 4RCZA 3GA5A 2JGDB 3BB3A 5FTWA 1RKBA 3EXG2 2OCAA 4V0QA 3ZBUA 5BRAA 1XOIA 4UU8A 3TVYA 2JDIA 1DRVA 3W6ZA 3HG7A 3SMQA 3C1AA 4HDCA 1LQUA 4RJJA 1AO3A 1C3EA 4LZWA 4AZ3B 3AFMA 4R83A 3IHKA 3DDCA 1U8ZA 1EWRA 4PLYA 1CD5A 2BM9A 1GIAA 2ZJYA 3ESCA 2HRZA 4O2AB 3AFHA 1RW4A 4LSZA 3ZWAA 2NU8A 3K5WA 3L8DA 4OYYA 3RT1A 3WSWA 3LDGA 2XAAA 2WR8A 3TBFA 1SCUA 4A7PA 5K3OA 1WCYA 4BBZA 4KITB 2HFJA 3MJCA 1JKMA 1W85A 4MVJE 2Q0QA 5DTMA 2YYZA 2F00A 2HLHA 3ST7A 3NETA 3ND8A 3H18A 3PB3A 1YL5A 1RXIA 4EG8A 5JADA 4J2HA 3ZKWA 1XAGA 3BWYA 2LBPA 1C14A 2VP3A 4TWZA 5CPBA 5CR9A 4XWKA 2GNOA 4DUGA 3N59A 3D6FA 2FFQA 2J0VA 4Q01A 2C5FA 2QQEA 2D5BA 1WW2A 4Z4QA 2V58A 1DAIA 4BYGA 1L7MA 2BONA 4IUCS 3PDIB 1NW6A 3HCFA 4EPTA 4AD8A 4MR8B 2SICE 5KU7A 2AOUB 4UTZA 3VC1A 1XJWA 1ZGAA 3P9XA 3ZN2A 5LDDC 1E1RD 1KYTA 1G21B 4L07A 2FFJA 5JJKA 1YDFA 3KO8A 5CA0F 1SD1A 3A6EA 4DRYA 4Q7KA 3OCXA 2DT8A 3T38A 1TQ8A 1JGTA 3COWA 1MX3A 3DGEC 4NATA 1KGDA 2RAVA 5BQFA 3EXHA 2AMYA 2PDAA 1E5LA 5BVHA 1DL5A 1XA3A 3B6ZA 1SZJG 3UMRA 4HADA 5LMZA 1M1YE 3E22B 4MLDA 1QIKA 2LE0A 3IAFA 4XIGS 4EG3A 4QOJA 1XCGB 4OXRA 3H19A 1NV8A 1ACJA 2W0SA 3NLLA 2VP2A 3KOXA 3W8RA 2QTFA 3H9CA 1A9XB 3EASA 3NBYC 1IZZA 1H4TA 3A14A 4L5BA 4OM7A 1Z8DA 2OC4A 1L5NA 3Q8LA 4KLZA 5FA8A 4S0XA 1JSLA 1LLUA 4TTAA 4RE6A 4ZVTA 5TPWB 4UQLA 1CR0A 3CR8A 2ZJAA 2WD8A 3PC8C 4PIMA 4IJUA 2WTNA 1VP9A 1VYTA 4ZOLA 2DTEA 2JAUA 3M1IA 3NHUA 5EHGA 1MXHA 5A4KA 2Y2UA 4RIEA 4R69A 1DG3A 2IBMA 2PS0A 3Q7TA 4IVQA 1I3LA 4MK4A 1Z74A 4MUAA 5KNBA 5KSZA 1MW8X 2W6IA 4JEMA 1H0KA 3VKWA 5JZMA 1WF3A 3GPBA 4UMFA 4OGFA 2MTBA 1ORIA 3SHQA 5F98A 5DYTA 3JD3A 3VQTA 3L07A 1G0NA 3D64A 1C30A 2QAGC 4WCVA 1WU8A 1DTWA 3P1JA 1LS6A 4JP5A 4MPJA 4M1OA 2VIIA 2R8OA 2W0MA 3J7TA 1SXQA 2D2IA 1X7ZA 3I2IA 1QP8A 2BHTA 1L7NA 2CXNA 1V11B 2FPXA 2PK3A 2WJ3A 3HRIA 2MWMA 3B70A 3LP6A 4F92B 3CLRD 1RXUA 2O1WA 3DD1A 3E70C 2V3CC 2AI2A 4PQEA 1I13A 1NAHA 4AP9A 4NJMB 3KT3A 2G09A 2VCHA 4GP6A 1XDUA 4WDRA 5AVVA 4LRXA 4NZYA 3PT5A 5A4MS 1BMFD 2OG2A 3EVNA 3H1BA 4UJ3A 1H42A 2B5WA 1JJFA 3DLIA 4DR7B 1EQAA 5KPDA 3E27A 1H9AA 3T7SA 1NURA 3E8XA 5AUOB 3P9IA 4KQ6A 2RI0A 3PE3A 3RV4A 4QHYA 3WB0A 3OCJA 3QJ5A 3KSMA 3L8CA 3AI3A 1ZD9A 1UPUA 4EZIA 1AHHA 1N1MA 2IBTA 3UMGA 2HGZA 5HM8A 4XJSA 4CQLA 4L0QA 4KYTA 3ZDYB 4W9NC 3ZKAA 4KOEC 4JJGA 1V5IA 1H8ED 2J7KA 4NONA 2I67A 5AW8A 3A26A 4RAQA 1GPWB 1U81A 4YMGA 1Q1QA 1ZOIA 2VCEA 3JQAA 1PWHA 2UDPA 3MWDB 4QREA 3C1TA 2Z2YA 2QQ0A 1DP4A 1PEAA 1EX1A 3HJCA 1L5FA 5D5HA 4LMAA 2NUTB 1EVQA 2FOXA 1VCHA 1JYEA 3OJFA 1QF9A 1RWPA 3FPKA 3IYLW 1P72A 4INOA 4IZOA 4OQEA 4Q1BA 4YJ2B 4UXIA 3EE6A 3IGFA 5AKGA 1I7NA 3OF2A 4URWR 4ZVUA 1KQFA 4JYMA 4Y9UA 1KY5A 2FE4A 4KQEA 1ELOA 1S5PA 4OK3A 5JRDS 3KVOA 2H1VA 3N3BC 3T7KA 1MAAA 2XD9A 3PC6A 3TKYA 4E33A 1IMJA 3T9FA 1SBQA 1F2UA 1UZLA 2D1YA 3ND5A 3M81A 5C46F 1B8NA 3Q8KA 2KBEA 1VLLA 1RE0A 4MKGA 1WU7A 4MRRA 1J8MF 3SJBA 1O95D 3D6UA 1CRZA 1AZLA 2HDWA 1KU0A 2FRVA 2J5QA 3H8VA 4H1WA 4WEOA 1ODCA 2O7NA 2R44A 2PJDA 3O1JC 5DMHA 2DBZA 1OA1A 2PT9A 3B1ZA 2NVBA 3N2IA 3QYFA 5F1OA 5FBHA 4C7OB 2JLYA 3K31A 4PPGA 1IONA 1M6VB 5I4CA 1L4MA 2V8OA 4OIFA 2HW8A 2V3VA 1XU9A 2EJVA 1B0UA 1TK3A 3VI3B 1F6DA 3M5PA 2DPGA 4MCJA 3THXA 2G9ZA 3UEOA 3DFIA 2GZ3A 3RUAA 1MTZA 2XNHA 3G59A 2GCEA 2BDEA 2IKQA 5KTNA 2M98A 1YFJA 1S3GA 1LFAA 3AB7A 1TU4A 1OT5A 4QUAA 3BF7A 5BWNA 1UJMA 3RV3A 3RYCA 4OP1A 4N6GA 5C3UA 3T9CA 2QL7A 3RADC 2I0FA 5IKXA 4RZIA 1AS2A 1TFUA 4BLTA 3BMXA 4WK4B 2Y1EA 5KTOA 3NTXA 3HDVA 4KV9A 1UWVA 2E4VA 4YXWA 4A0HA 3IV9A 1M6YA 2EJUA 3GU3A 3S81A 4WN3A 2ZIEA 1OT3A 3L6CA 2PX4A 4Z3KA 1E0DA 4OATA 1PNVA 2VBIA 1IY2A 1MEJA 2P5UA 4I8DA 4D9CA 4ZV4A 1J56A 4UHHA 3K30A 4GGPA 4AZTA 5I8WA 2F8TA 1ACMA 1KHTA 3FWNA 1YFZA 2AG0A 4EA8A 5I7WA 2HBRA 4OIMA 1K88A 3DTVD 4K9MA 5JCPA 1KRXA 3R1IA 5H1YA 4EQ6A 5CFZA 2PD6A 2VHYA 2BGWA 3UOWA 4EJ2A 4KC0A 2ZVJA 3O2QB 5B55A 1OTYA 3I01M 1B8PA 5ICCA 3QSGA 5C1IA 5F52A 3OZTA 4MGHA 2ODBA 2J3DA 4W5JA 1C0KA 1MC1A 1WCXA 3RGGA 2O7VA 4GMXA 3ZUPA 4KIWA 5AW9A 4YRCA 2FDRA 4CF3A 5K0TA 1AN0A 4WGFA 3NBAA 3D3JA 3F5FA 3VPHA 1RS0A 4RTNA 3ZGYA 1AMOA 2CNNA 1E8NA 1UIRA 1ZM4A 2F4NA 2G06A 3AGPA 3O8LA 5E0OA 3UJ6A 3BX1A 3QVJA 4HGQA 1DXOA 3A3OA 3GV0A 1P60A 2OOSA 3JYNA 5CCDA 1OX5A 1Z34A 1FEZA 3TGLA 5IJ9A 5BSHA 3KYCA 3WV4A 2ALJA 5FLXA 1WULS 1OTHA 1PKXA 1XRLA 3KZNA 1MABB 4XPZA 4A8JA 4BZZA 4BQNA 3AJEA 2O8DA 4J29A 4AICA 2JJMA 3FGZA 4R7GA 5FHQA 1I9CA 3H5WA 3RRNA 1L5OA 2ODQA 1F8FA 1IIRA 1DTSA 2EG9A 4XX0A 3WLFA 1JJBA 3B1KA 1CNFA 2F3SA 5EE5B 5A9RA 1MZVA 5IH3A 2G9UA 1PGPA 1JFLA 3B1WA 3NCHA 3KV1A 3ZQKA 3HA3A 2O5RA 1W1UA 3W2GA 4DANA 3GB9A 1Q84A 3AOEA 2NZXA 4BQFA 4UDOA 1R10A 3G5LA 3F7NA 1N9GB 4PSCA 3A6JA 5C2JB 6Q21A 1T4BA 5ADHA 5ALHA 3NUQA 3TSCA 1GAWA 2BKLA 3MJTA 4CI9A 5AW4A 4Q4CA 2CSUA 2WEKA 3KKNA 5KC9A 4HGNA 4IJQA 4NK4A 4CG0A 3I58A 4PLPA 4BVJA 5JH7B 1WB9A 3AH8A 1ORRA 1RPNA 3EZ9A 3WGQA 3K8ZA 3N2EA 1FCJA 2WTMA 2I5PO 4NU8X 5KWJA 5H80A 1HYGA 2G76A 3GRPA 3WRYA 4H6VA 2FWRA 1CY0A 2IE0A 1OBFO 4IDCA 2IY8A 2REOA 2ZK7A 3QITA 1J0BA 1X3SA 2F43B 1GPAA 4HDKB 3W3ZB 1BKDR 3JYOA 1PT7A 1OWPA 2JFZA 3G2KA 1XF9A 3ZNQA 4RS4A 1T8TA 3WWCA 2ZYRA 4JIGA 2PR7A 1I9GA 4FZRA 4LJAA 1E1QA 2LCIA 4FDAA 4FI3F 3TQCA 2MMGA 1XQVA 3D0RA 5DGHA 4ZHQF 3SZMA 1G7CA 1DJOA 3ZBTA 3ENVA 3LO5A 1W4CA 4H6XA 4XXHA 3N39C 5LCXA 4H7EA 3HA7A 1YH3A 5IDYA 5A6VA 5LMNB 1IZYA 1W30A 3K9LA 3R5HA 4IOKA 2Q28A 3RKSA 4D9JA 5JDIC 1SZPA 1WPXA 4QRHA 3RWOA 5CEEA 3NX4A 4RHEA 3U6KA 2TYSB 1MW9X 4TVBA 3TI9A 2QTHA 4WWHA 4JYAB 5BXYA 5EFOA 1Z0SA 4B85A 1V7QA 2FDXA 4GOND 4PLCA 4BP1A 3EGXA 1OXUA 3CX4A 2A9KA 4EKIA 4ZAYA 4M0KA 1IQUA 1ZPDA 4G41A 4LOAA 3LUHA 4HS4A 1H9CA 1RCFA 1W88A 3DEIA 3JTMA 3SYKA 4G3XA 1T1JA 1HRKA 2WF6A 1U3UA 4D97A 5DYYA 2QA5A 3ROGA 4B6QA 1XWWA 3GPIA 3PGJA 4FN4A 4MP8A 5IJ0B 2OFOA 3GJ0A 4U1RA 1TTQB 1NVTA 3JALB 5JCXA 1H4SA 2R8YA 2YBDA 3E2PA 2CVQA 4GDMA 3L4EA 4LA4A 3HLTA 5CLGA 5K8JB 3CVYA 5KYXA 4URXR 1VLVA 4JBXA 4EX6A 5FX2A 4DG8A 4QSMA 4XFDA 4D3YA 2ORWA 5HOEA 1I5RA 3E9YA 3O1IC 1LPPA 4EJSC 1DRWA 4KMRA 1DWQA 3K0EA 4X6XA 2X7JA 1TCBA 3ZLVA 2G1PA 4JR0A 4LYEA 1Z6YA 1NI3A 5D86A 3ZE9A 4ZCMA 2OAEA 4ALNA 4OREX 5JD6A 2IXBA 3JWEA 5BV8A 5GZ1A 3AF4A 4ETIA 1GPUA 2P9FA 4GO1A 3MTDA 4WA7A 3WV5A 2UYHA 1VHTA 3J81k 2BFCA 4HC4A 3HJFA 4G9GA 3VC3A 3HB7A 3ZU2A 1YRAA 1ZWKA 4RVOA 1ESEA 1OAOA 4OYRA 2ACWA 3VHXA 3EJ6A 1UFKA 1DKNA 1LF5A 3PCXA 3TE6A 2GAIA 5BYBA 4CVNA 1I2AA 1QH1A 4MVCA 4OV6B 3PGVA 3UTCA 3GLVA 4Z86A 4F4FA 2KJQA 1OYOA 1CZLA 2BGRA 1BCRB 2MHCA 2WUEA 4OFXA 4P1ZA 2C20A 4FYXA 1TECE 4QBTA 4YC7A 3N70A 3VPFA 4YLYA 4UTNA 4K86A 2AXEA 4KDCA 2IEGA 5TJHA 1VJ0A 1HY3A 2G4LA 1ZU4A 4RA9A 2O1EA 1D4OA 4F9EA 1H2EA 4FTWA 4W8HA 1KC3A 3A7EA 3OVMA 1QHXA 5D3MA 1MQAA 2CHFA 4H7JA 3LQYA 3FUUA 5AVJA 3OQBA 3V8BA 3UB4A 4A2CA 1BX3A 4LX0A 4MQEB 4L02A 3FZEA 4BNNA 1BCSB 4TTVA 3TQSA 4FGWA 1KEUA 2QLNA 1Y7HA 4HH0A 4EW3A 4L8LA 2W93A 2ZIZA 1XK6A 4R4JA 2IV2X 3ZXYA 4BX8A 4KAFA 4JI8B 1B26A 4OL9A 2W2KB 5ALQA 5EJIA 4WDQA 1ZGGA 1B3BA 4HWGA 1Q15A 4QARA 2HN9A 4EHHA 1G1AA 1P0FA 3NJ4A 1MO4A 1QQAA 4Q7QA 4KWTA 3IT1A 5LBTA 3AZQA 4DNFA 1CS4C 3CXRA 5IF3A 2I3DA 3PDJA 4LFBB 3QK7A 4J16C 1J2JA 4JLJA 5KWEA 2Z4TA 4L4ZA 4QXOA 1EVZA 5KYWB 5KYYB 4MI3A 1N5DA 1L5YA 2VTKA 2ZI5A 4OA8A 4UCWA 1GPJA 5DNAA 5JO9A 3RWMB 4C06A 5DNYB 4U9UA 4YMSA 1T9GS 4ZKEA 2VJPA 3RYTC 3VV2A 2GEFA 1U8CB 4M0PA 4BB6A 4LDRA 2WTEA 4OXXA 3IAUA 1DDOA 1JWAB 1TFRA 4R2WA 2FXVA 2ILVA 2OAGA 1T35A 1A1SA 2GD0A 3HCBA 1NHWA 3TEFA 1R15A 3CJRA 2X1VA 4LYGA 3P71T 3AG5A 3MMSA 1K9SA 2L69A 3JXEA 4NFYA 3ETDA 4RFVA 3W5UA 1ATIA 3KOZA 3L5KA 2FW7A 1ZCBA 2RGGA 5G40A 3VYWA 5DLEA 1W4BA 3G0DA 1VE9A 3OZEA 4HVTA 2QTWB 4M8NE 4QECA 2IWHA 2Q2QA 3AHIA 3HJAA 4KX3A 4MKHA 5IABA 5DW3A 3RTAA 1NI4B 2JGFA 3NASA 1P17A 3BORA 5EWJB 5DP1A 4KXWA 4UTXA 2BI7A 4F2HA 1Y80A 4MW6A 3NHPA 4MUGA 2XE7A 4YCSA 3R0XA 4ZJYA 4FGKA 3IBYA 2XA9A 2ZRBA 1LNQA 1OWNA 3K5PA 3QOYA 5C8YA 3S2YA 1HDGO 3MZ0A 4DYHA 1LJLA 1C4XA 1JLLA 2HKIA 1V48A 2WHPB 1YBFA 1TYEB 4CIWA 2V6GA 1L7VC 2AC7A 3WHIA 4RQBA 3MOGA 1L4LA 2IC5A 3TM5A 1NSFA 3I1IA 1XVIA 4JJZA 4YUVA 1PGOA 1LNSA 4IQ8A 2PXHA 1Q0TA 1UOQA 4ROTA 2WD9A 3BZBA 4KSCA 2DULA 2Z95A 1GPLA 5JQWA 4U2BA 1XCMA 1S89A 1BHO1 1ZM9A 3AM1A 5ITSA 3ZHOA 1XWFA 3JPYA 1JSXA 3PZRA 5FT9A 2JJ2A 5ULLA 4O0LA 5CBPA 2OV3A 1EEXB 2IPXA 4RL6A 3ODGA 2Y0EA 1MR3F 4C4TA 1QYWA 4DTIA 2HSJA 3GHYA 3ITNA 4G36A 1YRWA 2EJCA 4K6KA 4WASA 5D00A 2XT9A 3T9BA 3WRVA 4DIBA 1PNOA 1GUZA 2CYAA 1UDXA 3JW8A 3KXIA 5BN3A 2Q2NA 3PHJA 4KPEC 1NZJA 4LN1A 3U9LA 1WXDA 4F4HA 1GUAA 1T3ZA 2X86A 5LOVF 1GZ3A 3FWKA 2EFGA 3FRIA 3HVHA 2YQ4A 4S2EA 3QENA 2Q1UA 2HA5A 1DAGA 1J23A 2W4MA 3BMQA 2GLXA 2JFNA 1BKSB 1C0LA 2BSXA 2LWIA 2OEPA 2VNSA 3ROTA 2HF9A 5BR8B 3TTUA 2BM0A 1IC6A 2VP0A 1Q14A 2GHIA 2WYIA 4XB2A 4G4SP 1RZUA 1J6UA 2QJTA 3MT7A 2QN9A 1RCUA 5IN5A 3MIIA 4AG6A 1YBAA 4F46A 2XOKD 1XCOA 4K03A 3ZWWA 1MVNA 4KU4A 2EU8A 2IPAB 3CA8A 5ALZA 3WZ2A 5A4AA 2OWEA 5KDLA 2CWDA 2WD7B 5H81A 5FR2A 2B1GA 5JSKA 3TLKA 4PTLA 2R5FA 3RREA 5CIQA 3LRXA 4GYJA 5IDWA 1LX7A 1QQBA 2Y6UA 3NXSA 3PV0A 4RSHA 3V4VB 3I8SA 3VX3A 3EMDA 1U2RA 2REXB 3QLVA 3R3HA 3U4IA 2MINA 4HN2A 4J1TA 4ID9A 4YJ3F 3OTIA 4MV4A 1QIMA 5AVWA 2EXXA 1Y6JA 4KTVE 3K05A 2QN1A 1QVAA 1ZQ9A 5JSYA 1WXHA 3HKCA 4MZXA 4J94A 1A5SB 3EIWA 2CXSA 4HQKA 4ZOBA 3I01A 2FPUA 2QTCA 3GY0A 4O29A 2WTUA 1G8JA 4B7AA 5CBKA 3G2MA 2C3PA 2BI8A 3K2QA 4FQ5A 4L57A 1G17A 3L8HA 4N5MA 4RV4A 1DEKA 4MQUA 3TLGA 2D1QA 3U0VA 2V6JA 1QLJA 3QNMA 3RFXA 5C7YA 1KPHA 3H86A 1OD6A 4Q05A 3FPJA 4B7ZA 5BURA 3RYFA 1JKJA 5AHRA 2FU5C 5B2FA 2HSGA 5DI9A 3TAHA 3CF0A 4PZCA 4RLFA 1VJRA 4YRGA 5CIYA 1JR4A 2E4ZA 1U3DA 1G18A 5TVKA 3TNJA 1Z63A 3R9WA 1XVAA 4YFYA 2Z43A 3A27A 1N3YA 1NQUA 1QIGA 1T2NA 3FNGA 3RT7A 4LS3A 3NDPA 5KVQA 1NG9A 3FAZA 4XUCA 2F3UA 1RU3A 3WLPA 3ZHUA 2UZ1A 1V8DA 2Z1NA 4UULA 3WK6A 5L3QA 2QGFA 4R0MA 1PD1A 1SY7A 3L7AA 4Q9IA 1ZUNB 2XE4A 2ZWOA 4D3DA 1S2MA 4Q4JA 1RI3A 5B58C 1F0YA 4GXTA 4P3NA 3W34A 2P67A 1M2VA 3VOSA 3PGXA 1E7QA 4EAQA 3ZLBA 2JHGA 2OV8A 3ND7A 1Z5ZA 2ST1A 4PZ9A 2O8FB 2G9RA 5IKMA 4RVUA 1E3DA 3WWPA 5JT1A 1RAAA 3U7GA 1NYTA 1UIMA 2VZ8A 2XIQA 4N7MA 5J3JA 3G85A 2QE7A 4AU1A 4EUEA 3FOZA 3W7AA 3C3CA 3ZLTA 2VPXA 2P11A 4G24A 2G36A 4RDCA 4PZDA 4PVCA 5FBQB 3FBGA 4IL5A 2F90A 2REBA 2Z8XA 4N48A 1YZ3A 5E1MA 4LYJA 1AKYA 4GRDA 4P4UA 2JJ1A 4Q3EA 4C0JA 1N5MA 3QLUC 1XG5A 2V55B 4FNAA 4KLRA 4O6VA 3O8QA 4Y2HA 5LXTB 5FP0A 3RVSA 4QUIA 4OJYA 5TMEA 3GT7A 1HO3A 4GEGA 4U7FA 2DPXA 1QGUA 1P3Y1 4E2WA 1NJSA 2C2ZA 2ZR0A 3RO7A 2NAPA 2VKQA 4PCLA 2EQAA 2DVMA 4F3YA 2BGUA 1XROA 3O8OA 4ZVQA 3U7HB 3BWVA 2A14A 5CLHA 2F3RA 3IBCA 1L6RA 4GZ5A 4CCWA 2IW3A 5LM3A 1ZBQA 2QM7A 3V2HA 1QB8A 3LSTA 1AS3A 1SR8A 4O4HA 3UK0A 2G4CA 3ZY6A 4RPGA 4Q39A 4EHNA 4MRSA 3R7NA 4BGDA 3AKZA 3LE8A 3IELA 3BBPA 4UXHA 1U2GA 3LDFA 5GJCA 2XBUA 2FJ0A 1KEZA 2W48A 4UPDA 4DMRA 2DR0A 6PFKA 2WWFA 1ULAA 2ZAOA 2ZITA 4H3KB 2I66A 2OLKA 2F1OA 4RQTA 2DPHA 2HJVA 3RS9A 2NO1A 1CG6A 4JAVC 4LKRA 2KPOA 3G0BA 1GSOA 3H4IA 3AVTA 1P4AA 1QK3A 3UENA 2WT8A 1KJNA 2BYTA 1FNDA 4XIFA 3MBOA 4Y7CA 4LE2A 1CYDA 1W0KA 5LYJA 1DAKA 2QD5A 3K0SA 5IUKC 2CLEB 3WQHA 4OYHA 4CT4B 4LGMA 4CUZA 5E9WA 4G0UA 4TYWA 2B7LA 2I6GA 4QTZA 1ZDMA 2EATA 2ZRJA 1Z4IA 5TEWA 1FVXA 5K8UA 3HO1A 2BL4A 3T3OA 3CRW1 3ENWA 2WIGA 2R00A 3IHWA 1P77A 2R6ZA 4IBOA 1OFUA 3RSLA 4WI1A 2H51A 2CV0A 5LQKA 2KBFA 3MWLA 2HRRA 1BDJA 4JT2A 4Q19A 4DG5A 4RZHA 2AA3A 2OCPA 4AC9A 1RLJA 1QAQA 1Y3FE 4YUXA 2IEYA 5TQJA 2WJ6A 2BLNA 2RHWA 3T1VA 1YAHA 4EFDA 5JD3A 3FY4A 4A8TA 1LK0A 1NVXQ 1QZXA 4KE9A 4NZOA 4RMHA 5DOVA 1TAUA 3UJPA 5G4KA 4CF6A 3HO8A 2F62A 2NOAA 3E9DA 1NJFA 4A2QA 4LBWA 2GEJA 2ZR9A 2PHZA 5FD8A 3TGPA 5ALVA 3AUUA 2H1SA 2WTXA 1Q3HA 4R1LA 3K0BA 1RIFA 4DR1B 4GOLD 1YVDA 5G0TA 2BY4A 3TBHA 1LSSA 3T7IA 3GUUA 5ADWA 1E6EA 2QR2A 4V38A 3GNTA 4F4IA 4QT0A 1IUOA 4E70A 4AJ1A 1ECGA 2O3QA 2FN8A 4DZZA 3WLOA 2W22A 4BZPA 4F7WA 1I3MA 4BFVA 2FOIA 3SFVA 4TM7A 3AUKA 5CDHA 5FLEX 5P21A 1TC1A 2CVOA 3QXJA 5AKEA 4R2HA 1RRGA 3BMOA 4FYIA 4NEHB 4AO6A 3JASB 5GONF 5IC5A 1OILA 1TTPB 3N0VA 4HKTA 2Z58A 1KEEA 1JHXA 2B4RO 1R0XA 1UBLS 1DX6A 4UE6A 5EZQA 1TVKA 2O8EA 4E2XA 4E88A 3DWEX 1ULBA 2M32A 3ZY4A 3GN2A 2UV8A 5KHAA 1E4EB 4ABTA 5U9CA 3DLHA 1HEIA 1XAIA 2B4YA 2D4HA 3MGKA 1E1DA 2MR6A 1J5XA 3FCSB 3FUWA 3JRXA 3QBVA 4GBJA 4LOLA 4TKUB 5D3ZA 5FPTA 4FDVA 3RS0A 4B6GA 4A1FA 3FW1A 5IVDA 3OEED 5EUQB 4TKVB 2DLDA 2COUA 4JITA 1AMUA 1CT9A 4KWHA 1XEAA 1Y7IA 2H2AA 2PUFA 4TSFD 2P4UA 1CEXA 1EFVA 1IEVA 2PO7A 3QMVA 3T61A 4EITA 2VJOA 4TZ0A 1IM8A 5KYUA 4ZI5A 2EW2A 2C0CA 2IFTA 4JCCA 4CM3A 3WC4A 1ZOPA 2HCRA 1G0OA 3C3PA 1TB4A 4FFBA 2XOXA 1K63A 3HU1A 4TRJA 5FA6A 5LQSA 1F0PA 1D4ZA 3L01A 1W1IA 3ZWKA 1ORVA 1QK5A 3SYNA 3OIYA 4MKIA 4LGYA 5JWOA 3IEVA 4JVSB 1RYYA 2YQZA 4JODA 3DAGA 4ARIA 4MUXA 4BRUA 3WJ7A 2X40A 2QRQA 4X60A 3ZE2B 4R8VA 1CUBA 3CRRA 1A3CA 1CZOA 1PL7A 3BCHA 6GPBA 2IX3A 1SUSA 5AP9A 3TJRA 5KTMA 4MB6A 3JZDA 1KVTA 1ZW1A 2R3SA 2AN5A 2CMHA 1BZYA 3AONB 4DARA 4MIEA 1XCJA 2Q9CA 1BS9A 5HYVA 2IS4A 3HM2A 2JAWA 3BD9A 4PX5A 3THXB 4PZEA 2YHIB 1OJLA 1U2DC 1U65A 4DT1A 2QHXA 4POAA 2N46A 4R7ZA 2Q0XA 5E0KB 3VYVA 4CLXA 3EUAA 2XQFA 2OHFA 4P93A 2FPWA 1KJIA 2YWRA 4MJ7A 3LZ6A 1NZFA 2V0GA 3U16A 1CRPA 1E92A 2HQOA 5F5LA 5FPHA 1MG0A 3DZDA 5BN5B 3B82A 1QQ6A 5BSMA 4DA0A 1MH1A 2VYVD 3T7TA 3W5HA 1TU3A 3R5KA 2IU0A 3T9EA 1YMVA 4BN4A 3EXHC 3JWHA 1EJ2A 2BMVA 2RAFA 3N05A 2OVFA 3QTTA 5BQXA 3KQSA 5CGZA 4I3HA 3R6DA 2YIJA 3A1CA 3WQBA 4RA6B 4BGIA 5BPHA 1WP9A 3WNVA 4YVFA 5AK6A 1F4VA 5EE0A 3GPCA 2P9HA 4IHJA 1G5IA 1ZH6A 4HNUA 4L8YA 1P39A 3AVXA 3EXEA 3H5NA 4LZJA 4JJFA 1OUMA 4EL0A 2ZQ5A 2FWMX 2WY2D 1ZHOA 3Q15C 4O2AF 4EI9A 1FFEA 2UUAB 3WGZA 2P69A 4G4IA 4JBLA 4D57A 3H1GA 3QSYA 3CH4B 1JH8A 3ER6A 1YD7A 4QUBA 1RJGA 2JFHA 4MUBA 5BYJA 3RBZA 5CH5A 3WMXA 4QTYA 2K87A 2I8LA 1P0IA 4C87A 1C7QA 2RIRA 4XX1A 3ZEAA 5J5CA 5CDGA 4HDQB 3SICE 1M1UA 3IQFA 1W46A 2WYHA 4X1KA 4BMOB 1J49A 3LKDA 3A05A 5KSWB 5E7JA 4UD2A 3IP7A 1ADBA 1FU8A 2PBLA 4DKXA 3W05A 1Y3IA 3CQ9A 3E5MA 2B4AA 3NWJA 3AI1A 1EHCA 1B93A 1XD8A 3D2LA 3ORYA 4KEAA 1AO0A 3N53A 4YMVA 5B53A 5T41A 4C7MA 5TV2A 1D3AA 5F2EA 1H6BA 1SUFA 1A88A 4MJLA 4OUKX 1N5KA 3WLJA 3ZWPA 1N77A 4M7OA 4NE2A 1P1JA 2GRUA 5KTPA 1U2SA 3AUTA 3P94A 3T3MB 1NKVA 1K8QA 1DJQA 2CFRA 2GBPA 2OBXA 2Q0HA 1KARA 3C39A 3CXUA 3FUVA 4HLCA 3CU5A 5BOSB 2EX1A 2PRKA 2W6QA 1P1RA 2X0NA 1NIJA 2A1UA 2A86A 2LCFA 3HB0A 3OWHA 5FQNA 3VHQA 3WA6A 3ZXXA 3SG0A 3KVNA 3C1OA 1Q1ZA 2VSQA 1ZONA 2YWCA 4COOA 4CIDA 4JMLA 4EA7A 1SCBA 5CU7A 2OZEA 3AY0A 4LJ4A 4UOQA 1FU4A 1N8KA 2GXQA 4MV8A 3GRZA 1A5TA 5HUHA 1E18A 3RVOA 3KAQA 4D02A 1AQJA 1VPTA 7REQA 4Y2SA 2D7DA 3A1WA 2XYQA 1QAOA 4K9LA 4A4DA 2YQ5A 4GXRA 4II3A 1NW8A 1I0ZA 1XRRA 2CE2X 2R1VA 3JVIA 4FKMA 2H7CA 2OQIA 3EXAA 2C77A 3OIGA 4KH1A 5CH8A 3QPUA 5AIAA 1C1XB 3VR6H 2P5TB 3HYCA 4BO5A 2O5VA 3GGGA 3RT9A 4KO3S 3V4FA 1E6WA 3FHCB 4NYJQ 2FGKA 5C8VA 1O3YA 1YTUA 2WNIA 2FRDC 3PYLA 4JI7B 2BHSA 8ATCA 2DEUA 1RBZA 1S8OA 2OCXA 1EX9A 2R6R1 2XMCA 1X42A 1E77A 1PG5A 3ONWA 1KL7A 4IOMA 1QO0D