1Z0IA

Gdp-bound rab21 gtpase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
158
Chain Sequence
AYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Ras-related protein Rab-21
total genus 47
structure length 158
sequence length 167
ec nomenclature
pdb deposition date 2005-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z0iA00
1HTWA 3SJCA 1FNMA 4PPQA 2FE4A 4HZUA 2FFAA 1Q20A 2BEKA 3CX8A 1KY3A 2BHRA 4URXR 1R0YA 2WAXA 4KITB 5E4FA 3AUXA 2OBLA 4YXWA 4RCZA 4Q4HA 3ZIAA 1SKQA 4PC2A 4HUQB 3BC1A 1ESNA 4GOXA 4NCJA 4Q1BA 3TW4A 5IT5A 3BFKA 1TEVA 1HUQA 1TX4B 2MMGA 4JLJA 5JWRA 2QA5A 1WCV1 1KHTA 2Q9CA 4RD2A 2BBOA 3HYTA 1XCPA 2WJHA 4TMVA 3UMSA 5A5GA 4PC3A 2G3YA 3TQCA 5JECA 4Q4JB 1Z2AA 3B1ZA 5B57C 2YV5A 2C77A 3K9HA 4JBXA 5FUVA 1W2HA 3NC1C 1KI7A 4NBSA 5K8TA 4OK6A 2ODEA 2RGNA 3GEIA 2RGBA 4C0BA 4JT4A 1CXZA 3AP1A 1DPFA 1US8B 2YINC 4S35A 1KIMA 2PZFA 4HB2A 1U9IA 2IYQA 3AF1A 1JNYA 2B92A 2D2FA 3QBTA 2VHQA 3H4MA 4TTQA 4UNPA 1UADA 4MRPA 3TE6A 1N0VC 3TNFA 1XJQA 2FFHA 4WA7A 2B8TA 1G18A 1FPMA 4QBFA 4PFSA 3WP1B 2YC4C 1FL9A 4V02A 2Q3HA 1DAKA 3BBPA 4FIDA 4EPWA 2ZE5A 1I4DD 1KMQA 1US8A 3TAHA 2HF8A 3B5JA 5FH9A 5G40A 2BM0A 1MH1A 2IYVA 1YRBA 2P0EA 1P6XA 3T35A 4DBLC 4PQRA 2JASA 4GPTA 4EKDA 3KB2A 5JSZB 1MOZA 1OHHD 1IXRC 1YZUA 4QL3A 1GVNB 3GLHE 3CH4B 3K9GA 2NO9A 5C46F 1J8MF 2Z83A 4FN5A 2CLDX 3WMFA 2VRWA 3TGPA 3NWJA 5FOWA 3M1IA 4KSBA 4PO9A 2AXNA 1XD2A 3GMTA 3WRYC 1JI0A 3DZDA 4K81B 2WTUA 2YC2C 3CRQA 2OAQ1 2PJZA 4D4JA 2YOGA 3PJRA 2D62A 1MO5A 2XTMA 5JHHB 5CITA 5JFGA 1AS0A 5KDLA 2QI9C 5A0FA 3TUZC 2CHGA 4F4CA 4JVNA 5L3QB 4JLPA 3EWAA 4ZIRA 621PA 1XDBA 2F3RA 2ECKA 2V8OA 3WNDA 4DVGA 2ZVPX 4M1YA 3CBQA 4B3BA 2Q3FA 4L16A 5J4LA 3VHXA 2V9PA 2OILA 2EWVA 1KNQA 2WSSD 5H70A 2J0VA 2ZS9A 4ZPXA 3ZQJA 2ZAOA 4DDVA 5FUWA 4OBEA 2NQ2C 1LS1A 5AUQA 4D80A 2WWIA 2IK8A 5LB2A 3I8XA 1R5BA 2XJ4A 4I4LA 5FPSA 1J8YF 1DAFA 4JVSB 4Q7MB 3LQRA 1X1SA 2PCLA 4Q9KA 4GOJA 1GITA 4H1UA 3TUIC 3QOFA 5BW8A 5CLQA 4QC2A 1ZCAA 3B1WA 4FWIB 2V54A 4RD3A 3X1XA 2FA9A 1N6HA 4ZIRB 4TWZA 1G7TA 5EXXA 3W8NA 1CR4A 2F6RA 3TKLA 5SZKB 3CRMA 4DLXA 3MWJA 4G5SA 1UBGA 4POAA 8OHMA 2FSFA 3QQ5A 3I62A 2IX3A 1G5PA 1XXHB 2FOLA 4JIMA 4KODA 2PMKA 2GCPA 3K53A 5FTNA 4ZCIA 3BS4A 4EPXA 2P6RA 4AY2A 4A6PA 2O8BA 4C30A 1KO4A 3A36A 1LS6A 1VCMA 3IIMA 4DLWA 2ZJAA 3U6KA 2VO1A 1S3SA 2CK3D 1OIXA 2CJWA 4NH0A 5FPKA 4A2WA 3NTUA 4Q66C 5DI9A 4B3CA 4GL2A 4UQOA 4CEHB 3RS2A 4Q9IA 2ZRNA 4V0OA 5C18A 3N70A 1K8RA 2XNDA 4KO8A 4LV5B 3UANA 2AN9A 2QMHA 2CNWD 3GJ3A 4M22A 2IHYA 3KB1A 4BECA 1M6NA 1QHXA 1GZSA 3D3QA 2A5JA 4MA4A 5J4YA 3KTAA 4TT3D 5GJCA 3AKEA 5EE1A 3WNCA 3C5HA 1W36D 4DCVA 3LNCA 3FMFA 4TTRA 1JJ7A 3HU1A 3SE0A 2G83A 4Q9JA 1LFDB 1KSJA 4PAOA 4TL9A 1RVDA 2NPIA 1XD9A 4PAQA 1R4AA 3AEZA 4EDHA 5BYJA 121PA 1T5LA 4PZLA 3CF0A 4JS0A 3AP2A 4N0DA 2YNMA 3B1XA 4MKFA 3X1WA 5JRJA 1TEXA 3AF4A 4DLYA 3CW2A 3DMDA 4IOJA 1TL7C 4MGZR 2Z5FA 3IDQA 3M4YA 4M9XA 2FSGA 1XU4A 3GJ6A 3DMNA 3MMPA 3PIRA 2IUUA 2XX3A 3KKMA 4YDHB 2ZREA 3GLIE 2QP4A 1CR1A 2BJVA 4TSFA 4Q9LA 4IKEA 5F9HA 3VNVA 1KI9A 1AQYA 2HCBA 4FMCF 1S8FA 3RC8A 4US2R 2GJSA 2F55A 2V3CC 2W00A 1Z83A 3N2EA 1VIYA 4M21A 1Q0UA 1J7KA 1JPNA 2ERYA 4R98A 1XPUA 5F3WB 1VCOA 1DEKA 2XNSA 1PUIA 4LC0A 1LB1B 2ZR9A 4MITA 2ZUBA 3BE4A 1DE0A 4A2PA 3GLFB 3SOPA 2GEDA 2HUPA 1HURA 4KYIB 4EJSA 2AWNA 4HLUA 5JCZA 4TLBA 1PJRA 3PEUA 4KLZA 4N1AA 5JEDA 1RZ3A 2ZI9A 4JBWA 2ORIA 3QE0A 1UBFA 1W1WA 2FEOA 2A3RA 3BERA 2RMKA 4XVQA 1VG9B 3ZD7A 3OE7A 1HYQA 3QNUA 4B71A 4HATA 1Z07A 2Z4RA 1U0JA 3ZD6A 4DKXA 5DISB 4URVR 1GNRA 1DBSA 5C4GB 3K09A 1KMHA 4Q1AA 5KUTA 2QPTA 1U8ZA 4OJKA 1I4LD 5KSZA 1SVMA 2JGNA 5G3YA 2GCOB 1U94A 3MJHA 1G8PA 4QNMA 3ZS8A 1CP2A 5SZHB 1ZD9A 3BB1A 4UNRA 1FMLA 1G6OA 1NKTA 3K0CC 1NRJB 3K1JA 4WBSA 4ON9A 2NOAA 1E0JA 5FOUA 4K8OA 3JVUA 1OB5A 1G3UA 3V4RA 1SHKA 2B7BA 4EIWA 1HQYE 3PR1A 4GT1A 5KYKA 1IM2A 2KBFA 4IXMA 2CL0X 3NEJA 2GBLA 3B82A 5JJKA 3RS7A 1VPLA 1FTSA 1II9A 3AUYA 4ILEA 1U99A 3THWA 2V7QA 2GETA 2OV2A 3S1AA 4FCTA 2IYUA 2NZ8A 2FSHA 4MGYR 2W6JD 2VPPA 4XVUA 1FQJA 1PUJA 4NPHA 4HB0A 4QGHA 1G64A 4WVFA 4WOPA 3CKLA 4ZI2A 2RHDA 2QEQA 3TH5A 4KXFB 4TMZA 2GXAA 2WWYA 3G0HA 3QG1A 1ANKA 1L8QA 3U7FB 2V7QD 2OXCA 4A15A 5HE8A 3T1VA 3SDZA 2JLUA 4NDZA 4S2EA 4B43A 1JJVA 3EZ7A 3N2IA 1KSGA 3QENA 4Q1EA 3I4LA 1R0XA 4PPNA 4GOKA 3T06B 1G3MA 3BAFA 4RCYA 5B2ZA 4B48A 4GNKA 3HP1A 1GIAA 2Q3MA 3LWNA 4TTPA 3EZ2A 4Q03A 1YR8A 1D2MA 3L0PA 1J99A 3THWB 4O3MA 3UXMA 4DDUA 1KI6B 2WSMA 4OHZA 3GFPA 1JBKA 4X8OA 3RWOA 1YZLA 4MRSA 3AVYA 1NLYA 1OH6A 4F93B 4MKHA 1T0JB 1GM5A 4NMMA 4DDTA 1XEWX 3UMFA 2O52A 2J5XA 2CVHA 1M7GA 4WZAE 4PHFA 1XXHE 2EFEB 1TADA 5TARA 3A1TA 3LX5A 1NY5A 3QXXA 3EIQA 3I1FA 4HAYA 1V43A 1W0KA 2DWOA 4TMTA 1KY2A 1MV5A 4I99A 1I4TD 4EAQA 4EPTA 3O8RA 3DM9B 1EG7A 2VP2A 1Q3HA 2IYLD 4LWZA 2PCJA 3SFVA 1KSHA 4QFMA 2F43B 2RAPA 4HUTA 5HCNA 4B33A 4EUNA 2HLDA 2QT1A 1NIJA 2W0SA 3DDCA 3WYGA 3FB4A 4C4PA 5BN4A 2DCUA 2ZE6A 4Y0VA 4KBFA 3R7WB 3I8SA 4AD8A 1AK2A 1LW7A 2ZIAA 4PHTA 4IDNA 1SULA 1KI2A 4IVQA 5DLQC 1NSFA 4HDQB 4JJZA 4ARZA 5KU1A 4L4UA 3D31A 3W3AA 4QOSA 4OKSA 2RGCA 2WMNB 3BJIC 4NTZA 3GLFA 1BYUA 4ESHA 4YMVA 2HLDD 1RKBA 5L3RA 4B44A 2WBLC 2JJ8A 4LYFA 5J40A 1E79D 1S0UA 5FBRB 3SS8A 3OEEA 4BFVA 1RRPA 2W2VA 1KAGA 1QF9A 2FWRA 3CWQA 4KFRA 2DBYA 5EXTA 2QE7D 4JSYA 1OW3B 2ZR7A 2CCGA 2YWEA 2XXAB 1S96A 2NG1A 4B3GA 2R6DA 3OE7D 1L4YA 1JB1A 2A5DA 2GJ8A 1KI1A 1KGDA 1XD2B 3GP8A 3AP3A 4A8JB 5KSYA 5FOXA 1NVUQ 5B30A 3SYLA 2PZGA 1XWIA 3MFYA 3BB3A 4BPBA 5FPTA 1W47A 3LBIA 1Z08A 5FPHA 4HZIA 3MSXA 1E0SA 5HCIA 3KXLA 4NYMR 4XD7A 5KNBA 1B0UA 2BDTA 2WZQA 4LHXA 3ZVMA 3LLUA 4O0MA 1Z5ZA 1CU1A 1U0HC 1K5DA 2G1JA 2VIIA 4NONA 3SI7A 3IQXA 2EVWX 3QY0A 1HE8B 3KQLA 4AKHA 3NHAA 5FBLB 1WXQA 2GZDA 2KJQA 2QSZA 3GFOA 4D2IA 3O8CA 2IW3A 1ZYUA 2FH5B 3CPHA 4FWTA 2FZ4A 4CT4B 3HYRA 2N42A 1UBEA 3AGPA 1TF5A 4E03A 1NBMA 1U81A 5JWHA 4OL0A 2ZXUA 4TMXA 1DVRA 2ZYWX 4XWOA 2V4ZA 1KSFX 3G5UA 3R8CA 1KI6A 2QPOA 4OHYA 5IHPA 1X86B 1Z0DA 2VP4A 1NL3A 4I1UA 4JL8A 1PLLA 2HCJB 3QKTA 1IN7A 2OBNA 3P27A 2FPLA 3D6TB 1R5NA 2ERXA 4B47A 1Z0JA 3U4QB 1N2CE 5FUYA 4JLKA 4LJYA 1AM4D 1KNXA 2R6AA 3THXB 4O25A 2X2FA 3LW8A 4RFVA 1A4RA 3OF5A 4NE2A 2ZSFA 3TRFA 3J81k 3KXIA 3HPRA 1OXVA 1ZU4A 2A5GA 1NKSA 4U02A 1GNQA 4V0MA 1F2TA 2RGGA 3Q7PA 4HAVA 1XTQA 3RAPR 1XZPA 1B23P 2EFDB 4A9AA 3IBGA 3P26A 3JZMA 1W46A 5JMTA 1W4RA 4TL7A 4XSGA 2GAAA 1N5KA 4UXHA 1ZC4A 4QBGB 1ELOA 1G8FA 2HYDA 1OH8A 1VHLA 3UG7A 1DG3A 2R44A 3EZFA 4M9ZA 4JMPA 3QKRB 4JLMA 2REXB 1AZSC 1W0JD 2W58A 3TR0A 4A0HA 4ZDJA 1FX0B 1KI4A 1YHNA 2H57A 2OO7A 1IXSB 4KVAA 4LJ4A 4LK2A 4LX0A 3RRZA 3RRNA 4ACAA 4E22A 5LD2B 2W6IA 1MKYA 3QEJA 1QG4A 4QGGA 5AJWA 2P6NA 1E2PA 2ODNA 4Q5IA 2FZLA 1OFTA 2WWFA 2PT7A 3IUYA 3FMPB 1GRQA 3NDPA 1E2NA 3EW9A 3HPQA 4C0HA 5K8IA 2WICA 2WIAA 3F5FA 3O47A 2KWIA 1FOEB 1SVKA 4A92A 3OIUA 1IY1A 4HI0E 2ZYVX 4A2QA 2NIPA 1VIAA 2BIFA 4NCNA 2RGAA 3Q85A 3VR6A 4LBWA 4LBVA 2GA8A 1P5ZB 5JHGB 2R9VA 5EE9A 1EFUA 5EUMA 3B1VA 2VF7A 3B9PA 1YKSA 4MUBA 3LD9A 3A8TA 3G82C 2JEOA 2NZJA 3LV8A 4TSFD 1YE8A 4TLDA 1OIWA 3BORA 5JCPA 4LHZA 1ZIPA 2QE7A 4HLCA 5DHFA 2OFOA 1XP8A 2C8VA 1G5RA 2P5SA 3X1ZA 5HPYB 1CF4A 1DAMA 4D4MA 1RRCA 5AJZA 5DYGA 1NG1A 1Q1EA 2ZANA 1N6OA 5C2JB 4NP6A 5DYIA 4PHGA 2WV9A 4B74A 1EFRD 1LTQA 3RSOA 3U6BA 1E1RA 2F1IA 2EYQA 4Q7JB 1W4BA 4V0KA 5DE3A 4BEJA 3PEVA 4YMTA 3KFXA 1BIFA 4B2LA 4Z54A 2YOFA 3BOSA 1F2UB 1KJWA 2J7PA 1P62B 5B58C 2QAGC 1U98A 2I3BA 4RD4A 5FTLA 1N6RA 1NN3A 3CX6A 3PUXA 3KX2A 3UATA 4RD0A 1R8QA 2REBA 2FMXA 1E2MA 4B35A 2J41A 1ZM9A 2QMEA 3F3YA 4YC7A 4YONB 2H16A 1XPOA 1P4SA 2PT5A 5IF9A 2ZRAA 4PSAA 3KDSE 1VG0B 3U5ZB 3MCAA 4UNSA 1P2VA 3EAQA 4C7OB 3NVAA 1KTVA 3TUJC 2ANBA 1II8B 5SZJA 3WMEA 4TMWA 4ZDKA 1COWD 2F1JA 1W48A 1ZU5A 3C5CA 4CGZA 221PA 3RRMA 4BFYA 2FFQA 3MD0A 3CF2A 4JLAA 2IYTA 1XMSA 2NO1A 3LFUA 1IONA 2ZSBA 2V6JA 4C3ZA 1WF3A 2BMEA 3AVXA 3EPLA 1T6NA 3AVVA 3VKHA 3H0KA 2NPFA 2BKEA 4HZUB 5LD2C 1KDPA 3M6AA 4TQUS 1T5IA 2J46A 1ONBA 1WBDA 2QBYA 1E2JA 4MKIA 5DO9A 4AK9A 3M0EA 1E0AA 2QG6A 1A5TA 4MDEA 1NNEA 2ZRBA 4MYCA 3CZPA 3KKQA 2DYKA 2QMUA 3T5GA 2EFHB 5EP4A 5E7IA 2FG5A 4N0EA 3O8BA 4KYUA 3UG6A 2IS6A 4ZKEA 4CZ2A 1RYFA 3I32A 1TTTA 4O2LA 1ZJ6A 4Q7KA 1SZPA 1A1VA 4FCVA 1N25A 1ZW6A 4DLUA 4M4SA 4P31A 4LZZA 4BZXA 1BS1A 3Q7QA 1W7AA 1KK1A 1OT3A 5AJXA 1XX6A 1BYIA 2ZUDA 5IRCD 3KUDA 1CIPA 1DELA 2ZS7A 1N6KA 4TL8A 4V0ME 3IPYA 3AKDA 3WBKA 1YR9A 3DL0A 3ZZ0A 4ZV4A 4PXAA 1G1MA 3SBEA 3GFTA 4AKEA 4C2UA 1Z0FA 3ZS9A 1W36B 2X19A 4QGFA 1ZM4A 3C8UA 1NF3A 1UPTA 1XCMA 4B6EA 2NGRA 4JYBA 1M7BA 4R71A 2UKDA 1ESMA 1DADA 3RDPA 2IUSA 3R7WA 3PUYA 3HR8A 3OEHD 1UBCA 3GJ0A 3IHWA 4MRRA 2WKPA 2YWHA 3VFDA 3ZYCA 4JLNA 2OM2A 4M8NE 2NMVA 4E07A 1U8YA 2F43A 2JAQA 1U9IC 3DO6A 2JDIA 3KFVA 3C14C 1G8HA 1G19A 4HSEA 4TL6A 2XTZA 3KJIA 1Z06A 1GKYA 3KQHA 1OXUA 1SXJD 4RZ3A 2J3EA 3GLHA 1OXTA 1Z6AA 4ABYA 1UM8A 1JXOA 4IDQA 2KBEA 5IDVA 3OHMA 1FMJA 2WJIA 2X1VA 3L0SA 4QM6A 1R10A 4LYHA 2QAJA 2GNOA 4M0LA 1R0WA 1UKVY 1AKEA 3CUEF 2QBYB 1CR2A 5JS8A 2CK3A 1CLUA 4LRWA 3R9XA 1N3BA 4IJMA 1W44A 4LHYA 3CO5A 1T4GA 3PXGA 4MRVA 4QXAA 1LNZA 1E2QA 4JJKA 1J70A 5CK4A 1XFAA 4BLOA 1OSNA 5FTMA 4HAUA 1IN4A 2PEYA 2G1KA 4AKIA 1XB2A 3LBNA 1LF0A 2OBMA 5G3ZA 1E1RD 1E98A 4GMDA 2OSBA 2OXRA 1SVOA 1JR3E 1KJYA 4OQMA 1JEDA 3K0SA 4O2RA 4RFSA 2AK2A 1Z28A 3GJ5A 3ND8A 4GI7A 4HAXA 4OQXA 3RSLA 1G8YA 1UJ2A 3GJXC 4PPFA 3MLEA 5TV2A 3SC3A 4PSVA 3VQTA 3EX7C 1OFIA 1G4AE 1VYUA 5J5CA 4R9UC 3I61A 1T9HA 2P2LA 2PL3A 2OFXA 4KSCA 1NVVR 1ZM7A 3U44B 5KOYA 1BOFA 4DLSA 1SQ5A 3GLHB 3CLVA 3LAWA 5B64A 1EWRA 1N5IA 2D74A 2BMDA 1IBRA 2ZU6A 4FCWA 2V1UA 4OQLA 1WBBA 4UXIA 1E9CA 2BCGY 1AA9A 1IXZA 4RD1A 4EFNA 1H8HD 3UIEA 3AQ4A 4BUJA 3ICEA 4LPKA 5IK2A 3IO3A 2VH5R 1ZAKA 1SVLA 2F1RA 3QG5A 4G5GA 3RWMB 1VECA 3IKJA 1SKYE 1DO2A 3W6NA 1W2GA 4X8MA 4KLNA 4LJ5A 3WYAA 2BBTA 1QG2A 4H1VA 4D82A 1O87A 1Z22A 1AN0A 5IK2D 2BEJA 2C5LA 5HZKA 5GJBA 1R8SA 1CJUC 4HB3A 1Z6YA 4B3XA 3QVVA 1SKYB 4LJAA 2ZJBA 4WW0A 1P9NA 2ZETA 1XBTA 1ETUA 3I3SR 2EW1A 2IWHA 4ASUA 2JLWA 4TQ9A 3IGFA 5EP2A 5JI2E 4UJ3A 2MSDB 4L9SA 2QENA 1RIFA 4ERNA 3WMGA 3THYA 2E1RA 3EXAA 2Q0HA 3EPJA 3R9IA 4LGMA 3BH7A 4EJSB 2VA8A 3FMOB 1JQLB 1M74A 3NBZC 1ZUIA 2AR7A 2F9MA 3C7KA 1IOZA 1E2HA 3V00A 1P9RA 3ZVRA 3R9WA 3AVTA 1SGWA 1D6JA 2N46A 3B7GA 3BFXA 4BWYA 2ZRJA 1Q12A 1YVDA 3QPVA 2DFNA 5C1BA 3GEEA 5EXSA 4JSTA 3RHFA 4XJXA 3KL4A 4LY6A 1CBUA 4NCHA 3UWOA 3LRPA 4PZYA 2OG2A 3L0IB 5LB4A 3IPXA 4FI3C 4DC9A 2KE5A 4C0LA 4M9SA 2PBRA 1RC8A 5JZVA 1DAEA 2FN4A 4YMSA 3PENA 4KFSA 4A36A 4Q02A 1E9SA 2WJGA 3BXZA 3NH9A 1UF9A 3ZVNA 1YZTA 4URZR 4I81A 3IEVA 2HJGA 2CEAA 4D0LB 1SHZA 2BOVA 4DJTA 5A4JA 1OLOA 5FUXA 4TLCA 1EXMA 4B3DA 1EFCA 521PA 3A4NA 1T91A 3P4YA 2XZOA 4D26A 3FTQA 3RNLA 3PFIA 3EPKA 5LBIA 2EQBA 2RGNC 2OEPA 4JYCA 3QVUA 3PV0A 1W5SA 3U4QA 1PLJA 1Z47A 2W6JA 2D7DA 2VLIA 2WWWA 1Q1ZA 1TF7A 2MSCB 3DKPA 4LPSA 4IHQA 5HR5A 4NZYA 4BFSA 4AG5A 4GRAA 3NH6A 1NLZA 5D3MB 4CVNA 2ZRGA 3QJYA 4FXPA 3CNLA 1P75A 1EFHA 2R6FA 1E9AA 4PQYA 2X2EA 3KZ1E 5FI0B 3LLMA 1Z0AA 3ND9A 3ICQB 4CF7A 3AVPA 4BRWA 2GZAA 2P67A 5KDDA 1E2GA 3FWYA 1XTRA 1I2MA 3LXRA 3QF7A 4D6PA 1D8TA 1OH7A 4D0NA 4HUQA 2FGKA 1G21E 2GJKA 2OCYC 3RS3A 1P2TA 3VMFA 5TXGA 3LXXA 1EFRA 4DLTA 1XNJA 2HYIC 2AFHE 4DEYA 2JLYA 1QRAA 2O8EB 2ZJZA 2D4HA 3U2QA 3FGNA 1CTQA 2J7PD 3QUSA 4L8GA 1VCIA 4V03A 2X8AA 4G5QA 1YRAA 2JJ2D 4OI1A 4AURA 2Q21A 5CIWA 1KO8A 1AIPA 2JLRA 3OFNA 1FQKA 1GL6A 4Q4AB 2EU8A 1IJFA 4IXNA 4KJZA 1G41A 4PO8A 4DT1A 1ZD8A 2CNWA 4F4JA 3ONWA 5AUNB 2BCJQ 3GLIA 1T0HB 4FW9A 3GD7A 2A9KA 4YMWA 4NHOA 4P32A 4C0JA 3VKGA 1P3JA 1VYVA 3A1VA 2ONJA 1Z3IX 2QM7A 1N5JA 1KZGB 2SHKA 5E95A 2J87A 2XGJA 3GLFE 2A2ZA 1KZ7B 4G1UC 5DH9A 1AGPA 2IF2A 3A4MA 3QKRA 1W0JA 2OE2A 2QNRA 1ZUHA 4DWJA 4BEBA 1BKDR 1UDXA 2CDNA 2Z4SA 1OKKD 5EJEA 4G01B 1W4AA 3HDTA 1X1RA 1T8UA 4OK3A 4CRWB 2BJWA 3V4FA 4JKIA 4US1R 3B60A 1LY1A 3FOZA 4M1MA 4C9BA 3CM0A 2KSQA 4AKGA 4RD6A 2R62A 4PQFA 3HR7A 1E4VA 2QL6A 4M53A 2QN6A 2ZQ5A 4RZ2A 3FHTA 2ZRKA 1GG2A 1GRNA 2IT1A 2QTVB 1NLFA 3QKUA 4DSTA 3FE2A 3FHOA 4CDGA 3E2IA 4DSUA 5KDOA 4X8HA 4MKGA 3THXA 3W90A 4EFMA 2CLSA 2GRJA 2WWXA 1OB2A 1QBKC 3I5YA 1RW4A 2QGNA 1ZMXA 5EUQB 2ZRPA 1G3QA 4JLOA 4TLEA 4TYPA 3CR8A 3H86A 1R0ZA 2B8WA 2AX4A 3AB3A 2IS1A 3SFZA 1Y3AA 4PPGA 4ASUD 1JR3A 1ZBDA 1HEIA 2VSOA 4HLDA 1CJKC 4URYR 4AYWA 3KKOA 1ZIOA 3QPWA 4BLQA 4Q19A 4GZMA 1E2LA 1XEXA 4XWAA 2OAP1 6Q21A 4NYMQ 3T5DA 2OCAA 721PA 2AKYA 1F3OA 2GJ9A 3CRVA 3IHLA 1TAGA 1YR7A 2KB0A 1L4UA 5HE9A 1XXHA 3UMRA 1JR3D 5C4MA 2GXUA 3CRRA 3EC2A 1WDTA 1CR0A 3KXKA 4TYYA 2A78A 3TAUA 3ADDA 2VF8A 1N6PA 2AK3A 4A82A 5L3VA 4TN1A 1NG9A 1XMJA 3SYKA 2WWGA 4BFUA 1UAAA 2BMJA 1Z2CA 1W36C 1DAGA 5K8LA 4JBYA 3B1YA 1IY0A 1MO3A 1X6VA 4A0RA 4BLTA 2IYYA 3ZGXA 3DOEA 4DB2A 2VSXA 5LDDC 3AKYA 3FMIA 3GJ4A 3O8DA 5HKKA 2G0TA 1SXJA 4DB4A 3TSZA 1GUAA 2KI5A 2GF0A 3WYFA 1QDEA 4A8JA 5GVRA 4DSOA 2HXYA 3GLGE 5ELXA 1G3RA 4DT1B 1E2IA 3X1YA 2ZR0A 4Q4AA 4US0R 3OZXA 1JR6A 1Q22A 1UKZA 3C4JA 3RS0A 3L0OA 4Q01A 2OCBA 1Z0KA 4QJ3A 1ZINA 5EQTA 4IRUB 5JBQA 3QPUA 2QT0A 1AS3A 3IQWA 1U90A 1XD8A 1ZM3A 4TLAA 1SVWA 3VHLB 2Q9AA 4HLUC 4ZDIA 1AQUA 2QROA 2QTFA 5KTYA 2OLJA 2NO6A 3QXCA 5E3HA 2AD1A 2ZU0C 1N6LA 3QKSA 1HT1E 1U8AA 1XMIA 2CCKA 1PZNA 5J47A 5KHOC 4Z8YA 2ANCA 3MG9A 3A1UA 4Z8XA 4F4IA 1OXSC 4EQ6B 3KUCA 4DXAA 1RYHA 4LJ7A 4KFUA 1E2EA 4M1SA 1XCGB 3HU3A 2JLQA 3T61A 5BWMA 4IW3B 4QKQA 4EPYA 1Z63A 4AG6A 5DNYB 2IBMA 1D2EA 2QRNA 1JAHA 2QTHA 1EX6A 3K8YA 3LX8A 2XZPA 4JL6A 4URUR 4Z1MA 2WJVA 5JS7A 4LDJA 3TSWA 3MRSA 4BFZA 3CIOA 3DHWC 2GAOA 1XZQA 4R2HA 4MGKR 1F5NA 4PZZA 1NI3A 1OV4A 2ZPTX 3SQXA 4JT2A 2O0JA 3EARA 1ZC3A 1EK0A 5JLJA 3EASA 1II8A 2QMOA 5CLLA 2H17A 4Z1MD 2ORVA 4PR0A 1AJEA 1ZRHA 2QAGB 3NKVA 4IOKA 3SNHA 4A6XA 1G5TA 4GP6A 4NYJR 4A4DA 3A4LA 2OESA 2FSIA 2UZIR 4JVLA 4XSHA 2F1HA 2WPDD 2QY9A 2ZJ2A 3IIJA 4UNNA 1KDTA 1FUUA 1FNNA 1COWA 2HT1A 1W49A 2C99A 4ESVA 1F6BA 5FTKA 5TVKA 2WWHA 3QSYA 3W5JA 3SZRA 2C96A 2IL1A 2B7CA 3U60B 4V0LA 4P33A 2JLVA 2NO0A 2O0KA 2WJJA 1W4CA 2CBZA 1HA3A 3I73A 3WHLA 3SJAA 1H8HA 2GVZC 1ZNWA 1W0KD 1XTIA 1P72A 3LBHA 4Q1DA 2XOKA 2GILA 4BRUA 3WNBA 1GP2A 4PO1A 1VCNA 1ZVQA 2VHTA 2ZJYA 3SEAA 1A7JA 2PX0A 3FHCB 4BZQA 5K8UA 4LV8B 5KNDA 1GTVA 2BBSA 4RZXA 3MWYW 2W2XA 1E0KA 2G6BA 3KJHA 2IYZA 4BLSA 3UWKA 4WXPA 1XPRA 2XEXA 2ZM5A 5TY0A 2ORWA 4YLGA 1BMFD 1HQCA 2FDCA 1O3YA 3HJNA 4LJ8A 5GJWC 3AH8A 5FL7A 4UXJA 1JAIA 4LYJA 3TVTA 3WRXC 4NCKA 1YZKA 2GXSA 4BE7B 2YZ2A 1KO7A 2RKOA 3FKSD 4TYQA 4W7SA 2O8CB 1X8LA 3A37A 2XSZD 3SHWA 1E79A 2ZVQX 2YJTD 4EFLA 2FNAA 1N0WA 3VR3A 4Q00A 3ZLJA 3E70C 3PEYA 1XRJA 3A1SA 3E5HA 3U3KA 4BFXA 1KAOA 2G0NA 1E96A 2R6CA 4D4LA 3TW8B 4DRZA 5CM9C 4KBGA 5JJIA 3U7HB 3H1TA 3ZVLA 1OXXK 1HY3A 2LCFA 3HU2A 5BN3A 1E9RA 2ZSDA 3OIYA 3TK1A 1ZUNB 4JL5A 3VX3A 3LQQA 2XZLA 3RRYA 2GK7A 5FOVA 3QEOA 3ZZTA 4N3NA 5CYPA 3K0EA 4OHWA 3PUVA 1JQJC 3B78A 2VHJA 4ZO4A 3BK7A 1H8EA 3U44A 3FVQA 2DY1A 2YOHA 2ZUCA 4XD7D 2HDNB 4PANA 4JVMA 4FMDB 4HLQB 1JPJA 1MO6A 3TSOA 1RPZA 2FU5C 2ZI3A 4IDPA 3EZ6A 1NN1A 2AKAB 4B2PA 1K6MA 2VBCA 2YWFA 5L3QA 4DUGD 2PH1A 1M2OB 3K0AA 2WVJA 3KJGA 1DAIA 1KKMA 1Z29A 4IFBA 4D0GA 3K9NA 4DHEA 3WY9A 2R6GA 3VTKA 2P65A 1U2RA 2JJ1A 3IEUA 1R7RA 3EA5A 2GTPA 4IOMA 3KQKA 3C41J 4M1KA 5DN6D 1E1QA 1NY6A 2GWHA 2IXFA 2OFWA 4E09A 5CDFA 2OZEA 1D5CA 2IF0A 2P3SA 4LOAA 5AUOB 2IEZA 2XITA 1OIVA 1KDRA 2C03A 3W34A 3ZDQA 4CEJB 5F9FA 4KU4A 1C4OA 4OI0A 3ASYA 2ZSEA 3T1QA 1WRBA 2FFBA 3LW7A 1P2UA 3WP0A 3IIKA 1G7RA 4QHTA 3SBDA 5LPNA 1LVGA 5H68A 2QZ4A 3P20A 2WAYA 3VU9A 2B6HA 2GESA 1VYTA 5DSZA 3SJBA 1UKEA 1VDZA 4OI2A 1DTSA 2C98A 5BQ5A 3OEHA 1M34E 5TB5A 1AS2A 2IEYA 2ZRMA 2QPAA 3U7GA 4DCTA 1KO5A 5EZ5A 3VX4A 1QVAA 1XTSA 3RYTC 2EFGA 4LBYA 4TZ6A 2FGJA 1QHHB 2ATVA 3E1SA 4WZBE 2ZITA 4LJ6A 1NMZA 4HDOB 3ADBA 2R8RA 1GRRA 4WXRA 3QF4B 5AJYA 4Q4LA 3RVBA 3K70C 4GP7A 2J7KA 1EESA 1IN6A 2FEMA 2W6ID 4B76A 3UPUA 2RB4A 5TDHA 1FFHA 4OHVA 5SZIA 4XTRA 1YJ5A 3NXSA 3I5XA 1VG8A 4JZKA 3FYHA 1CEEA 2E9SA 3REGA 2Z6VA 1BMFA 1QHSA 1S2MA 1KK0A 3OAAA 3QBVA 1MABB 2J0UB 4NKRA 4B3FX 4DCNA 2IXGA 1OKKA 3C15C 2MSEB 2WHXA 4Q1CA 1EFTA 4UNQA 3IILA 4EPRA 3FFBA 1YZGA 1KJZA 1Z8FA 2GHIA 2V55B 4IVRA 3TMKA 4F7WA 5JRZA 3EA0A 1PLKA 4AI6A 1OH5A 2XB4A 4W5WA 4KVGA 3W9YA 1TUIA 1NMXA 2JATA 5GJVC 3FFAA 4QHYA 1M1YE 3UKDA 1KDOA 2PX3A 4F38A 1P73A 4XTCS 4LUCA 3AF2A 4IFEA 2O8EA 4LCBA 4GBMA 4LHWA 2BVNA 2ZJ5A 2LWIA 2C9OA 3P32A 3QIAA 3REFA 4B6FA 4GMXA 4A0GA 4EJSC 4HAZA 4QBIA 1E3MA 3C16C 3OFND 2DFKB 2DHRA 2DPXA 3JZAA 3ZJYA 2A7QA 4UKDA 3MJRA 2QP9X 2ZE7A 5E7MA 3QKSB 1A2BA 4HEJA 5FL7D 4FMBB 2DFLA 1NMYA 5EE3A 1NSTA 1EWQA 5FBQB 2QGZA 1E94E 4R7ZA 2ZS8A 4TYNA 1S1MA 3K09C 5L8VA 4YQFA 1Z6XA 1XEFA 1H8ED 3GJ8A 2WIBA 2J0QA 2ZRCA 4I1VA 1II0A 4PSKA 5EZ6B 2RGEA 2BM1A 2VEDA 2A30A 2VYFA 3QF4A 3QXSA 4GSYA 3Q5DA 5ANRB 3AVQA 5FBVB 4NCIA 1QHHA 3QXHA 3TLXA 3VR1A 3LO5A 1H65A 1CULC 3GEHA 1IY2A 2GEUA 5TMPA 2J59A 4PC7A 4DUGA 3DKVA 1G4UR 4PHHA 4EPVA 4RFSB 5AK0A 1E4YA 4A0FA 5KPDA 4L15A 2PEZA 1ZNXA 2W83A 2QAGA 1G3IA 3K70B 1XEWY 4P4UA 1G20E 4H9GA 1E9DA 4II7A 2D3WA 2I1VB 4W5HA 1A2KC 5G41A 4TZ0A 4BLRA 1TQ4A 3RANA 3JVVA 4Z51A 1CJMA 2W0MA 2BWJA 1E9FA 4YMUA 5HTKA 5CDFE 4Q9HA 3S1AB 2FJUA 1G6HA 2G77B 5CM8B 4V0NA 2RGDA 2DB3A 3SJZA 1RJ9B 2ZEJA 1XTKA 2JIZA 2ZYUX 4L9WA 3DM5A 1TUEA 3CZQA 1F2UA 3T1TA 2J9RA 2H5EA 1R2QA 5CYOA 5HKKD 2J45A 1RFLA 3AGQA 1TU4A 3BH6A 4B32A 1MRSA 2VHUA 2C9YA 4EQ6A 2AD5A 5KO2A 3KKPA 4ZCMA 4K46A 4HB4A 3B9QA 1GILA 4PC1A 4ZKDA 5JEEA 4RY2A 4XVRA 1EX7A 4B75A 1NBME 3Q8XB 3U7EB 1NIPA 1FX0A 2GJAA 4ZCLA 1K5GA 2X77A 1RRGA 2TMKA 5CJ2A 5FI1B 1EGAA 1TQDA 1E32A 3X2SA 4F91B 1FP6A 5AJVB 1S1CA 1SXJE 3Q5EA 1N0UA 1P61B 2QP3A 2VSFA 2YKGA 1IJEA 2QUZA 3SN6A 1UEJA 1T3HA 1XTJA 2Z43A 3DZ8A 5L3SB 5DI3B 3VR4A 1OPXA 1V5WA 3H84A 2MMCA 4OQFA 3A58B 4BFWA 4NL4H 5H1YA 1DAHA 4XOIA 1E2KA 3RS5A 1TF2A 4U7DA 1E6CA 4QG7A 3LH5A 1G7CA 3DOFA 2VP5A 1HV8A 1QHGA 2QORA 3EZ9A 1MABA 2J0UA 4CIDA 4NYJQ 1NVVQ 1JALA 3MAAC 1GKIA 2CHQA 2ATXA 2HJVA 4C0QC 2K5UA 1RE0A 1LF5A 5AUPB 3CONA 1T3SA 2OCPA 5EP3A 5FL3A 3RS4A 4M1WA 2WKRA 3TR5A 4GDFA 3BGWA 2ZJ8A 1ZNZA 3CRW1 3PITA 2CCJA 2ZROA 1L2TA 4OJQA 1F48A 2FPMA 4JLBA 1VHTA 4BFTA 2QU8A 5FFMA 3U3OA 1WQ1R 3KJEA 1TQ2A 1QZXA 2DFTA 3N5CA 2O8CA 3TJZA 3PUWA 4XIGS 1LV7A 1GWNA 3KQNA 5F98A 1XEXB 5DGXA 1PVOA 4ZI3A 1F2TB 2LKDA 2WPDA 3LDAA 3AM1A 2YWGA 2Z0MA 5FBWB 2GEVA 1KI3A 5FOSA 5EXPA 3U3JA 3AVUA 5EE5B 2O8FB 1ZNYA 1I2DA 1NN0A 1SVSA 2CL7X 1RJ9A 2J0SA 4RSGA 4M1TA 2ZJOA 4LV6A 1Y63A 2D7CA 2RCNA 3TQFA 4YXWD 1IN5A 1ZP6A 2CL6X 4W9MC 4Y0AA 3LA6A 2WKQA 2JLZA 1XMVA 4OQNA 1HT2E 4CEJA 1KK3A 2IS4A 1MT0A 4MYTA 4C7OA 2GBLC 1JECA 4KCGA 2ZRHA 3U61B 1Q3TA 1CJTC 3PEWA 2E87A 4IEEA 4LSGA 2CJWB 2O8DB 1FTNA 4FD2A 4QRHA 1U0LA 3PVSA 2PJRA 3P4XA 1TU3A 2YHSA 3EWSA 4DCUA 2LKCA 4C0AC 2GDJA 1VKJA 4M1OA 1E2FA 1Q44A 2FX3A 2FV8A 2F7SA 2XTNA 2ZYTX 1M8PA 1OFHA 5H8WA 3CF6R 4PX9A 2ASEA 4PC6A 3L2OB 2VHCA 1IHUA 4Q47A 3W6PA 4PAMA 1X3SA 1SVIA 3DPUA 1JXMA 4OHXA 4R2IA 2XB2A 2NTYC 3CX7A 1T8TA 4AWXA 1OHHA 3CWZA 4CW7A 2VP9A 5KPJA 1G7SA 1UKYA 2H18A 2I1QA 1N6IA 3NDBB 2CLCX 2IYXA 3U3MA 4KI0A 2QSYA 2ZRDA 2JIZD 1X8KA 4BGDA 5FPYA 4B34A 3R20A 4Q4HB 3EC1A 1VMAA 2ZI4A 5DN6A 3VNUA 3AVOA 1GNPA 5DI3A 2DWPA 2ZAMA 5BXQC 3I72A 5J4HA 2AFIE 4RKFA 2BV3A 1QHIA 4WZ6A 2IHBA 5KSPA 3RLFA 3W6OA 3NC0C 2VTKA 5JJLA 1A82A 3SU8A 3CH5A 2JLXA 2GVDC 2H1LA 3BB4A 4MYUA 4RZUA 1OYWA 1CRPA 3TBKA 3DEFA 3PQCA 4BLPA 1DO0A 3CB4A 3AV0B 5FTJA 1WE2A 2O0HA 1NP6A 4C0SA 4DLVA 2DR3A 3AF3A 2AWOA 4G5OA 4IOLA 4P4SB 4XWKA 2WM9B 5DIFA 4OYHA 4IDOA 2IWRA 1NJGA 4Q21A 4QNRA 5FR2A 1W5TA 1IAQA 2ODBA 2OHFA 4AYTA 4G0NA 3K9LA 2PZEA 3L43A 3BD9A 4MDFA 3ADKA 3FKQA 2FF7A 4C0KA 4E5UA 3QXJA 1E1QD 4U5XA 3D8BA 2Q6TA 1C9KA 3F8TA 1HE1C 5AWFC 1QVRA 4D81A 3GLGA 1KYIA 2IC5A 3B8HA 1CKEA 3PCRB 5AR1A 2UVQA 3ZH9B 2IYWA 2H92A 2PLRA 3WXMA 4QBHA 1C1YA 4JLVA 4AC9A 1G17A 4C2TA 4Q48A 2V1XA 5GVSA 1Q57A 1WP9A 2ODWA 2VL7A 2L0XA 1UEIA 4P0TA 3IBYA 3T15A 1QHYA 2FPKA 2REOA 1YU9A 2QQEA 1OF1A 1ZM2A 1SXJB 2BC9A 2BKUA 2Q9BA 2JDID 4DIEA 1DG1G 1L7VC 1S9DA 1ODFA 2RGXA 2ZI6A 2H7VA 3BFVA 4U00A 3R8FA 1D9ZA 5E7JA 2HXSA 4RJLA 3Q72A 3EPHA 4RVCA 3VU9B 2GF9A 2IUTA 1GKUB 3PUZA 3Q3JB 2PMDA 5CK5A 3F0TA 4DSNA 2C04A 3L8YA 4QM7A 4B2IA 1AZTA 1MO4A 3EIHA 3GCGA 2WSSA 2HT6A 4A1FA 1HH4A 1ZCBA 3NEYA 1IN8A 2WMOB 2JJ1D 3Q9LA 1ZD1A 4FMCB 1OJLA 1WB9A 1FP7A 3CNNA 2G88A 5FOTA 4Q4JA 3ZIAD 3BRWD 2D06A 5J4VA 2IS2A 5DHAA 4Q18A 2O8DA 3ADCA 3LVQE 3CPEA 3ZZUA 1DS6A 2B21A 4D4KA 3VAAA 3FKSA 2P5TB 2ZRLA 1GSIA 2WJYA 5CB8A 2XAUA 2XNDD 3H2YA 2VP0A 4QJ4A 3SQWA 1X8JA 4MRNA 1KI8A 2ZE8A 3U3RA 4KHZA 2OUKA 2CE7A 1AGRA 1GL7A 2Y8EA 3T12A 2R2AA 3CR7A 3P1JA 3THOA 4MQBA 3BH0A 2EYUA 2V6IA 4OI4A 4WIAA 3KTAB 2AHOA 4Q7LA 5EP1A 3W3ZB 1OYYA 3A6PC 1P60A 2HF9A 1FUKA 2GCOA 2GK6A 4KAXA 4JLDA 1M7HA 2JJ2A 4QHSA 4DLZA 1IQPA 1CJVC 4LHVA 1E69A 2VQSA 1GL9B 4LC1A 1OFUX 1KMHB 3NBFA 3SR0A 1Q21A 4W5JA 3NIBA 1Q1BA 2C95A 2XOKD 2O8FA 4CEHA 2C9CA 2OT3B 4WAUA 1NVXQ 3K0FA 3GLGB 4CEIA 2XJ9A 1KKLA 4MGIR 4LYAA 3T34A 1VTKA 1JEEA 1R5OA 2O8BB 4ZDWA 1GAJA 3CPJB 2QM8A 3VKWA 3KQUA 5F2EA 2C78A 1Z6TA 3OESA 4J0QA 1WMSA 2XSZA 3FDIA 1YZNA 1F60A 4I1OA 3LVRE 4M2LA 3T1OA 1YZQA 1NBMD 2P6UA 4P4SA 1J90A 1OE0A 3OEED 1G8GA 1G16A 2A5FA 3NBYC 2F9LA 1FZQA 2HEIA 1NJFA 2ZSAA 4JKYA 4P3YA 1UDWA 4QGAA 3ZQ6A 4AYXA 4DDWA 4Q1FA 2GCNA 2ONKA 1N5LA 1G291 2ZI7A 4HDCA 5EE0A 2J1LA 1P7CA 3RC3A 4LBZA 1P9WA 3AKCA 4TQAA 3TIFA 1BH2A 4TMKA 2D2EA 5BN5A 1CS4C 3SHFA 5D3QA 1YQTA 1GOTA 1WA5A 4ARZB 4F92B 4M9QA 2PLFA 1S3GA 3B13B 4HAWA 5L3SA 1J2JA 2IYRA 3EIEA 1QHNA 4CEIB 2CMKA 2HV8A 2JLSA 3VR2A 4RKEA 5BYKA 3A1WA 3QI2A 4FMDF 2IXEA 2F3TA 3BWDD 3SYNA 1VG1A 1XF9A 1YR6A 3NBXX 2WOJA 1E9EA 1MRNA 2UZ3A 4FINA 3WHKA 3B6EA 5M04A 1Z0IA 1GDDA 2CE2X 1CRQA 2QQ0A 1D9XA 1Q1QA 2ZTSA 4IEIA 4YDSA 1TPZA 2EWWA 1XJ0A 5J4KA 5GADl 2IYSA 4ITRC 4DZZA 4P4TA 4DLRA 2N1BA 1PV4A 1RRFA 2JA1A 4UJ5A 2H8KA 2BMFA 4QJ5A 2YVUA 4MUAA 421PA 1TNDA 3GQBA 4KV9A 4URWR 5D3MA 5P21A 2R65A 1P2SA 3GPLA 1NVWQ 5JSZA 5KNCA 2IA5A 1E9BA 1DARA 3K0CA 1Z6GA 4I1SA 4ACBA 3ETLA 4A8JC 2I4IA 4IDHA 1UFQA 1S4QA 3K0AB 1R6BX 4MH0R 4BQSA 3D7MA 3GJ7A 1NN5A 2OLKA 3WBJA 3DVLA 4G5RA 3PG5A 4GFDA 3TVDA 4BASA 1E2DA 1TMKA 4BZPA 3RABA 5JI3E 5CIQA 4DCSA 3LY5A 5UKDA 2BBWA 5CB6A 1KO1A 1GFIA 3HWSA 4MYHA 4CYMA 3MWLA 4NYIR 1AKYA 3EG5A 2CVFA 3FPAA 1E99A 4LJ9A 5KSOA 4X8LA 5HZHA 3OIWA 2JCSA 5CJPA 2ZI5A 1MR3F 3L8ZA 4AIIA 2QRZA 3ASZA 3L82B 4NU0A 4G3XA 3V9PA 2RH5A 4DIDA 5FR1A 2G9NA 4IVPA 4KFTA 1N6NA 3W8RA 1G9XA 5JWOA 1D2NA 4XH9B 1S9HA 1XJCA 2AL7A 5G53C 2XXAA 1BO6A 1KOFA 2GKSA 1TQ6A 2C2HA 3AF0A 2CHVA 3B85A 3CNOA 2RHMA 3BIFA 4DEXA 1SXJC 4GZLA 3NG1A 2AXPA 4TT3A 4B73A 821PA 2NO7A 3I92A 4NYIQ 2GZHA 1FW6A 2EFCB 3OIVA 3IO5A 2YYZA 4LI0A 3MUFA 2A5YB 3MWKA 3B2EA 4PTLA 4L5BA 2ZRFA 3OAAD 3VR5A 3GLIB 2W2TA 2GXQA 1KK2A 3MGCA 2O5VA 4OK5A 4HYYA 4D25A 3W5IA 2DWQA 3UK6A 3ECCA 3THYB 3AVWA 3X1DA 1DOAA 3NHBA 2CXXA 2WOOA 3KKNA 4CT5A 4TYWA 2ZRIA 3K0FB 2VP6A 3K70D 1T3LA
chains in the Genus database with same CATH superfamily
1NQVA 2C7BA 1FNMA 1A4UA 1XCOA 1XZ8A 3VOSA 2Q5FA 4EZBA 2AMFA 4I0WB 4NAHA 2UZ0A 5JALA 5L4LA 2GGSA 5JAOA 3G5AA 4EY4A 3DD5A 2BHRA 4G5FA 1R0YA 2C2BA 2XKBA 3KU1A 3CURA 4U2GA 3RYFA 3W2FA 3WLLA 2EFJA 3HYNA 5E4FA 1UAGA 1R74A 2DX7A 5JNVA 2G17A 3R3YA 2QVXX 3DCNA 5CVVA 1SKQA 4ARCA 1UXJA 3C3AA 2C84A 3LPMA 2NTEA 4GOXA 4JEHA 4DWWA 3BFKA 1V11A 2MMGA 4EVIA 4J4TA 1Z5OA 1DXHA 1KH1A 2Y0BA 3MAJA 1L9XA 4ZC1A 4RD2A 1I51A 2BBOA 3VZDA 3WGIA 3AEQB 4G5HA 1XZHA 1X7XB 4ARAA 3IT3A 4HDRA 3UQYS 5JNRA 4AKSA 3KUUA 5HRCA 1S3IA 1EP3B 4F2HA 2O6LA 3D1VA 3VYSB 2VPXA 1Z2AA 2VSQA 4LN1A 3ZE1B 2EKPA 5JJ5A 3L84A 3BWBA 2QN7A 1AMNA 1YS9A 3EPPA 4ZVTA 4C4SA 2XUQA 2YQ5A 1SHLA 3DEAA 3EG9A 4H7IA 3NC1C 4NBSA 4OGLA 1GV0A 3PNSA 3FVRA 4OK6A 4RSMA 1AF4A 1ODIA 2ODEA 3BMNA 1OBOA 5EGSA 1CXZA 4W5TA 4BXOB 4FYYA 3QHPA 3RS8A 4S35A 1KIMA 2ISQA 1U5BB 3IJ5A 1JB9A 4HB2A 1U9IA 2IYQA 3DPSA 2D2FA 3KZKA 5DCLA 3QBTA 2IBSA 3H4MA 2ZUFA 2OZLB 1UADA 1P80A 1I0LA 4GOOD 3ZY2A 4K6FA 3TE6A 5A5EA 3C8MA 4JAVC 4PAWA 5JO9A 4V0SA 4JI1B 2B8TA 1HNXB 4NFHA 2J08A 3QKIA 4CIYA 1G6Q1 4YUXA 4BWFB 5GGXA 2YQZA 4KXUA 3O93A 4CLEA 2AEJA 4FIDA 4X3OA 3LRXA 4U7FA 5ECDA 3G8CA 4INAA 3CE6A 5BOSB 3U7IA 4LA4A 3B5JA 1EP2B 2BM0A 4G0QA 4D3YA 5KWJA 1ZH8A 3ODGA 1P2DA 3EZXA 2EKZA 1TE2A 4RNDB 4PQRA 4DBLC 1KIFA 1KU6A 1NKVA 2JASA 3NWBA 1CUHA 1SOUA 3HYCA 5JSZB 3UW3A 1MOZA 1IXRC 1C1DB 2C94A 3GOHA 3OHPA 4QL3A 3PDIB 4HPWA 2G9UA 1GVNB 3K9GA 2NO9A 1K66A 2OUIA 2PZJA 1JDPA 4DYVA 5FYQA 3CRZA 2F8MA 3EVBA 1FFEA 3EF3A 3MJFA 5C46F 3FOWA 1DT3A 1O97C 4OB6A 1EDDA 4Y9TA 2WQZA 2E18A 1D4ZA 4O8CA 2BFCB 2ZYRA 4W9NC 2QD2A 3B1FA 2O8NA 1ONSA 4YP6A 4MWGA 3INGA 3H4VA 3DBOB 5IZ4A 4M9CA 3CRQA 2BRUC 2BTQA 4KE7A 3OWHA 3HDGA 2IHVA 3AHGA 4D4JA 5JCOC 2XQVA 5JHHB 2VDPB 1GA1A 5JFGA 4UCWA 2FEKA 1AS0A 1L5RA 4QAQA 2CVQA 3GA0A 3O9VA 3OOSA 4G89A 3MIIA 1I2BA 2WF7A 3DYBA 5HUQA 1PFUA 1Y3HA 3SYTA 1XDBA 1ZITA 1U6IA 2CZQA 1QP4A 2CV1A 4FIZA 4MK4A 4DVGA 1D2GA 3LYAA 3Q7IA 2EEZA 3UPDA 1EP9A 4YWJA 5CEFA 5J4LA 4HBGA 1O77A 3VHXA 1T5SA 1E5LA 2OILA 1JHVA 3I6BA 4OSOA 5H70A 5KNBH 1L4LA 1XAGA 4ZPXA 1UK9A 1J9ZA 4MXDA 2ZAOA 3H11A 3EQ8A 4ITVA 4OQ4A 4RZHA 5AUQA 2WWIA 3A9CA 4ZOLF 4DWVA 3DW3X 5DHQA 4A8TA 3AERB 1SXHA 1M6HA 1DAFA 2Z57A 1V45E 1O0BA 1CNEA 3PXBA 4Q9KA 2QXTA 2HQ1A 3WMXA 4P38A 5ICFA 4JJFA 3I28A 4HS9A 5JISA 1K68A 3OOHA 4W9RA 3QOFA 5CT4A 4LFCB 3ZWDA 2GBFA 2YFQA 3LX4A 3PKIA 3WSTA 3UJHA 2PSSA 3T7AA 3SDSA 5E2BA 1LBEA 4FWIB 2GK4A 3C98A 3NM4A 4RD3A 3RR2A 3VI4B 2A7XA 2XKKA 2EKDA 1QUEA 2WC1A 3K7EA 3ZGOA 3OX3A 4JOCA 2BLNA 2I7CA 3CRMA 3OOWA 5JYCA 1NUAA 4FDAA 2Y2UA 4X91A 3PC8C 1D1SA 1Q7RA 4M8IA 4B8ZA 3LXMA 5JD5A 5IM4A 1OLSB 1XXHB 2YHIB 3EZYA 4GI2A 4QSMA 4QSHA 4YRDA 2PTHA 5JZ9A 1PJTA 2I4RA 2GCPA 2PMKA 3FX2A 2QNBA 5HF5A 4DR2B 1CUZA 1VQ1A 1USGA 3VH2A 1GHTA 3A36A 4WBNB 1VCMA 4U39A 3M6XA 4ZZIA 4MEJA 3WGVA 3G2NA 3L7JA 3UVEA 2PZAA 4B85A 5FPKA 5JQWA 1GGHA 4I9FA 4A2WA 4ND7A 1Z13A 5DI9A 4B3CA 4BMSA 1Z5NA 2XMDA 4UQOA 5FV4A 3RS2A 4GL2A 4XCQA 1QIHA 3PUHA 4V0OA 3INTA 4CKXA 3T3PB 3OIDA 3CLUD 1K8RA 2E3JA 1EQUA 2V3VA 4QECA 1T36B 3HKEB 3BE6A 3QEMA 5DOVA 5CXQA 5I6DA 2UAGA 3KOMA 1DT5A 2XRFA 3E0XA 3KB1A 1OC2A 3RBVA 1G63A 5HGXA 4RK7A 4WT7A 4K03A 2COUA 4AUMA 1AKWA 3KTAA 5J4YA 4FR2A 4JU8A 5EE1A 5K3CA 3C5HA 4C4RA 4XYLA 1RWXA 1DRWA 1YQDA 1WHTA 2BF4A 3FMFA 3UHAA 1HBJA 1EUCB 1FU4A 3DZCA 3R7NA 4IIJB 2ZJ3A 3ISTA 4E30A 1KSJA 1IMJA 3TIXB 5TS2A 3GAZA 1ULTA 1CDEA 1NI4A 3BD7A 4BRSA 1NDHA 4MVJG 3C3MA 2AV6A 3WGUA 4FFSA 4NJEA 4LXTA 2XLCA 1TD9A 121PA 4NMWA 2EDAA 1OGJA 1MFZA 3GFSA 3K0HA 3L1IA 4U3JA 4UHFA 1ES9A 3ZI0A 1JTVA 4KUGA 3AP2A 4NFLA 2YNMA 4BQEA 2OHIA 5EWMB 4X7PA 2OHHA 5JRJA 3AF4A 4DLYA 4F9GA 3WB1A 4YAIA 1RQ7A 5AK5A 1ZIXA 4AJ4A 4ZCPA 3UFXA 4M9XA 3A2KA 1FXUA 5B58T 3MMPA 3FSGA 2IUUA 4CM4B 2GH1A 3FSEA 2JD1A 3OD1A 2QP4A 2ZW9A 4Q9LA 3LGXA 1OX5A 3DBRB 1KYQA 1AQYA 1H2HA 1IDOA 2WNIA 3LECA 1XUOA 2PKWA 2GJSA 1JA9A 2X22A 3IKTA 3N2EA 1ZMBA 1VPWA 1A2QA 4ZQGA 4LQLA 3WG9A 4HD8A 1VCOA 2YBEA 3TLZA 3N05A 4AJJA 5K6AA 2XNSA 5F5XA 5ED4A 4MITA 2OD9A 1GPYA 1MNQA 4HX5A 1HT3A 3ENVA 5AM0A 1UQRA 3NJ8A 1HURA 2I0FA 3KHTA 4X1IA 4U6NA 4EA9A 1V95A 1PJRA 5JEDA 4KLZA 2HWXA 4YAJA 4RAQA 1C7EA 4DQKA 4M0CA 4HRYA 3LIIA 3SSNA 4F4HA 1QIDA 2QUIA 4JA2A 2QF7A 2IBTA 3ZD7A 4PWYA 4B71A 4X71A 2QZJA 4CMBA 3WGYA 1DKNA 3KPUA 4FYIA 2DERA 3M5CA 4WN3A 1QGED 4URVR 3VR3D 3I83A 5JO0A 3ZN2A 1KMHA 4LHSA 1D2RA 7GPBA 1Y8ZA 5AQ1A 4QQRA 5JAHA 2QW0X 1EX9A 1U8ZA 3O4VA 4OJKA 2JGNA 2NV0A 2PUBA 2GCOB 4MWTA 3T52A 1M6YA 1VIDA 5C7YA 5HYVA 3ZS8A 2WVAA 4QDXA 3WNZA 3SR3A 1ZD9A 4UNRA 3H8JA 2Y0DA 2EX4A 3K0CC 1LH0A 5IYZF 3WK8A 2GRAA 3ROXA 3AB7A 4W82A 1XZNA 5CLIA 1GPH1 5FOUA 1CIJA 2A0WA 2H52A 2PKXA 3A6KA 1OB5A 1G3UA 1E3JA 1U5CA 2I1WA 1R9GA 3GBSA 3KQVA 2FQXA 2B7BA 3FCSB 4MQUA 3LUPA 1DHRA 4NK5A 3K9CA 3LHDA 3PR2B 2C4TA 5KYKA 3K0BA 1KRHA 3JARA 5TQ0A 4R1TA 1RBQA 2CL0X 3NEJA 4M99A 3B82A 4Y9RA 4MI6A 3HDJA 1MIHA 4JQSA 1VJGA 3FM9A 4CT0A 3RADC 1PFKA 1BC5A 1T4DA 2FPPB 2E55A 2FOIA 1H2ZA 4JENA 1U7ZA 4KYVA 1Q15A 4IPTA 4UE2A 1ACJA 4ZVRA 4ZYTA 3QU4A 2J48A 4FSXA 3WJAA 2XCLA 1G64A 4WOPA 2BLLA 3CKLA 1TVKB 2QEQA 3EFEA 4EHAA 4ZI2A 3LA8A 3RTCA 4QU8A 3G0HA 1T9GR 3QG1A 4H16A 4EO4A 1FJ2A 1ANKA 3BSSA 2RGRA 2JFUA 2OXCA 3EE6A 4A15A 2J07A 3I52A 1N92A 3N7AA 3FDFA 4XXHA 3VM6A 4D96A 1ZVVA 4OUKX 3SEFA 4S2EA 1H42A 1XZFA 4KQIA 2Z56A 4ZU6X 3HABA 1KSGA 1M3SA 3QENA 1DIAA 4E4TA 2QX9A 4EHIA 3DZHA 3VYUB 1PX2A 1QKIA 4B48A 2X86A 4LVCA 5B2ZA 1E8DA 1GIAA 4WY5A 4R9NA 3RLIA 5KINB 3EZ2A 1AZWA 1MDFA 1YR8A 4Q03A 2HQSA 4UAVA 1YJBA 2Q1XA 3UFXB 1HR0B 3THWB 2RHOA 4FONA 4DDUA 1QFXA 4C3UA 3D64A 4GBGA 4XR9A 1USVA 5KYVA 1I1HA 3W1WA 1JFFB 2IUFA 1OC4A 2ESRA 5BV2P 4GPD1 3ZWAA 1E3WA 3SSOA 4EVRA 4KLCA 2E4UA 5L9AA 3IP5A 4H1HA 3DFMA 3JSXA 4NMMA 2BUBA 1UINA 3BRSA 3G6KA 3TFQA 1MEJA 1M1XB 2YN2A 2J5XA 2CDAA 3I9NA 1LDEA 2C8JA 5H4HA 5THKA 5LU9A 4PHFA 3WGTA 3UCEA 1GXSA 3A1TA 4YAUA 1NY5A 4RF5A 3ZWYA 1WSDA 4X65B 3C6XA 5D84A 2M1ZA 2NSJA 4HAYA 2FKNA 4QLOA 5TMBA 2R8ZA 2GA9A 1I4TD 4EAQA 4PRKA 1Y9DA 1EG7A 2VP2A 1P77A 1Q3HA 4YRGA 5AI9A 2DFPA 5TQJA 2Q2QA 3G0BA 2GUWA 3SFVA 1O6FA 4MV5A 1KSHA 1N8SA 5AVVA 1WLSA 3FWKA 5I7SA 2Z5LA 2HOQA 2JZNA 3W9SA 3S81A 2XUIA 4NENA 4B33A 4BKMA 4FGUA 4YI5A 5LZ7A 2H1FA 2O7VA 4OU4A 2QT1A 3AK4A 3WYGA 3I6ZA 2XBUA 3MCUA 3UWMA 5A5FA 2E4AA 2DCUA 1LW7A 4PHTA 2WLTA 3SKXA 1KI2A 4IVQA 4XJSA 2RJOA 1P45A 4XB2A 1Z4KA 2GZ2A 2VK1A 2ZDQA 3EB9A 1LUAA 4MVJA 4ARZA 5KU1A 2VXBA 1DJOA 3W3AA 2DLCX 1T9DA 1XVVA 3ONEA 1OAAA 4B6JA 4JI4B 5EJMA 3GDHA 2C57A 1BYUA 1G8JA 3H2HA 3REOA 4F56A 4YQZA 4OJTA 4YRJA 5K09A 4Z4QA 3DFZA 3WGMA 4CR6A 1SZDA 2PPVA 3EOBI 1E79D 3I04M 4B7ZA 3SS8A 5IXJA 5T8KC 2J33A 2Y4OA 4WL0A 3KZVA 1RRPA 4Y1EA 3LY9A 3KSDO 4O63O 2DBYA 5EXTA 5FXMA 2IPLA 1CE8A 3Q6IA 1R6DA 2V7WA 1D09A 2Q1SA 3QWIA 5FNZA 2YWEA 2XXAB 3IJRA 1S96A 2R6DA 3HJBA 1FYDA 2ID8A 3RVNA 1JB1A 2GJ8A 3JQ7B 1KI1A 2ZBUA 3VZBA 1J20A 1GQYA 4DCJA 1VC2A 3M5WA 4FUQA 4O1MA 1KGDA 2V98A 4K3VA 5HHTA 2YYYA 3AP3A 5FD8A 2RAVA 4NDAA 5KSYA 5FOXA 5CR9A 4LNUB 5EKTA 2PZGA 3L0BA 3BB3A 3MFYA 3ZU5A 2VVTA 4LXYA 3LBIA 4RANA 1Z08A 4B17A 2Q8QA 4HZIA 5U1PA 4MAAA 3LGSA 3KXLA 1Q1AA 4NYMR 4OXIA 4BO0A 5CXSA 4LHXA 1YQXA 3AFIA 1Z34A 4RU1A 1Z5ZA 1CU1A 2I4TA 1G5QA 1IHXA 4XDZA 4CCAA 1SKUA 1CD5A 1XKXA 3PL5A 2BGIA 1CDOA 4RZSA 3LM8A 4AFNA 4OQDA 3IUJA 1ISIA 1VMDA 4AKHA 3R7FA 3FNFA 1VMIA 3QEAZ 3AXSA 3NT5A 3L1KA 3PDHA 4D2IA 2QSZA 1CRZA 1K2WA 1Y6RA 4D79A 3VH1A 1ZUD1 1ZYUA 3TD2A 4CT4B 2QD1A 3I64A 2O14A 3N6XA 3R8XA 2VDJA 1VI6A 3QJ5A 1Q7GA 3JVEA 3P0RA 4CLRA 1QR6A 1UBEA 1TF5A 4E03A 1NBMA 3N76A 1V39A 4C05A 1ZXLA 2HK9A 4TMXA 3VPGA 3RFXA 1MFPA 1JTEA 1SU4A 1E1YA 3EGDB 2PFGA 3GFRA 3PQEA 1C1DA 5I8ZA 5IHPA 3L79A 4LJLA 4PY2A 1NL3A 2XE7A 3AINA 3S2EA 3G49A 1ZD3A 4C78A 1I80A 2GCGA 3CN9A 3DBLB 1O89A 3M6FA 1FC0A 3D6TB 4CM7A 4X7MA 1R5NA 3UMVA 3LY7A 2I7DA 2QN8A 2VSNA 2XYQA 1N3LA 4QYIB 5FUYA 1EQAA 4INZA 5CEEA 2GRUA 2BTOA 1DNPA 3MJ4A 5FIUA 2R6AA 4QULA 3GWZA 3LW8A 2COKA 3SZMA 1ECBA 4FLEA 2NUAB 4BNWA 1PQPA 1UXIA 4BN5A 3HPRA 1OXVA 1L7AA 3E23A 3TXAA 2H3EA 4U02A 2XCOA 3TRKA 2EATA 4YBZA 3JQ8A 4C20A 1RAFA 2YX1A 4R68A 1PS9A 2H59A 3P9SA 1JHDA 3OT1B 5DV9A 1XZPA 4BMCA 1IBKB 5IW8A 1B23P 5AVTA 1RPTA 4MPJA 3IBGA 1SOMA 1YBVA 2RD2A 3R4VA 1B93A 4OATA 1RJEA 3N5KA 4YV1A 5HBRA 2GAAA 1GZDA 3BG5A 3NEPX 4LXIA 5DNEA 1Y6ZA 4TTSA 4BVLA 1JILA 1OH8A 2IUEA 3T4EA 3E3LA 3H8SA 2Z5VA 2VJOA 1PR3A 3IESA 1XZGA 3IAS1 4Z9YA 1QQ5A 3DBVO 2V5UA 4HH3C 1X42A 5H9VA 1FNBA 4B4VA 4MAMA 5AHXA 5ECWA 1ILWA 2UXBB 1E58A 1AZSC 2VYND 4DRXB 2IYFA 3MCVA 3D81A 3TR0A 3TLMA 3AEQA 1YHNA 4UTVA 4MVXA 1Y5MA 2BGJA 2HUNA 2OO7A 4DHWA 4UTZA 2EWMA 4KVAA 3VV2A 2E4XA 1UBRS 1L1QA 3ILHA 3TOSA 3U49A 1IVNA 1MKYA 2KMLA 2R4UA 2CXPA 3CTPA 1FDVA 1QG4A 1ID8A 2B1IA 1E2PA 3F6SA 2Y0CA 1TZKA 5K2OA 1Y5NA 1F2VA 1RP1A 3FMPB 1GRQA 1ZEMA 4R0MA 2VJKA 1AHPA 4XYGA 4BNUA 4C0HA 4B3IA 1O95C 2ZDGA 1JLSA 1RQPA 3KSRA 1B8NA 4NOKA 3PNBA 4V0RA 3AFOA 2JLBA 3HUTA 3CE9A 2M6RA 3OP4A 3CBGA 2BIFA 2CFSA 1N34B 1XA0A 4XQEA 1S89A 3IX7A 1HWYA 3U31A 2XB8A 4L72A 4R9VA 3PQFA 4LBVA 1DHTA 1OI4A 1P5ZB 2KLBA 1D6NA 4RA9A 5DX1A 1H4TA 2VF7A 1WV1A 4MUBA 1NGSA 1P39A 4RJTA 1XZAA 2GYVA 4HRVA 4B81A 2JAOA 4TLLB 1KU0A 2UYOA 1KR5A 3RAFC 4LF5B 4AUKA 3UB4A 4DL9A 2YV4A 3EXIB 4MS1A 4PU0A 4AY5A 2B6NA 3MK31 4YALA 1M1YA 1XP8A 1G5RA 2DM6A 2EV9A 5CYFA 5HPYB 4F6RA 4X6LA 1U0RA 3OLYA 3L7MA 2CSUA 4RE6A 2XMRA 5DYGA 2PUCA 2ZANA 1DU4A 1N6OA 2YZMA 4HPJB 3UMGA 2J6IA 1EFRD 3BJMA 1TZCA 2E5LB 3RFUA 2ODTX 3C6KA 2ORYA 4V0KA 1D2AA 1S2LA 2HO5A 3PEVA 2LDXA 4Y7CA 1Z68A 3EUEA 5G1OA 4B2LA 1J1UA 2Y1EA 4RIIA 2J7PA 3O1HB 1P62B 2HO4A 4K1LA 1I7LA 2P9YA 3EMKA 1BE0A 1R50A 4BVJA 2OYRA 1BXZA 4AVYA 4COKA 5TMEA 4ECEA 5A9TA 1JFSA 1Z2NX 5JDCA 1AUVA 3HJFA 1BKSB 1L7EA 2BJHA 3PUXA 3ACBA 4K9KA 1YZFA 4RD0A 1WL8A 4PSUA 4Y1FA 1E2MA 1I4OA 3VC1A 2J41A 4B35A 4C7JA 3BTVA 2EIXA 1ZW1A 2QMEA 3E35A 4YONB 2FN3A 2O2SA 3VV3A 4MTCA 1DQSA 4XOUA 3X1JA 2ZRAA 4WXYB 1SG9A 2WF6A 4RHXA 1CDDA 4PSAA 3KDSE 3W05A 1HGXA 3FUWA 2PKQO 3B3FA 3MCAA 1P2VA 4FDTA 4C7OB 3KDAA 1JEOA 1SG6A 3WDSA 1KTVA 3V7NA 4HJRA 4A8PA 2DEUA 3F6RA 1SOAA 1QO0D 3G23A 1II8B 4XIFA 5B1SA 5SZJA 3WKEA 1KWKA 3U39A 2O4CA 1ZU5A 3ZU4A 4CGZA 1USUA 1QMPA 3RRMA 1ZRSA 4EKGA 2YV1A 5EHXA 3MD0A 5ENDA 2EJVA 4B9AA 4N41A 2QW8A 2NO1A 3GELA 3C3PA 4DVJA 1NQWA 3ZI4A 2IQ5A 1YHYA 4K6KA 5EHQA 3W5CA 3AVVA 5F1OA 3VKHA 1CIVA 5CBPB 3Q7SA 1T2VA 4WN9A 1XTZA 1YS6A 4HZUB 5F33A 5TGTA 5AICA 5LD2C 3E82A 4TQUS 5LQCA 1T5IA 2AN1A 4O2AB 3HHPA 3LKBA 3A6HA 3NKFA 1E0AA 2JCBA 1QPZA 4MDEA 4ER0A 3T5CA 4BIIA 4NXNB 4W4TA 5M3BA 1DKUA 3PJDA 2IZOA 4MYCA 4LY3A 4FDUA 5JVDA 4HEA6 4UMEA 5EP4A 3EZLA 2XCSB 2FG5A 4N0EA 4I19A 4TV9B 3UG6A 2IS6A 4ZKEA 5JSHA 2J4DA 3Q3HA 3U17A 2JH3A 3I32A 5IM5A 3HB7A 3G68A 4TWIA 3OJXA 3KE9A 4I5FA 1NBAA 4P31A 4K0KB 4LZZA 4ZOLB 5GGYA 4CMKA 1A8PA 1I2ZA 1YQGA 3C6MA 2ZUDA 2HK8A 5KOHA 5IRCD 1OQAA 3L77A 3KR1A 3QFTA 1YAHA 2G67A 2QM0A 3E3AA 4QQKA 5DTEA 3SXUA 4W1PA 5HM8A 1QK4A 1JFTA 2JI7A 1OBHA 3R5KA 4MUMA 3KL2A 4TL8A 3N0RA 3LT2A 2IYNA 2EBWA 4J1TC 3HJRA 3WBKA 4YCDA 1KJIA 1ZZGA 2C2OA 4TRRA 4ZV4A 4GGMX 4XVHA 3HO1A 3EVDA 4XI9A 3GFTA 2WYVA 1EFKA 5ALPA 1IRIA 3ZS9A 3A26A 1M54A 4KGVA 1QIMA 4AMUA 1NF3A 4ZZ1A 4G84A 5LA6F 1X15A 2J9ZB 5CDUA 4R71A 2V6MA 1QTQA 2Q4EA 4FZRA 1U9CA 1ZUWA 3PSAA 1TJ4A 1I10A 3HCNA 3F90A 1KMIY 1PQWA 3IHWA 4YA6A 1PWXA 2WKPA 4JASB 1AURA 2HSGA 1T2UA 3JYOA 3E61A 1U8YA 3KK0A 3R7AA 4DMLA 2VHZA 4OX9B 2AH5A 3F5DA 5HF8A 2JDIA 3KFVA 1EP1B 4EHNA 4Z4GA 2REQB 2OB2A 4JC0A 4U6QA 4TMFA 2H1RA 3C3EA 3DQPA 2ZSKA 3OQ1A 5BRAA 1PG0A 2BUCA 3CUKA 1F12A 1GZ5A 4G1EB 4HAIA 4MJXA 4PLWA 1PT5A 3TZQA 1M1NA 2HU5A 3DUFB 1DKRA 2J3LA 4ZQIA 2NWQA 2XDAA 4QM6A 2A6PA 2PX2A 3L0SA 5TEWA 3GQBB 1J97A 3CUEF 1SRRA 4DANA 2IFTA 2VJQA 3HCBA 5IBRA 3KWFA 1GA4A 2CK3A 4A6DA 1R3UA 4DF3A 1A9XA 1N2ZA 1N3BA 1W44A 2PY6A 4LHYA 3FSRA 4NRDA 1NTRA 1Y5IA 2O2IA 4IIJA 4UDYX 3OCJA 4QXAA 4E11A 4JJKA 2PVPA 5I3ZA 1JLKA 1J70A 4IWYA 3UF0A 5JZMA 1B73A 1QRRA 1XFAA 3MPOA 1OSNA 4BLOA 3G9QA 3G9XA 3QOYA 4HAUA 3JYLA 2PEYA 5BRJA 4AKIA 1RPNA 1R9JA 4HADA 1ZK4A 3LBNA 1FVXA 3QWHA 5G3ZA 2QTMA 4GMDA 3TTWA 2OXRA 2OQIA 1JR3E 5HZGA 4RXTA 1L1FA 2IEAA 5FWXA 3DXFA 6REQA 3Q87B 2Q8NA 4D9JA 5JAIA 4RFSA 3AUAA 4H0FA 5K5EA 4ZN6A 5KEIA 4ML3A 3NNNA 1N5MA 3GJXC 4JCOA 1TVKA 4F7DA 4PPFA 5COAA 1K4YA 5TV2A 5FJJA 3SC3A 1RR6A 1AGYA 1OFIA 2OL4A 1VYUA 1YJQA 4H7HA 4X20B 4BLWA 4CETA 2G76A 3MS2A 4XUGB 2PL3A 2Y1XA 2OFXA 1ZM7A 3H17A 4I4NA 5ETJA 1IWPB 2XMSA 3DV0A 1SQ5A 1TYAE 3GUZA 1Y3BE 4B79A 2G9QA 1XRSB 5B64A 1EWRA 1DWPA 2ZU6A 4MUKA 4A1OA 2WT4A 3BE8A 1CY2A 3BQMB 4K8RB 4UC0A 1X7YB 1AA9A 1F5SA 1U2GC 3PJEA 4PTZA 1WMDA 4RD1A 4DQVA 5J58A 5JUWA 1WQ3A 4V1CB 5CA0A 2ODAA 3DAGA 3LHIA 4J7XA 5K1ZA 2P6PA 2O7QA 3LU1A 3FFTA 3PDJA 2IY8A 4C22A 1UFOA 1FK8A 1VECA 1WNFA 2CXQA 1HMYA 2G09A 3TQOA 4G36A 5CX1B 4R2MA 1SKYE 3FOAA 3HXKA 1I3KA 5CCBA 4KLNA 1GKKA 4D7AA 3DE1X 3UK1A 3ICOA 5B1EA 4OHMA 1Z7BA 4KWIA 3D8HA 2R8PA 4BNFA 1KJQA 1KE1A 5TQVA 2X2OA 5AKGA 4OY3A 1Z6YA 4HEA1 3OLCX 4B09A 2Q2VA 3O7WA 1PJZA 3LUFA 1JA0A 1C4XA 2ET6A 3LP6A 1ETUA 4OHCA 2QXYA 4MQFB 5KTKA 3DUWA 3PVCA 1WVIA 1RJGA 3G2KA 1JEAA 2QD3A 4J2HA 4YJGA 4G5XA 4I50B 4NBLA 1Q11A 5DM0A 5F7JA 3VUFA 3W4IA 4EKYA 2MSDB 4JXJA 4L9SA 4CGYA 3QJGA 3V1TC 3PTLA 1RIFA 3E1KA 5AXBA 3DYIA 3WMGA 2TMYA 1O4WA 3THYA 1QV7A 1QIKA 3O75A 3EXAA 2Q0HA 1MQ9A 2IYPA 2VS1A 3FYUB 1KFKB 1VPVA 1EA5A 1MX5A 2AJCA 3BRCA 3GROA 3HA5A 3L6EA 4QOIA 3FMOB 4MW6A 4EJSB 3GG2A 2XRZA 1L7MA 3HKDB 4QJIA 1R4NB 1ZUIA 2AR7A 5LYYA 3UJ3X 4XGIA 4ZQEA 3LL4A 3C7KA 2G71A 3JPWA 2O1SA 2CXNA 3ZVRA 4N7BA 3BT7A 3R9WA 3LPLA 2YMLA 1ICEA 4K1XA 3UK2A 3BFXA 4C43A 2AXQA 2ZRJA 3D6AA 4WJZA 3E53A 5B4UA 2Q5CA 5LIRA 3BMCA 2OWEA 5C1BA 4V1CA 4XJXA 3HJHA 3KL4A 1DRJA 2AZXA 4MX8A 4OSEA 4UVEA 1MN6A 1YRLA 1C3XA 1H94A 4NCHA 4PZYA 1JEYB 3L0IB 3IPXA 3R7SA 3ZV3A 1DMRA 5CLGA 3VNBA 4DC9A 1KEVA 5BWBA 4OJNA 1RHMA 2ZTVA 3KC2A 2IZ0A 1Q0RA 4YMSA 1T5OA 2I4NA 4NX2A 4LSMA 3TZLA 1QX3A 2HREA 3D3WA 3V2GA 1T0PA 3BXZA 1JLLB 2W4IA 2HJGA 4YMLA 3RARA 4DJTA 5A4JA 1DFHA 5GTDA 2Q7OE 4TLCA 4PR3A 1EFCA 5DDIP 3A4NA 4X90A 521PA 3LHKA 1Y5RA 2J3JA 5BUQA 4AN0A 4KQKA 3S40A 2K6GA 4D26A 3MINB 2OZLA 5AJTA 3T5TA 4UOEA 2QU7A 1H3EA 2XY4A 3NHFA 2EQBA 2OEPA 4D6XA 1P7YA 4RHCA 2V8BA 1Y37A 4FHGA 5BSMA 2PE5A 1G8MA 4HEHA 4YYZA 2BEVA 4N0PA 1BXGB 1D8AA 1Z47A 1F38A 3N9IA 3RIEA 4OV6B 2YV3A 1JR2A 4BV9A 4POOA 4UOZA 1TF7A 3ZE6A 3HXQA 3DKPA 2FXVA 4LPSA 4O1IA 4EVQA 3O1IC 2PIAA 4NZYA 5L6LB 3NTVA 3RSCA 3CLTD 3A27A 1GNLA 3NH6A 1NLZA 5D3MB 1ZAYA 1H1LA 3CH7A 3H1AA 5CYGA 1U8XX 3L8MA 1E9AA 3NASA 3CX3A 1BQEA 3KZ1E 3T7RA 1B14A 4REQA 2Y67A 1Y5LA 4HUJA 5F4BA 2QTWB 4X1KA 3H9JA 4QAJA 2P67A 3G0IA 3CXUA 4MINA 1CERA 4PRYA 1QTIA 4ZT5A 1E2GA 1XTRA 1CVIA 2I6UA 5IVPA 1ZQ1A 1IH8A 2FGKA 2NVOA 4J91A 4F1JA 5JSFA 4PLYA 1V7CA 5C7LO 4MIEA 5DHTA 5HKAA 3UT0A 3RS3A 1W6RA 1BNCA 2QJRA 1M2JA 1EFLA 4RJKA 3S7TA 3SPXA 4YO8A 1EFRA 5G02A 3S2SA 1XNJA 5LDGA 2FAXA 1Q7CA 3AUKA 3E22B 3L9XA 3DE5X 3QE3A 2D4HA 4CTJA 4AZ0A 1U3TA 1NQAO 1ZO8A 2XUZA 1SCUA 4J6EA 2J7PD 5DT9A 5JZOA 4V03A 1HZZA 3T5GA 3QVWA 3AR7A 3EIFA 1JHQA 1X14A 4OI1A 4AURA 1AIPA 1SO8A 2C9ZA 4RE5A 2WWTA 3HZHA 4U9UA 1ORRA 3VA7A 2ICAA 3RBZA 1IJFA 3ZDFA 1AXEA 2CNWA 4RAOA 2HPAA 3MMSA 4P36A 5DNAA 3WQQA 5MFPA 5BYBA 3NORA 2E6UX 4KIWA 1KEEA 3NV7A 1JBEA 2A9KA 2BAGA 2JGKA 2ZYHA 4NHOA 5CURA 4YMWA 3WO0A 4MUGA 3V4LA 1F06A 5GOZA 2XUJA 3CC8A 3T7SA 4YJDA 5E95A 2VWGA 5BV8A 1KZGB 4EVSA 4YLYA 3K70D 2AJ8A 3GLFE 2A2ZA 4YMGA 4GKBA 2LD4A 1AGPA 2XD4A 1C14A 2YRXA 1KJ9A 3DNMA 2MCFA 3P96A 1TCCA 4RBNA 3BFPA 2HB6A 1K86A 1W0JA 2O3UA 2OE2A 3QKRA 1XN4A 4I8XA 4MR8A 4C4YA 1ZUHA 4QODA 1Y82A 1UDXA 3WLIA 1ZJ4A 5AM5A 2Z4SA 2WWRA 5EJEA 1C8VB 4BVBA 1B6RA 1DRKA 1PEAA 1X1RA 3HDTA 3FHJA 4M9UA 2PN1A 4MV3A 4BZWA 1UMBA 2BJWA 3V4FA 5FLXA 4IZIA 4M1MA 2WU0A 2E5FA 3HEBA 3Q15C 4KO4S 4AKGA 3DE7X 5B6IA 5KTTA 1BD3A 4RD6A 2C2MA 3EWIA 3GNSA 1E4VA 2QL6A 3HR7A 4FYVA 4UFNA 4E0BA 4KPEC 1NPTO 3KOYA 2CNOA 3SMVA 1EEXB 2POCA 2XRYA 1FNSA 1J24A 1U4OA 2W93A 3LBFA 4GXRA 4KE6A 2IY7A 4WESA 4TROA 3RVKA 1U80A 2IT1A 2QTVB 3QKUA 1SC1A 1U2PA 2IDMA 5TPWB 1RBZA 3FE2A 2VK8A 3FHOA 4H2DA 4PWZA 3EEYA 1TQ8A 4CDGA 4LZLA 2VF5X 3S1LA 4X8HA 1U8TA 1E6WA 4DSAA 2PKRA 1ZN8A 4WJKB 4EFMA 2CLSA 2GRJA 2WWXA 4FC6A 1VHWA 4MEAA 4NATA 1RW4A 2WU1A 3IQDB 3I5YA 4L5AA 5EUQB 1G98A 1XELA 2C4HA 3ZV6A 1Y8AA 4TZTA 4TLEA 4OU5A 3V4OA 3H86A 2QRLA 3IEXA 2XW6A 4UHHA 1R0ZA 2O4UX 2AX4A 2Y9MB 4YQEA 4ASUD 4NCBA 1MCZA 3PC2A 1ZBDA 1O8CA 2IDKA 4HLDA 2ZJ1A 3AESA 1J56A 3KLMX 5IMBA 2FP4A 4BLQA 5IG2A 3ZK9A 2QTCA 4GZMA 3VZPA 1XEXA 4FFBB 2AF4C 3KYCA 2O2YA 2HAEA 3T5BA 4EUHA 3ZE0B 2OCAA 1VLVA 2X4GA 2AKYA 2B4YA 2G08A 2XUHA 3IHLA 1YR7A 2KB0A 5ILQA 1L4UA 3TIIA 4EENA 3UMRA 1RC0A 1TZJA 2GXUA 1W5EA 3VPDA 2A78A 4QXMA 4BKPA 4ZGBA 2AK3A 3IV9A 2JH8A 4TN1A 1SHTX 1XMJA 3SYKA 1TKBA 3KT0A 1NG9A 1K6JA 4IAOA 1D6MA 4UPVA 3LQ1A 2BMJA 1Z4NA 2PFSA 1UAAA 1MC1A 2EF0A 3AU9A 3P52A 4R3UC 5C8YA 1P4RA 2VWPA 1ZD4A 4ZGWA 2N1MA 4E5SA 5AW4A 4WZBB 1IY0A 4C6RA 1PJCA 4BLTA 4B2YA 2HMWA 4EAAA 4ENPA 1DXYA 4QPCA 5LDDC 4YBRA 2ZIWB 4D45A 4RTMA 3GL9A 4DB4A 5FEUA 3ANTA 5TT1A 1QDEA 3RF7A 1SKAA 3IUNA 1PKXA 5GVRA 2J3MA 4DSOA 4C14A 2HXYA 2B20A 2H1WA 4NFYA 1YA8A 5ELXA 2GAJA 2MYTA 3EVEA 1PFVA 1XTTA 2FSUA 1ZKDA 4IHJA 4JC4A 4US0R 5E2AA 4EG3A 1O54A 1AKRA 3FYSA 3MTQA 2GDZA 1UKZA 2FSPA 4H0NA 1EFAA 5FBHA 4Q01A 4P58A 3NTLA 5D3ZA 1L7BA 1U8EA 3OLVA 5GV8A 4QJ3A 1CJBA 3AHIA 3WVNA 5K2MA 4KR7A 1CE8B 1JE0A 2CVPA 1I7PA 3IQWA 2JVIA 1C3VA 3KYJB 3RHFA 1VGVA 3KR0A 1J1IA 5EGNA 4F9EA 4R2JA 4RUKA 4TLAA 2MINA 4HLUC 1V8BA 1RT9A 1PZNA 1LV8A 5EWJA 5KHOC 4P0PB 2CMDA 4PINA 4HWKA 2GSWA 4HX2A 4N8SA 7MDHA 3JTEA 2PKQP 4D42A 3NKLA 1WHSB 4XUEA 3Q7EA 4YJKA 4Z8XA 4EQ6B 5JFOA 3KUCA 4RULA 3CLSD 4UBIA 4CL3A 4LGCA 1XCGB 5DM2A 5BWMA 5H0IA 1DV1A 2DQKA 4IW3B 1B0PA 5FV7A 2GJ4A 4EPYA 1RXYA 3BCUA 3F3SA 2G7MC 2JF0A 4AG6A 3WNVA 2IBMA 5KTSA 1QIGA 5KYUB 1EX6A 3CPSA 3EC7A 3UICA 3WWEA 1TC1A 4X5OA 5JS7A 4LDJA 2VPWA 5CT8A 4FNOA 5HILA 5IZCA 3QELB 4UZSA 4ID3A 1E89A 1YOVB 2QN9A