1Z0FA

Gdp-bound rab14 gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords RAB14, member RAS oncogene family
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0fA01
4JT4A 1M6NA 1IJFA 3F5FA 1XCGB 1SQ5A 2WBLC 5F3WB 1XJCA 2HLDD 4CRWB 1Z6TA 2ORWA 4KLNA 4YONB 5GJVC 5J40A 1CIPA 2KWIA 4JLPA 2ZYTX 3FFBA 2GAAA 2AXNA 1KYIA 3P32A 4PHHA 5DYIA 4QL3A 4J0QA 4TLCA 2JLZA 3DOFA 5D3MB 3SOPA 1EFUA 3V4FA 2EFEB 1UPTA 2PJRA 3KB1A 1NG1A 3VR4A 4A8JC 2XB2A 4NPHA 4Q4AB 1XFAA 3C4JA 1Z22A 2WKPA 4JMPA 3LFUA 1GIAA 1OXXK 2MSCB 3LBNA 2QN6A 5SZKB 5F2EA 1MRSA 1EFTA 4B75A 4PANA 2O8BA 1E99A 2GNOA 2ZRIA 3RS4A 4AWXA 4B3DA 1HURA 4MDEA 4D0LB 2V8OA 5H1YA 2B8WA 3PG5A 4F4CA 4HZUA 4KITB 1GWNA 3K70B 3B9QA 3LO5A 5IF9A 2HT1A 3IHLA 2FSGA 2CBZA 2VTKA 2B7BA 1DAKA 3NBYC 3QVVA 5FR2A 1II9A 4M21A 1W47A 2VHUA 4DUGA 1G3UA 2WOJA 3LX5A 4LC1A 4DDWA 1KMHB 4CF7A 2EQBA 1D2NA 2G0TA 4FWTA 1S2MA 1U81A 2ZROA 2V7QA 5FBWB 1Q21A 2KBFA 4A4DA 1KO8A 2P5TB 3PV0A 1N6HA 2DFNA 2Z5FA 1HTWA 3IEVA 3Q7QA 1J70A 5D3QA 5DHAA 4LHWA 5KPDA 4HATA 3WXMA 4X8MA 5FOVA 1R0WA 2QE7A 2ZE7A 5KPJA 3RNLA 1NLYA 4A9AA 3AKYA 2D62A 3EAQA 3BFXA 3I73A 3U3MA 4AG6A 2ZVQX 1ZM7A 4U00A 5C18A 1KJYA 1F2UA 1US8B 1GP2A 3B1VA 5BN4A 4DHEA 2ZR7A 1VMAA 1E32A 4DDVA 1DG1G 4S2EA 2BM0A 1FUUA 4Q1FA 4L15A 3B13B 4F7WA 2WJYA 3CKLA 4ZPXA 1GL9B 4L9SA 2J45A 1KSHA 2J59A 1JQLB 4LYHA 4Z8YA 3REFA 4WW0A 3FMOB 3W34A 3SR0A 3L0PA 1E9CA 3FHCB 4FI3C 1AGRA 2JLRA 4G5OA 4P4TA 2ONKA 2HDNB 4LBWA 4M53A 1JR3E 2W00A 1O87A 2YWFA 3BB3A 4LJ9A 5DGXA 3ZVRA 2PLFA 1G4AE 1SXJA 1Z0KA 3IIMA 2G3YA 1KOFA 4RFSB 2IYWA 1K8RA 4URUR 4TTRA 2IT1A 1AN0A 2IUSA 3C41J 4IFEA 3LW7A 2IF2A 3K70D 3U6BA 1UKYA 2OCAA 1QVAA 2CLCX 4P4UA 2REXB 4BPBA 1G20E 2LKDA 3UMFA 5FPTA 5F9FA 1A7JA 5FL7D 3U7EB 1GZSA 1SULA 1RKBA 1AS3A 1UJ2A 4BLPA 3IDQA 3WYFA 4LHZA 1JJ7A 3K09C 4GP6A 3U2QA 3C16C 5EQTA 1X8KA 5HKKD 4PR0A 1S3SA 3WMGA 3A8TA 4ARZB 3G82C 5JI3E 2O8EA 4DB4A 4DLSA 5B30A 2XB4A 3BB4A 4PZYA 2H7VA 1FPMA 1EESA 2A7QA 3U6KA 4DLZA 4V0OA 2SHKA 4OQNA 2IYTA 1N6NA 1Q3HA 5EXSA 4DIEA 1FMJA 1AA9A 2CE2X 4FXPA 2G83A 2WSMA 2A5DA 3ICEA 4QGAA 1W2GA 3NC0C 3KJEA 4JLNA 5JJKA 1NNEA 1R5NA 4TYPA 4Q47A 4V0KA 6Q21A 4NBSA 5HE8A 2QORA 3TW4A 3MG9A 5KSPA 2W58A 4G01B 1T4GA 4II7A 3I5YA 5HPYB 1XF9A 3FWYA 4KI0A 1E2LA 1U0LA 5JBQA 3NXSA 1XEWY 3CLVA 4HAZA 5L3QB 3NVAA 1DEKA 3C14C 1SXJB 3RS0A 4A2PA 4PAOA 3U44A 3B82A 4C0HA 1II0A 1QHYA 2XGJA 2FEMA 3MGCA 4EAQA 3BH6A 1P2TA 2ZANA 4KXFB 2R6GA 4QXAA 4BFVA 2YINC 5GJCA 3VX3A 4CEJA 3MAAC 4MITA 2N46A 1AQUA 1S9HA 2QSZA 3K9HA 3W3AA 3B6EA 1Q1ZA 3EZ6A 2F6RA 2V1UA 3GFPA 4GMXA 4QGGA 4CT5A 3J81k 2GA8A 4C7OB 2RGDA 3K0AA 3QKSA 3EARA 2PEZA 3KFVA 2G77B 2JDIA 2FH5B 3KKNA 2YNMA 2GK6A 4R9UC 3TAUA 2NGRA 1JR3A 1UDXA 1XMVA 1TQ2A 2ZR0A 1L4YA 4RKFA 3CNNA 3PQCA 1G7SA 4KFUA 4XWOA 4TMVA 5G40A 1RW4A 1OXVA 5JCZA 2VSOA 4BFTA 4DSNA 2OEPA 1IXZA 2J0UA 4JKIA 3UMSA 3T1QA 3I32A 1YZGA 4NYMR 3GLFA 2P5SA 1BYIA 1E2QA 1SHKA 4BGDA 4B73A 4BWYA 4C0SA 3AGQA 4RJLA 2P6NA 2MMGA 1KY3A 2QAGB 3TLXA 3TUZC 4AYWA 2ZVPX 1VG1A 2CXXA 4M22A 1WA5A 4LPKA 2WWFA 3ZQ6A 4LSGA 2F1JA 3SU8A 1IONA 4MUBA 4RD3A 3Q72A 4EFLA 3B60A 4N1AA 4WXPA 5J4VA 4IEIA 3BJIC 1IM2A 5FBVB 3M6AA 2GTPA 3TVTA 3IPYA 1TMKA 1A1VA 3ASZA 1P6XA 1XTKA 3MUFA 5DYGA 1N0UA 5FPHA 4DLVA 4A8JA 2C5LA 1U0HC 1K5GA 4Q4JB 4LYJA 2JIZA 1W4RA 4GP7A 1RRPA 2HV8A 1YRAA 3FKSA 3NBXX 1S96A 3P26A 2RGCA 1FP6A 2WWYA 4LV8B 4UXIA 4A6PA 3I3SR 2ECKA 3CRVA 4BASA 4P32A 1M34E 3CNOA 3IQXA 1Z0JA 1ZUHA 2V3CC 3K0FB 1JXOA 3CRRA 4P4SA 5FR1A 3SFVA 3FGNA 4LV6A 3N5CA 2A2ZA 1W4CA 3KQUA 1D9ZA 1DOAA 2QMHA 4PC3A 3EASA 1E2HA 5BYJA 1SGWA 2J0VA 3PUZA 3ZVNA 2A5YB 3EZ2A 2QE7D 1N2CE 1KDPA 4A0GA 1W48A 3AP3A 1KGDA 2BHRA 3LQQA 721PA 5JHGB 1Z29A 2YC4C 4UNPA 2ODBA 2DFLA 4HZIA 5BQ5A 5LD2B 3HYTA 3PEVA 2XTZA 1NKTA 3O47A 4PTLA 2ATXA 3R20A 1T0HB 4Q4HA 4C0QC 2ANBA 4PZLA 1OH8A 1E79D 1R5OA 5J4HA 1O3YA 1G64A 5EUQB 4F93B 2BJVA 2D2EA 1UBGA 3AKCA 4DCTA 4Z54A 2UZIR 3CF2A 5DH9A 1IN4A 1N5LA 1TUIA 4L16A 4XVQA 4RZUA 4CYMA 1XWIA 3P27A 3CH5A 1KY2A 4C9BA 3RC8A 4F92B 1TNDA 1CRQA 2A5FA 2HJGA 1KK0A 4Q9KA 3UWKA 2C95A 3SBDA 1ZU5A 2GETA 3SQWA 2CCGA 1KI6A 2ZUDA 1TUEA 4KU4A 1Z06A 3ND8A 1SXJD 2BCGY 2O8EB 1R8QA 3LVQE 3EXAA 1JJVA 4LHYA 2CLSA 1M7BA 3IILA 5L3SB 1Q12A 1VG8A 1KTVA 2VP4A 4IOJA 5KTYA 2GZDA 3PCRB 4HAWA 4RKEA 4URWR 5DI3B 2XSZD 1CJUC 3ZZUA 1ELOA 2Z43A 4Q9JA 2W2VA 5EUMA 1QHNA 4BLOA 1E69A 3B78A 2REOA 1P5ZB 3A58B 3U7FB 1MO3A 2VYFA 4DC9A 4LRWA 4OQXA 3THWA 1ZIPA 4XOIA 3U4QB 4Q9LA 5HCNA 2NTYC 1NF3A 5EE5B 4HYYA 2ZETA 1TF2A 2C9CA 2JJ1A 2RGNA 3CUEF 3THXA 3THYB 3HR7A 2XTNA 4OBEA 3THYA 2OUKA 3U44B 2FNAA 1IY2A 2FFBA 4GZLA 1BH2A 4P31A 2FPLA 1XB2A 4Y0AA 1FNNA 3ZIAA 3D31A 4RD6A 5E95A 1R0YA 2IC5A 4D4KA 2OSBA 4MRNA 4ZDJA 2CCKA 4I1OA 3VNVA 3MCAA 1M8PA 5A5GA 2NZJA 2QPTA 2RCNA 3KQLA 4XTRA 3WRXC 2FSFA 5DNYB 4GI7A 2PLRA 4AC9A 1XPRA 1ZNYA 2QMUA 5L3VA 3RS5A 4HLDA 3O8CA 3LV8A 1L8QA 5SZIA 4BFZA 3P1JA 4WAUA 2PT7A 3L8YA 1AS2A 1SVMA 1GG2A 5C4MA 5EP4A 3ADDA 1KI1A 3T1VA 1WF3A 2IYZA 1OB5A 521PA 2W83A 5AJYA 1T91A 1P9WA 3OZXA 1E9SA 1NVXQ 2GBLC 2WPDD 3OE7A 1GKIA 5FUXA 5SZHB 1NVVQ 1P72A 2BCJQ 4M0LA 4BRWA 4Z1MA 3CWQA 2QP9X 3I4LA 4W5JA 3LY5A 4FMBB 2HF9A 1E2IA 3GEIA 3CIOA 2ZJZA 3ETLA 4MYUA 2HCJB 4ZDIA 4TLBA 1U0JA 4JLBA 2H18A 4HLUA 5IDVA 4ZI2A 1LFDB 3VR1A 1JB1A 4IXNA 1EGAA 5EZ5A 4A2QA 3GEHA 2ONJA 3R8CA 1EWQA 1WQ1R 3SYLA 5IK2D 2G0NA 1P9RA 3FMFA 1N6RA 4M1YA 3QXJA 1A2KC 2HYDA 3IIKA 1R4AA 3GLGB 3U3RA 2R8RA 2QNRA 2YWHA 1VIAA 3SQXA 2IYUA 3CR7A 1G8GA 1OXSC 4FMCF 1T3SA 1XNJA 1CTQA 2OXRA 1NBMD 3MWJA 1SHZA 1S1MA 3SJZA 3PEUA 2JLXA 3RDPA 2GJAA 2CNWD 2E9SA 1MKYA 3QSYA 4IOKA 1GRNA 3HJNA 2J0SA 1CRPA 2OBMA 4JVMA 4PO1A 2ORIA 1G9XA 1S8FA 3MWLA 4A1FA 1N6LA 1ZW6A 2JLUA 3KUCA 3SHWA 2IS1A 4TL6A 1FNMA 4Q48A 4B43A 2WOOA 1IN8A 2FJUA 3HU3A 2J0QA 1U90A 3B1WA 1J2JA 3T35A 1K5DA 4FN5A 2VPPA 4NKRA 2ZJYA 1Z0DA 4HB4A 5JWRA 2O5VA 4RFSA 2IUUA 5JZVA 4Q4LA 4OHWA 2F1IA 4K81B 5ANRB 5AJWA 5KHOC 3LX8A 2R6FA 3EZ9A 3K9GA 4TQAA 2D3WA 4YMTA 4FW9A 1FW6A 2WMOB 2V1XA 4XJXA 5A4JA 2AX4A 3IBYA 1E2GA 3AH8A 3CX6A 4AKGA 1TADA 2OLJA 3SJAA 2XNDD 3WHKA 2RMKA 3RS2A 1NRJB 5KO2A 2Z0MA 4W5WA 2RGNC 3MFYA 3KKMA 1G16A 2FGJA 5FOXA 2R9VA 3BAFA 2QRZA 3K0EA 1EXMA 1VG9B 3QF7A 4LY6A 4OQLA 4PO9A 1NSTA 2KSQA 4B71A 3BH7A 4TQ9A 1ZM2A 2P0EA 3A1WA 3RABA 1Z83A 5J4KA 2KJQA 2QTHA 2Y8EA 1E98A 3SC3A 1E1RA 4NYIR 5JWHA 4BLTA 1HT2E 4HUQB 2ZI3A 3PR1A 1T5IA 1Z8FA 1NIPA 3AVPA 1QF9A 2NIPA 4HAVA 4BZQA 2AN9A 3PUYA 4JT2A 1MOZA 2FF7A 2HT6A 1R6BX 2EVWX 1NMZA 1S0UA 3CBQA 4OHVA 3RC3A 3T12A 2YWGA 3W5IA 4BFXA 1RJ9A 1QG4A 3ECCA 4RFVA 4KLZA 1HYQA 1OLOA 2QGZA 3QXHA 3SFZA 1CXZA 4TYNA 1ZM9A 2BMDA 3MD0A 2ODWA 4RVCA 4QM6A 1G5PA 5TB5A 4IOLA 3JVUA 1P7CA 2BWJA 3K0FA 4TL9A 4I1VA 1G17A 4IVQA 4C0BA 4B2IA 4IDOA 2B8TA 3UXMA 4B76A 1OFTA 1SVIA 4DSUA 1EK0A 1S4QA 3UK6A 1LNZA 4KODA 1CR1A 1KNXA 2ZS7A 3CZPA 4LBVA 5LB4A 3EPKA 2ZUCA 2KE5A 1ZCBA 2YJTD 4US1R 1D5CA 2F3RA 3CX8A 2RH5A 2W0SA 1J8YF 2ZRFA 3PUVA 4HEJA 2ZE8A 4AIIA 2C78A 5EE0A 3EC1A 2CJWB 1GKUB 2RHMA 3AF4A 2FPKA 2RAPA 4TQUS 3ZZ0A 3EWSA 1HH4A 3WMEA 2ZS8A 4Q1EA 5D3MA 1JI0A 3BGWA 5EP2A 2BEKA 1G7TA 1UEJA 2V55B 1XXHB 1OH7A 3BRWD 3SJBA 3ZVLA 2V54A 1OIVA 2FEOA 1I4DD 4OI4A 5EXTA 2TMKA 1GDDA 1WP9A 4MRSA 2OM2A 2VQSA 1HT1E 4Q7JB 3NTUA 4ON9A 5K8LA 2Z4SA 1ZRHA 1U9IA 1E3MA 1E1QA 4EFMA 3FTQA 3H0KA 4D4MA 2KB0A 4KYUA 4ACBA 1CJMA 2BEJA 5G3ZA 3VQTA 2WPDA 2OILA 1RE0A 1CJVC 4MGIR 4BE7B 3TMKA 1KIMA 3QE0A 2Q3MA 4BRUA 2GHIA 1XCPA 5JJLA 1PZNA 1IJEA 1N5JA 3BORA 1MT0A 2UKDA 3LBIA 1Z6XA 5HTKA 3KTAB 3QNUA 2H1LA 2XZLA 1KI6B 5KDLA 1ZUNB 3IUYA 2GVDC 3K0SA 2CJWA 4DJTA 4NZYA 2AK3A 3AF0A 4NU0A 4BFWA 1YVDA 4H1VA 3RS7A 1W7AA 3VTKA 3C5CA 1W36C 4B2PA 1NVVR 3TW8B 3CX7A 1D8TA 3SZRA 2J9RA 5JRZA 1QBKC 1GM5A 3IKJA 1Q1BA 4AKIA 4LBZA 3RS3A 2CK3D 2AR7A 1F60A 2ODNA 1AZSC 1I4TD 2QENA 1KI3A 4UJ5A 2B6HA 1W4AA 4ACAA 5AUPB 1II8A 4JSTA 4ERNA 1IXRC 2IEZA 4KVGA 2AKAB 2C2HA 2Q21A 4S35A 4EJSA 2BC9A 2ZUBA 3MWKA 4Q1BA 4Q19A 3MLEA 2DWPA 1N5KA 3TR0A 1A82A 1LW7A 3H2YA 4AKEA 2QTFA 3AGPA 2BM1A 1XD8A 2JIZD 4GZMA 5FUWA 3RHFA 1ZM4A 1W0KA 1JEEA 4G5RA 4CT4B 3R9IA 4B6EA 3CH4B 2A9KA 4ABYA 1JECA 2OBLA 3CWZA 4ZKEA 3QKUA 3SJCA 2JJ8A 1VKJA 2RGBA 1DAGA 2OG2A 4DLUA 2OV2A 5DI9A 2G6BA 4HUTA 2D74A 4IVPA 4LGMA 1AGPA 1JBKA 2E1RA 4E22A 1F48A 3AKDA 1BYUA 4I1SA 1XX6A 4JYCA 3KJGA 3VKGA 2FGKA 4M2LA 3TGPA 1M74A 3KKPA 3QPUA 4M9ZA 5EP1A 4TMKA 4GL2A 1KJWA 2XITA 2NOAA 2DWQA 1Z0FA 1MO4A 2DY1A 3E70C 3GJ6A 1UM8A 1XRJA 2G1KA 1Z0IA 4UXHA 5AUQA 1YR9A 3U3JA 3UG6A 2D7DA 2MMCA 4D2IA 2OCPA 4A15A 1WBDA 1HEIA 3FFAA 2LKCA 4WZAE 1R7RA 2NPFA 3GLIA 3M1IA 3RLFA 5IHPA 1KZGB 3WNBA 3QPWA 1LS1A 4Q66C 1L4UA 4HLCA 4FMDF 4HAUA 2YYZA 1CLUA 5KSOA 1NY5A 2FZLA 3P4XA 2RGAA 2CHQA 4L9WA 1KK3A 3SBEA 3WP0A 1UKVY 3WHLA 1E2MA 4IVRA 3REGA 3VR5A 3WBKA 3VHXA 1P61B 1LV7A 4OYHA 3QF4A 4LBYA 2ZREA 3QENA 2AWOA 5AJXA 2GCPA 3I92A 5LPNA 1IOZA 3L0SA 5EE3A 2CDNA 2WKQA 3AEZA 4Q01A 1P2UA 3KXIA 2MSEB 1E9FA 1Y63A 2V6JA 2XOKA 3KJHA 2W6IA 4NMMA 4RSGA 2AK2A 3HU2A 4GOKA 4EPXA 3FVQA 4PC7A 3TNFA 1VIYA 3MSXA 1XDBA 3VU9A 1JEDA 1HUQA 1TQ4A 3KDSE 4NH0A 5HE9A 4QJ4A 4DLRA 2N1BA 3GEEA 2O8CA 5DISB 1W46A 2AL7A 3VNUA 4YDSA 4OKSA 3GPLA 2BV3A 2LCFA 3ICQB 2ODEA 4PAQA 4ASUA 1CU1A 2G9NA 5K8TA 3AUXA 1L2TA 4D4LA 3OEED 4PQYA 4FCTA 1E79A 5AUOB 3CW2A 2ZJOA 4NL4H 1T0JB 4BLQA 1GNQA 1Q44A 3A1SA 4B3BA 1DVRA 3GLHE 2YKGA 2XXAA 1N6KA 1SKQA 1NKSA 3TIFA 4Z51A 4KSBA 2J7PD 2GF0A 2FZ4A 3OAAD 1SVWA 3TUJC 3FHTA 1FX0B 4M1KA 4V0LA 1XPUA 1VTKA 1TX4B 1RYFA 1E1QD 1E9AA 4MKGA 1W44A 1JQJC 1UKZA 1Q1QA 4JIMA 1T9HA 2OXCA 2ZQ5A 2W2XA 3AKEA 3NKVA 3RSLA 2VHCA 2Z83A 2EYUA 1RYHA 4JJZA 4IDPA 2Q9CA 1XTQA 4LX0A 3S1AA 4D6PA 4DKXA 4NP6A 2V6IA 4RY2A 1MO6A 4I4LA 1E2JA 2WAXA 5TARA 1XPOA 3THXB 1JAIA 5KNCA 3OF5A 4JL6A 1V43A 3A4MA 4WZ6A 1EFCA 3KUDA 1JPNA 2ASEA 4DEXA 3OFNA 5EJEA 4MRRA 1GTVA 3MWYW 4KCGA 1RZ3A 4MGYR 3SYKA 2BMFA 2QROA 1AS0A 1G8YA 2NQ2C 2NO1A 1UDWA 2EW1A 1OFIA 4M1SA 1PLKA 1U8YA 4TYQA 1Z6AA 3GJ8A 5P21A 2IYRA 4C4PA 3LXRA 1Y3AA 4HUQA 1IBRA 1KDOA 3I8XA 1G5RA 3AF1A 1FX0A 1Z6GA 3LW8A 1DAMA 1K6MA 5C2JB 1FZQA 1Z6YA 4PAMA 3IBGA 1PUIA 3V9PA 1M2OB 3K09A 4Q7MB 1BMFD 2YV5A 1E4VA 1RIFA 5H8WA 1P62B 2HXSA 3SDZA 3VR2A 4Q9IA 5B57C 5JHHB 1F2TA 1C4OA 1E2NA 3PXGA 4CEIB 1VYTA 1X8JA 2AKYA 4A8JB 3BE4A 3ZYCA 1AKEA 1W1WA 1E6CA 4X8OA 2ZRGA 1DAFA 2ZRPA 3RWMB 1HQYE 2IYYA 4OHXA 4XSGA 3KB2A 3FMIA 2P65A 3ZDQA 4LCBA 1GVNB 4LJ6A 3GP8A 2ATVA 3QBTA 4KJZA 2RGGA 3EW9A 4TYYA 1BOFA 2XEXA 4GPTA 5DHFA 4RD2A 2JATA 4CEJB 2ZRMA 1P75A 1KK2A 2A3RA 3RWOA 5AWFC 4JLKA 3FOZA 3Q85A 2JJ2A 4M4SA 2VL7A 4LJ4A 4V0NA 1Q0UA 2BKUA 4GMDA 1EG7A 4DCUA 1L7VC 1NMYA 2NO6A 1NLFA 5LBIA 3PUWA 3DHWC 4A0FA 1P60A 1E96A 2JLSA 5GADl 1R0XA 3B5JA 4NE2A 4DLWA 2O8BB 3TSZA 1FTSA 2NO7A 4IOMA 1ZMXA 3DEFA 3KKQA 2V9PA 2J3EA 3KX2A 4AG5A 3RRYA 4BFYA 1AZTA 1KHTA 1P2VA 1R8SA 2GKSA 3GLHB 2CHGA 2GZHA 3EIQA 1G5TA 3OIWA 1JXMA 1ZNXA 2V4ZA 5DSZA 5BN3A 2VSXA 2ZSAA 4HI0E 3G5UA 2F9MA 1DELA 4EDHA 2PH1A 1GNRA 5AJZA 3ZGXA 1C1YA 4PSKA 2ERYA 2W2TA 3GLIE 5JECA 4AD8A 2Q6TA 1CR4A 1DBSA 1LF5A 3QKTA 4PZZA 3R9WA 2L0XA 1Q1EA 2ORVA 4CIDA 5CJPA 4M9QA 3QQ5A 2OESA 4QOSA 4C0LA 2DPXA 1Z07A 2PZEA 1V5WA 3F8TA 3N2EA 4HB3A 4IHQA 4NCKA 5HCIA 5AK0A 1WE2A 2GXQA 3QF4B 3QKRA 3G0HA 1TU4A 1N25A 3S1AB 3KZ1E 2WZQA 2WICA 3AP1A 2O8DB 4OHZA 1H8ED 4O3MA 2K5UA 4HSEA 1X1SA 1M1YE 2HYIC 4AKHA 3NEJA 3RRMA 2IYSA 1W0JD 4KFTA 5GVSA 4QRHA 1SVSA 1X8LA 2Q0HA 2VO1A 4PFSA 3RRNA 3AP2A 4QJ3A 1R5BA 2ZJ8A 3CB4A 1OH6A 3QG5A 3LQRA 5JRJA 2J46A 1OHHA 1IY0A 1YZTA 3NH6A 3AVYA 2ZI5A 2XXAB 2VP2A 1T8TA 4QC2A 4CDGA 3MJRA 3CZQA 3RSOA 5L3SA 5KNBA 1AKYA 2XOKD 4PQFA 5FTLA 2ZPTX 3TUIC 2Q3HA 1XEXA 3NH9A 4E07A 1LS6A 5CYOA 5KDOA 221PA 1XMIA 2ZRLA 2W6ID 3K53A 3QEOA 4LWZA 1W36B 3ZD7A 3U7GA 3EG5A 3NDBB 4PSVA 2VP6A 4C0JA 1OIXA 2H8KA 3BBPA 2CVHA 3A36A 1TQ6A 4FINA 4O0MA 4A0HA 4XD7A 1YHNA 1OB2A 1HE8B 2WJVA 2BIFA 1TEXA 4B34A 2AD5A 4QBHA 4FMCB 1C9KA 1Z47A 4Q9HA 4ZCMA 1OXUA 2EWVA 2CLDX 1VCMA 2IXGA 3QY0A 3FKQA 1ZP6A 1IY1A 4QGHA 1VHLA 2O0KA 1W4BA 1UEIA 2RGEA 1SKYB 1EFRD 1NMXA 4LK2A 5E7IA 1Z2CA 5H70A 4PHFA 3ZZTA 4JSYA 5KDDA 4HZUB 1WMSA 1G41A 4V0MA 1OPXA 1CS4C 3LVRE 1VG0B 1A2BA 3OAAA 4D0NA 4DSTA 3A4LA 4DLXA 1HA3A 2BVNA 2J0UB 2FFQA 3AUYA 3DMNA 3M4YA 4HB2A 4F4JA 4XWKA 2C9YA 4C2UA 2ZU6A 2DFTA 4D0GA 2OFOA 1OF1A 1VCOA 1EFRA 2IK8A 4PC2A 2WJHA 2ZJBA 1HV8A 2QY9A 5FBQB 4AURA 3UKDA 1XTIA 2GAOA 421PA 2FX3A 4R7ZA 5DI3A 5TXGA 3TE6A 2QP3A 3ZQJA 3ADCA 5TY0A 4NCJA 4NONA 3GJ0A 1GFIA 3RAPR 1IQPA 2B21A 4GNKA 2J5XA 1I4LD 2VLIA 3GLHA 1AQYA 5FOSA 2O52A 3AVUA 2Z4RA 5CLQA 3BIFA 2ZYWX 4XSHA 4UNRA 4TMTA 1KZ7B 2OAQ1 1YZKA 1QHXA 2G1JA 5EXPA 2RB4A 4OQFA 5JEEA 4M1WA 4KSCA 1EX6A 1VDZA 3OEHA 1CR0A 1YE8A 5FTJA 3RANA 3VKHA 2QA5A 3HP1A 3T06B 4F4IA 1COWD 3C5HA 3LRPA 1I2MA 4CEHA 3GCGA 2GZAA 3NDPA 2QQ0A 4OJQA 3ZJYA 2ZXUA 3ZD6A 1KDRA 4ESHA 2DHRA 3O8BA 4JLOA 5J47A 4KV9A 4U7DA 4KBGA 2W6JD 4ILEA 1KKMA 4R71A 5FTNA 1XZPA 3K1JA 4D82A 5F98A 4Z1MD 1YU9A 4QBFA 2I1QA 1E2PA 1U8ZA 1OSNA 4B74A 3JZMA 2XTMA 1MH1A 2X77A 5JMTA 4ZIRA 4TL7A 2WWXA 1KI2A 1U8AA 4UNSA 2PT5A 3NBFA 3L0IB 4D4JA 4LDJA 2VP0A 4M9SA 1NG9A 4DBLC 1KSFX 4IDHA 2FG5A 2G88A 4EPRA 3DDCA 1F2TB 1M7HA 1XXHA 3VFDA 2IXFA 3QUSA 1WRBA 2ZSFA 4Q4AA 2JA1A 3QJYA 3AV0B 3AF3A 3Q7PA 1GUAA 4GT1A 4MQBA 2ZSDA 2ZAMA 4JLMA 2KI5A 5G53C 5FBRB 1G3RA 3CRW1 4LHVA 2REBA 1OH5A 2BBWA 1Q20A 4EKDA 4HB0A 2XX3A 1IXSB 4M1OA 3Q5DA 2A5JA 2QM8A 1X86B 2ZI9A 4R2IA 1R10A 3WY9A 4NYJQ 5KSYA 1WBBA 3EZ7A 3DO6A 2FFHA 2VEDA 1IN6A 4QNRA 1Q22A 2FSIA 3TK1A 1ESMA 3EZFA 1S3GA 1G6HA 1YRBA 1ONBA 1Z08A 3DMDA 3EA5A 3EIEA 1RVDA 3DPUA 4LHXA 4F91B 1GOTA 2OE2A 2PMKA 3M0EA 2H5EA 3CPHA 4EPWA 2HXYA 3WRYC 4D25A 1YZNA 2R2AA 2QSYA 3N70A 2VIIA 3X1WA 5CDFE 1TF7A 4JLDA 4ESVA 3CO5A 2GF9A 2ZU0C 2F9LA 1ZD8A 2ZRCA 3VMFA 5JJIA 4TT3A 2WWWA 4BLSA 4KBFA 4MGZR 2R44A 4MKIA 5EZ6B 4PC1A 3IO3A 2Z6VA 4A36A 4PQRA 1KI7A 3ZH9B 3X2SA 4ZI3A 1YQTA 4YMSA 1FOEB 5EE9A 3HWSA 5CM8B 1OW3B 5F9HA 2Q9AA 2R62A 1NN1A 2C04A 1XMJA 2C96A 1PLJA 5DN6A 5E4FA 5JCPA 1NI3A 1DAEA 4OQMA 4Q4JA 2OLKA 4Q4HB 4US0R 4JBXA 1MABB 1MABA 3GQBA 4RCZA 5E7JA 4KFSA 2ZE5A 4URYR 3BC1A 1DTSA 3ZLJA 1XTRA 1G3MA 1MR3F 3NG1A 2XAUA 3BS4A 2P6RA 2GCOA 2JASA 2YZ2A 4C2TA 1KKLA 3AVVA 4GRAA 1UAAA 1P4SA 1AK2A 5FPKA 2QRNA 3JZAA 4PC6A 2B92A 2GVZC 2ZYUX 1II8B 3BK7A 1KSJA 2GJSA 4TTQA 4V02A 1G3IA 4QBGB 4MRPA 1TAGA 1YR8A 2ZEJA 1RRGA 5CK5A 3FPAA 5TMPA 4MYHA 4B3CA 4BQSA 4Q02A 1W2HA 4IW3B 3W90A 3T1OA 1Z3IX 1OKKD 3LBHA 2E87A 1TF5A 3B2EA 2DCUA 2ZE6A 2IWHA 1XBTA 4OI1A 3WMFA 3H86A 5FL7A 3EC2A 4X8HA 3W8NA 2NPIA 2IX3A 5CDFA 2D7CA 5GJWC 5E7MA 5UKDA 2DBYA 3X1ZA 2FV8A 1TEVA 2YOGA 3LLMA 4W9MC 4CW7A 3BFKA 3NC1C 4LI0A 4LJ7A 4NHOA 2ZJAA 4FCVA 4JBYA 4RD0A 4HLQB 1ZNWA 1GILA 3W6PA 4GOJA 3MRSA 3VR6A 1D6JA 1JAHA 4TSFA 1FFHA 4QBIA 3DZ8A 2AXPA 4BUJA 5FUYA 4EUNA 5M04A 1N6OA 1W49A 4QJ5A 1DO0A 2C03A 1F6BA 4QFMA 3IQWA 1DS6A 2C99A 4IRUB 4OHYA 2I3BA 4BLRA 2GK7A 4LYAA 5EXXA 4ZDWA 3TH5A 2GEUA 2AFIE 4L8GA 4TMZA 4A2WA 1U99A 4QNMA 4EJSB 1XTJA 3PUXA 4XVUA 2IA5A 3T5DA 2WVJA 1E2KA 1J8MF 1KAGA 4MKHA 4N3NA 4TMXA 4MDFA 4IDNA 3CM0A 4AYTA 2WSSD 4QM7A 1FTNA 3UIEA 2NO0A 3FB4A 4XH9B 3QXCA 2QM7A 4YQFA 4YLGA 1SXJE 3AVQA 2JJ2D 1J7KA 4URXR 3DOEA 1Z0AA 3LXXA 4ZCLA 2JLVA 3D6TB 1PJRA 4NCIA 5EE1A 3VHLB 1ZM3A 3QI2A 3DM5A 1UKEA 4D81A 3BWDD 1DAHA 1NN3A 3I62A 3CRMA 3QXSA 4GOXA 3X1YA 1UBFA 1WXQA 4US2R 4DVGA 2IYQA 4YMWA 3C8UA 4BZPA 2AHOA 3EPLA 2GEVA 2CVFA 2ZAOA 1NJGA 4B3FX 4IDQA 4JVLA 5J4YA 2XZPA 4G5GA 2O0JA 3KQNA 1YR6A 3BOSA 4JS0A 5KYKA 2GESA 5FUVA 1NIJA 4CVNA 2F43A 3ONWA 2QU8A 1RFLA 1U2RA 2F43B 2BJWA 1SVLA 2GJKA 4CZ2A 2FWRA 3OHMA 1G7RA 1TL7C 1UFQA 3ZS9A 2N42A 4I81A 621PA 1XEXB 4M9XA 2NZ8A 3EWAA 2QBYA 5KOYA 1DO2A 1U9IC 2OCBA 1E0AA 2ZRAA 3NBZC 4YC7A 2HEIA 1UBCA 2WJJA 4Q03A 2IBMA 3ADKA 1JNYA 1GRQA 1ZNZA 4WXRA 5K8IA 3BFVA 3KXKA 1RJ9B 1OYYA 3X1DA 1E0JA 2VHTA 1NN5A 3MMPA 3QOFA 1Q57A 2ZITA 4CEIA 2OT3B 2RHDA 1J99A 2IF0A 3P4YA 4WIAA 4NYJR 2ZRBA 2J7KA 4I1UA 4OK3A 1G7CA 1AIPA 4JKYA 1SVKA 2GDJA 1E2DA 3I5XA 1F2UB 1US8A 1H8EA 3A1UA 4BECA 1OJLA 5B64A 4DWJA 4EIWA 2VA8A 4PPQA 5CYPA 3QXXA 4TN1A 1YZQA 3EA0A 4JZKA 3FKSD 4GSYA 3Q3JB 5CB6A 2IW3A 4D80A 1FUKA 4B33A 4DLTA 1XJ0A 2AD1A 4QHYA 1N6IA 1W5SA 2NO9A 3KL4A 5FBLB 1XD2B 4LJ8A 2WM9B 2O0HA 3NHAA 1ZUIA 1D2MA 4OL0A 5FH9A 2O8DA 1QRAA 3T5GA 3PEWA 3B85A 1OHHD 4BFSA 4JLVA 2FU5C 4C30A 1CEEA 2QBYB 3HYRA 2QMEA 3HPRA 3T15A 4F38A 1YZLA 4LJ5A 1ZVQA 3THOA 1LVGA 1R0ZA 2LWIA 2FPMA 1COWA 2WJIA 4XWAA 2OZEA 2QT0A 2IHYA 3AB3A 4UQOA 3THWB 2ZSEA 4Q7LA 3VX4A 2EYQA 2JEOA 3B1YA 3FMPB 4QHTA 1LTQA 4JL5A 3GLGE 2J1LA 3A1VA 3SE0A 2IS2A 3GD7A 2QAGA 3SN6A 4DXAA 3IGFA 5TDHA 5IK2A 2HUPA 3TSWA 3R8FA 1VCNA 4M1MA 1E9RA 4DLYA 5L3QA 4B32A 3TR5A 1JPJA 1DARA 1GAJA 3GLFB 1XMSA 3GJ5A 2CCJA 4NYMQ 2Q9BA 3BH0A 4G0NA 1P3JA 2P67A 2CMKA 5IRCD 1XD2A 3VKWA 4DDUA 4Q18A 4OI0A 4U02A 3GJ3A 3OIYA 1QHHB 4N0DA 3V00A 2UZ3A 3P20A 2R6DA 5KNDA 3GLFE 4TWZA 3BERA 3I61A 5SZJA 3U61B 3L0OA 1U94A 1XZQA 2PJZA 1BKDR 2JCSA 3Q8XB 1AM4D 4B44A 3L2OB 1RC8A 1EX7A 1CKEA 1A4RA 4QG7A 5G3YA 4YXWA 4MH0R 1SXJC 3E5HA 3UPUA 3TQFA 2ZR9A 3QIAA 3OEEA 4HLUC 2ZI6A 2GCOB 2GRJA 5JS8A 2QQEA 2YOFA 4XIGS 4G1UC 3T1TA 2HF8A 5JSZA 2ERXA 3DVLA 5L3RA 2ZRJA 2C77A 3F3YA 4HAXA 3TJZA 1CJTC 1RPZA 2DWOA 4DRZA 1J90A 4Z8XA 3EPJA 2AWNA 2ZRKA 3LH5A 4PX9A 5FFMA 1N3BA 1VYVA 4P4SB 3RVBA 3O8DA 1M7GA 3K0CA 4XD7D 5BXQC 2JLWA 1W0JA 4A6XA 2FDCA 2OFXA 3SHFA 3UMRA 1H8HD 2ZIAA 2D4HA 1VCIA 2D06A 3OEHD 3VR3A 2IS4A 3CF6R 5JI2E 1GSIA 2FMXA 2WHXA 1NBME 5DIFA 4LJAA 1PVOA 1GRRA 2ZJ2A 4MUAA 2MSDB 3Q5EA 1VPLA 2XZOA 3NWJA 3IIJA 3OIVA 4E09A 2XJ4A 3UANA 4B47A 4DZZA 2F1HA 4XTCS 3GLGA 4TZ6A 1KSGA 3K8YA 2I1VB 1KO7A 3AVOA 1W5TA 1E4YA 2V7QD 4PXAA 4DSOA 4LPSA 4E03A 3W9YA 1KK1A 2VHQA 1XP8A 4Q5IA 3X1XA 3CPEA 1E0KA 1JALA 2ZI7A 2BBSA 4G5QA 3TBKA 4DUGD 4P0TA 2WWHA 3DL0A 1WDTA 2H57A 3B7GA 4WA7A 2GILA 1Z5ZA 4Q1CA 4URVR 4LYFA 2GEDA 5G41A 4TL8A 2OAP1 2WSSA 2XNSA 5AR1A 4CEHB 3A37A 1G19A 2J87A 4YMUA 1HQCA 4LJYA 4NCHA 4N0EA 4A0RA 1ZD1A 1DE0A 2JGNA 2VSFA 4G3XA 5HZKA 3BD9A 2BBTA 2ZRHA 2RGXA 2CK3A 2BOVA 4EQ6A 2AFHE 4OK5A 3DKPA 1G6OA 1ODFA 1UBEA 3GLIB 2IWRA 1Z28A 3KXLA 3Q9LA 1KJZA 3B1ZA 4TMWA 4UKDA 1QHGA 2CHVA 4ZIRB 3BXZA 2FA9A 1WB9A 3AQ4A 5DN6D 1T5LA 2F3TA 2J7PA 2QMOA 3HPQA 2JLYA 5LB2A 3SI7A 2P3SA 2QI9C 1CP2A 4LC0A 2PCLA 3VU9B 3SYNA 5FOTA 1KNQA 3PEYA 2A78A 4V03A 2IL1A 4MA4A 2W0MA 1ZJ6A 1OFHA 4JVSB 2B7CA 2XNDA 3E1SA 3CNLA 4EJSC 1NY6A 2C9OA 2VHJA 5KSZA 3PVSA 5C1BA 1NVWQ 5JWOA 3U5ZB 2A5GA 4NCNA 5C4GB 3W5JA 2CE7A 3KFXA 5B2ZA 1FQKA 2OBNA 3IHWA 3DKVA 4TT3D 4EPYA 3E2IA 5CITA 1G8PA 1A5TA 5CK4A 1R2QA 3W3ZB 1MRNA 3LLUA 4IFBA 1NP6A 1KO4A 4JVNA 4DT1A 1S9DA 1E2EA 4JYBA 3U3KA 4TSFD 1T8UA 5A0FA 2QEQA 3K0CC 4L5BA 1QVRA 3AVWA 2OFWA 2HJVA 2JAQA 3I1FA 4B3XA 2A30A 2H17A 4BEBA 3U4QA 2OO7A 3UWOA 4TTPA 2QAJA 3WP1B 4KVAA 3OFND 2WTUA 2C8VA 1ESNA 5BN5A 1ZAKA 5CIQA 3FHOA 2YVUA 2PZGA 1ZIOA 1CULC 4PSAA 1VECA 2W6JA 4UXJA 4X8LA 1GL6A 4P3YA 5FTMA 1F3OA 2ZTSA 4A82A 1VHTA 3AVXA 4TZ0A 2GXAA 2C98A 1QDEA 4MRVA 2VP5A 1X3SA 1YKSA 3V4RA 1N6PA 4ARZA 1ZBDA 4UJ3A 2QUZA 2X8AA 2GJ9A 3ND9A 3N2IA 4U5XA 2QL6A 3B1XA 4KO8A 3HU1A 1TTTA 4POAA 1OFUX 4QHSA 4B48A 3R9XA 3TVDA 3AM1A 2JJ1D 4W7SA 3H4MA 4FMDB 2VH5R 3C7KA 5AJVB 4K46A 3H1TA 1KO5A 2VRWA 3I72A 4DCSA 2O8FB 3U3OA 5KUTA 4RD1A 4EQ6B 2CNWA 3VAAA 3L82B 1N0WA 2VBCA 4JL8A 5CB8A 5J4LA 3W8RA 1KI4A 2FN4A 1F5NA 3EX7C 1G1MA 1SVOA 4HAYA 2OHFA 2BBOA 2QPOA 3QBVA 5FPSA 2YWEA 1W0KD 3NHBA 4DCVA 1FQJA 1Z2AA 5IT5A 3JVVA 3PFIA 4LV5B 4TLAA 2BMJA 2FFAA 2QPAA 2QTVB 1I2DA 5E3HA 3H84A 2R6AA 1S1CA 1XU4A 2CL7X 4ZO4A 5B58C 1OXTA 2IUTA 1FMLA 1OE0A 4W5HA 4WZBE 3RYTC 2EFGA 4JJKA 3K9LA 4LZZA 2QP4A 5AUNB 5KU1A 5ELXA 4YXWD 1EFHA 1QHHA 1N0VC 2X1VA 3LWNA 1SKYE 4JLAA 1LB1B 2WKRA 5DO9A 1E2FA 4PPNA 1CJKC 2X19A 5CM9C 4ZDKA 3TKLA 1OYWA 4O2LA 5L8VA 3TSOA 3QVUA 1GL7A 3GJXC 1XEWX 1P73A 3OESA 4OJKA 3QKRB 3L43A 4BFUA 1B23P 4I99A 5LDDC 3TRFA 4KFRA 1B0UA 1OIWA 1W36D 2DB3A 2F55A 1KI8A 2J41A 1XXHE 1XCMA 1D9XA 4PHGA 4QGFA 4RZ3A 3W6OA 5JSZB 4AI6A 4NYIQ 1X1RA 5HZHA 1ETUA 2O8CB 1QG2A 1KMQA 1JR6A 1JR3D 1KMHA 1ZD9A 2VP9A 1BIFA 1HY3A 1VYUA 3IEUA 4K8OA 2ZRDA 4IKEA 5CIWA 3CPJB 4KYIB 3LDAA 1NSFA 1BMFA 4XVRA 2DYKA 5LD2C 4PO8A 2UVQA 5CJ2A 2CL0X 2H92A 2QAGC 1QHSA 1WCV1 2EFHB 2EWWA 1NL3A 1ZINA 4M1TA 4L4UA 1E9EA 3U60B 4HDOB 1NN0A 4PHTA 1H8HA 1MV5A 4LOAA 3D3QA 2EFCB 2GXUA 4KAXA 4Q1DA 3K0AB 3QKSB 3TQCA 1G291 5FI0B 3UG7A 2PCJA 1GNPA 3L8ZA 3B9PA 1DG3A 3NIBA 5CLLA 3W6NA 1DADA 4ZV4A 3IPXA 4RZ2A 4QKQA 2WJGA 4BZXA 1CR2A 4RD4A 2CL6X 4WVFA 5FOWA 5BW8A 2GBLA 3HR8A 4KHZA 3PITA 3LD9A 4DIDA 3UATA 3U7HB 5EP3A 4E5UA 4LUCA 1RRFA 4MYTA 1E1RD 2VF7A 3KQHA 1E0SA 1NBMA 1GITA 1EWRA 2WMNB 3WYAA 821PA 4DB2A 3CRQA 2PMDA 1BS1A 1QZXA 1G4UR 2HCBA 5FL3A 3T34A 4YDHB 1NLZA 2PEYA 2DFKB 4DT1B 2YOHA 1T3LA 4FIDA 2GCNA 2QZ4A 2GXSA 2ZJ5A 2ANCA 1P9NA 2YC2C 3A4NA 4RZXA 4DEYA 4BEJA 1KDTA 2X2FA 1E9DA 3ZVMA 1TU3A 3QEJA 1KO1A 4NDZA 4RCYA 1KI9A 1G21E 2PBRA 5J5CA 2DR3A 3RRZA 3PIRA 1T6NA 2FE4A 2IEYA 4HDQB 4IEEA 3WBJA 4O25A 2R65A 1P2SA 2QT1A 1ZYUA 4FCWA 2PL3A 5FI1B 1SZPA 2WIBA 2PX0A 4JLJA 4H9GA 3NEYA 1XD9A 2R6CA 3B8HA 4Q00A 5FOUA 4DDTA 2IYVA 3D7MA 4MKFA 4WBSA 1XTSA 1ZCAA 4MYCA 121PA 3EIHA 4C7OA 2PX3A 5GVRA 1PUJA 2CEAA 2IS6A 2F7SA 1T3HA 2FSHA 4YMVA 3ASYA 3FYHA 2ZS9A 3SEAA 3DZDA 4R98A 4UNQA 1OT3A 1U98A 2ZYVX 3WYGA 4ASUD 1ZU4A 2O8FA 4MGKR 1CBUA 4Y0VA 4A92A 5BWMA 4NTZA 1OKKA 4ZKDA 1ZC4A 3AF2A 2D2FA 3C15C 1ZC3A 2X2EA 3K9NA 2XSZA 4TLDA 3R7WB 4EFNA 3ZIAD 4DCNA 4EPTA 4TLEA 3WNCA 5HR5A 3QPVA 4FWIB 2IXEA 4PPFA 2ZRNA 4IJMA 8OHMA 1PLLA 2ZSBA 2P6UA 3KKOA 1G3QA 3ZS8A 4C0AC 1Q3TA 5JLJA 2EFDB 1G8HA 3SNHA 2KBEA 3SS8A 1LY1A 3PJRA 4AK9A 2VF8A 5BYKA 1NVUQ 5FTKA 5JEDA 2F1RA 2H16A 4B2LA 2BMEA 1LF0A 2QGNA 1ANKA 2NMVA 2WAYA 1UF9A 4OI2A 3QG1A 1TQDA 3TAHA 1XJQA 3GJ4A 2BKEA 2RKOA 1QHIA 3KTAA 1IAQA 3T61A 2WV9A 3GMTA 2IHBA 3IO5A 4PPGA 4IXMA 2IYLD 2JLQA 1TPZA 1GKYA 2IYXA 1UADA 2ZM5A 1CF4A 1D2EA 3OIUA 4EPVA 1IN5A 1YR7A 3A6PC 3A1TA 5FPYA 2OCYC 1BO6A 3LAWA 4Q21A 3FE2A 5JS7A 3F0TA 4Q7KA 5JFGA 1IHUA 5K8UA 4FD2A 1DPFA 1MO5A 4Q1AA 3LNCA 4M8NE 1YZUA 4AYXA 2XJ9A 4HDCA 5DLQC 4CGZA 2GJ8A 5HKKA 4C0KA 3WNDA 1E94E 3O8RA 4O2RA 2JDID 5C46F 4TYWA 1FL9A 3BB1A 2P2LA 2NG1A 4JBWA 2BDTA 2WIAA 1G18A 3PENA 2WWGA 3HDTA 2I4IA 1PV4A 5DE3A 4ZCIA 5H68A 4AY2A 4V0ME 1Z63A 4GBMA 2YHSA 3DM9B 3CR8A 1RRCA 4P33A 2Q3FA 3CONA 3OE7D 3FDIA 4WOPA 3LA6A 5GJBA 3GJ7A 4ITRC 1YJ5A 3KQKA 2PZFA 4B35A 3CF0A 2EU8A 1OV4A 4UNNA 4C3ZA 2ZI4A 4B6FA 1H65A 2HLDA 3GFTA 4G5SA 3I8SA 1HE1C 1X6VA 2QG6A 1IN7A 3GFOA 4D26A 3ADBA 1XEFA 3K70C 3MJHA 3EPHA 2WWIA 4R2HA 4OK6A 5TVKA 1G8FA 4B3GA 4GDFA 1FP7A 3KJIA 1E9BA 1N5IA 4URZR 3R7WA 2GWHA 1NJFA 1DAIA 5TV2A 3AVTA 1AJEA 2FOLA 3D8BA 4GFDA 4H1UA 1KAOA
chains in the Genus database with same CATH superfamily
2AF3C 4PN3A 1M6NA 4WK4B 4WLVA 4RNDB 3SX2A 3EXIB 5T6BA 5K9ZA 1SQ5A 3AESA 3CURA 5AI9A 3AIIA 1NJ8A 4CRWB 3AWIA 4YRDA 2ZYTX 4JHLA 5C34B 3SLRA 3TOVA 3P32A 5DYIA 3H5AA 4BJHB 1JHPA 5TSDA 4YRMA 2FWIA 3PPYA 1BS9A 4NK5A 1PT7A 1K4MA 3KOUA 4WK2B 1UPTA 2PJRA 3NJ8A 1VIVA 1A69A 5I48A 1JZQA 2XB2A 1SKBA 2HK7A 1J2TA 4RDHA 3RJ9A 1XFAA 1C1XA 2B34A 3AY7A 3C4JA 1Z22A 1WU8A 2PFGA 3OVMA 4ZCQA 2VP3A 3LBNA 1D7AA 2QN6A 3HJRA 3G79A 4RK4A 4J3FA 1EFTA 2O4UX 4RKRA 4B75A 1W25A 2A0XA 2PUHA 4BKUA 4B3DA 1TAQA 4JA0A 5IUJC 1KRXA 4BMNA 4D0LB 2ZJ0A 3PK0A 1CZOA 4UTZA 2NNWB 4YA6A 5DTQA 4BNIA 4CF3A 1M6EX 3PG5A 4M0FA 1MJHA 3DZKA 2OV8A 2PKQP 3M5PA 2E6KA 3OCXA 2WYVA 4TTIA 1FU7A 3B9QA 3R5XA 4O8ZA 5HP4A 3I9FA 3K70B 3RARA 1JAXA 2CBZA 4E5DA 2ZBDA 4GXQA 1FXUA 2ATCA 2B7BA 4XGIA 5FR2A 1UBUS 1XU9A 4WH0A 2Q0SA 3DLCA 2OWEA 1X7XB 3Q11A 2EQBA 4LRXA 3WLEA 1A9SA 4QATA 1W1IA 2I1LA 1U81A 1P5JA 4UHHA 5IS2A 2XMPA 1I2ZA 3CVUA 5C1OA 2GZ3A 3S2EA 2H3EA 2GH1A 2HTFA 1VI5A 1N6HA 3PV0A 4MUIA 3GUVA 3Q7QA 1XTPA 2VDPB 2OVFA 5LN1A 3B51X 1U8EA 3PKJA 4NDNE 1UFKA 1OYVA 2PUBA 2P3OA 3KV3O 4TV9A 3WXMA 5E2BA 2P0YA 1Z7BA 1TZMA 2B37A 3ZHVA 3R9XB 4X7BA 3A7EA 4BNWA 1WAMA 1ZH4A 4E5YA 1GQOA 4P7JA 4A9AA 5A3JA 4LQ4A 6AT1A 1Q1NA 4W9NC 3EAQA 5J43A 1OFUA 5HHTA 3VKUA 2B4KA 2VH2A 1IZZA 2ZVQX 2G9ZA 4R1OA 4A1OA 2UVDA 1ULSA 1M2VA 5C18A 1US8B 4RIEA 1H3NA 1GQFA 1U8UA 2ZR7A 1YS1X 1QONA 5I4IA 4JI5B 3W2TA 4FYWA 4MUEA 4AUNA 4S2EA 2BM0A 1U3GA 4JT8A 2B1JA 3CF4G 3AEKB 2Y6UA 4L9SA 1QJ4A 1KSHA 5AVVA 3QX7A 1AMNA 3WTBA 3EDCA 2Q0XA 3FMOB 1YZFA 1MB9A 4MW7A 3L0PA 3HXPA 3F49S 3NATA 1M67A 4IVNA 4RE5A 2G9UA 1LDNA 2ONKA 5HKAA 4CPDA 3EGDB 4O4HF 1ZMRA 1EXNA 2X42A 3WQHA 1T9DA 5DGXA 3MTGA 3R0IA 4AO6A 4E12A 2W43A 2RKWA 1KOFA 5A7HA 4RTNA 4YRCA 3ND5A 4P82A 5ALYA 3WLTA 1AN0A 3C41J 4QOGA 1DIHA 2DOKA 2BGMA 4IJVA 3EPRA 1UKYA 4X1OA 3E3OA 1QZTA 1S01A 4P4UA 2REXB 1BKSB 4D3DA 1T9GR 2OXIA 3UMFA 3S44A 2XNJA 3VOBA 3H65A 3PNVA 3U7EB 4DWVA 4EO9A 1CQIB 1TM7E 2KMLA 4FKBA 1UJ2A 2BSXA 5J1SB 1P9LA 2PZMA 1DLIA 1NJ6A 5JZMA 4ZCRA 4EECA 1JJ7A 1RXVA 4R1PA 4ZVVA 2NSDA 3C3XA 4LNHA 1ID1A 2Y0PA 3G82C 2XV1A 3N8KA 4KQGA 2C84A 4BN4A 5LP6F 2E4YA 1ZCJA 4PZYA 3WMRA 1WXIA 2H7VA 3DC2A 4WZAB 3MSCA 3DFKA 3HP4A 1IUPA 2QLNA 3IC5A 4L0DA 4BX0A 4FXPA 5EKTA 2HADA 2IIPA 5IAJA 3ZI0A 1SIWA 2DSTA 2UYQA 1B8PA 1Z73A 1MRZA 3S3TA 1TGYA 1TJNA 3DLAA 4JLNA 1Y82A 3T54A 3KNZA 5LA6F 1DQYA 1ZHHA 2C4WA 4N7JA 1NNEA 1JEYA 4TKLA 1OBCA 4F4FA 1BGXT 1U6KA 4FOOA 1X2EA 4Q47A 2V6MA 5HE8A 3WLMA 5DVZA 2NUTA 3TQQA 3AHJA 3EIFA 4G01B 4R1SA 3QWHA 3VPHA 4C01A 5CDSA 3W3AD 3OI7A 1XEWY 1LUAA 3LUPA 2B6NA 2G7ZA 3VR0A 3NVAA 1YUBA 3C14C 1MHTA 3UWDA 2OKCA 4A2PA 3U44A 3QU7A 5B3AA 1TJYA 2AOVA 3B82A 4M8KA 1JT2A 3DXFA 2YMMA 3OJXA 4IJWA 1U8FO 1II0A 2Q2VA 3MGCA 5ALNA 2ECQA 4RS3A 3I6ZA 3TXXA 4D46A 1I5OA 4KXFB 3FFWA 2QIOA 3MT0A 4QQ8A 5GM2A 2B1RA 5EJ2A 2FG7C 3VX3A 3ABZA 1YB5A 2N46A 1AQUA 1KFEB 1LDBA 1M2EA 3P2KA 3P52A 2V1UA 4R6XA 5KWVA 5FHQA 2E5LB 1VLZA 5EIWA 4DG8A 3B1KA 1GCAA 4C1BA 3DDZX 1O77A 3K0AA 2EAUA 1T4CB 1A7KA 5HIIA 2NTNA 1NI4B 3N87A 4ENVA 4FNAA 2G77B 3KUUA 1LJLA 3NNDA 1N2GA 3TECE 1HT3A 2GK6A 4JX9A 3VVCA 3TAUA 1Y42X 4R7TA 1QPZA 4FBLA 4I3HA 3CCCA 5HNKA 3KKEA 1X3LA 2IV2X 2WB2A 1TQ2A 3IMCA 4RKFA 2PLNA 3AFMA 1KPHA 3PGJA 4MDFA 2V4MA 4NXNB 2HA3A 3I12A 5TEVA 2I66A 4L8VA 1U2GA 3T5AA 2VSOA 3ZE1B 1PDOA 3S0JA 2KPOA 3SSAA 3WWOA 2OEPA 2RIPA 2ARKA 3PVCA 2BGLA 2I7TA 1S8AA 4WERA 3OTWA 1QLJA 2C57A 2V7WA 4G8JA 4RK0A 1K75A 1PR9A 5TQVA 5KYXB 5M5BA 2ZKIA 4BWYA 5DZSA 4C0SA 4BMXA 2BFFA 3MYRA 2H1CA 1KY3A 3TUZC 2ZVPX 3LXMA 5HGXA 1VG1A 2BDUA 1CHNA 2Y1OA 4QRDA 5LC1A 5AM2A 1LK0A 4LSGA 3QX8A 4G1MB 2WILA 3IPCA 4RELA 2F1JA 2GFHA 5KZMB 1A98A 3BM5A 5F7OA 5DNCA 1Q7BA 4WD3A 3OD1A 3ZCTA 3TDNA 1UXGA 5J4VA 3BJIC 1LRLA 1OFGA 1QH0A 1PGPA 2UVPA 4BRSA 1KIFA 2QTRA 2I1WA 5FBVB 3RIGA 3HTXA 3HACA 1EA5A 5HIJA 1VE3A 3CX3A 1TMKA 5DTMA 3L7OA 3K1YA 4XWYA 1P6XA 1XTKA 3MUFA 5ESRA 4EELA 4QXPA 2EDAA 4DLVA 1KZHA 3QHQA 4Q3DA 5IVHA 2I91A 2MINA 2FPWA 4YUVA 4FGWA 1BFKA 2AG6A 1YRAA 4CV2A 3NBXX 2FW7A 1VHDA 3T7KA 4PZ0A 4FDMA 4IKPA 4BEWA 3OBIA 3CVOA 3JD1A 4H77A 3HM2A 3I3SR 4DADA 4YCDA 3QUAA 2GZMA 3K9BA 5JNUA 1AGYA 3CNOA 3O7MA 4OJMX 4DSAA 1T8YA 3FTNA 2NZVG 4R81A 1JDUA 4H7IA 1VPEA 3JWEA 2IPNA 4ADSG 3CRRA 4P4SA 5G0TA 4DDMA 3HSKA 5FEUA 2A2ZA 3QLEA 3ETEA 4PBSA 1PSZA 3AFOA 5HMMA 3UJ6A 3ILXA 4JP3A 3E6AA 1A4IA 2VCEA 3PZBA 3EASA 2AEJA 3N2NA 2RAFA 5BYJA 3ZOZA 1FRVA 2A33A 4TVSA 1ESDA 4KK3A 3OZVA 1KDPA 4C4ZA 3X44A 1YVEI 3QA3E 2BHRA 4R51A 3DWEX 1Z29A 5HKLA 4GI5A 2C54A 1Y6ZA 5BQ5A 1JZSA 3TKYA 1HPLA 2XTZA 3X1MA 3ZU5A 2ATXA 3DGFC 3NKLA 4J1QA 4Q4HA 4C89A 3OBBA 3W1WA 3FPFA 5J4HA 1R66A 5EUQB 3U4CA 5EZQA 5KMGA 3MRXA 2HWWA 3VSBA 1QGUA 4DCTA 5CEEA 2JFQA 4O4HA 4EA8A 4N5NA 5AI5A 3OSZA 2BKXA 5BV2P 4C9BA 1KY2A 3CGGA 4O4IF 4BXOA 4LI3X 3RK1A 1CY8A 4TKVA 5J2TA 3RM3A 3TZHA 4MV4A 4J1TC 4J76A 5BV0A 4PX3A 4EI8A 1WKBA 3FVVA 2PANA 4Q9KA 3UWKA 3GRAA 2EHJA 2Y4OA 3FCUB 3SQWA 2HXGA 1KI6A 3T7EA 3BXGA 3WMXA 4Y2QA 2ZYSA 3KQOA 3FZGA 1VRWA 3BDAA 3OWXA 2O8EB 1L1QA 3L8MA 3LVQE 4PIPA 1L4NA 2Z3ZA 1M7BA 4OXNA 1OTYA 1VG8A 3P9SA 1RPAA 4JNKA 2PS1A 3I04A 2GZDA 3PCRB 4HAWA 4RKEA 4F3KA 3ZXIA 1P1HA 2BUBA 2O14A 2PGAA 4D9JA 3ZZUA 1QLWA 2Z43A 4BGIA 4QXQA 3EGIA 3L4BA 1Y1KE 5HBRA 1JEQB 3WGJA 5A5DA 5GOZA 1E69A 4AY5A 2WTXA 5C53B 1P5ZB 3A58B 3U7FB 1Z7WA 3N2GB 4DC9A 3DMTA 3FUWA 4PRKA 1QKJA 2YN2A 3K2QA 3I28A 1D2HA 2OCGA 2EX1A 1UFOA 3WL8A 2I8LA 2BFPA 2OSVA 3NWEA 2ZETA 3T7JA 3SC6A 5L7TA 1ZJYA 4MLCA 1BMDA 1SUEA 3JATB 4JLSA 1TYDE 3V55A 3SZOA 5BYBA 2FFBA 4KG7A 4QA9A 1GYPA 1J24A 1XB2A 2E4XA 1ISPA 1USGA 3H2BA 4Y0AA 4MUFA 1IXKA 2VHVA 5CNIA 3T9FA 5LLTA 4B3RB 2GO7A 1OLUA 4BJ5A 2R1UA 4MRNA 1FFWA 2CCKA 4QZVA 1T36B 1VBKA 1RWWA 1ZH6A 4I1OA 3HFRA 3MCAA 1JIIA 1M8PA 3QPDA 4UVEA 5A5GA 4BO0A 2XWSA 4UAJA 2RCNA 4K87A 2VPYA 3UZUA 2MINB 1F8XA 1WNFA 4GI7A 2G1AA 2PLRA 1UZLA 3QVOA 1QUEA 1FY2A 2FW0A 4KO4S 1LPOA 3QP9A 5EXEA 5L3VA 3RS5A 1SH7A 1ZUNA 2C2XA 3PTZA 4M9RA 1YFZA 2G5TA 2NYAA 3SZ3A 1RS0A 4BFZA 5CXUA 2BHLA 1CNEA 2C4UA 4R5MA 5AXBA 3P1JA 1MTZA 3HG7A 4LDRA 4WAUA 1Z13A 3DTVB 2WTAA 1AS2A 5C4MA 4KJXA 1NUAA 4YMIA 1T10A 3O3NB 2D4AA 2IYZA 3RUPA 1OB5A 4G0VA 3WRWA 1Z36A 5AJYA 4C07A 1CNFA 3OZXA 1JE1A 2J3LA 1L7MA 4EHKA 2R1TA 4Q37A 4G2TA 1M83A 2WPDD 3SQNA 3A6ZA 3SZLA 1NVVQ 4YJHB 2BCJQ 1J07A 4AY4A 1VJ1A 5K03A 5KNBH 1YBVA 3K96A 2X8JA 4W5JA 4MAAA 2HF9A 1L4GA 1E2IA 3K6JA 3GEIA 3KL2A 4Y9SA 4ZCSA 3U81A 2HCJB 4C4AA 1L5KA 1U0JA 4ZDIA 4ARIA 5AI6A 4JLBA 1BVRA 4FTWA 2CLKB 2IOHA 2VAMA 4ZI2A 1I3NA 3UHAA 1K2VN 1JB1A 4D9EA 4G0MA 1YRYE 1Y4DE 5CLJA 2PU5A 4U9IS 1JYFA 1ZONA 4A2QA 4ZFNA 2O54A 1OC2A 1UKAA 3OICA 3R09A 4FS3A 1H69A 4IQ0A 3N39C 2ONJA 1SU4A 4NX2A 2O3RA 4XCQA 1TYZA 1QYWA 3PHJA 5F73A 4DLNA 4M1YA 3QYFA 5BSTA 4WN9B 3DD5A 3H5RA 4BE9A 3NQ41 4RH3A 3DPIA 5CCDA 4NESA 1CVIA 4ZEXA 1MMFB 2PDAA 3IAM6 4MV7A 1KE1A 3SQXA 1AXEA 3K4HA 2PA0A 5HEKA 4DAOA 2QW8A 1HNZB 1T3SA 5ALRA 1XNJA 1BXGB 1CTQA 3ONDA 4ARAA 3E58A 4D8VA 1S1MA 1L7BA 3D7SA 4C2BA 3PWKA 2Z2ZA 5BY2A 1PR2A 3LVFO 2Y1WA 4D98A 3GDHA 3K7EA 1UANA 1WZIA 3N07A 4J4BA 3RDPA 3RQSA 3OZAA 3IKTA 2C7QA 3QSYA 4BFCA 1GRNA 2J0SA 1U2EA 2UYOA 4YFYA 4RK7A 2X40A 1RYMA 1XR3A 4MVJI 4XJVA 3SHWA 1EJ0A 1J22A 1FNMA 1SK9A 3HO6A 3PQDA 4B43A 2DRIA 1IN8A 1E8NA 3HU3A 1MFZA 3HYNA 4JH0A 3L0YA 3B1WA 3GJTA 1RBMA 1K5DA 2WJ3A 3LDUA 4FN5A 2ZJYA 4UPVA 5F1YA 1Z0DA 4HB4A 5H81A 4D8UA 3A9VA 3ZWKA 5AQ1A 2VNKA 1PL7A 2Q07A 2XNCA 4PLYA 3C5EA 2NU6B 5EQDA 3LQKA 1T3GA 4C7JA 2PWAA 3RRBA 4A2CA 4HTAA 2EF1A 2I55A 3KHKA 1DIGA 1EE2A 4KR2A 1WD5A 1EJ2A 4LZOA 4LRQA 1MA0A 4K28A 5KHOC 2R6FA 3WIUA 4I5DA 3LXUX 3CJTA 4YMTA 2HL6A 1R12A 1X1BA 2WMOB 5I3CA 5BR7A 1VP3A 1NDUA 4TMFA 3RVDA 1E2GA 3BRCA 5THKA 4DWOA 1TADA 3VH3A 1R64A 3WHKA 3KEQA 4RW0A 1NRJB 4ETWA 3HJFA 3DDWA 1EDDA 1GUYA 1DFIA 1AQ6A 3JYLA 3MFYA 3CRZA 1UJCA 3SMVA 3SYMA 1CSEE 4MW4A 1BDBA 4MUMA 1EXMA 3MILA 3EWNA 3IT2A 4HG2A 4OQLA 2P6OA 4X1KA 4B71A 5U1PA 2OP0A 5EJ5A 1U7XA 3BF7A 3CSUA 4JB8A 4RIIA 2PKEA 5AJUA 1T5DX 1ZM2A 2DSNA 3CTPA 3Q9NA 3A1WA 3QFSA 1XALA 3CIFA 1Y3HA 3MJVA 4L22A 5F3RA 1Z83A 3RABA 4U2GA 4E88A 3E4DA 5KTRA 2KS6A 4EY6A 4DW8A 5JWHA 4BLTA 2JD2A 5K6AC 2CFCA 3KR2A 1I1NA 3TQOA 1Y9EA 1NYLA 1N2OA 1PJCA 1TIKA 1ATIA 1QF9A 1YIDA 1Z8FA 2H11A 3C85A 3GY0A 3NFRA 3PUYA 4G0ZA 1DBRA 1UFVA 4I4TA 4L5AA 5BN5B 2BY4A 4CFZA 1U8TA 3VO1A 1R6BX 2NSYA 2OZVA 1Z26A 2PMBA 1NMZA 2INGX 5CFNA 4JGIA 1SD2A 4CG2A 1RJ9A 4TXMA 5KVQA 1L7NA 1VE1A 1E1YA 2EKBA 2VPQA 4NPCA 4U6SA 1HYQA 1D6NA 2Y77A 4ZAXA 3SFZA 3B8EA 2PSFA 4HWRA 5A71A 2BMDA 1M2NA 4FQ5A 1NV8A 1UWKA 1HI9A 2ODWA 3Q9UA 4RVCA 3VO8A 3UHJA 3KJZA 4BCCA 4OHMA 4DMGA 2X5JO 3E0XA 5CEJA 1YCGA 5H3HA 4YJ2A 1NW3A 1P7CA 4B82A 2BWJA 1ZWLA 3JWHA 4EEZA 1MFPA 1TKRA 2FN7A 5CT5A 3UEOA 3I9V6 1LX7A 2JLAA 1Q92A 3EGXB 4Z0HO 4Y2VA 1OA0A 3UC5A 1N2EA 1GFWA 1LFAA 1OWNA 4RANA 1QORA 4KQ2A 3ZGZA 1S4QA 1B8VA 1U5CA 4YJGA 2ZIFA 3Q88A 1CR1A 3CZPA 1HETA 5LB4A 3UMCA 1RWPA 3ZYZA 4IIVA 3ORQA 1ZCBA 4US1R 1RMQA 2J9GA 1PL8A 2RH5A 5EUBA 2D2XA 1I32A 4AIIA 4RF2A 1RQRA 4RK1A 3WK8A 3M83A 1F5SA 2RHMA 1EFLA 3ILHA 4CF5A 1KHHA 4FYJA 4O4JB 3WGKA 2O2EA 4Q1EA 3QVXA 2BEKA 3TOSA 4H60A 4FFPA 1U0RA 1V7QA 5A1JA 3UXEA 3WAJA 4II2A 4NBUA 3RRFA 2EW8A 3O1HB 4GI1A 4MP8A 4KHPB 1V5IA 4I4IA 4W7IA 2IZOA 4XLLA 5C35A 4DA8A 2P8SA 1QIMA 2TMKA 1GDDA 1WP9A 3VPXA 3VZSA 4EUKA 2OM2A 2VQSA 4Q7JB 2QF7A 2AJBA 2XB9A 3F2VA 5K8LA 4EA9A 1ZRHA 1FP4A 1TEZA 1V6AA 1E3MA 4D9NA 3OY7A 3PA8A 4D4MA 4LRSB 3WLNA 2KB0A 1H1LB 4KYUA 1CJMA 1ULBA 3O90A 3ZHCA 3KAQA 1RE0A 4FGUA 4LWPA 1CJVC 4C06A 2O1EA 5HDQA 2ZT8A 3BRWA 2Q3MA 2NTVA 2GHIA 5JJLA 1BXRB 4R9RA 4UUAA 2VJMB 1P4AA 2W2MA 4IDCA 4QO8A 2OXTA 3IHKA 3V4FA 5BQ3A 1VIMA 1OR8A 2EKPA 2UKDA 2X8BA 3PCXA 4UUMA 3PQ6A 5CW2A 5HTKA 5I8ZA 1JF8A 3OCVA 3K2BA 1ZUNB 2CJWA 1M5TA 2AK3A 3AF0A 1H9BA 1IZYA 2W8ZA 4NZYA 4CCSA 4DDKA 3KRTA 4A6DA 1A8QA 1JPVA 4H1VA 2H0RA 3L04A 3COSA 1QH9A 4PLGA 4R8KA 3UO8B 5J2UA 1NVVR 1VPWA 2BRUA 2QM3A 1NR5A 1NMEA 1SOVA 3CX7A 4BGUA 4JSRA 4BVEA 2Y76A 2VG8A 2XKJE 3MN1A 4G0XA 2XDWA 1M5UA 3DZIA 2FN8A 4L4RA 3RFFA 2HSDA 4B40A 1XDDA 5CH5A 4D9KA 2ODNA 4MUXA 4L3WA 1KI3A 4ZHSA 4B7ZA 1Y9ZA 4ACAA 1EM8B 5EY5B 2OO3A 3DNMA 4LS3A 4MJ7A 1II8A 2ZJ4A 3R7SA 2IEZA 4KVGA 4UBMA 3LUBA 2C2HA 2VT3A 4F11A 2FQXA 3IRVA 2ZUBA 3LFHA 2B35A 2YCLA 4Q19A 2DWPA 1N5KA 2F9FA 3H2YA 1IPFA 4AKEA 3AGPA 1JLHA 2ZDHA 3GUCA 2BM1A 3JQQA 2Q4OA 1XD8A 2JIZD 2HIHA 2ZQYA 2XVYA 4GZMA 4QNNA 1TYEB 1YH3A 1ZM4A 4TKUB 2WT4A 4V0SA 3GD5A 1X7ZA 4UTXA 4B6EA 1J20A 1QV9A 3CH4B 2A9KA 3NBAA 1YS9A 2D59A 3M3HA 1JYEA 2XA2A 1OBFO 3SJCA 4RVGA 2JJ8A 3KOMA 2RGBA 1JG2A 3IVXA 2YUIA 1ESEA 3MBIA 5DI9A 3RGGA 2G6TA 3KHUA 5DM1A 3PX2A 4UMVA 2J48A 4M7WA 1U0NA 1F48A 3MF4A 2FFJA 4KDCA 3IBSA 2XQIA 3A4TA 3KWJA 4I1SA 1TK3A 4X90A 5LKRA 4JYCA 1L5VA 3TGPA 3FY4A 3A2NA 2BPOA 3KTDA 2FW1A 4YAGA 4UVDA 1NVGA 2NOAA 1Z0FA 3GJ6A 1MO4A 4ER7A 4YAFA 1AHHA 3R0JA 1YR9A 1UR5A 1R6AA 2D7DA 3C0KA 3KU4A 3NONA 3KYCB 1HEIA 3EQ7A 2P1DA 3KKLA 4FGKA 4XJSA 1WBDA 1T8PA 4C4YA 1BWSA 1EP3B 2F8LA 2O8NA 2OC4A 2E85A 4BMPB 3VAYA 4J03A 4NZNA 4ZQIA 2YHUA 3LKDA 2I76A 1KZGB 3RLFA 2V7BA 3QPWA 3EGEA 4OIMA 4EDFA 4P5DA 5FV4A 1VJ0A 4FFVA 4EYGA 3TFOA 1BJKA 3MT7A 1ZMTA 4IDDA 2MSNA 4GICA 3WYEA 1GKKA 3M5WA 3SXUB 4JB2A 3WP0A 3WGLA 1E2MA 3QMPA 2E1PA 3KQNA 3LS2A 2MYTA 4FE7A 4WNIA 4YP6A 4ZQBA 2NU8A 4D7AA 2YHAA 3DVAB 1JB9A 2JFGA 1NW9B 1LV7A 1QYRA 4CTKA 3OE5A 4LBYA 2ZREA 1WL8A 3QENA 4RH0A 5FWAA 4J3NA 4AROA 5AJXA 1U1CA 3I92A 3L0SA 3JTMA 1WM1A 2CNDA 1GNTA 1QTIA 3AEZA 3KJQA 4CIXA 4EQZA 2C5HA 2FMHA 3ND7A 1RZRD 2NPOA 4EM6A 2XOKA 1DP4A 3S29A 2P0AA 2AK2A 4GOKA 3KOYA 3UJHA 1DG9A 2HSJA 3FVQA 4PC7A 2P9TA 2ZWOA 4AWBA 3MSXA 3OCUA 3IIEA 3VU9A 4CMKA 2OO5C 1SOUA 1V16A 1HUQA 4UKDA 3W9BA 4WBNA 2WKSA 3PPVA 3E9RA 1CS0B 2O8CA 5JSKA 3USCS 3NYWA 1R9GA 3ZGVA 5C9ZA 1EB8A 4L75A 4PZEA 5CT9A 4NC9A 4Q93A 3WA7A 4RVOA 1Y3DE 2HLNA 2BFCB 4OOFA 5CP8A 3ICQB 4W4TA 4CDNA 3QTBA 3P0IA 3SS9X 1W9MA 1X80A 1J09A 5AUOB 3CW2A 2ZJOA 3HR4A 4G5YA 1ZHFA 2X0FA 4UEQA 2CNBA 3MGAA 5KYNA 4B3BA 3GLHE 2QD3A 1VGVA 3JQ9C 1KQFA 4CQNA 4LECA 1OYOA 1SD1A 1Y3CE 4HGRA 1ORDA 3TIFA 4EKNB 2O2IA 4KSBA 1PZGA 4YB8A 5AICA 1PR6A 1V4BA 2WWVD 4R1MA 4LC9A 3OAAD 1NZJA 1FX0B 3DPSA 4I7EA 1RQNA 4M1KA 1Y8ZA 1YMUA 1VTKA 4HVLA 1V6CA 2OOKA 2GKGA 4AJ1A 1E1QD 1E9AA 4MKGA 1RYYA 1EWYA 2QTTA 1YZVA 4JI0B 4C6TB 2H7XA 2I99A 3EVEA 2IPOA 2FZKA 4E11A 4D6PA 4JJZA 2Q9CA 2IHTA 4NP6A 4HKTA 4RY2A 2A0WA 1YNSA 1QQTA 4E3WA 3HVRA 1C9YA 1XPOA 1NA5A 3UAVA 4EGJA 2FUG6 3L6UA 5KNCA 2V7VA 4JA2A 4MUGA 5E3JA 3ROXA 3F6SA 1EFCA 2ASEA 2JPDA 5A2QA 3IDZA 5EJEA 4MRRA 3WWYA 3GUHA 3HXQA 5FUQA 2NM0A 1WETA 4KQEA 1AS0A 2NQ2C 4EYOA 2BFBB 1U8YA 1U02A 4XZ3A 4YJFB 4ZOEA 5MDHA 1KJ8A 1W4LA 3HS3A 3M4ZA 3UKJA 1Y3AA 5MN6A 4HUQA 3P0HA 1SWVA 2I8CA 3R0XA 3LIPA 1A8SA 3AF1A 3H05A 3LW8A 1NWCA 3D4IA 3OZUA 1FZQA 4PAMA 2PMEA 3FM9A 1DBIA 3V9PA 1EQAA 2XRYA 3IDAA 3VPBA 2R0QC 2ZAGA 4LQLA 2YV5A 3QEKA 4JBLA 4NS1A 4F9FA 2J8ZA 1M1NB 3SDZA 3NUGA 3TLJA 1X0XA 4PFKA 1F2TA 1C3JA 4CEIB 1YCFA 4A5SA 2QK4A 2AKYA 4AM8A 4YBRA 3TW0A 4R6WA 1M2WA 1ONOA 2CVOA 3BE4A 1AKEA 3KYDB 1ZOLA 4GPZA 3H3JA 1IB0A 1LK7A 4KE8A 5KTTA 1UWCA 3RYIB 3OFSA 4JYZA 3DUFA 1WEKA 2Q6KA 3FSRA 2IYYA 3BUSA 4HTFB 4DV3B 1ZS9A 2W6MA 1UMKA 3GP8A 5CT4A 3QBTA 4KJZA 2RGGA 1EVQA 1CJCA 1FUEA 4NU8X 4BP1A 4TYYA 5JAUA 2XPCA 4YUAA 2AN4A 2L82A 2VWPA 4GPTA 5JTUA 4HNHA 1I0LA 2UZ1A 3V80A 5B36A 4F97A 4CIWA 4IQGA 2OC9A 1X2BA 1QOPB 1KK2A 2HPVA 1LVHA 2R7LA 4JC4A 3LLCA 4JLKA 5AWFC 3RWOA 5BRJA 2CUZA 2JJ2A 4M4SA 2VDWB 2VL7A 4EB6A 3TPCA 1EG7A 3FJ1A 4GOND 5FBZA 2GBCA 4IINA 5ARCA 3W3AH 4AX8A 1TMOA 5EHXA 1WDMA 3PX3A 3PUWA 2YNMC 3DHWC 3PC3A 1UP4A 2WK1A 4EGFA 4NE2A 3IE1A 3UFXA 4QGBA 3K20A 1FTSA 2NO7A 2QVCA 1ZMXA 1I30A 4IOMA 4XB2A 4C4OA 4CL3A 2V9PA 3KX2A 2QVBA 3CZ9A 2VWHA 1FMFA 1V37A 1P2VA 1D1QA 1SZDA 3UENA 3EIQA 6NULA 3AU9A 2P9GA 3HKBB 1UMBA 1ZNXA 3DJYA 1IWOA 3D6FA 3DC7A 1YQWA 3HWRA 1EUYA 2JIRA 2VSXA 2ZSAA 3PE4A 1L9XA 3BILA 3AUUA 2F9MA 1DELA 3V3KA 1HBJA 4OAOA 4R69A 5AJZA 2HJRA 1JEOA 1D1PA 4YXFA 2QTWB 5B55A 2Q6VA 1X13A 3L8GA 4IQFA 2NXWA 2I22A 2Q6LA 4INJA 5CU7A 4AUEA 1TXGA 5CA1A 1GG5A 5JECA 3CB2A 2XUPA 1XZEA 2QL5A 2NV0A 1CR4A 4I66A 4PZZA 4LK3A 3QKTA 2F3UA 3DCYA 3PKIA 5CX1A 2L0XA 2ORVA 2Z5LA 3KOXA 1DMSA 3RBZA 4DG5A 1PT8A 5EJAA 1EIZA 2OESA 3H5LA 4QOSA 4ZO7A 4EVQA 2PZEA 1V5WA 3F8TA 3N2EA 3IUEA 5BWBA 7ADHA 3OX1A 4KXQA 3UV7A 1N25A 1XFDA 3VV3A 1RJWA 2ZUEA 1EWTA 1DEAA 2SKDA 3E7XA 5C8YB 2ZB4A 1YBAA 2LV8A 3DVRX 4F5ZA 1PVVA 2JJQA 2IYSA 2PYDA 1W0JD 3IJEB 4KFTA 5GVSA 1P4RA 1X8LA 2Q0HA 5IEBA 4QJ3A 3O2NA 5BV1A 4PZPA 4PINA 1LA2A 1T6BY 3QG5A 3VSAA 2ZB7A 5LNK1 2J46A 3I2HA 3KYCA 2WUFA 3GRCA 3MWEA 3STVA 1G0OA 5D5QA 4TM7A 4U8HA 1IY0A 1YZTA 3HYLA 1DCKA 5T41A 3TEFA 4DYDA 2G36A 2YZGA 5ALIA 1SAYA 3CZQA 4GL4A 5L3SA 4ZI7F 2UYCA 1X70A 3KVYA 1AKYA 4PQFA 3VBEA 3TUIC 2ET6A 4RADA 1RFGE 3NH9A 4YDQA 5I7WA 4GWLA 2G4LA 4ZHQB 1HORA 2EC5A 2DQ4A 3RLIA 2JNWA 2JGDB 3F74A 3ZY4A 2ZRLA 3UMJA 3GEPA 4GWGA 4KX3A 3ZXUB 3TCXB 4PSVA 2NUAB 2H8KA 3KETA 1KU0A 2W98A 4R0MA 3IDOA 2WP0A 1RADA 1V26A 1YHNA 2C2OA 2V03A 4WKPA 2WJVA 3MS2A 3SOZA 4U63A 5AKHA 4MUNA 4URFA 2AD5A 4UUBA 4B34A 1Q0TA 1MJNA 1YL5A 2WG0A 3C3YA 4FMCB 4Q9HA 5DW3A 4ZCMA 5J5VA 3FKQA 3G7SA 5LQMA 1J2UA 9LDBA 3HCAA 1AH2A 3QELB 5DGCA 2ECFA 5LQRA 2WDZA 1I01A 1VHWA 4GM4A 4UPDA 1NBHA 5J2UF 1NP7A 2RGRA 4DT1B 4ZC1A 4CHTA 5AW2A 3NNNA 4GH5A 4X85A 3PE6A 1SCUB 3M2PA 1YL6A 4B3MB 3W6UA 1H2WA 1UXOA 2GSDA 3FI0A 4MQUA 2FKNA 2POCA 3UQYS 4X1KB 1J2EA 1A2BA 1VG0B 4OHPA 4ALMA 3A4LA 5FIUA 3C6KA 2R1TB 1HA3A 3M82A 3DMNA 2FFQA 3G8BA 4HB2A 4ZD6A 4CFYA 4CJXA 3GIDA 4LQCA 4C2UA 3EVTA 4Z3OA 2QR5A 1CF2O 3CUKA 2E4VA 2OFOA 4EG3A 1R3DA 1EFRA 1MOQA 5CFLA 2Q5OA 3IVGA 4O6VA 1HV8A 5FBQB 4AURA 3WK7A 3PGLA 4Q7EA 421PA 5I9LA 5TXGA 3QX3A 2QP3A 3GGGA 2H1IA 3FF4A 5TT0A 1RWBA 4CV0A 4MQEA 4BOYA 1P7WA 2XRMA 2WF5A 5D1HA 1SQSA 3GARA 5FOSA 2OV3A 2Z4RA 2XWBF 3JQFC 3BIFA 5CLQA 5AKZA 1E6UA 2X9NA 2ZIEA 4XEHA 4EW6A 1MAVA 1ZGCA 1MTOA 2H29A 4L0MA 5TQ0A 2HNKA 4G63A 1YZKA 5E38A 1OXBB 2G1JA 2XGGA 3FDFA 4F7DA 3M6MD 3CY6A 4MCAA 1P80A 1Z0ZA 1XAGA 4IIFA 5JEEA 3SHTA 4WNCA 1R88A 1EX6A 1VDZA 1Q77A 2E48A 4FGSA 4GQAA 5FTJA 1N0HA 3KU1A 3CPSA 3AB7A 1YVPA 1COWD 4CL0A 1I2MA 4LF4B 3JAWA 3I30X 2I4LA 3IPRA 3GCGA 1YA4A 2GZAA 2QQ0A 2QX4A 4OJQA 1FW8A 4PZ9A 2Q5QA 2DGDA 3HB5X 4I8XA 3TKAA 2ZXUA 1FSPA 3NM4A 3O8BA 5CVUA 3P9IA 4IFTA 1W35A 4U7DA 1ZVMA 4ILEA 1VSBA 4DMCA 1NZDA 2H1HA 4ZYUA 5FNVF 1UK6A 2ZYGA 1PL0A 3ZXXA 3BMCA 4U5QA 1L5ZA 4Z1MD 4I9FA 1DIRA 3DWIA 3T3EA 4QBFA 1E2PA 4Q6BA 2J08A 3W2HA 1HDIA 2NSLA 2X77A 2FEWB 3R3ZA 2BCEA 3Q6MA 4PYKA 3VVLA 2GPNA 2EJTA 5ER6A 4EGAA 3Q8WA 4GXTA 1JQ3A 1E62A 4L0QA 1U8AA 1I3KA 1XVVA 4DNFA 3FF1A 3L0IB 3TM4A 4MWZA 1KORA 1P2BA 1W4ZA 4RPGA 4D4JA 3DTTA 2F4VB 1LV8A 2XE4A 3WLSA 5HOEA 1KSFX 3O9MA 2G88A 2VJKA 3HB1A 3LTEA 4U2CA 1F2TB 4NBWA 1M7HA 4ME6A 2IXFA 3PXBA 2VZ8A 2VUHB 4J0EA 1WRBA 3ELDA 4HAVA 4Q4AA 1U0GA 2JA1A 2PD6A 1UMDA 1PT5A 3KJNA 5JXWA 3Q7PA 1GUAA 4MQBA 5KREA 2BUAA 1PD1A 2ZAMA 2ZSDA 2PS3A 4JLMA 4QUIA 2BMWA 2XCTB 1QNLA 2DUJA 2JGMA 1KETA 1PJZA 3EXHC 4BNVA 4J4TA 1DRVA 4Y1GA 2XYVA 1FYXA 3WGUA 2BBWA 1Q20A 3AL0C 2WKWA 1Z2EA 2XX3A 4OKNA 3SZUA 3RJZA 2ZB2A 2A5JA 3F96A 1YOVA 3Q5DA 5LIRA 1MGPA 4YCNA 1X86B 2XXBA 2ZI9A 1R10A 4BBZA 3IB6A 1WBBA 5TPWB 4LTMA 4TV8A 3N7AA 3CVXA 1T9GS 1LEHA 2VEDA 1S2OA 3PDJA 3JSXA 4OIFA 1G59A 2PYZA 2R68A 4E7PA 1G6HA 5AM4A 5TS3A 1CZNA 4HN2A 2A88A 4GPEA 1QH1A 1YRBA 1N1MA 4BDSA 1Z08A 2NAPA 3OECA 1U3TA 4P9NA 1M5RA 1FC0A 4CMEC 2BTQB 2VK1A 1RVDA 3F7TA 1KVSA 1M2KA 2QD4A 4R2XA 5BSWA 4GEGA 3OX4A 2OE2A 2PMKA 3M0EA 1KDZA 1J9ZA 1KQOA 3E8SA 1OVGA 5LP6B 2DHCA 4MWGA 3DEAA 3G0OA 1CZLA 2HXYA 3DLIA 3PXXA 3CVVA 2QSYA 2VIIA 3JPYA 3SAJA 5H4GA 3H5VA 4BP8A 4XUGB 1C0PA 3CO5A 3H7IA 4MPRA 2AFIA 4UTVA 2D1RA 3AU8A 2F9LA 5DMXA 1ZD8A 4KTTE 5C0OE 2VQEB 3N53A 3VMFA 2WE7A 3QEMB 2ZUVA 3HVKA 4KBFA 1PGNA 4MKIA 4MI3A 2ECOA 4IGKA 1XYGA 3B48A 2OHJA 3UWSA 1TM2A 1KI7A 1HNWB 3CLRD 3JARB 3SQMA 1U3DA 2IU3A 3EZXA 1ZH8A 4YMSA 1XQ9A 5BSVA