1Z0FA

Gdp-bound rab14 gtpase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
167
structure length
167
Chain Sequence
b'NYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB14, member RAS oncogene family
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 58
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0fA01
5FTLA 5JCZA 4ACAA 1W36C 2MMCA 3P1JA 2FF7A 4LY6A 1CR2A 1GTVA 1E1RA 2RGBA 1L8QA 4BFZA 1NY5A 1R2QA 2IWRA 2IF0A 1C4OA 1SQ5A 3AKDA 1AN0A 4QC2A 2AK2A 4Q1EA 2OBMA 1XTJA 4N0EA 4M1SA 4OI1A 1P2VA 1E2KA 3G5UA 1XPRA 4N3NA 1NJFA 1NF3A 3CWZA 4MUAA 4TLBA 3QSYA 1FP7A 5JMTA 1HUQA 1KSGA 3FHCB 3B1VA 2F1HA 1Z8FA 2GHIA 3LQRA 2R6GA 1CJVC 5FBWB 2C95A 2WAXA 3TSWA 3GLHA 2F1IA 4QGFA 3W6PA 4URVR 2JLZA 4K46A 5JEEA 4Q4HA 2NMVA 1PJRA 4PHTA 5FOUA 2ZI4A 3HPRA 3VR4A 4B2PA 3DKVA 4XWAA 3G0HA 3AF2A 1RRCA 4TMZA 2HF9A 4F7WA 5KPJA 1WCV1 1II9A 2RGDA 3TSOA 4PQRA 3GLIA 1G3MA 4A8JC 1G7RA 3B82A 1HH4A 4TYYA 2Z83A 1X8KA 2YOFA 2H16A 2DY1A 8OHMA 1KO7A 3EAQA 2CBZA 4LK2A 2QMUA 1GNPA 1ZNYA 4M9ZA 2GBLC 4Q5IA 4GP6A 4EFLA 4OHVA 4G5GA 2A5FA 4MQBA 3ZQ6A 4FCVA 4DLTA 1QVRA 1G41A 1AIPA 1KI7A 2QG6A 5IK2A 3HDTA 1OHHD 1TU4A 2N42A 3SR0A 3L8YA 3KJIA 1CS4C 2OXRA 2W6ID 4Z1MA 4HEJA 2JLWA 2Q3MA 3TKLA 3MSXA 3U3RA 2IA5A 4A6XA 3QG1A 2X2FA 2FFBA 4MRNA 2L0XA 2B21A 3CR8A 3AUYA 2V6IA 2VL7A 1E79A 4LHYA 4QNMA 4B73A 3IGFA 5JRZA 2XZLA 2PJZA 5BN3A 2FNAA 4EPRA 1KDPA 4PTLA 3VMFA 3WP0A 4YC7A 4V0MA 3UMSA 3AVVA 3U44A 5G53C 1KK0A 4C2UA 2OFWA 3DVLA 4IOJA 1M7GA 2KBEA 4FMDB 1F2TA 4ZO4A 3MG9A 2J0QA 1K5GA 2ZU0C 4C4PA 2ZVQX 2FV8A 1G3IA 4CEIA 2WSSA 5DHFA 1LS6A 1VG8A 4HUTA 3A1VA 4TQAA 3BFKA 1ANKA 2P67A 2GXUA 2OCPA 4MKIA 3OHMA 2VBCA 2BMFA 1A2KC 1KTVA 1X3SA 3LXRA 4TSFD 5DN6A 1G5TA 3LW8A 3T34A 4I4LA 3VU9B 3L0SA 1UKYA 2PL3A 4L8GA 2DFNA 3NBYC 2JLYA 3TNFA 1G3RA 4PC1A 1T3LA 2AWOA 5B2ZA 3SNHA 3THXA 1NNEA 3BD9A 2J1LA 4A8JA 5KSOA 1U90A 2IS4A 5FUVA 3W34A 4TTPA 2Z4RA 2FG5A 4DCVA 4QJ4A 5CB8A 4C3ZA 3IIMA 2GBLA 3PIRA 2QNRA 2OV2A 1GRQA 3C14C 3U3KA 5L3QB 3EPLA 1EXMA 4L15A 1G291 5CITA 3I8SA 3RABA 2YYZA 2PZEA 3W6NA 3AVYA 5FL7A 4QHYA 3S1AB 3ADBA 1ZYUA 5F3WB 3QUSA 2XNDA 2ZRHA 3D3QA 2Z6VA 3QKRA 3RS4A 4D0GA 5KSPA 1Z6GA 2PLFA 1IN6A 1YR6A 5E3HA 1KI6A 4NL4H 4L5BA 2FFAA 5LD2B 5IRCD 3R9IA 1FL9A 2AD5A 2QUZA 2ZE7A 4U02A 4DDVA 5E7MA 4BLPA 4TQUS 1GWNA 1SXJD 2EW1A 5H8WA 1G6OA 1SVKA 4A36A 3PUWA 1DOAA 2DPXA 2IYZA 1AS0A 4EIWA 5KHOC 2CJWA 3NHAA 2OUKA 2LKDA 4PSVA 1XWIA 1E9FA 3D6TB 2C04A 3TAUA 5JI2E 1KK1A 2K5UA 4J0QA 4XH9B 3R9WA 4PAMA 3V4FA 1GP2A 2ZE6A 5AUPB 3SEAA 3SJZA 1CLUA 3FTQA 5AUQA 1YZNA 3EWSA 1ZRHA 2O8EB 1ZM4A 2CCGA 1A7JA 1XP8A 1YRBA 2G83A 2C8VA 4JLVA 4M0LA 4OI0A 4NU0A 1P9WA 4M1YA 1ESNA 5C2JB 5CLLA 3REGA 2J41A 4G0NA 5AJZA 3PXGA 4D81A 2AKYA 3B1YA 1EFTA 3L0OA 2B7CA 3CW2A 1OT3A 3K1JA 4Q1CA 3CX7A 3BB4A 2UZIR 3DOFA 4L16A 2FSGA 1KJWA 4Q9HA 1DO2A 3KUDA 3ZGXA 2IYWA 5HR5A 2ASEA 1HT2E 1Q20A 4BRWA 1E2IA 5D3QA 1LF0A 1N6LA 3A58B 5JJIA 4QJ5A 2IYQA 4ARZA 2WVJA 2YOHA 3W5JA 1E2NA 1F3OA 1R8SA 4US0R 3ADKA 3LO5A 3O47A 1LNZA 2R2AA 2VP6A 2P6NA 1M7HA 1E98A 4FMBB 1OB2A 4FN5A 2ERYA 3KXKA 2GAAA 4YMSA 1E0AA 3DMNA 5GVRA 2YVUA 3B9PA 3C4JA 4GOXA 4Q1DA 1OXSC 2QAGC 5C4GB 3CNLA 2NPFA 4C7OA 1LFDB 2QTFA 4KVAA 4Q66C 3TUZC 1DEKA 4X8OA 2WOOA 2WSSD 1N6NA 4BLQA 2QM7A 1KMQA 1DAIA 5IDVA 1FX0B 4JLAA 1ZU5A 3UG7A 1IY2A 3U6KA 3Q7PA 2BEKA 3U7GA 1E2EA 3K9HA 2ODBA 5FUWA 3RANA 1G9XA 2ZROA 4D26A 4C0SA 3HYTA 2VA8A 1XTQA 2VP0A 2YNMA 2IW3A 4GPTA 4TN1A 2H5EA 1XBTA 2ONKA 2YWEA 2G6BA 1EFRA 2OFXA 3FGNA 2OBLA 4QBGB 2RCNA 4EJSB 5IT5A 1TU3A 2OG2A 1YE8A 1R7RA 1CIPA 2CNWA 3W8RA 3GLHE 3ONWA 4W9MC 1IXSB 5EZ5A 3IBGA 4QHSA 3A1SA 4II7A 4M8NE 4DDWA 5CK4A 2FE4A 1IY0A 2ZQ5A 2H7VA 2XJ4A 4EUNA 3HJNA 3RAPR 4OQNA 2KJQA 3MAAC 4JMPA 5J4HA 3FB4A 4A6PA 2B8TA 4CEJB 5FL7D 1T9HA 1UBFA 4PPGA 1OJLA 2JA1A 4C0AC 5HPYB 2ZRPA 3NG1A 3PG5A 2BIFA 2Q3HA 5JHGB 2IBMA 3LAWA 3NC1C 3AV0B 4KJZA 3C8UA 2GJKA 1JQLB 1CU1A 3GFPA 4UJ5A 3FMFA 4KAXA 3E1SA 1H65A 1D9ZA 2E1RA 2ZJBA 4ZPXA 2KWIA 1L4UA 3BB3A 4BZXA 5JS7A 5H70A 4ACBA 1S0UA 1EX6A 1IBRA 3QKSA 4B47A 5EE1A 3CM0A 4ON9A 5KUTA 1M6NA 3UG6A 5B64A 4HLCA 1ETUA 3TQFA 4MYTA 1P6XA 4Q02A 2VSFA 4JVMA 4EPWA 4FINA 4UNSA 3CB4A 4QM7A 2QAGA 4DEYA 1U0LA 3BGWA 1UBEA 2QZ4A 3SS8A 2P5SA 2QPTA 4PHFA 3TSZA 3ZZTA 3K70B 3GJXC 3H84A 2ZJOA 4V0ME 3EXAA 5CK5A 1E9EA 4LYFA 4BRUA 4NYJR 4Q9IA 1XNJA 1U8AA 2OXCA 1DO0A 3QIAA 5BYJA 1JJVA 1ZCBA 2IS6A 1NKTA 2O8BB 2XXAB 4LV8B 2H18A 4US2R 1P3JA 1YKSA 1DE0A 5JJKA 1DVRA 4Q4AB 3BBPA 3EWAA 4KFUA 2IUTA 5EE3A 2RH5A 2YINC 2F3TA 3HPQA 5A4JA 1OXTA 1ZC4A 4JLMA 1ZM2A 2F43A 4LV5B 5EJEA 1TUIA 2W0SA 1NJGA 4HB2A 1ELOA 1HE8B 1K8RA 2GESA 3SQXA 1GITA 4TYWA 2IS2A 2EU8A 3FFAA 2DFLA 3VHLB 4LHWA 2REXB 4RKFA 3Q5EA 2AFHE 4UQOA 4HUQB 1VCNA 4PR0A 4PAOA 3RWOA 4YMWA 1TX4B 2XZPA 3JZMA 3FHOA 1E2HA 1S3GA 4FMCF 4DT1B 3GFTA 3P26A 1OKKD 1IXZA 1TNDA 3EA0A 3AKEA 4UNNA 2IT1A 2PX0A 1NMXA 4TWZA 1GKYA 4U00A 4F4CA 1ZAKA 4ITRC 4FWTA 1MT0A 4WIAA 2FOLA 2V54A 4PC6A 5A5GA 3GQBA 3TQCA 1G7CA 4U5XA 2ZI6A 1YZKA 2PMDA 3T1VA 4DCUA 4P32A 2WBLC 4DLWA 2J9RA 3KX2A 3PVSA 3T5DA 2RGCA 2EWWA 2A5DA 4CGZA 2CNWD 421PA 3CNOA 3SU8A 4ESHA 2J87A 1SKQA 3TGPA 2NPIA 1FMLA 1G8GA 2HUPA 3BH7A 4JYCA 2C96A 4DB2A 1NG1A 1X8LA 1L4YA 2FZLA 2GKSA 2ORIA 3BERA 3RRYA 1T5LA 4WA7A 4RFSA 1J90A 4DLVA 1KSJA 3AH8A 4DRZA 1XTKA 1RRPA 3THWB 1HV8A 4AIIA 2UKDA 121PA 4DSUA 3WRYC 2KSQA 4RZ2A 3VNUA 3J81k 1Z47A 2R6FA 1GL6A 4B2IA 3C5CA 1S4QA 3K0CC 2OAQ1 3B13B 5FUYA 4E5UA 4BFUA 3RS2A 2BJVA 3RS7A 2CHVA 3EZ9A 2ZRJA 4MKFA 3W90A 2ZRBA 2ZRKA 4EAQA 2V1UA 4TMXA 2GNOA 2QL6A 1VECA 4KLNA 4OL0A 1XD2A 2ZYTX 1KDOA 3QPWA 2ZRDA 5SZJA 1SXJB 3DDCA 3LBHA 3X1WA 4BE7B 1CTQA 1Z6YA 1VMAA 1WQ1R 1Z0DA 2BM1A 4C30A 1CKEA 1R8QA 1D2NA 1XEXA 3ADCA 2ZREA 4JL6A 1E4YA 3SN6A 4QKQA 5FI0B 2V7QA 4N0DA 1PUJA 2VP5A 5BN4A 2ZRIA 4QBFA 1RW4A 2G1JA 3AP1A 1L2TA 2VSXA 2AK3A 2ZYVX 5AUOB 2CE7A 5G3YA 3QKTA 1Z0IA 4LX0A 5F98A 3UMFA 3P4YA 3U61B 3KKMA 4BZQA 4NP6A 3QOFA 2H57A 3MUFA 2YWGA 4R2IA 4AKHA 5JSZA 4BEBA 3LA6A 5FBLB 4KFTA 1HA3A 1OXUA 3KFVA 1S8FA 1ZVQA 3TLXA 5KU1A 1FW6A 1NG9A 4D4LA 4Q7KA 1NRJB 2FEOA 3JZAA 5IF9A 1ZD9A 4MKGA 1DAKA 2C9CA 2IK8A 1N25A 1PLLA 4DEXA 1DAGA 2VEDA 4OQMA 4YXWA 4V0KA 4BASA 3BFXA 5JI3E 3LX5A 2AKAB 4TLEA 1NN5A 3PEYA 3LH5A 1N5KA 2ERXA 2JIZD 2GXAA 3MJRA 1SKYB 2GAOA 2QP4A 4O0MA 4YQFA 2NO9A 4KV9A 1E3MA 2R9VA 3U7HB 5KDOA 4FWIB 1LY1A 4TMKA 3TAHA 2IL1A 4HSEA 3I1FA 3W3ZB 3K0CA 4MRRA 1KI4A 2J0VA 3MGCA 1CJTC 1XXHB 3TUJC 1R0ZA 4OJQA 4CT4B 3A8TA 4HYYA 1BIFA 2BEJA 5KPDA 4DDTA 1N6KA 1M2OB 1K6MA 1X8JA 2IYVA 3FMOB 1WA5A 4B3BA 4XJXA 2RAPA 1KAGA 1T8TA 2HXSA 1UBGA 4UNPA 1XMSA 4URWR 2OBNA 1YZUA 2F55A 2WWXA 2QBYA 1Z08A 1VCOA 5EP1A 2O8BA 4PPNA 2P2LA 3ZH9B 2VPPA 3SQWA 4P31A 2HV8A 1W0KA 2ZAMA 5KNCA 2FDCA 1GNQA 1Z2AA 5EQTA 3KKNA 4MKHA 2B8WA 2OILA 1W5TA 1P7CA 2OLJA 4D2IA 1IAQA 5H68A 3VR6A 4FXPA 2WHXA 4KO8A 5CYOA 1UJ2A 1CR4A 1P62B 2XSZD 2B92A 2BKEA 4MRSA 1M7BA 3WYGA 1VPLA 4MRVA 2CHQA 3RS0A 3AUXA 2C9OA 1KJZA 1NBMD 1NI3A 4GP7A 4B33A 3AP3A 4YMTA 1IONA 1A4RA 5FBRB 5KYKA 2QT1A 3ZVLA 2WPDA 1KZ7B 2C5LA 2JAQA 1MO3A 2NG1A 3UXMA 4PX9A 1JR3D 1ZCAA 2JJ2D 3B1WA 4HUQA 1N6PA 3F5FA 3CZPA 1TTTA 2ORVA 1X6VA 3SBDA 3NXSA 3R7WB 3GPLA 4NCIA 2XTZA 5BW8A 4IRUB 2IF2A 4PQYA 2AL7A 3KZ1E 5JS8A 1UKZA 3BE4A 4NH0A 3QXJA 1CBUA 4FI3C 3EC2A 4BFWA 4AI6A 3IQWA 5JZVA 5AJWA 5K8IA 2ZR0A 1GILA 4B32A 2JGNA 1Z6AA 4RZXA 1PLKA 2VQSA 3U3OA 4MYUA 1KSHA 3A6PC 2REOA 1G6HA 3TVTA 3QXSA 1ZUIA 1US8B 4IDPA 4JZKA 4ZIRA 3CZQA 1UBCA 2BDTA 4UKDA 1CJKC 5KDLA 1YR8A 3ZVRA 4A0RA 2V9PA 3SHWA 4PZZA 1TEVA 3EASA 4NHOA 1XU4A 1HEIA 4A4DA 2F9MA 3RVBA 3K8YA 4R7ZA 1OH7A 3RDPA 1NVWQ 1E2QA 3VTKA 2GCOB 1II8A 4OKSA 4Q7JB 2RGAA 5CDFA 3OEEA 4Y0VA 1XFAA 2VO1A 5AWFC 3VFDA 2PT5A 3EIQA 3AM1A 1P4SA 4A2QA 1KDRA 1VCIA 5DHAA 3EX7C 3OESA 5FH9A 3WBKA 4Q4JB 5G3ZA 4WZ6A 1MRSA 1TEXA 2XTNA 4JSTA 1SVWA 1GSIA 4RD1A 4IOMA 4OHZA 1VYUA 3LBIA 1R10A 2ZE5A 3NEYA 4JBYA 2PZGA 2FWRA 4H1VA 3TBKA 2MSEB 3CRVA 4S35A 1AS2A 3A36A 3VNVA 3RC8A 1ZUHA 3GLFB 1OH6A 1AKEA 1EG7A 1KI8A 2CK3A 3IHWA 4RD6A 2CLDX 3TW8B 4D4JA 2IC5A 2YV5A 2JJ1A 5E4FA 4HB4A 1ZD8A 4LI0A 4Q01A 2WKRA 4W7SA 2AHOA 2HF8A 2WSMA 3LVRE 1GFIA 5CLQA 1W0JA 4X8HA 2BV3A 2EFCB 3CWQA 6Q21A 4QGHA 1P61B 1AGPA 1WMSA 4MYCA 2IEYA 3K9LA 4BLTA 3N2IA 3UWOA 1TQDA 2EWVA 2R6AA 5K8LA 2JCSA 4KODA 4B3DA 1OXVA 2HT1A 2ZJAA 4TL8A 5DE3A 4B34A 2BCGY 3Q8XB 4LDJA 4OI4A 1DS6A 1NLZA 4CIDA 4DHEA 4IVQA 1XMIA 4C0JA 5FL3A 3T1TA 4CEHB 3AVWA 721PA 1W4CA 1NBME 3UK6A 5L3SA 1IHUA 2WMNB 4M2LA 1FPMA 3JVVA 2DWPA 2QPAA 1G8YA 3KTAB 4KFSA 3L2OB 3B78A 4IW3B 4MGYR 1RE0A 1W0KD 4JS0A 4DSOA 5AK0A 1HYQA 1JR3E 2BMJA 4OI2A 3ZIAA 2VRWA 2QE7D 4R98A 2KI5A 4I1UA 1TUEA 2IXEA 3NH6A 4L9WA 3CLVA 3VKWA 3DPUA 2ZYUX 4HATA 5C46F 2XGJA 2P5TB 3I4LA 4M1MA 2WJGA 3QXCA 3CUEF 3VR3A 2J7KA 1KIMA 1P2TA 3NDBB 5BWMA 3CF2A 2OO7A 1JNYA 1XJQA 2BOVA 3UMRA 3QI2A 5KNBA 2YHSA 3A4NA 1VIAA 4Y0AA 1LB1B 3LW7A 2PX3A 2J0UB 1J8YF 2WWHA 1JPJA 3EPKA 4NYIR 2ATXA 2BBTA 3PCRB 2J45A 1JJ7A 1F5NA 2BHRA 2FFQA 3T1OA 1KK2A 1KI3A 4IDHA 2BC9A 4OQFA 1U2RA 1F2UB 4GMDA 4BFVA 5FFMA 1ZJ6A 1WBDA 2XTMA 2X77A 3EZ2A 1R0YA 4X8MA 5CM8B 5B57C 2IWHA 3PJRA 4B76A 1CJUC 2QA5A 1JR6A 1RVDA 5DI3A 1HY3A 4GNKA 1AM4D 1MH1A 4B6FA 3ICQB 1IN4A 2A5JA 2BMDA 4V02A 1VHLA 3U3MA 1CR0A 4JYBA 1E1RD 2CCJA 2V4ZA 4A82A 1S9HA 3LXXA 3K53A 1C9KA 5HTKA 5J47A 3OE7A 3GLGE 2G9NA 3I62A 2Z4SA 3AF1A 3IPXA 4UNQA 2P6RA 4YLGA 1RIFA 2ANBA 1RJ9A 1RZ3A 3BAFA 4LRWA 1WBBA 5AR1A 2QI9C 1E9DA 4ERNA 4ZI3A 1QHHB 3P20A 3CX8A 1JBKA 1T0HB 3UKDA 4QM6A 5K8TA 3DMDA 3LV8A 1BOFA 4TLAA 4PZYA 5E7IA 3Q5DA 3P4XA 1IOZA 3RSOA 1ZIPA 2FEMA 3PQCA 3OEED 1E9AA 2QRNA 1FQJA 4PSAA 1E94E 3RSLA 4EFNA 3I61A 1E69A 2JDIA 3QF4A 5J5CA 2N1BA 5B58C 2ZRGA 1KAOA 4JBXA 3THOA 2O8FB 3PITA 4JVSB 4MRPA 2H1LA 5SZHB 4HI0E 2VHCA 4P0TA 3B6EA 1DAFA 3B8HA 2VHUA 4XWKA 4F4JA 4CZ2A 1G19A 2OT3B 3K0FA 5DISB 3DO6A 1F48A 1FNNA 2C9YA 2F7SA 5DO9A 2HYDA 3R7WA 4Q19A 2EYQA 3AQ4A 1I4TD 3AGQA 3OAAA 2CK3D 4DLRA 4H9GA 3WMGA 3HP1A 2B6HA 5HKKA 4LJYA 4QL3A 5SZIA 4EDHA 1BYUA 1NSFA 4MDFA 5KSZA 1UAAA 1DPFA 1W0JD 4K81B 4TLCA 3X1YA 2FU5C 1P72A 4C9BA 5IK2D 1E0SA 4JKYA 3LBNA 3DM9B 1TQ2A 4IXMA 2D7CA 1DBSA 4JL8A 2IXFA 4XD7A 1JB1A 2NO1A 2XITA 5CIWA 4NMMA 4Z1MD 2VYFA 2XAUA 4PHHA 4BECA 4OK5A 4QXAA 4DUGA 5AJVB 4JKIA 3KXIA 4GZMA 3K0AB 1R6BX 3OIWA 3ND8A 4OQXA 1E79D 2R62A 4RD3A 1SZPA 4D25A 1W36D 1JXOA 4PQFA 1UM8A 1XJCA 3SYLA 4HAUA 4C0LA 4ABYA 4FMDF 2CCKA 2ZI3A 5F2EA 2BMEA 1G5RA 4OHXA 1VG1A 5CJ2A 4DLXA 3DM5A 2O8CB 4GDFA 1FTNA 3QEJA 1KDTA 5LPNA 3I73A 1MV5A 5DGXA 2ZJ5A 4NCNA 1AK2A 1G20E 3BS4A 4A1FA 4LBWA 5JCPA 5LDDC 4M1OA 3CONA 3VX4A 5FTNA 1P2SA 4IVPA 1SVSA 3LLUA 2WWGA 2ZJ2A 4YDHB 3EPJA 3KDSE 1Z29A 4G5RA 5J4KA 3MJHA 3RNLA 2J3EA 1IN7A 4IFEA 5DN6D 2Z43A 1JECA 3AB3A 4JSYA 1YU9A 1JI0A 3VX3A 5J4YA 4TYQA 1JALA 1ZM9A 2IYUA 4P4SB 1JQJC 2OCBA 3RS3A 4DLYA 1FUKA 3L8ZA 1LTQA 2E9SA 4C0KA 5FTMA 1ONBA 3SJBA 2RHMA 3W5IA 4R71A 3GJ5A 1W4RA 4G1UC 4FD2A 1RC8A 2E87A 2GJAA 4D4KA 4I1OA 1KI2A 4LPKA 3KUCA 5LD2C 4HDCA 1KOFA 4GT1A 3GJ7A 4CW7A 5KOYA 2CE2X 2X2EA 1G8FA 3TMKA 4LPSA 3Q9LA 1G1MA 3C7KA 1TADA 3KTAA 3WHLA 3WNDA 3TR0A 1T5IA 3W6OA 3OE7D 1II0A 2ODNA 3FYHA 4ZDWA 2G0TA 1Q57A 5EXPA 4NYMQ 3GLIE 1Q1EA 2JLQA 4NCJA 3U5ZB 2ZTSA 2C78A 2XNDD 4XOIA 5FBQB 1N2CE 2HEIA 2HCJB 1G8PA 2OZEA 1IY1A 2AR7A 3A4LA 4QHTA 3SC3A 1BMFA 3PUYA 4RFVA 4EFMA 1SULA 2R6CA 5E95A 2NGRA 5JLJA 3KJHA 2V3CC 1T3SA 4HB3A 1E2JA 2ZPTX 3NVAA 3IO5A 4OBEA 2XOKA 4PO1A 3W8NA 2LCFA 3EZ6A 3LY5A 4F92B 4ZKDA 4M4SA 1H8EA 4ZCIA 2JASA 2F3RA 3KQLA 3VU9A 1F2UA 1E9RA 2WKPA 1MKYA 1P5ZB 4LJ4A 4RKEA 1KI9A 1ZINA 2CVHA 3K09C 4ILEA 1R4AA 4V0NA 5AJYA 4AYTA 1GNRA 3QEOA 4OYHA 1D9XA 1W4AA 2X1VA 4DIDA 5GADl 1KGDA 4KHZA 2X19A 5HKKD 4NPHA 3U4QB 2OSBA 1W47A 3FVQA 4WZBE 5M04A 1E2DA 1OH8A 3I72A 1BS1A 4G5OA 4JT2A 1ZUNB 2HJVA 2ZJZA 3IPYA 1T4GA 2FMXA 4M9SA 4QBHA 4TLDA 3REFA 2DB3A 2O8DB 2GF0A 1Q3HA 1E4VA 2VLIA 1W48A 2ODWA 1ODFA 1SVMA 2JLRA 4DLUA 1J8MF 5H1YA 4DKXA 2WJJA 3B7GA 4C0HA 4LYHA 2GZDA 3DEFA 3HU3A 2WJHA 4HDQB 4XD7D 1KSFX 3QENA 4KLZA 3WP1B 1M74A 1R0XA 1UEJA 3IEUA 3ZD7A 1XTSA 3WXMA 3S1AA 4CF7A 2HLDA 3PUZA 5GJVC 4B48A 4BEJA 1T91A 1WXQA 3EARA 1HT1E 4P4UA 1RRGA 3V9PA 1Z2CA 1N0WA 2OEPA 2P6UA 2RGXA 4XWOA 4AY2A 2BWJA 4GL2A 5EE5B 2FGJA 4JJKA 4QJ3A 2IYSA 4CDGA 1QHIA 2PMKA 4LJ9A 3O8DA 2ZSAA 3CF6R 1I4LD 5C1BA 1EWRA 2Q9BA 2ZS7A 2NZ8A 4BQSA 1XD9A 2OE2A 2O8FA 4JLNA 1XMVA 2ZETA 4EJSC 4F91B 4LYJA 4O2LA 2JLUA 1GM5A 4IEIA 3MWLA 1EFUA 3AEZA 1MO6A 3RWMB 1SGWA 1J2JA 2ZSDA 4ESVA 1OFTA 1U81A 4JT4A 1CULC 3N70A 3NWJA 1AZTA 1HQYE 3M1IA 5HZHA 1W49A 2O8EA 2VF8A 4M21A 2AWNA 2A30A 2J7PA 2BBWA 5HZKA 5EUQB 1Q12A 1H8HA 1HQCA 1SVIA 1WRBA 2Q9AA 2X8AA 2QQ0A 3IUYA 4GOJA 4PC2A 1MO4A 5JEDA 1COWA 3I32A 4YMVA 5FTKA 2NTYC 1JEEA 3IBYA 4XVUA 1EFRD 1Z83A 5F9HA 3CPJB 5J4LA 4EQ6B 3KFXA 5C4MA 2UZ3A 1TAGA 3AP2A 1XPOA 4KSBA 3W3AA 3K09A 1CR1A 4B35A 2KE5A 1FTSA 1RYFA 3BB1A 1MABB 2ZR7A 2ONJA 4ZCLA 5FPHA 1Z0JA 2W58A 3RLFA 2GWHA 1ZW6A 1HE1C 3B1ZA 3HR7A 2FSFA 4B43A 2O52A 3MMPA 2CL0X 2VHTA 2ZANA 2R6DA 3Q85A 3NIBA 4DDUA 2G77B 3M4YA 1UFQA 1FNMA 2FPKA 2EFEB 2WWYA 4A0HA 1X86B 3B9QA 3ADDA 3KQKA 2HDNB 2VP9A 1UDXA 5P21A 4MGZR 3CH5A 1AZSC 1S9DA 1R0WA 4Q47A 4IXNA 4B74A 1Z0AA 3QBVA 1DAMA 3GLHB 3K70C 3RRNA 2ZI7A 4DLZA 2DFKB 1OH5A 2IYLD 1ZBDA 4TL9A 5HE9A 4KYUA 4Q4HB 1KO8A 3CF0A 1FX0A 1NVVQ 4HB0A 4MA4A 4EPTA 3SHFA 2XOKD 4JLJA 5EP3A 2QEQA 3SFZA 3CBQA 3BIFA 2A9KA 1Z63A 3KQNA 1H8ED 4ZKEA 2ZRMA 3DZ8A 1R5OA 2PEZA 1A1VA 2ZRAA 1D8TA 1OFUX 4Q7LA 1FMJA 4P4SA 3AF0A 4EJSA 1ZMXA 1G17A 1NN1A 4LBVA 2Y8EA 4ZCMA 3R9XA 4IOLA 3DOEA 4AYXA 2GZAA 4BGDA 4E22A 1J7KA 3N5CA 2OM2A 1UF9A 3SYKA 1XTIA 4DBLC 4EPXA 4CYMA 1SHZA 1G7SA 4LHXA 4LCBA 3U7EB 5K8UA 1U0JA 2XB2A 3OIVA 3GD7A 4KFRA 1E2FA 4DB4A 2C77A 2D2FA 4CEJA 3IO3A 1MR3F 1IJEA 4POAA 1NLYA 2AXPA 4H1UA 2HLDD 3QG5A 3U2QA 2O0JA 3CPHA 5EE0A 4BLRA 1PV4A 3QJYA 1X1SA 3E5HA 3V00A 1A5TA 4HAVA 1DTSA 2ZSBA 1E9SA 5IHPA 2P65A 2GXQA 3A4MA 1OFHA 3FMPB 2IS1A 2GDJA 4M1TA 4NCKA 3WYAA 2I1VB 3OFNA 1MRNA 3AF3A 3X1ZA 3O8CA 3SYNA 1P75A 5HCNA 4P4TA 4M53A 5LB2A 3GJ8A 2CL6X 1AQUA 3D8BA 3PEUA 1KNXA 3U44B 3CNNA 2UVQA 4BWYA 2ZIAA 3T06B 1MOZA 2ZE8A 5DYGA 4IEEA 1OIVA 4O2RA 2OCAA 3H0KA 1Z22A 2FJUA 3QBTA 3ASZA 5FOTA 2ZR9A 3QY0A 3PUVA 2FFHA 2ZS9A 3D7MA 2EFGA 2I3BA 4LJ7A 4QOSA 2BBSA 5DNYB 2W6JA 4CEIB 1AJEA 2RB4A 4RD2A 2ZSFA 2PEYA 3H4MA 2W00A 3MRSA 3U6BA 2QGNA 4MDEA 3MFYA 4Q7MB 1E9CA 4V0LA 4XIGS 1Z6XA 3OEHA 3CKLA 1FFHA 1VKJA 2J7PD 1W44A 1KY2A 3IKJA 4XSGA 3VR1A 5F9FA 4HLDA 4RSGA 1GVNB 4E07A 2WZQA 2DYKA 1ZM3A 1E32A 2Q0HA 3H86A 3I5XA 3GJ0A 1XDBA 2J46A 2XXAA 1NL3A 1T6NA 1VHTA 2F6RA 2WWWA 3B5JA 3RS5A 3PEWA 3U7FB 1LVGA 2WIBA 3MWKA 1P2UA 4UXJA 4Q4AA 5JRJA 2JLXA 2DR3A 4BFTA 1Y63A 3THXB 2H17A 3FHTA 5FPTA 3GJ3A 4JL5A 2W6IA 1KI1A 3R20A 3HU2A 3B85A 4A8JB 4ZDIA 4A15A 1KYIA 3FE2A 5D3MB 3QPUA 4ZDJA 4G3XA 5JWOA 2ZEJA 1XZQA 3RRMA 4MUBA 2QMEA 5FPYA 1KO5A 1CEEA 4FCTA 1QG2A 2D62A 2EFDB 4MGIR 2BVNA 1P9RA 1SXJC 3GFOA 4IKEA 2ZSEA 3EZ7A 1FUUA 2HJGA 3ZZ0A 2D06A 2GRJA 1M8PA 4B3FX 3ZVNA 4AURA 2ANCA 3N2EA 4B71A 4BZPA 3WMFA 2VHJA 2A5GA 3NBFA 4I1VA 3H1TA 5EZ6B 1E96A 5FR2A 1W1WA 2CHGA 1YZLA 2WV9A 4N1AA 1O3YA 2J0SA 1U0HC 1KI6B 2GA8A 4XVQA 4DT1A 1Z5ZA 4A0GA 1QHSA 1JXMA 2NOAA 3TJZA 1QHGA 1S96A 4GRAA 3P27A 1R5BA 4BPBA 2PH1A 4ZDKA 2D7DA 1LS1A 1NN0A 3WNBA 4O25A 3KXLA 3UIEA 3AVQA 2NO6A 4Q48A 4E03A 1KKMA 1EX7A 4TSFA 3FMIA 4DCTA 2CJWB 3BC1A 3EIHA 4O3MA 2V7QD 4AG6A 4EQ6A 2IHBA 2FZ4A 4F38A 4URZR 4NBSA 621PA 1Z0KA 1KY3A 5BXQC 1GKIA 4CRWB 5UKDA 2W2VA 4GMXA 3TR5A 1I2MA 1MABA 1Q1QA 3RHFA 4AC9A 1E2MA 2CEAA 3VKGA 2YOGA 5BQ5A 4URYR 3ZS9A 4IDNA 2Q3FA 2RKOA 3AGPA 2OFOA 3PV0A 3THWA 3UATA 3FWYA 1G8HA 1ZM7A 3L43A 1CRPA 5ANRB 2QP9X 1EFHA 4HDOB 1FP6A 3T15A 4OQLA 2QM8A 1GRNA 2GJ9A 4IFBA 2VP4A 5GVSA 4DSNA 1Q44A 1EWQA 3PR1A 1EK0A 2D4HA 4NYJQ 3LQQA 3WBJA 4YXWD 4KYIB 1UPTA 4L4UA 1TL7C 2RMKA 3OFND 5C18A 4IDQA 3ZQJA 2QROA 3L0PA 4B6EA 4ARZB 4D82A 2YZ2A 3WHKA 4Q9LA 1RYHA 1BO6A 3IEVA 2CLSA 3UPUA 3SJCA 4AKGA 1SXJA 1G3UA 2EFHB 2ZRLA 5EE9A 4KCGA 3K9GA 3OIUA 1OYWA 3UANA 2V6JA 1P60A 3F3YA 2A78A 3LFUA 1XTRA 1TQ6A 4MYHA 4C7OB 4LOAA 2W6JD 5J4VA 4Q1FA 3AVPA 4P33A 1RRFA 2NZJA 2RGEA 3E2IA 4M9QA 2WWFA 1N6IA 3GEHA 4PFSA 4CVNA 4D4MA 1XEWX 3WNCA 2FA9A 3OEHD 3K70D 4WZAE 1PZNA 5FTJA 1DG3A 4BLOA 4DCNA 1YZQA 1SHKA 4LHVA 3EIEA 5FOSA 3FOZA 1PVOA 1B23P 2IUUA 3LX8A 1ZU4A 4KVGA 1S1MA 2QP3A 2FPMA 4U7DA 2JEOA 1Z6TA 4X8LA 4GOKA 1T0JB 2GVZC 4V0OA 3WY9A 4AKIA 2ZUCA 1QG4A 2IXGA 2XX3A 2ZUBA 4HZUB 3SI7A 3TW4A 3ICEA 1G3QA 1W4BA 3I8XA 5KTYA 1DAHA 3Q72A 4A0FA 4AYWA 1E2GA 1N5JA 1HURA 1TPZA 2ZJ8A 1D2MA 3OIYA 3ZD6A 2O0HA 4IJMA 1YRAA 3EW9A 1WF3A 4TQ9A 2DCUA 5GJCA 3R8CA 5JWHA 4WVFA 3A1UA 1YZGA 2ZRCA 4HLQB 4TTQA 3B60A 1Z07A 1WDTA 2ZXUA 2I1QA 3C41J 3PENA 4BFSA 3A37A 1EGAA 2R65A 4JLOA 3ZLJA 3M0EA 4RZ3A 4F4IA 3C15C 1JEDA 2WPDD 1PLJA 4GI7A 4D80A 1NMYA 3LRPA 1Q0UA 4RCYA 1I4DD 3NBXX 2MMGA 4HAZA 4TT3A 1XMJA 1YJ5A 4TMVA 1XRJA 3KB1A 2GEUA 3GCGA 3OF5A 1VTKA 4Q1BA 2ZM5A 4EPVA 3ZDQA 1U99A 2ODEA 1XXHA 4LC1A 2GF9A 4PANA 1SVOA 2KBFA 1AA9A 3BORA 3GEIA 2GVDC 1O87A 2AD1A 2V55B 4Z8YA 4K8OA 4YONB 4DVGA 2EQBA 2P0EA 2BBOA 3ZS8A 3QKSB 2FSHA 4YDSA 4LJ5A 1GKUB 2AFIE 2QPOA 3CIOA 4JLPA 2NO7A 1DELA 2R8RA 4QGAA 3JVUA 4TTRA 4AG5A 1E0JA 4DC9A 5KDDA 2F1RA 4JVNA 2QENA 1CF4A 3Q3JB 4RY2A 3ASYA 1ZC3A 3CPEA 3ZVMA 2FPLA 2PBRA 2AN9A 1N6HA 1KO4A 3EC1A 5DIFA 2QAGB 4Q18A 3AKCA 1XCGB 1ZNXA 1ZNZA 4JLBA 3X1DA 2ZVPX 3F0TA 2WIAA 2IHYA 2IX3A 2ZRNA 5D3MA 5SZKB 5TVKA 3BFVA 4PZLA 1VG9B 1OYYA 4I99A 1XF9A 2GK6A 2H92A 2QN6A 1DARA 3THYB 1ZIOA 3TRFA 4W5JA 3SZRA 2YJTD 1GG2A 2W0MA 5L3RA 1NVVR 1TF5A 3LVQE 3A1WA 2DWOA 4WBSA 3MWYW 1XCPA 1QRAA 2ZJYA 1K5DA 4XTRA 2Z0MA 4QGGA 4IHQA 2W2TA 821PA 5FPSA 4R9UC 2CL7X 3A1TA 2KB0A 3EA5A 4E09A 1G7TA 2OHFA 2F43B 1KJYA 2QRZA 1OPXA 2D74A 4HAWA 4Q1AA 2OESA 5JWRA 3RYTC 2JATA 2GXSA 2JJ1D 1KMHB 5CJPA 1Z3IX 3HU1A 3GP8A 1DADA 4CT5A 2JJ8A 4QG7A 2C2HA 2W83A 3HR8A 3KKOA 4Q00A 5G40A 2O0KA 5J40A 1WE2A 2QT0A 5JFGA 3FPAA 3NBZC 3NKVA 1DAEA 1US8A 4D6PA 2HYIC 2AXNA 4LJ8A 3TE6A 1MO5A 3X1XA 3QVUA 4D0LB 4WXPA 1N0UA 4LYAA 3PEVA 2QORA 1CXZA 2B7BA 5BN5A 2FX3A 1LF5A 5DYIA 2ZU6A 1W5SA 2WOJA 2GCOA 5FBVB 3ZIAD 2YWHA 3MCAA 3LNCA 3VKHA 4TL7A 1GAJA 4JLDA 2YC4C 2ZYWX 1W2HA 2XZOA 1NVUQ 1GUAA 1KHTA 4Q4JA 4PO8A 3BH6A 1GZSA 4US1R 2QSYA 2QTHA 2OLKA 4RFSB 2G3YA 2ZI9A 2IEZA 2A5YB 2H8KA 3CR7A 4AWXA 4DXAA 3DL0A 3GLFA 2HCBA 5DH9A 4AK9A 4DZZA 4M9XA 2VHQA 2CXXA 4Q9JA 5AUNB 1UDWA 2FN4A 5TDHA 1IJFA 1OLOA 2GCPA 3WRXC 4TT3D 2Q9CA 2ZAOA 2ORWA 3QXHA 1W2GA 4KITB 2G1KA 1E6CA 4RD0A 5AJXA 3K0SA 5EXSA 3VQTA 3AVTA 2A2ZA 1G21E 4GBMA 3MLEA 2DWQA 1XD2B 1P73A 2GEVA 1OKKA 1NIPA 1S1CA 2PZFA 3H2YA 5TMPA 1FOEB 1Q1ZA 4S2EA 1J99A 4CEHA 1E2PA 5CDFE 1QVAA 4FMCB 2VH5R 3IIJA 4P3YA 4HAYA 3BOSA 3IIKA 1VCMA 3F8TA 1TMKA 1G16A 1QF9A 1V5WA 3TIFA 2WJYA 2WM9B 2YC2C 2ZUDA 5CIQA 3W9YA 2RGGA 1XEXB 1OXXK 4HZUA 3VR5A 3KQHA 2CVFA 1NLFA 2NIPA 4FIDA 3VHXA 4Z54A 4NONA 1A82A 4R2HA 2BCJQ 1QHYA 4BUJA 3I3SR 1GRRA 1NIJA 1VYTA 1OF1A 3BH0A 1BH2A 1GL7A 1XEFA 1D5CA 4LC0A 5DSZA 4WXRA 5ELXA 2J59A 3BWDD 4LJ6A 1SXJE 4HAXA 1WP9A 1D2EA 1GIAA 3G82C 2JDID 2QQEA 5JSZB 4NCHA 4NZYA 2J0UA 4JVLA 4LWZA 2VF7A 4LHZA 5BYKA 4WOPA 3KQUA 3AVOA 3O8BA 2PLRA 3Q7QA 1RPZA 1KK3A 2QMHA 4B3CA 4DWJA 4XVRA 3GLGB 1XX6A 1YHNA 4M1WA 2BKUA 2EVWX 1CJMA 4UJ3A 1ESMA 4Q9KA 1TF7A 2PCLA 3AKYA 5TY0A 1V43A 2ZI5A 3HWSA 3OAAD 1Z06A 5KSYA 5GJBA 3VR2A 1XD8A 4IOKA 3U60B 3IDQA 5L8VA 1OV4A 1Z28A 2D3WA 2WJVA 3E70C 3RC3A 2J5XA 4ASUA 1A2BA 4TYPA 2A3RA 1U9IC 3ND9A 3QVVA 4FCWA 1VIYA 1XJ0A 2GTPA 3GJ6A 1VYVA 3GJ4A 2QU8A 2V8OA 4YMUA 1YQTA 5GJWC 1RFLA 5FPKA 1DG1G 2OCYC 1W46A 5HE8A 3KKPA 2IYYA 1T3HA 4DUGD 2PT7A 1IXRC 4PXAA 3MD0A 4TZ0A 3CRQA 3DKPA 1NKSA 4Q21A 1CRQA 2C98A 4UXHA 1QHNA 1QHHA 1SVLA 2F9LA 2QMOA 2YWFA 4WW0A 4OK3A 4I1SA 3WMEA 3EPHA 3U3JA 4ZV4A 1TQ4A 4C2TA 1QDEA 5JBQA 4RZUA 3NH9A 1M34E 2QBYB 1SKYE 3THYA 1OW3B 1E2LA 3QKUA 1AS3A 2OAP1 4RJLA 4DLSA 2G88A 1E99A 3ZJYA 2XB4A 1OIXA 4LUCA 3VAAA 3M6AA 4FW9A 2GETA 4QBIA 1XXHE 2DFTA 3FDIA 1BYIA 2QTVB 2VP2A 4KBGA 2XNSA 3AVUA 1NY6A 3X2SA 3FKSA 3IILA 4NE2A 1Y3AA 1KNQA 3OZXA 3SE0A 3NHBA 2WWIA 4W5WA 5L3VA 4TYNA 2FSIA 3L0IB 1Q3TA 2G0NA 1KMHA 3CO5A 1LW7A 4JBWA 1KO1A 4UXIA 1ZD1A 3TUIC 2TMKA 1I2DA 1QZXA 2JIZA 3DZDA 4JJZA 2GJ8A 4W5HA 3AF4A 2WTUA 4TZ6A 3KJGA 4M22A 4BLSA 4OK6A 3IHLA 1QHXA 5JHHB 3C16C 3SFVA 3KJEA 1E0KA 2I4IA 4LBYA 2LWIA 1OB5A 2VSOA 4L9SA 1UEIA 3SOPA 3K0AA 4NYIQ 4OJKA 4DCSA 3T35A 3O8RA 3BK7A 3HYRA 3QXXA 3BRWD 2W2XA 4JIMA 1U8YA 4AD8A 2C99A 1D6JA 5JJLA 1NN3A 1U9IA 2ZRFA 4A9AA 4QNRA 2C03A 3P32A 4RD4A 2GILA 1CP2A 4JLKA 4NDZA 1Z0FA 1S3SA 2QAJA 3NEJA 3SJAA 4ZIRB 2QGZA 3FKQA 3CRMA 2PCJA 1P9NA 3ETLA 4QFMA 1G5PA 2O8CA 3CX6A 4D0NA 2IYXA 1NMZA 1BMFD 4URUR 1FQKA 1VG0B 5TXGA 2XSZA 4KI0A 1GL9B 3I5YA 2ATVA 4PAQA 1II8B 2AX4A 4TL6A 5FI1B 1JAHA 2WKQA 1NBMA 2R44A 1E1QA 1GDDA 1U98A 5CYPA 4BFYA 1XEWY 3QNUA 5EP4A 1YR9A 1IQPA 2XJ9A 4PPFA 3IQXA 5L3QA 3K0EA 1G18A 3NTUA 1HTWA 1JR3A 2GEDA 2XEXA 2JJ2A 4G01B 4A92A 4KBFA 1KZGB 3GLIB 1Q21A 3NC0C 4LV6A 4C0QC 2ZITA 4UNRA 4MITA 5EP2A 5DI9A 2GZHA 4B2LA 1ZNWA 1OFIA 2JLSA 4A2WA 3SBEA 2FGKA 4ASUD 1TF2A 4MH0R 1ZP6A 5LBIA 4V03A 4B44A 2NO0A 3T61A 1KKLA 5FUXA 3CH4B 4LZZA 1UADA 2HXYA 4OHYA 4LBZA 4HLUC 2ZS8A 1UKVY 4G5QA 4GFDA 3LLMA 4PPQA 3KKQA 1Q22A 2VTKA 1N0VC 2Q6TA 1XZPA 1IM2A 3EG5A 1RKBA 1VDZA 2RGNC 4QRHA 2Z5FA 3GLFE 5L3SB 3QPVA 4HZIA 2RHDA 1AKYA 2GJSA 4Q4LA 4GZLA 3K9NA 1W36B 2WJIA 4PC3A 4EPYA 2N46A 2QY9A 1YZTA 3SDZA 3R8FA 2P3SA 4ZI2A 5TB5A 1YR7A 1N3BA 5CM9C 4KSCA 1N5IA 3QF7A 1U8ZA 4LGMA 3CRRA 5HCIA 1B0UA 4DSTA 1S2MA 2YKGA 1AQYA 4NTZA 4M1KA 1XPUA 1W7AA 1EFCA 2WMOB 2BM0A 1IN5A 3I92A 4Z51A 1F2TB 2A7QA 5EUMA 3BXZA 3GLGA 3MWJA 2LKCA 1G4AE 4B75A 3FKSD 4AKEA 1F60A 2VIIA 3CRW1 3LDAA 4KU4A 1XCMA 2V1XA 2NQ2C 3LWNA 4A2PA 221PA 2Q21A 1L7VC 5G41A 3T5GA 1PUIA 1T8UA 3QE0A 4GSYA 2WAYA 1JAIA 3U4QA 2WICA 1H8HD 1OE0A 1C1YA 3L82B 4NKRA 4URXR 2O8DA 1J70A 2EYUA 3ZZUA 1COWD 5KNDA 5EXTA 3FFBA 4DIEA 2MSCB 3RRZA 4PSKA 3V4RA 2QSZA 5FR1A 5FOVA 2REBA 3T12A 4TMTA 3KL4A 521PA 1N6RA 3GMTA 1OHHA 5JECA 1BKDR 1FZQA 2CMKA 4Z8XA 3UWKA 1R5NA 4RCZA 2F1JA 4IVRA 1N6OA 4PC7A 2CDNA 5DI3B 4TMWA 4B3GA 1X1RA 5FOXA 4XSHA 3T1QA 1M1YE 5TARA 1LV7A 1XB2A 1OIWA 3GEEA 4IDOA 4PO9A 2GK7A 2IYRA 5E7JA 4BFXA 1Q1BA 1JPNA 3QQ5A 2IUSA 4XTCS 3BJIC 2D2EA 5B30A 4I81A 2ECKA 3ECCA 2O5VA 4RVCA 3WYFA 2SHKA 2QE7A 2MSDB 5KO2A 5FOWA 4HLUA 1AGRA 4LSGA 1NP6A 1G4UR 1RJ9B 3TK1A 2FH5B 5A0FA 3QKRB 4PHGA 1N5LA 3B1XA 4LJAA 5TV2A 5CB6A 1EESA 5LB4A 1E9BA 1U94A 2RGNA 3KB2A 3B2EA 4KXFB 4F93B 1UKEA 1G64A 4G5SA 1E1QD 3D31A 2DBYA 2GCNA 4WAUA 2JLVA 3EZFA 4B3XA 1WB9A 1NSTA 4C0BA 3QF4B 4DJTA 1QBKC 5DLQC 3TVDA 3TH5A 2BJWA 4Q03A 2DHRA 5EXXA 4OHWA 1IN8A 1YVDA 1NVXQ 3AVXA 2PJRA 4MGKR 4EKDA 3C5HA 3DHWC 3PFIA 3PUXA 3K0FB 1F6BA 1GOTA 3NDPA 3LD9A 2IYTA 3ZYCA 2HT6A 4NYMR 2CLCX 1OSNA
chains in the Genus database with same CATH superfamily
5H82A 5IFKA 2PUBA 4IDFA 1WMDA 2VLBA 4ZK2A 3P1JA 5LNK1 1CR2A 1RQLA 3C8MA 5EEHA 3R7DA 2HK8A 1L8QA 4HDMA 4MPTA 3T7IA 3ZCSA 1D09A 1FFEA 1OT5A 3AKDA 3ZV3A 1RKXA 3KLPX 4QC2A 1GA1A 1O94C 1T2DA 3MUEA 4XLTA 3GFBA 3GK3A 2XZTA 2QUAA 2F3UA 1U3FA 1GSOA 3E5NA 2W7TA 1P2VA 3M33A 4OXNA 4ZO7A 4YRIA 2QLJA 3HBFA 1PJ8A 4HAIA 2RBEA 4DNOA 2FWBA 3A1EA 3CLHA 1HUQA 1UXGA 4R31A 1GNVA 1GGVA 4CLOB 4F85A 5IZCA 1Q50A 3NX4A 1IQUA 1G1AA 1Z8FA 2GHIA 1T4CB 2XV1A 1C3EA 3VPXA 2R6GA 3BMOA 3IQEA 2HLNA 4RWZA 4ER5A 2Z8XA 3GLHA 3M8KA 3UT0A 3FYCA 1UM9A 2Z04A 3W6PA 4N9QA 1NRIA 3AUTA 3DP9A 4K1LA 4Q4HA 1PX2A 4BZZA 4PHTA 1O6BA 3DKVA 4QOEA 4XWAA 5K8JB 3LPLA 4K9MA 2DHCA 5I8ZA 4IICA 3W5VA 3G0HA 4RS4A 2QLFA 4MQFB 4KQGA 3EDOA 1MPXA 5C3UA 4IIJA 4I50F 1JDTA 2NSLA 4BO9A 2E7ZA 2LV8A 2HF9A 1WCV1 4QOGA 2WTXA 2AH5A 4BE9A 2YQ4A 4A8JC 4YUZA 3B7WA 2HLPA 1HH4A 3R5TA 5DCUA 1NI4B 1SXHA 1LBEA 2AHRA 4QE3A 4TMFA 3KZCA 3ER8A 5IYZF 1O08A 2ZPAA 1MOPA 3DZHA 3HBAA 1GNPA 2XYVA 4M8SA 3FD8A 1UWKA 4AQYB 2VK4A 5B7QA 4X1YA 2XUFA 4GP6A 4B6RA 3MJ4A 4EFLA 5TRTA 3DMHA 3H6HA 1ISIA 5CIWA 3NHYA 4MVWA 3H3FA 1G41A 2QTMA 1AIPA 3IUNA 1DRVA 4QREA 3TN7A 1GPBA 1Z12A 4GM4A 3VJLA 2ZB4A 4AMBA 3I9JA 1QV6A 4MRMB 5CPBA 1RWXA 5TQVA 3T9BA 4LXXA 2AMLA 2OXRA 4PVCA 3CX4A 4YFVA 2UYQA 3GZJA 4Z1MA 2CMHA 4KPYA 3KZNA 5E8JA 4A6XA 1VM6A 3OX3A 5DGIA 4MRNA 5KWSA 2BLLA 1KL7A 2GCIA 3CR8A 4Y9TA 2VPQA 2UV8A 4C4AA 4LHYA 3PP8A 1EAMA 5EN4A 3I2JA 1T1RA 3IGFA 4XPZA 2X0EA 3ROZA 1N1DA 1J2EA 2FNAA 4FYXA 5I9NA 3TSCA 2WHPB 1XN4A 4X3CA 2BEUA 2Q07A 1E1YA 3VMFA 3JQAD 3AJ9A 3WL8A 3U44A 4CV1A 3KJZA 3I4CA 5G53C 4AMVA 5FD8A 5ALOA 2WF7A 2OFWA 3DVLA 3LQFA 1M7GA 4FMDB 4ARUA 2ZIGA 3V6MA 1ZRNA 1J0XO 3DL7A 4KAJA 2J0QA 2ZVQX 1NXOA 4XQ0A 4CEIA 1S02A 1VE3A 4BNIA 4PE5B 2WSSA 3H5TA 1VG8A 3A1VA 3IODA 1USKA 4E5KA 4M8LA 5C9ZA 1PRYA 1QBGA 2GXUA 1F6WA 1KC1A 2X9GA 3I2GA 1LKZA 3KQOA 1EQ2A 1DXYA 1X3SA 3LXRA 2RHCA 1JYFA 1G5TA 4G25A 5DN6A 4BMXA 1DCFA 3LW8A 1PJBA 4G67A 4LVOA 4I4LA 3UAOA 2V7WA 2QTWB 2QMQA 3L0SA 1R0RE 2PL3A 2YCBA 1QK4A 4L8GA 5CB4A 1UKBA 1JEYA 2JLYA 3TNFA 4PC1A 5J2UF 2O54A 4KKVA 2H0RA 1HDIA 2H08A 2ZTHA 5PNTA 4EB6B 4EP1A 4J4BA 3BD9A 2QVLA 3P2IA 5KSOA 2X58A 5FUVA 1KKUA 3UY4A 3NUQA 2CV2A 2JK1A 3NBAA 3ZOKA 4P54A 3G0DA 3IVGA 3VJMA 3R3XA 5F2OA 4C3ZA 3IIMA 5IVKA 1DT3A 3PIRA 2P9GA 3L1KA 2ZYAA 2ZIFA 1GRQA 3KQYA 4JUIA 3EPLA 5AVRA 1EA5A 2H4XA 1Y5MA 3L7LA 1DUIA 3PPXA 4LNHA 1V16B 4R16A 5GWXA 2YYZA 3CEPB 1JJFA 3W6NA 1FRVA 4QHYA 5K3AA 3T95A 1HNNA 2DUUA 3QUSA 4GKJB 2ZRHA 2X6QA 3RS4A 1ACMA 4CODB 4YACA 1EE2A 2PLFA 5F21A 3T38A 1SRRA 2HSDA 2FFAA 5DYNA 2Q27A 5DP1A 5B37A 1FE8A 4AJJA 5IRCD 5LD2B 3ZNOA 3PQEA 2VDWA 3R9IA 2AD5A 2QUZA 2ZE7A 5B6IA 1EB8A 4UUPA 2YY7A 3JARA 3NVDA 4GG1A 1HG1A 1YF3A 3CTPA 1WSAA 2X40A 1V48A 4RHXA 1Q6YA 2YNMC 4OF4A 5DM0A 1KEZA 1TOAA 3FPCA 1JDNA 2J9FB 3HCPA 3KT8A 3R23A 4HEA6 4KGVA 1JAYA 4OHOA 4P5PA 4WKPA 3RF6A 2DPXA 2YRFA 2XCSB 2HOQA 2IYZA 3IJPA 1UOOA 5KHOC 4B5LA 1QIKA 1H4VB 2LKDA 2DHQA 1E9FA 4W5OA 4O0LA 5T6BA 1HBJA 1D07A 5HKLA 1KK1A 2K5UA 1U3CA 3GNLA 2XQJA 4PAMA 4YEDA 3LX6A 3R9WA 4IFIA 2WG1A 4MQ4A 4RZHA 3FTQA 1I5RA 1V4VA 2A0YA 1YZNA 4O4IB 3Q8LA 1ZRHA 1YRBA 3DF7A 3LY8A 2CYCA 3P0EA 4OI0A 2Q1XA 3KUKA 3LBFA 4NU0A 2X8JA 1P9WA 4XJTA 1MJHA 1EGVB 2IXBA 2PXHA 4RJKA 3H1EA 2W6ZA 5CLLA 2J41A 1V8DA 4G0NA 3ND7A 1VP9A 5AJZA 3JYNA 4FSDA 2AKYA 2Y6UA 1EFTA 4UM5A 2WTBA 2ROQA 4J1TA 2VPWA 3R6DA 1U4NA 2G70A 4ND4A 3H97A 1NONA 1WV0A 2G4VA 1NXWA 3CX7A 1V96A 2UZIR 5AKHA 5J59A 2Q3CA 2B4RO 3DOFA 3EXHB 2FSGA 4JELA 1MJGA 4J03A 4L16A 2QUIA 3KUDA 3KDPA 2BD0A 1N7IA 2W2PA 4XX0B 2ASEA 5KCMA 4EOGA 1TTTA 1HT2E 1TKCA 1Q20A 4XQGA 4CQMA 4TKVA 3ANLA 1E2IA 2XF2A 3NYQA 5D3QA 3AVTA 4HBZA 1P1KA 1YDHA 3IAS1 1NFRA 3CSUA 5IEBA 5E6UA 5TC4A 3OQOA 1N6LA 4J3NA 4HT3B 3DC2A 1Z6ZA 3WDKA 4MDHA 2WVJA 2PDAA 3SBOA 4US0R 1R8SA 4BY9E 3ADKA 2D5IA 5LP6F 1QZUA 2UYYA 3B5IA 1ADFA 1R37A 2BKAA 1HSOA 2FRDC 3LO5A 3FOCA 3O47A 3PPYA 3QE4A 1K9SA 1E98A 1M7HA 3O1IC 1SMKA 2LGJA 3C24A 3HB1A 5TF4A 4JI4B 2EHJA 5G0UA 2H0AA 1NUUA 4LRQA 1OXSC 2C5AA 3CNLA 4C7OA 4KVAA 4Q66C 3ODGA 2WOOA 3LG2A 1F1BA 4E5DA 4AMUA 4ZGWA 1OX4B 3EVAA 5IDVA 4JLAA 3U6KA 3UG7A 1ODLA 3WGKA 5A04A 3Q7PA 2BEKA 3ZTTA 5I01A 1MAHA 5FUWA 5KINB 1A3CA 2ORED 2Z09A 3E48A 1YRHA 3ER6A 3GELA 1XTQA 4DA7A 3ZVKA 3GGGA 1OU4A 3KZKA 3SHTA 4Z86A 4OYLA 1I7PA 4G1CA 2H5EA 1XBTA 4ZFNA 1T8PA 1Y8CA 3AW9A 1U9JA 4R9SA 3EQ7A 1XDDA 1EE9A 2O23A 2C8LA 2RCNA 2RH8A 2B4YA 2OG2A 2CNWA 2PA0A 3NFYA 3IPRA 3B1KA 5CXXA 1CEYA 1MZVA 4QYIA 4XGQA 1JQAA 2DUNA 1TDJA 3OOHA 4II7A 5TE9A 4H35A 1QFXA 1ZN9A 3TTXA 1SU8A 3EMVA 1A4XA 3T3PB 4A6DA 3A28A 3ZH2A 4MO9A 3TLMA 2OAEA 1M2KA 3FR8A 2I2XB 4I36A 1J6UA 2H7VA 2XJ4A 4J49A 3HJNA 1H2HA 3N0WA 3N9IA 5LZ5A 3RAPR 4I5GA 1V71A 3MAAC 3RJTA 4D41A 4DYDA 2AFIB 4XYLA 4ZMSA 3HN2A 4YMLA 5BN1A 3PQ4A 2FZ5A 1T9HA 4P34A 1BGXT 4PPGA 1OJLA 5KZMB 4A8TA 3NG1A 4G1EB 2H8GA 1OLXA 4LC9A 3K6SA 1UR5A 1TW2A 5TS2A 3E8MA 5JHGB 3LAWA 3NC1C 3DUWA 4JYPA 4UJ5A 4DJ5X 3ZWDA 2FYTA 4D7AA 1MLDA 1H65A 3DV0A 5A4AA 2ZJBA 4AZ0A 1JG2A 5FWNA 4BV8A 4KRYA 2GM9A 1CUFA 4KZKA 3IR7A 1SELA 4OBBA 1N7JA 3S8YA 4IGIA 1YVPA 1WPXA 4KPGA 1LSOA 3B48A 4WY5A 3K1ZA 3JR3A 2IV7A 2ZIXB 4R54A 5IDYA 1ID8A 2DECA 3W1EA 1TB4A 5JZMA 3PDIA 4E5MA 5KUTA 4IG4A 2YTZA 5B64A 3TECE 3V7NA 3K6RA 4Z4EA 1IEWA 4HWOA 2VSFA 4JVMA 1QCDA 3WGVA 2I54A 4Y1RA 2YMLA 4I1IA 2DSTA 2ZTUA 1ZUWA 4YPFA 2PUDA 3ZHZA 4OLJA 4DEYA 4OLHA 3BGWA 2P0AA 5BSUA 4YCAA 3SS8A 1PT7A 3OWXA 4QYXA 4MARA 1Z6PA 3GYBA 3SBXA 3V97A 2JCXA 2R1TB 4GPEA 4F4FA 1TO2E 1W5BA 3EXAA 3KPYA 5LN1A 3S81A 1E4EB 3WWCA 5B7NA 1U8AA 2DLDA 5I9IA 4GPAA 3Q5GA 2ESRA 2J9ZB 3GJZA 4LV8B 3VC2A 5C4IA 4LRTB 1P3JA 1YKSA 1D2RA 3ND6A 1WY7A 1DE0A 1KYXA 5A05A 1DVRA 1CUBA 4Q4AB 4IUBS 3FMGA 4YR7A 5LQCA 1T13A 1Y7HA 2WABA 4AJPA 4TWAA 2Q2WA 2XCUA 3DOJA 4K9RA 2WM8A 1XNRB 3ER9A 3NIWA 3HJUA 2RH5A 3L7OA 2XBUA 4R8KA 3TCXB 1NYQA 2FSUA 2QTRA 4OHPA 2F43A 3H83A 4GMFA 4E4TA 4LV5B 5MF6A 2HRCA 3FFWA 5EMMA 5EJEA 2BISA 1JZSA 4HB2A 4DWWA 3RJMA 1GITA 1U0TA 4TN5A 1NV8A 3BZWA 2VI5A 1K98A 2DFLA 4X94A 3H0EA 1QJ4A 3QBDA 1GUDA 1O8CA 3QPAA 1JG3A 3ZY3A 5TVGA 3CT6A 2BFPA 3KSBC 1Z74A 1P33A 2G7MC 1GNSA 4PEVA 4Z9FA 2QD5A 3QE9Y 3AONB 4GLJA 2PQMA 4W99A 5I7SA 1EFPB 1JSLA 1UBTS 3V7UA 3AOEA 1LVUA 2LUOA 5EJ8A 1TX4B 2XZPA 1E2HA 1KETA 1EWTA 3IOCA 3HNPA 4AM8A 4JITA 4BLUA 1F06A 4ARCA 1QFMA 1IXZA 1QDUA 4G4SP 4KE9A 1H6DA 4UNNA 2AOWA 2A9QA 3I45A 4TWZA 1GKYA 1SXQA 4U00A 1ZAKA 4YMIA 4ITRC 4O4LF 3C4VA 4YP7A 4GGOA 4IS3A 2Z95A 4WIAA 3Q0IA 3GQBA 2YNMD 4L3VA 1ORWA 4PY2A 1Y33E 4E51A 2ZI6A 4DCUA 4P32A 1HYHA 4FFPA 3H05A 3HVJA 3KX2A 3MVEA 5GM1A 3RVOA 1VSBA 2A1UB 2RGCA 3RSHA 3LBAA 2PWAA 5D2CA 4CGZA 3HDQA 5K6TA 3GVPA 4RF4A 3AFGA 4K40A 3CNOA 1QO9A 3O4RA 1PWYE 1GZVA 5C8YF 3AC0A 3HB4X 2OD7A 3SU8A 4ESHA 5LZ2A 1AB5A 3T7CA 4JYCA 2HUPA 3FNRA 1D2GA 2QNBA 4UD2A 4UTXA 4KPFC 3D4PA 2FW6A 2ORIA 3D1JA 3GLRA 4FMPA 5AYVA 1FYDA 1P44A 1L4GA 4B3MB 4B4DA 3O7MA 1KSJA 1TC1A 3AH8A 4DRZA 4CTOA 1V9CA 2UZ0A 2HU8A 1SQ0A 3DUFB 1VPDA 1HV8A 1WUHS 4AIIA 2UKDA 1XPRA 5H7XA 5B1YA 3VNUA 4KMOA 1U3GA 2FMKA 3BMCB 4H6WA 5B6JA 4MRAA 4G81A 5A5DA 4CFZA 3B13B 3KS9A 1JQBA 4Y2GA 5FUYA 3N74A 3EDQA 3RS2A 3ZHQA 4OX9B 3HXQA 2JBHA 4GE3A 3F7TA 2ZRJA 1AF4A 1C4KA 2NXCA 2ZRKA 3GB9A 3P9SA 2OQ2A 3U3ZA 3TLZA 3SEFA 2HSEA 4TMXA 1PQUA 2EKBA 4J7AA 4OL0A 3LZDA 1XD2A 5A2GA 1YZYA 1I7NA 2R0QC 3L1JA 4KXXA 1JQEA 2JFBA 1QAOA 5AHKA 2ZRDA 3WK8A 2AF4C 3CLTC 1LLQA 2SNIE 4TTJA 1WXHA 1UP4A 1N2EA 1FP2A 1Z6YA 1Z0DA 3WLJA 2BM1A 4BEVA 1R8QA 3EAGA 3E9ZA 1V2HE 1PG5A 4GBGA 4XB6B 5AKIA 4YONB 4FONA 5LQUA 4F11A 3DCNA 1KHHA 5DULA 3WLMA 4YJGA 1EXVA 4RF2A 1AUXA 1PUJA 1FPQA 4KXQA 2I1LA 2K2WA 3OMLA 3C3EA 2XDWA 3TL2A 5LBTA 5I9LA 4CIAA 2CMGA 5AUOB 1M2WA 1S2DA 2CE7A 3MJSA 4F3YA 1Z0IA 4LX0A 1SA0B 3QQPA 2DTEA 1SU4A 1SUDA 3ENZA 3L18A 3ZIDA 1DB3A 3BIWA 4I55F 4FB5A 4F21A 1JEQB 3U31A 1V1RB 1YI0A 2FJPA 3LA6A 5DOZA 5TQ0B 4A5OA 1NA5A 1PGNA 4EHBA 1ZVQA 1J4AA 3A6ZA 2I22A 1SD5A 1T26A 2OENG 4HC4A 4Q7KA 4AW9A 1P80A 3FVVA 3AEKA 1CP3A 1V1JA 1VQ1A 3BL5A 4RIFA 4KR2A 1ZD9A 2ISQA 1F7VA 2C9CA 2IK8A 4TQGA 1G2QA 4BPRA 2W43A 3PJFA 4UFNA 1ONNA 5AI5A 3QGMA 1QU2A 3L8EA 4V0KA 1QIHA 2IRWA 4CM1A 4KTTE 4UASA 4X95A 3E82A 3UN1A 1I8TA 4TLEA 5M3BA 4YAJA 1CLEA 1E0DA 1XSEA 1M1UA 4P53A 1ODCA 2B0CA 4NZZA 1M34B 3C6QA 2A1TS 1EP2B 2NNLD 4ID3A 4YQFA 2QP4A 1TIBA 2NO9A 3IRVA 4KV9A 1EM8A 3FDFA 4FWIB 3L7NA 3E5RA 3BWYA 2H65A 5JVDB 4UUNA 4B09A 3K0CA 1MIOA 1JUDA 2J0VA 3CC8A 1CJTC 4LCEA 2OFFA 1NQTA 3DEHA 3P0JA 3A8TA 2DF8A 5DFAA 1OLSB 1MN6A 2Z58A 5EUBA 1FSSA 2BEJA 5KPDA 2E4ZA 1ZISA 3M4JA 5HF8A 2AA3A 5L7WA 1K6MA 2DQZA 3KIPA 4OLFA 3D8RA 5AXDA 4B3BA 2NTNA 3D4IA 2FUCA 5AMXA 5JUWA 2V7XA 2RAPA 3QY9A 4B0OA 1FMFA 2HXSA 3DMFA 4H59A 4ZT3A 1DT5A 1YZUA 3F3SA 4CFYA 3IBSA 3JATB 4TTTS 2F55A 2QBYA 5EP1A 3PC8A 3TLCA 4PPNA 4UM7A 5J2TF 3ZH9B 3LC0A 4KIWA 3ZWKA 3WYEA 4P31A 4YXFA 2G5TA 2VPXA 2BGRA 2ZAMA 1NAIA 1FJHA 1ZWKA 2EKPA 3ZY2A 4FGSA 2FF5A 2NVOA 4D97A 1PJ3A 3HZZA 4Q16A 1T4BA 1P7CA 4RK0A 3MS4A 1AO3A 4CM3A 5H68A 1HWYA 1VE6A 2VATA 5IAJA 3VR6A 4BJ1A 5HVNA 4F1WA 3G0IA 4KO8A 2BR5A 4MWBA 1BCSB 2CKDA 4REQA 3HL0A 1RS0A 1VCHA 4Y8VA 5DM2A 3EZGA 1CR4A 4G65A 1BW9A 3HSSA 3L02A 4P5DA 3RUDA 1ZQ1A 5F7XA 4MUGA 1TUBB 4DRXA 2ZG6A 4E12A 3AUXA 2VQ3A 1VMEA 2C9OA 1KJZA 2P35A 3FUVA 2QRPA 3JQBA 4RVDA 3EFOB 4UE3S 3ROMA 2OMKA 4BUZA 3ZW9A 1SBIA 2AN1A 1DV2A 5FBRB 1YFJA 2R4TA 3L40A 1YL5A 2QT1A 1T3GA 3P5SA 4X60A 1CY2A 1WCXA 1U04A 3AQIA 1Z8NA 3MJFA 2FSPA 4TTAA 4KFCA 1ZCAA 1NURA 2MOKA 2PK3A 2QT9A 3B1WA 4J7UA 4WADA 1A8IA 2E37A 4FKZA 1N6PA 3A9TA 1FDVA 1DP4A 2ORVA 3CZPA 3R5SA 2CFOA 4M76B 3DBLB 3LT4A 3IOBA 3OT4A 3HXKA 1G5QA 3KEFA 3TEMA 2Y05A 4NCIA 1AQNA 4BXOB 1TPYA 4N12A 1A7AA 2IF2A 1U0RA 2CDRA 1Y9JA 2VF5X 3E9DA 2AL7A 3B70A 1ZCZA 3E7FA 3W4JA 2GYUA 4ENQA 3LZCA 3IUJA 4WOKA 3L6DA 3THSA 2A7XA 4YROA 3W4KA 9ATCA 2YRXA 1C1HA 3N76A 4BFWA 4AI6A 1XALA 4K2HA 2AE1A 2FSVA 2ZR0A 4Y7DA 5ILQA 5K8IA 1GILA 2VQSA 3U3OA 3D8NA 1KSHA 3A6PC 2GD6A 3TS1A 1G38A 4QWWA 5DTQA 4L5JA 2GRAA 1EZZA 1G6HA 1WB4A 4DQXA 1C3OA 1JJIA 4UAVA 3QXSA 1US8B 1TTHA 2HGSA 4B3TB 3PC4A 4UDXX 5FKJA 3FPHA 3H17A 3JQFA 4BO4A 1W93A 2BDTA 3NBMA 3NDRA 4NFLA 4A0RA 2CSXA 2VJNA 1IULA 3DL4A 3EEYA 3SHWA 4ZZ3A 3AY0A 1ECGA 1K0FA 1TEVA 1G21A 1W4LA 1T8YA 3P52A 4AXXA 1J8DA 2NAPA 1HEIA 3JD1A 5BN5B 3K8YA 4R7ZA 1OH7A 2QR3A 1GCAA 1C9YA 1II8A 1Z7GA 2QVGA 1FS4A 4HOYA 3CKKA 5EWLB 7YASA 4O2AA 1OA1A 5CDFA 3CXRA 1XFAA 4FC7A 2PT5A 1TM7E 1TUGA 3AM1A 1P4SA 3EZXA 3VHLB 5DHAA 1QVVA 4F8JA 4Q4JB 2VSNA 5B1IA 5HG0A 1MRSA 1KIFA 3EN0A 2EIHA 3EHEA 2QSJA 2WJPA 3OPNA 4YR9A 3ZU6A 4IOMA 2IEGA 4OX9Y 2V7GA 1VYUA 1Z62A 3EXIA 1R10A 1A9XB 1V7QA 3TNYA 3D3EA 1V47A 1XZGA 3DDHA 2PZGA 2FWRA 1QB7A 1RHRA 5CFNA 3A36A 1VJTA 4NCAA 1N2CA 2HQ1A 5K0GA 3VNVA 1GPH1 3PDJA 1NLUA 3RC8A 1UBMS 3ONDA 5BY2A 1KI8A 1XQVA 5A4IS 2YV5A 3T94A 4EGJA 2AMFA 1NVTA 1WULS 3E3LA 4Q01A 2WKRA 1ZLXA 2NV2B 1G0OA 1NQXA 3UMBA 3CWQA 3FF1A 2C5HA 3H9BA 4QGHA 1QQTA 4Y1FA 3LM8A 2X9QA 5AQEA 3OURA 2CWDA 1TQDA 3RRJA 2EDAA 4C78A 4KODA 3OQ6A 2FSSA 1UBOS 2ZJAA 4TL8A 3A11A 5DBOA 5DE3A 1VSVA 4PS1A 3U62A 1TYEB 4LDJA 5B3KA 1DS6A 1V4NA 2Q8PA 4IVQA 1ZW1A 4OQEA 3OQNA 721PA 1T2UA 1GQQA 4EX7A 1NBME 2NYVA 2FPSA 2M6RA 4WBXC 1GZ6A 3CLTD 3ZCXA 3JVVA 5HX7A 1M2GA 3L2OB 4IGEA 2Q7XA 2PZLA 4BC0A 4F6CA 1W0KD 5K3DA 2BAGA 4WZBA 3D3KA 4O3FA 5CH8A 5H0IA 4D8TA 5K05A 2WLSA 2VRWA 4N0PA 1T4DA 1X9GA 4R98A 5CH5A 1NJ5A 4LQCA 2F48A 3OU6A 3W9UA 2DFVA 4FFBA 4MMYB 3QLUA 3CLVA 1T2EA 1KQFA 3DLHA 3DPUA 3IAEA 5AW2A 3MTIA 4OBXA 1IMJA 3UJ8A 4Y9SA 1B6RA 1N0IA 3VR3A 1KIMA 1P2TA 1LGYA 3IT1A 4EHHA 3N8GA 4OQYA 3RIMA 3CF2A 5LKAA 1JNYA 3NDBB 1XJQA 2BOVA 3ZV4A 4QARA 2VT7A 3QWBA 1VIAA 1RAHA 1M1YB 3VPDA 2YH2A 2CD7A 2PUFA 4FLFA 4P98A 3TZCA 5AKGA 1J8YF 1JPJA 1ZR4A 1CWUA 3HJTA 3VPSA 5EERA 3PCRB 4KQMA 5DCWA 1IMOA 1JJ7A 2FFQA 1BWQA 1Z16A 2R7LA 2YASA 4HEHA 3ZDFA 1QPZA 1K2VN 1KYZA 2BC9A 4P4LA 5A9TA 4EZEA 1NR5A 1PR9A 1J0CA 1F2UB 4BFVA 1XT6A 3ACDA 3CLRC 4S1NA 5C53B 1AKQA 1MJ5A 4BBPA 3EZ2A 3EQ9A 1R0YA 3VOTA 5IBQA 1QIMA 1NQUA 1W88A 2J4FA 3WQBA 3F46A 4C4RA 1JR6A 1HY3A 1H0HA 4GNKA 4J0DA 1MH1A 4UNIA 2IPNA 2BH2A 3OOEA 1AUOA 4MIKA 2XF8A 3PSAA 2A5JA 4UHJA 4EG7A 1WB6A 2BMDA 1VHLA 4V02A 2XCTB 5T8KA 2X7XA 4BIMA 1IBKB 3VOSA 3LXXA 2EIXA 3K4QA 4JUAA 4RTKA 1QV7A 2B99A 3K53A 4J16A 3SJUA 3ZE6A 1QUFA 1YKGA 5EL0A 2IJGX 5J47A 2XE4A 2YS7A 3AF1A 1Y48E 2C57A 3BTOA 3R75A 1RLMA 1K7FB 4FKBA 3ND5A 4FDUA 4GI3A 4FFWA 1E4OA 4Y98A 4I9FA 3A6GA 1FIUA 5AR1A 1ZH8A 2QI9C 3KOZA 3P0RA 2B34A 3K0BA 1W34A 2OECA 1H6BA 1G2OA 1QHHB 3A3YA 3B1FA 3KXDA 1T0HB 3HJGA 1KDZA 3U1TA 1X7HA 5BNZA 3GRPA 1E5TA 2XTAA 4OTZA 4TLAA 4XEUA 4KDCA 1BQ3A 4EF6A 2FWAA 3JQQA 3Q5DA 4KK3A 4JH0A 3PQCA 2QTNA 1EBUA 3SR4A 1PWXA 4KKXB 1JDJA 4I08A 3ZOZA 4MKZA 2EBHX 1OWOA 4I9GA 3RSLA 4W7HA 1DQPA 1V0JA 3QF4A 3GJSA 5DB4A 3E03A 2B2XA 4B4UA 2ZRGA 3THOA 1N77A 2IEBA 3P9YA 4IYJA 4L74A 1TEHA 3E61A 1PK7A 1M1XB 4CCYB 3SDSA 2WFLA 1MJFA 4XWKA 3GROA 3GNTA 4J9VA 1ULAA 4MUEA 3ZIUA 4DPMA 5EJ2A 1UPFA 2OT3B 3K0FA 1P0FA 5DISB 3WK4A 2F7SA 2C9YA 2PFGA 1ILEA 4C22A 4CIVA 4WK0B 4D4HA 1JR4A 1UC5B 4Q19A 3AQ4A 2JBWA 4DLRA 2QPLA 4H9GA 3EMDA 1E63A 1QG0A 3GBPA 1UT8A 3NORA 4PLTA 4ECAA 3IAAA 1EQAA 1GPWB 1CQPA 4OFZA 1RLTA 1VDMA 1DPFA 1W0JD 2F1OA 3C6ZA 4TLCA 5AKXA 2K6GA 1WXDA 3KVVA 3PNLA 3TOCA 2R8EA 1HMYA 1XZDA 3HY4A 2RH4A 3I04M 3AEUB 1PR0A 3LBNA 3Q3GE 3NKFA 4J4TA 4UU0A 3ZY4A 4BZWA 5C51B 3DM9B 4BNXA 1W5AA 4H7DA 1DBSA 2FN3A 4I8DA 1JB1A 3RJ5A 1MMFB 2QWXA 4ZQHA 4Z1MD 1QK5A 2VYFA 3E2MA 1M2VB 4I9UA 4YECA 3UMYA 4RDCA 4DR5B 5TGDA 3BK1A 1V8BA 2XYQA 1EDZA 3GFFA 4NNJA 2B30A 2RFLA 3ND8A 1JIJA 3OIWA 4OQXA 2ZYDA 4PGAA 2C29D 2R62A 2UDPA 2Z4TA 4LQDA 4NOKA 3SAJA 4YRMA 1JXOA 1PHRA 1XLTC 1XJCA 1LZKA 2CLHB 5C5IA 1J23A 2BKLA 4FMDF 4TTIA 3EK2A 3P96A 4GI1A 4BQPA 4DUGD 3NVKI 4ZJYA 3ELWA 4H60A 1LRKA 2IZ0A 2XNCA 3KWLA 1RXUA 4D74A 2QRHA 3P0HA 3FNIA 4FGZA 2PBFA 3BTSA 4YAUA 2Y1LA 4I66A 3AHGA 3VVCA 4DLXA 5A4DA 4AY6A 1RC0A 4GDFA 1SUCA 1XLUA 2BKVA 1M2JA 2Y2VA 4K9DA 2AOTA 1ZG3A 1NNUA 3I73A 1MV5A 4WCFA 3HGMA 2ZJ5A 4NCNA 1G20E 4Q6WA 1Q0QA 2RHRA 1PBTA 3OPMA 2ZWPA 4LBWA 4A1FA 4YJ2B 1Z17A 3CONA 4BNDA 4LOHA 2WWGA 1L4LA 4IZOA 1JE1A 1Z29A 3DAHA 4YV2A 1SC9A 2Y0CA 3AR3A 4Q39A 5FDFA 1IB0A 2DTXA 3FDJA 3MZ0A 2B5WA 3K9BA 5DN6D 3NUZA 4LNAA 3UAYA 4QSHA 5H4GA 2IGTA 3G8BA 4R41A 4HJRA 3RTCA 3WO0A 4AZVA 1JI0A 4EHKA 1I6LA 4ZOEA 1GGHA 1KA9H 2DBRA 3B6MA 4YRJA 3UFXA 1QAQA 1WHTB 2XLCA 1CEXA 1X1DA 1DWPA 1T5DX 1U3VA 5I48A 1LTQA 2E9SA 2BSQA 1YB7A 2HRZA 2V6GA 4IQ0A 4G1UC 1DGQA 2GJAA 1IAVA 2H6EA 4R8VA 1E8MA 3ORSA 5IWCA 4HDCA 3FUTA 4QGSA 3SIWA 1G8FA 4LPSA 3Q9LA 4IH4A 5JD3A 4ZZ1A 1JHQA 3WGYA 1T5IA 2QQ5A 3W6OA 3OE7D 1II0A 4TKUA 2X5JO 3IKMB 4MWCA 4ZDWA 1LBIA 4PBTA 1A7UA 2X22A 1GPKA 1M5TA 2IHJA 3ORRA 5D5HA 2V7EA 3U17A 3ZWAA 5BMVA 3GLIE 1RAFA 1X19A 4O2BA 4GKBA 4JP5A 1LSUA 2JLQA 4DREA 2YL2A 1IJKA 1YULA 5IJ9B 1RZRA 2V0NA 3VKVA 1SZCA 3AJAA 3T4UA 1HRKA 2GTHA 1DHRA 2BFCB 3I0ZA 5EG5A 1BVHA 1IY1A 4K3UA 4QQ8A 4YT2A 7REQB 1FP4B 4HP8A 2DFPA 4Q6BA 4FQ8A 2B8JA 4ONEA 3RYFA 4B5KA 3PUYA 5T6MA 2P4UA 2R6CA 5E95A 4IKPA 4GECA 1XZJA 4WFIA 2NGRA 2E5FA 3G89A 2V3CC 4JMLA 4HB3A 2AEJA 3EUAA 1ECCA 1L5LA 3UOWA 4NI5A 4Z53A 3SVTA 4CM4A 1N2GA 1Y1SA 1XL1A 4IR7A 3G13A 4CIWA 3EZ6A 4AZ3A 1EKXA 1U02A 3H5IA 3GHYA 2XUQA 1KAEA 4O4IF 3KQLA 1TJ3A 4NZMA 1LK0A 1V7CA 1MKYA 4IWXA 1P5ZB 2QAIA 3IAXA 2LCIA 3KHSA 3KJNA 3ONFA 4LJ4A 3MTJA 3RNOA 1KI9A 3K09C 3VSAA 1T2VA 4LXQA 2R25B 1PR4A 4INPA 3QEOA 1D9XA 2ET6A 2DT8A 4KHZA 5HKKD 4TSRA 4M88A 4NPHA 4Y2RA 5L6MB 4AT1A 3LCUA 1JW9B 3FFXA 4HTFB 1NZDA 3HMQA 2WINI 2HA4A 4MVJG 1OH8A 3SM3A 3IPYA 4TLDA 4M9SA 3REFA 1P0IA 4QBHA 5M34A 3AIMA 1RXSA 4RGYA 1E3SA 1TAUA 4OXRA 4ME6A 2ODWA 2Q1SA 1ODFA 2J6HA 1J8MF 2QU7A 3W8DA 4L4ZA 2WJJA 1WY5A 1AMUA 4LYHA 4Q3KA 5E6SB 1L7MA 4XCQA 3ZDXB 1DRKA 2H85A 1R0XA 2LCQA 1A0OA 2G17A 4PHCA 3UW3A 1BDMA 3IP1A 4FYHA 2LZ0A 1CUWA 3PE6A 4NDAA 5KAPA 3SEQA 4RC9A 3ZPXA 3S5UA 1EUYA 3GAAA 3N8NA 5GJVC 4CQMD 3HRIA 3LI2A 3JPYA 1RRGA 2OG1A 3HB5X 2M6KA 1N0WA 2RGXA 4FT2A 3FCSB 4ETNA 3PX2A 1O96A 4LOKA 4QNNA 1MPTA 5JCJA 4QJ3A 4GL2A 2IYSA 2Y0BA 1QHIA 4XD2A 5DZSA 5ENZA 1ORDA 4ZCPA 2OHIA 3O8DA 2H2HA 1WCYA 2ZSAA 1I4LD 3UJ3X 1D4AA 4C4YA 3C6XA 4C07A 2IEAA 5C1BA 2FQWA 1EWRA 1CQIB 2F4NA 2Q9BA 3KZMA 2HHAA 4L0MA 3N59A 4J6EA 4UTZA 1E62A 1U2SA 1NW3A 2P9BA 1V7PC 5B1HA 3TRIA 5IP5A 1CQJA 1G6KA 2DU8A 4BNJA 5H02A 4F91B 4AX4A 3L8DA 4YNBA 4O2LA 3UBMA 1GM5A 4IEIA 1ESZA 5DJ5A 4NESA 2WB2A 1TYBE 3AEZA 5SY4A 4AS2A 1KR5A 1E6LA 2JEYA 2WRZA 1F0KA 3RUIA 3RWMB 4BNWA 4X1KB 1C8BA 2ZSDA 1P5HA 3B53X 1BFKA 3SVZA 2BKXA 1ADCA 1QE5A 5CDYA 3NWJA 4EKNB 1HQYE 1WIWA 1N1GA 1D1PA 1RU3A 1WW8A 3LPMA 3LFHA 3M1IA 5HZHA 2O8EA 2VF8A 4UOZA 2A30A 3CUUA 3QE3A 4S1VA 5COQA 3OUTA 5BR1A 1SVIA 4WUTA 2IIQA 2X8AA 1ZMRA 3CO0S 3D6AA 2Q29A 3I2FA 3IUYA 3NT2A 4GOJA 3WJ7A 2VHEA 3I32A 2NTYC 4GVPA 4UREA 5IKEA 4XVUA 4MW6A 1EWVA 1W96A 1Z5WA 4GPZA 5DX1A 3A31A 4NJMB 3UAVA 5C8XA 2HJ9A 3UNXA 1IDOA 3PA8A 4EQ6B 1PL8A 1KZ6A 4MHSA 2O6HA 4MV0A 2DY0A 3AP2A 2AKEA 1CUJA 4ZYYA 2BFBA 1XPOA 1WM1A 5E1MA 1DKMA 2C5BA 2R5FA 4B35A 1RYFA 1S6YA 3BB1A 3FJYA 2PMBA 2ONJA 2ZYSA 4MS4B 4MZXA 4Y2UA 1JLMA 2QZPA 4JR2A 4L0DA 5F35A 3URKA 1R6TA 2YN4A 4E2ZA 1DXQA 1KFEB 4HDMB 4B43A 2C7QA 3M6FA 3WB0A 1FDWA 3I53A 2CL0X 3MMPA 5BNIA 3OLVA 1H4QA 1TKRA 3Q85A 2PUWA 2OPHA 1NMQA 3M4YA 1YMUA 1UFQA 1WO8A 4JB3A 4DDUA 5CB0A 3DKKA 1B8OA 4H4EA 5JC8A 2Y92A 1DXHA 1ZBQA 4A0HA 4UHCA 9LDTA 4MA5A 4OAOA 1WPGA 3CVWA 2QTZA 2J32A 1VLLA 5E7QA 1RJFA 2X6TA 2FN8A 4B74A 3OM1A 3QBVA 1DAMA 2VRNA 3BMOB 4N48A 1KIAA 3GLHB 1EI9A 3K70C 4DLZA 1R4ZA 3K2EA 4IWYA 4K9NA 4XGKA 1OH5A 2HR1A 4TL9A 3C6YA 1BQEA 4Q4HB 3MT7A 1DI0A 2M1XA 3N2LA 1WMEA 4PZUA 5JQWA 1V8PA 5LZ9A 5L6LB 3KKLA 4EPTA 1NAHA 2PKQO 4JOCA 3LQKA 4FFLA 4F86A 1Z7YA 4PLYA 4BVFA 3CBQA 1IUNA 4UEKA 3VR0A 2A9KA 2O2YA 3ZCRA 3B6IA 4ZARA 2ZRMA 1R5OA 2CXTA 3JQ9C 2PXCA 1C4XA 2NTJA 2D1RA 3AFOA 6REQA 5DXFA 4IXDA 1NW5A 3BD7A 1HLDA 1NYLA 3G85A 3JQEA 4LF6B 4NEHB 1HMPA 4BMSA 3T7KA 2WM2A 4V3BA 1EFDN