1Z0NA

The glycogen-binding domain of the amp-activated protein kinase
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
b'ARPTVFRWTGGGKEVYLSGSFNNWSKLPMTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-AMP-activated protein kinase, beta-1 subunit
publication title Structural Basis for Glycogen Recognition by AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Sugar binding protein
total genus 16
structure length 87
sequence length 87
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16561 AMPK1_CBM Glycogen recognition site of AMP-activated protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1z0nA00
1W8NA 5D72H 1CZ8L 4OZGE 3DRQA 4BQ9A 5CD3B 3LH2L 1FZOB 3CVHB 1GZQA 3SHSA 3OHXB 4N0YL 1OLZA 3QJHB 3C60B 4YNYA 3U36B 2NPLX 2KUTA 3I9GH 4P5KA 4OLWH 5E8PA 5EU5B 3BH8A 2X1XR 1J0ZA 1OB1B 4KV5F 2DDQH 1CXFA 3OZ9L 4MWFB 3RWJA 3DBXA 4KZDH 3I75A 4F7EA 5EZOL 2YRZA 2X40A 3HE7C 4WO4A 4Y4KB 3BW9B 4IRSA 4PJAA 3OXRB 1V3MA 5IVZA 2O61A 3ARUA 3HI1A 2KPNA 4LPCA 4JRXB 1IBGL 3E6HB 3SKJH 4LP4A 1OAUH 4F58H 3MODH 1EHLL 5EU6B 2B1HH 4M6NH 2EH8H 3I2CH 2B0SH 3ZDXF 3M17B 5I1CH 2IALB 3F7YB 3FJTA 1FVDB 2BVTA 1CD0A 4TN9A 4YEFA 2OSLA 2MPAL 4WJ5A 4LAQL 4GG6A 5CAYB 3VFNA 1VHPA 4ZTPL 2FD6L 2FCBA 3PNWB 4HGKC 1RJCA 5KW9L 4OCXH 3DHJA 2FJGB 3STLA 1GOHA 3I6KA 4AG4H 2X1QA 1JFQL 3SDXE 2GY7B 5JDSB 1NGPL 4MDJA 1DQQB 1DEDA 5DUBA 4HWEL 3RVUC 1HILB 3HNVH 4AM0A 2A77L 4FQCH 2ZG3A 4JFQB 3WNNA 1DBMH 1CL7I 4PTTB 2XQBL 2ICWJ 3B6SA 4HBQA 1F58L 3U1SL 2HKHH 1DBBH 2XQYG 1QRNE 4TSBH 1W0YT 1ORQB 4G7VH 3A67H 4M5YL 1I1AD 1MUJA 1V7NL 4G43B 5D1XD 2KQNA 3M1BB 1MCQA 3LHPL 3ZDYE 3KPRE 2V17L 2IJ0C 3VXQA 3WEXA 1U92B 3B5HA 2P7TA 1QFWL 4M62H 1CVRA 4M8VA 5IW3A 4OCYH 3MLWL 2J6EH 4NQTA 5IGXL 5B8CC 1LMKA 1CLCA 2JJWA 2W9DH 2RCSL 5BMFL 4XP5L 4G9FA 1AI1H 2NTFA 3BP7A 3KPSE 5E00B 4G5ZL 4HXBH 1H3UA 3VXRE 3FT2B 1N59A 5JO5A 1T66D 5E94A 1FE8H 3GSNL 5TF1L 1LEIA 1Q9OA 2V5SA 3IU3A 3DLQR 1DJSA 3BMVA 3OKOA 4Y4FA 2EC9U 4W4OC 4MA3B 1Z0MA 2OTWB 1AR1C 4JHBA 1NC4D 1YMHB 3O6FD 2GITB 4K7FA 5GISL 1SHMA 1AGDA 2CQVA 2OZ4A 1AHWA 3QPXH 4EUPA 4Z76B 3TPUA 1IEAA 1IAOB 2R2CA 4UT6H 4HUXA 2IMNA 3BPCA 3GMNA 2WV3A 4NM8L 2ZG2A 5LKNA 1P4BH 1F4WL 2VLME 1BVLA 3RUGF 2E27H 3KDMB 3DXAD 1G7PB 1MELA 3UTZA 4XT1C 1FGNH 5EO1B 3UJTL 1IM9A 5FUCC 2XA8H 3VXUA 2YN5A 3QUYA 1KJ3L 3PDOA 2X4SA 4GXVH 1NAMH 3L3HA 4KY1L 1ZHNB 43C9A 1INDH 4ZFGH 1UXWB 4JFDD 1AD0A 2Y06L 2R4SL 4Z7WF 1P1ZA 3LCYA 2JLLA 2IANB 3DVGB 3ZE0E 3CFDA 3GSQA 4DOHB 5TJWK 5CEZL 2BOCB 3EGSB 4YX2L 1DEEA 5DZNA 2DLEA 4ODUB 1U8OB 2EC8A 3H6JA 1U3HD 5F7HA 5K9OA 1JPTL 2IGFL 4ZUTA 2IG2L 3KYNB 5CP3A 3VGGA 5KVFH 4DVRH 4M7ZB 1ZXQA 3VWKB 4QRRD 4YIQA 3UO1L 3C6SB 1INEL 5H94A 4R4BA 5IB3A 4LSPH 5I2IA 2HFEA 4L8BA 3X12B 1T21A 3MOBH 4HT1L 5F97E 3C6LC 1FFPA 4PRBA 2DLGA 3JV4A 2FECL 5ABDE 4KDVA 4LHUG 3SCMA 2CIKA 5D7KE 4JQIL 4W6XB 4UOJA 5AUMB 5L2KD 3VD4A 1OP5K 1MLCA 4MX7A 1G7HA 1PQZA 4P3DB 1OTSC 2DQIL 1DUYA 5LAXA 4U6XB 2CRIA 1T7YA 5IVOA 1U8LB 3ZKNC 1OQOA 4P23A 3SDAC 2ZUTA 4X7EC 5EIQA 2ZG1A 3S7GA 2A6DA 3IFPB 4M7KL 4M48H 5C0IA 5EZIH 4HS8L 3IS1X 3BEWB 4MD0A 1B0WA 4NNPH 1HKLH 2JIXA 3GNMH 2F5AL 3FQUA 4P5TC 4JM2C 3T8XB 1F6LL 4P46C 2HLFD 5I71B 4CMMB 2NX5D 2MJWA 5HHOB 4GRLB 2AW2A 4OCMC 1MHEB 2VXSH 2XG5A 1E28A 3P9WB 4TUOA 3RWGB 1F45A 2MQ3A 3KS0J 1F13A 3UX9B 5ETUA 4KXZI 5CINL 5D1ZA 1SYVB 2DYPB 1HOCA 1JGEB 2RJMA 3BRDA 1XH3B 1ZTXL 2IBZX 4IOSD 5HTSA 3ARFA 3VWJC 2J88H 2BK8A 3EYOB 5A1AA 1QO3B 2EIZB 4BZ1H 2FYYB 4MNQE 4L3EB 3D0VB 3BISA 1L9MA 3TVMB 2IQAB 3QH3B 3FQNA 4MVBC 3WD5L 3ZE1E 5CILH 3O3EA 3JXAA 4K3GA 2GEEA 3CCHB 4C83B 2ARJQ 3UEZA 5E9DE 1Y6MR 1J10A 4JR9L 3VXSE 5ENWA 5K59F 1UYWH 4WHDA 5D71H 3MACH 1D3CA 4M7LT 4YHZL 4KK9C 2EXYC 4FP8H 4JN2A 1F3JA 3HAEG 3ZSSA 3I02B 4KJYA 1MWAH 1Q9WB 5HVWA 4PRHD 4NDMB 5JHDD 1JPSL 4YXKL 3KAAA 1KELH 2Q76A 2AV1B 4A6YB 1A7PL 4UT7H 3QIUA 4QTHB 3L1OH 4C4KO 3IFNH 5KG9B 3TYFA 2WW8A 3P3YA 4R3SA 3TA3C 1QFWI 4S1DD 4GBXC 1NAKL 5J3HC 2EDDA 4NQEE 4M1GH 3MLRH 4NT6B 2NXYC 5CEZE 4YHIB 2R23B 3VU2A 4M5ZH 3PF2A 2EDQA 3L3KA 1QKZH 3MBED 3D5OF 3FT3A 4P2RB 1JHTA 3LS5H 3H0TB 3MBXL 4HCRA 5IMKA 2I9LB 3T1WA 3PWPA 4HJGB 5GS2H 3MRGA 1AO7A 3MLTB 1T7XA 5C70A 5I76B 2AGJH 1AD9A 2JB5H 4KUZL 1QFHA 5FKPA 1RIHH 5KS9F 5D2NE 2CIIB 4MD4B 3D3VD 4F3FA 4FQLH 1JL8A 1OGAB 4NO0D 4CJ1A 3P4OB 1I9IH 1JWUB 5J1AB 3G6DL 6CGTA 3CSYA 1KCLA 3RIFF 1K2DA 1YPZF 2AJYL 3GI9H 3R4DA 4U1SB 3QUMH 1IGCH 1KTKE 3H9ZA 4S1RL 3TIDB 1S7TA 4LRNH 2VLJB 1W72H 1KPUA 4KC3B 3O8XC 4DVBB 1A3LH 3VA2C 3LKOA 4OZGB 5GSRB 4XP6L 3OR7A 2IAMC 3CC5A 3THMH 5ESQB 3RGVC 5EZLB 1T1WB 4ZXBD 3TFKC 1NBYA 1XF2B 3LPGA 2PXYC 4KQ3L 1BZQK 4M93B 5F7KC 3PL6D 4UV4H 5E4EC 1SMAA 3NZHH 5E95B 3VXME 4F7PA 1A6UH 1HQRB 4APQB 3WXVH 4LRIC 4IRJC 4YDIH 1NCBH 4NN5C 3ZTJG 1WFUA 1WZMA 5ISZB 1NGYA 2FECI 1BJ1J 5BJTA 2Q6WB 4I0CC 4WY7L 5I18L 1UB6A 3F8UB 3HUJE 4PV8A 1RUQH 5D7JC 2HJFA 2PETA 4KK8D 3F58L 4JFFE 5D1QB 5M94B 4NNXA 3B9KB 4L9LA 4I18B 2VZUA 1UCBL 2BOBB 1KN2H 1UACL 2BMKB 2EE2A 2N1KA 4LKCA 4TNWK 3LKSA 2Q8BH 3VFUB 4KKCC 3QUXB 4PV9A 4AIOA 3QUMB 3DROA 4O51A 4PJFE 4U1LA 1QQDB 4PGJA 1DTUA 4U1IA 5IMLA 4HMCA 3L5XL 4R4FH 1IQDB 5GGUB 4PJ7A 3L5WB 5C0DB 4MJIB 5GZND 4FTVB 1W72B 1Y0LB 4KKLD 4NOBA 4NRYA 1EDQA 3HAEB 1B0RB 4U05A 4MB4A 2NY6D 3D6GA 2VAAA 4MCZB 3MRBB 1L4IA 3GBML 2IFFH 1SJEA 3ZE2F 4PR5B 3S5LA 2XYCA 4BKLA 3FAWA 3IVKB 4RSVA 1T0MB 5K9KA 3NIFE 5F1NB 2CMRH 4WTZG 4J3SA 4PUBH 1QG3A 3HNTL 3EYSH 1KTRL 1QRNB 4IOIA 3QUKA 2EEBA 3HLAA 4D2NA 4KMTH 3MLYH 4K23H 2CKBL 1RJYB 4AMKL 1CR9L 4XAWL 3AS2A 3C2AH 1U58A 3LKPA 1CIUA 1FVEB 5I1AB 2DQGH 3LEVH 4DKFL 4G8FB 1T7WA 3ZTNH 2JJTA 3FN9A 1OAYL 1S9WB 1LNUB 4JDTL 4HKXA 2WSKA 1ZT4A 1EO7A 5CP7B 1X5ZA 4UV7H 1WITA 1U6AH 2GSGB 1MRCH 5JOFB 5IG7A 2DQTL 1KEML 3X14A 2OS7A 4XTRD 3DO7A 4POYA 3KPSB 2V2XA 5IBTH 4JO4H 3D25B 3PP3K 5DD0L 5F44A 4HFUH 1RUPL 4XB8A 1PG7W 3FQTA 5HGHB 1UA6H 1I1RA 4NRZB 2BY1A 4G80B 4L4VE 5E6IC 1U8IA 4OCWH 3WO4C 1GHFH 5FYKD 2VE6B 1RJLA 3DRTB 2GK2A 3GB7B 4Y1AA 2EO9A 2OX5A 3U9PL 4GS7C 1MCCA 3RDTA 2F8VA 4WFHE 1NJ9A 2LTQB 3VDCA 1FAKT 5EN2B 1G9NH 4RMRA 4JANA 2UZXB 1FZKB 2C26A 4HHAB 3V95A 2YPLD 3RL1B 4ALAL 4P3WA 4XBPA 3O6FA 3T4YA 1G7LA 5DJCB 1E4WH 3F6LA 4J3XA 4XAKE 4K9EC 2PTTA 1NGXA 2GFBA 3OR6A 4I3RH 5INCB 3RPIB 4ZQKB 4CVUA 2OJZH 5L6YL 5EC1B 4YWGH 1JMZA 1HH6B 4ZSOE 1CK0L 5GGQH 4PG2A 5CEYA 2JK5B 5DK2B 4MXVE 2W65B 3C5SA 1KGCD 2XXMB 4HWUA 3QPQD 2R0WH 2Z92B 4HBCH 5IHZB 4TUKH 5J13C 5GXBB 3CMOL 4O5LL 2A73B 3LVEA 3B5TA 3W9EA 5FUCE 3V6OC 1PSKH 1VENA 1UH2A 1Z5LA 3WJLA 1OSPH 2OTPA 2XWBB 4XVTL 1MOEA 4N90D 5HGAA 3LIZL 1LO5B 2VMFA 5AYUL 2DIAA 5IVNA 3FB8A 3H7BB 1DE4A 1R3KB 4X7TB 1LO2L 1KENL 3EZJB 3B9EA 3TN0B 2G60L 1FV1A 4FABL 2VISA 5DMYA 1DVFB 3WJJC 4XP4L 5T5FL 4DZBB 5FYJH 1MH5A 5DHVA 1ZT7A 1MPAL 5BVPL 5L2KA 3DX8B 4IMKA 4JZNB 1CXKA 3GMMB 3DO3A 1FSKB 1ED3A 4NKIL 3N1PC 1DQML 5DI8B 2H6PB 5TGBA 3VFVB 1D6VL 3MRQA 4PRAB 3DTXB 4YE4L 1FNHA 1WZKA 3IDMB 3RBSA 4Y16B 3IU4H 4N9GA 4JG1H 4RRPA 4PS4H 1KC5H 1KTDA 3CDGB 5F7DA 2NNAB 2P5WD 4PG9A 1AXIB 4OZIF 1WBXA 1GRWA 3JVGA 5DURD 4RMSA 5KSAC 4J8RB 3MA9H 4IBLT 5F3BA 4L1DA 4OKDA 4X6BA 5DK0A 5EA0H 5CWSB 2X5PA 1YEHH 3LKRB 4KGJA 4XI5D 3T1FA 3S9DB 4ZUVA 5IHUH 3D2UB 4DFIA 5E56A 1E27A 5GJSH 1VKXB 2EKSB 2VWEC 1I3VA 3LN5A 5F9JA 5HYFA 2RIKA 3P0VL 4Q74A 4N8VA 1LEGB 3VXSB 1T5XA 4XBEH 3GSNA 3SQBA 3UTQB 1N5YH 2VR5A 1Z0NA 4WWKC 2F74A 1P6AB 3U0TB 1FLTX 1IILE 1BD2B 3BQUB 3FOMA 2O26U 3OMZA 4KTYA 1Q0XH 4PJEE 2A2QT 3RX7A 2HP4A 5DJ0B 3O3DB 1NCCH 2A9ML 2IH1A 3MJ7A 4I0PD 4Y19A 5EWIH 1I1AC 4PRPA 3X3FL 4DAGL 5F7YC 5TE7H 1EEZB 4J4PD 3UYPA 1O7VA 3ARDB 2PTVA 3IETB 2LFGA 2VABA 1AP2A 4KTEH 5HHVL 4OF0A 5FIEA 4YJZL 1XIWC 2G9HB 4PRHA 4FRWA 2VZSA 5JHDA 5FDWB 3RWEB 4XPFL 3VGDA 5IBLD 5JNYB 1EJOH 2KDGA 5EBGA 5TFSL 1RIVL 2Z4QB 3X13B 3V4UH 25C8H 3FO1A 1FDLH 4IHOB 5H35A 4XPBL 2OI9C 1D5MB 2DS4A 1E4KC 1QRKA 3CDCA 1RURL 5D5MF 1WTLA 3FFCB 1IC4L 1ZANH 1T6WA 4MQTB 4OQ1A 3HZVA 4XCYB 1C16A 1N26A 1YA5A 4PLNC 3TPKA 2AKRB 2BC4A 2V5TA 3TIEB 2H1PH 3MBEA 4K94C 2NY2C 4PJCA 5IB1A 5C8JA 5AZ2L 1QBMH 4PRNA 1FIGL 2JB6A 2PO6B 5KSUA 3VD5A 5HDQL 4GUPA 1YEKH 3Q5YA 5I19H 3BPLB 4PREB 1N7ML 1FNAA 4YGVB 4JY6B 1TJIL 5DS8A 3CXDH 5MEOB 3D3VA 1T1ZB 1Q94B 5I1EL 3TBYB 2OCFD 4QOKE 1K5NB 2HKFL 4NO0A 4RDQF 3W39B 1NLDL 2BP3A 3AXLA 4ZAKB 2DOCA 3JTTA 3JV0A 4XNYL 1YNTA 1R3HB 3T0EA 5FM8A 4OAWB 1JE6A 4YPGB 3UBXG 4HFWA 2VDPH 4OLXL 4IOFD 1MSPA 2X89A 1MRFL 4YH6A 1BIHA 1KCSL 2FX8L 4XBGA 4WUUA 3MO1A 4J3OC 4R90L 1AGFB 3KJ6H 1NCDL 1U3HC 5D96B 1BZ9B 4QHLB 3N1FC 4RWYH 2P49B 1UM4L 3NCYP 4MA8H 1S7UA 3VXMB 3IJSB 2IBGA 3LOWA 3LD8C 5LXGL 5JXEA 1ZA3A 2DLIA 4ZXBA 2R1XA 1A7OH 2WUBH 2YC1B 1QR4A 1X4XA 4G8GE 5CJOH 1EK3A 1RMFH 1UJ3B 5BVJA 3PL6A 4RAUB 4MDIB 3W0WB 1JZ5A 3S8WA 5JORA 1I1FB 4JKPL 3LEYL 3GMPA 3EO0A 5FA4B 3RZCD 2X1OA 1I7RB 4WW1A 3WKMH 5M7QA 4HGWB 3ILQD 3LKQB 5FGCB 2H3NA 2D7OA 4BQ6A 1HQ4B 3DUSB 1H3GA 4EEEA 2D03H 1BF2A 2KZ1B 4JFFB 1IM3B 3E0GA 4K9EL 1A3RL 2DM4A 3L7FA 1B6UA 3OKYA 1F90H 2WIIA 4W6WB 1MF2L 5EPMA 1FO0A 4JZJA 4LVNC 3NPZB 2XFXA 5JMRA 3MMEB 3P0YL 1ZLSH 3HI5H 3VD3A 1X5YA 1A6ZB 1FL5A 2P42B 3HR5B 2HLFC 5MENA 3WUWA 3ESVF 3EDFA 3BZEA 4TPRH 4M7JH 5MEQA 4D94A 3QDGA 4L29A 3DSNA 4YDLC 5EORH 4YDKH 4MD5B 1KB9K 4BSWB 2IQ9L 4N0UE 2Q86A 4HIHB 2HJLB 4OIIH 2UWEE 5FUZH 1T20B 5DYOA 2HWZH 3LSOB 4NQCE 3PXHA 4KK6D 1A4JA 2VDLL 2AQ2A 1RVFL 3NCFB 5C0CD 2GCYA 4G42B 4X9IA 4YAQA 2OL3H 4BZYA 4FXLA 2ITCA 4JPVH 1U8HB 1BF8A 3LEXB 4IIQB 1TPXC 2OTUB 2E5EA 1IKNC 4EBQL 2ED8A 2J12B 4OFPA 4HAFA 1LP9A 3A0OA 2CUHA 5T33H 3DIFA 2BVEA 2E8ZA 4J7RA 5C2BL 4YFDB 5AEAA 4L4TA 4K3EH 3SDYL 1II4E 5IFHH 3WHE0 3PGDA 3GBNL 2G5BA 4P2OD 2PKDA 1QLRB 2VDRH 2B4CH 5I9QB 3K2UL 3KPMB 3WIFB 1H15A 3SKUD 3QULB 4WFFE 3H9YA 1DLFH 1J12A 4LSTL 4KZEL 4WU5A 5CLTA 3VFRB 3PV6B 3SGKA 3SE4A 5EH1A 2FRGP 3DGGA 1LDSA 3QDMA 2R2HA 3MR9A 1HHIA 4S1DC 4C56B 4ONFH 8FABB 1FL3B 4FQQA 2APBA 3L3GA 5F72S 3WFBH 5IFJA 3Q3GB 2OK0L 1NANI 4F7CB 3UJJL 5DJDA 1J87A 1MFBH 4LQFH 2RR3A 2BRQA 4XPHL 5BV7H 1AIFA 5B8CA 3TESA 4JE4B 4I3SH 3HC4H 4D0BA 3MCG1 1NEZA 1EAPA 1ZV5A 2JJUA 3KLSA 2AXHA 2AJUL 2OL3B 1JGVL 2YPLA 1KBGH 3EYFA 1AXTL 1R3LA 1CU4L 5BRZD 5CMAA 5IT2L 4ZSOB 3QFJA 3NN8A 5LGKA 1DQLH 2QL1A 2PW1B 5DT1L 1IGFL 5D7LD 3HR6A 3VGBA 1VFMA 4NKDA 5DVNA 1DQDH 3K8MA 5HHXL 3MNWB 3EO9H 3NCMA 4NC2B 1I1YB 4QT5B 1F02I 2BNQE 1ERNA 3PWJB 4TVPD 1A1OB 1QYGL 4D9RE 2KBGA 1OP3H 3UZVB 5F7FA 4JPKH 1PLGH 5I1IH 1S7RB 4ZYKB 4GG8A 5E2TL 4KRMB 3CZJA 4KKNA 1BIIB 4FQXC 4ZFOL 3Q6GL 2JJSA 3DVNA 1GGTA 5H2BB 2WMPA 3MRRB 2GT9B 1CXIA 4JY4A 4EUPG 2N4IA 3EYUH 3SOBL 3OJ2C 4M4PA 1PEZA 4NWTL 5GS0H 3MUY1 3SDDD 4PBVC 1J9CT 3ME0A 3DRQB 2PR4L 1RU9L 2OLDA 1GZQB 5C07D 4NQDD 3JBG7 3FOLB 3QRGH 3MRJB 4YNYB 3V6OE 3CAFA 4K94L 4ELKA 3GHEH 4G6KH 5FGSA 4ZS6D 4JY5L 4P5KB 5H37G 4Q9QL 3FB6A 1HSAB 1TTGA 1RK0A 1XGYL 5E8PB 4Z7VA 4R97B 1JV5B 1UKQA 4QRTA 5JQHC 3BH8B 4RAHA 4EI6B 3VE0A 1IC7L 1N6UA 2HMID 3GSVA 1CFVH 3RWJB 4OZFA 4BSJA 3DBXB 2Y6SC 1H8OA 3I75B 2OR7A 5DJXB 3TCLA 4FQHA 3CH8A 5AYQA 3DGCR 5IESH 1HHGB 4H0IA 3WFEL 4KK8C 5IVZB 2O61B 1QHPA 1DSFL 3SDAB 4LHJB 4HZLB 3MRKA 5F9OH 4DN3H 2QSTA 4LPTA 2FHBA 4KHTH 5E6YA 1ND0B 1U8MB 3NPSB 3BT2H 2C1OB 3OF6D 1N5AB 4RIRA 3KR3L 4H0GA 4P5TB 2VC2L 1HZHL 4HH9B 3BRGC 4HH8A 4XNMA 3BUYA 5GZNC 4KKLC 1H9VA 3ZHLA 5FB8A 4UTAL 4ISVB 4YBLC 4HG4K 2ERJC 5TDOB 2OSLB 1N0XL 5J9PA 4P46A 4GG6B 1JI2A 3AS0A 3GSOB 4RA0C 1P7KB 3EOAB 3VFNB 5KJRL 2VUYA 1KJVB 5CFHA 1GXEA 2ZUYA 4ZNCD 2OZ4H 3STLB 3I6KB 1SJXA 4EUPH 4XVSH 1JTPA 4F57H 4OJFL 2EYRB 3DX7B 1BAFH 1JZ8A 3VWJB 4ZFZA 4MDJB 2W07A 5C09D 2NTSP 2ENYA 2QEJA 4XPTH 4RCAA 4U0RC 4YHYC 1RD6A 4LSRH 4XRCA 5EUOE 2AXJA 2P1YA 5E2UH 1FG2B 1FJ1A 2VWEE 1ZE3C 5H37H 3MXWL 5CJXA 2D3VA 3VI3E 3MV8A 4WGWB 3MNZA 1UWEH 5GGSB 5I1KL 1BX2A 1MUJB 5I75C 4NKOA 4IDJL 3FN3A 1H5BA 1X9QA 1ZMYA 2WBJD 2BNUA 4XTRC 3X3GH 4OZHE 4RGOH 4K3DL 2ADJB 3VXQB 4U6VH 3WEXB 3WLBB 2DD8L 4N8CH 4DW2L 5J56B 3L6FA 5ADPL 2P7TB 4O9HH 4WW2C 3MYJB 1SY6L 5F9AC 1L6ZA 2NYYD 4MA7L 4Y89A 1YMMD 1A5FH 5F8QC 3VD7A 2EDFA 3P30H 1MIML 1ORSA 2H8PA 1BM3H 1QSFE 5ID1B 1I9JL 3BP7B 4FZ8H 3O6MH 1JYWA 4PJIA 3T2OA 1PBYA 2D9CA 4NQXA 1WWAX 4S1QL 4RGNC 3TA3A 1N59B 2NXYB 4GMSH 5E94B 1LE5A 3CX2A 4JG0H 4LMQE 1LEIB 5DWUH 3DYMA 1Q9OB 3IU3B 4QOKB 2AP2A 3OKOB 4Y4FB 3STBA 1T83C 5T3XL 4OLUH 1MCLA 1EFXB 1AGDB 2X4QA 3G6JF 3CGTA 4Z0XA 5DD1H 2DI7A 5HDOA 1NCTA 5EU3A 2FNBA 4HUXB 4KROC 3SGJA 3BPCB 4Q7DA 5IVXE 1R3JA 4JGMA 4BYHA 5LCVH 1RUML 1TCMA 5ADOH 1QTYT 3BKCH 3BKYL 2XZZA 5J57B 1NC2D 4YHKH 3PDOB 2VKWA 1S9YB 2X4SB 1T04A 4K8RD 5T1KD 1XGUB 3HFMH 3WN5C 5D7IA 43C9B 2X4OA 4CVWA 3LKNB 1WIPA 4YXLL 1RV6X 1AD0B 1H8NA 4KVCL 5KTEH 2IPTL 3QHFL 3DXAE 3GMLB 3SN6N 2EC9T 2QADB 3T3MF 1CDBA 1GGCL 5J1SC 3GIZL 3DX9A 1DEEB 3O8XB 4WEUD 4Y4KD 2DI9A 4DN4H 3RAJL 2X9YA 1EA9C 4JFDE 4ELME 4Y5VC 3AM8C 5H94B 3KPQA 4R4BB 4PJBF 4LMQI 3D18A 4AEHL 2HH0L 5IB3B 4LQ1A 3T0WA 3EKCA 4NFDA 4IJ3C 4Z77A 3O3BA 4XMPH 3LN4A 4LSUH 5E4EB 1ETZA 1UEYA 1C5CL 1FFPB 3S36X 4BH7B 3RZCA 4OLYH 3V6FA 4QRRE 3JV4B 3JWOH 1CLOL 3SCMB 2CIKB 2ARJA 4UDUA 5CZVH 2VZOA 1CT8A 3B3IA 2Q3AA 5EOQL 3N85H 1KB5L 1MLCB 3FONA 3QEGL 4MX7B 4NN5B 5B22A 3T0AA 1PQZB 1ADQL 4TULH 5TQ2H 1IT9L 1UWGH 3S88H 4X4XA 4B50A 1A7QH 4Y5XA 2AK1H 2O93L 4UNUA 5JW3H 5I8KH 1UCTA 3CDFA 1YN6B 3BN9C 3QNYB 3S98A 2ZUVA 4XMLH 1GOGA 1WGOA 3HRPA 5C0IB 4GKNA 5F7EL 5D7JB 1W8OA 3U79A 2VXQL 3UTPD 4MD0B 2EDNA 2UWEB 2QQLH 3AB0B 1KIQB 4PJGF 3WHE1 1CI5A 5IJKA 3EFDH 1U3JA 1K8IA 2FR4A 1BHGA 1Q72H 4P2CG 1EBAA 5EBWA 1EEQA 4HK0B 4YFLI 1ITCA 2Y72A 1KIUA 4ZOCA 3G5ZA 2EH7L 2HFGL 1E28B 1CFQA 4TUOB 5JZ7D 3H9SA 3BXNA 3R06A 1AXSB 4QWWD 4XC1L 3I85A 4HCRH 4NN7C 1CE1H 4OLZH 4NZRL 1CBVL 2Z31D 4YZFF 5IIEB 1HOCB 1BFOA 1QHOA 3U46A 5CJQH 3INUH 1FFNA 1C7SA 4KJPD 4ZS7H 2BY2A 4PPTA 1BEYH 3ARED 4KPHH 3T2NL 3PHOA 1OWWA 1OAZL 5FO9A 3SJVD 2YKLL 2LVCA 4OB5L 3S3PA 4I0PC 1U8PA 2AV7A 3O2DA 1BZ7A 2X42A 5T3XE 1UZ6E 4J4PC 1JK8A 3CNKA 2VL5A 3BWAA 1MI5A 4P2OA 4KHXL 4KGLA 2VDML 3GHBH 4JN2B 4MXWL 4O00A 3SDCC 3ES6B 1F3JB 1KEGH 4KJYB 5ELIA 1MVUB 2D31B 3PIQA 1WFTA 2DBLH 2Q76B 3S5LG 4RBPH 2L7JA 4H1LA 2VLKD 3QIUB 1KJ2L 4RA3A 4HX1B 3OPZL 1CFNB 1X4ZA 3SE8H 3TYFB 4R3SB 3GRWL 2X09A 1D5ZA 4P4KD 4LLVA 2A74B 5I73C 5DD3L 4U1GC 2HT2D 5F7MC 1UZ8B 1RIUH 4U1NA 1U8JB 3CXHK 5F6HI 5BXFA 3AAZA 5I15L 3MRLB 1MJ8L 4ZOAA 5K9QI 1CDIA 4LCIH 3BKJH 4KMQA 4UDTB 4UIMA 1UB5B 4ZD3L 3FT3B 1JHTB 4HUWB 4R9HA 1MFAH 4D0CA 3RGHA 1CL7H 3MRGB 1AD9B 4R2GD 5FKPB 5KN5B 1FNGA 4F3FB 2BNQB 1GOFA 2EDTA 4WHTA 1JRHL 3BDBA 4YXHH 1E6OL 3VFTB 2VDKH 4UB0H 4GQ9L 4PJAF 3CLFH 3CSYB 4FXGA 1S7QB 1TQBB 4M6OL 1K2DB 5BS0D 1AJ7L 1HHKB 2QLVB 3HI6H 2NXZB 2C5DC 3S35L 1DDHA 3OGOE 4LOUD 4JFYA 2F8XC 2FBJL 4JFEE 5LBSL 2B5IC 2FIKB 3QXAA 1TCRA 4J3WA 4IEFB 3UPCA 4F33A 3LKOB 5E1AA 1IGMH 4WV1A 1R24A 4XNUL 3CC5B 1HH9A 2BSTB 2R69L 1NKOA 1OT1A 1XZ0B 1NBYB 3A6CH 1JI1A 3LS4L 3ELAT 4OGAD 5GSVA 1M7IA 3N1GC 5FYKL 1T5WA 5CSGA 1AC0A 3L7EA 2C4FU 1JTTA 2ADIA 4O58H 2F53A 3QA3B 1DN2A 1GCFA 1S9XA 1IQWH 1KSRA 5I17A 5EIIB 1NGYB 1A9BA 2EYTB 4AENA 5HHMD 1P9MA 1B0GB 4NKMB 1FGVL 3CFKA 1I8LA 3JWDH 4P9HC 5DJ6A 1NMCC 1UB6B 4XX1G 4Y4HD 5FECA 3MLVH 1NFDA 5EFIA 3DV6B 3FL7A 4KQ4H 4MA1B 3KYOA 4L3ED 2HJFB 4QRSA 3ULVC 4MMXC 4Z7UE 1QEWA 4Q6IA 4NNXB 1CFSA 1XCQB 5EDXA 3QI9A 4AIXA 4E9LA 2NLJA 3O9WC 4KK5C 3VGEA 2UY7A 4U1IB 3OTTA 1RZFL 1E4JA 5DJZA 2AXGA 4PJ7B 4HSQA 1OGTA 5DJ8A 4KK6C 3MTRA 5IEKA 1OSZB 4HF5L 3PJSA 1NCAH 2O5YL 2VAAB 3OAUH 5KSAA 4X99B 4ODXA 5ACMA 2X70A 4X9GA 2CUIA 4HKBB 3S5LB 4BKLB 5C0AA 2BSSB 2P24A 3MPCA 2NY4D 3FO0H 4ORGA 4EQ3A 4PY8I 3SKMA 3DWTA 3WE6A 2ESVD 3BVNA 1AE6L 1TJHH 5F9DC 5C09A 2CD0A 5I16A 4RRPG 4JQXC 3UPRB 3V79C 4NJ9L 2WUCH 5E70A 4QLRA 3LKPB 1U58B 5IWLC 4OZHB 1GGYA 1UVQA 1EJ6A 3HTLX 1UH4A 2EDXA 2DQHH 3ZYJA 5SX5H 5K9QG 4L4JA 1HDMB 1Z9OA 5KVEH 3MV9D 1I1AB 4HKXB 1EHLH 1ZT4B 5D1XB 1SVZA 1J1OH 1N6QH 4X6DA 5IG7B 3X14B 2X4PA 3DO7B 2AABL 4GSDL 4HPOH 4DGIL 4N8VG 1EV2E 2GSIA 4LCWD 3EJZC 4PJDA 4ZTPH 2FD6H 3HZMA 4MAYD 5IM7B 5JW4N 1U8IB 4EKXA 4LHUD 1YYML 4A2LA 1JFQH 5FV2A 2ILLA 2Y7QA 1I7ZB 5DHVH 1JYNA 5D2LF 1YEDB 5CGTA 2RQ8A 2J5LB 3RDTB 5T1LA 3PABB 5MEPB 8CGTA 4QXTA 4JANB 1NC4B 3O6FB 2JELH 5EC2A 5FYKE 3D85A 3T4YB 3O4LA 4RGNE 2WZPD 1K4DA 1MJ7L 4OQTA 4Y2DD 4NQSB 2GFBB 3RP1A 5FUOL 1KG0A 1A9EA 4U6HB 3DXAB 3T0XA 3WNPA 4U33A 2ZNXA 4FG6C 4K7PX 1JRHI 4U7KA 2V17H 1I4FA 1EGJL 5DC0A 2Z93B 4QXWA 2VR9A 2HTKD 1JZ4A 5T1KA 2UYLA 3E2HB 3UYRH 4JFDB 4ELMB 1CWVA 1VEMA 3BH9B 2ZSWA 4XZUB 5GS2D 3T08A 3I84A 2RCSH 1G7QA 3W9EB 2WQ8A 3TBVA 5HPMA 5ALBL 3B2UD 4KJQC 4X7DC 4G5ZH 3QHZH 1WWBX 1MRDL 2YPKB 3BDYH 5DRNB 1AC6A 3LD8B 1YPZA 4QRRB 5D1QD 4FFYL 2FGZA 3B9KD 3GSNH 1BMGA 2IH3A 3DVIA 3CFEA 5JIIA 3DOSA 4AIZA 2F8OA 1KFAL 3QUXD 2DI8A 3D1MC 4R96B 2DQJL 4RNRA 2CLRB 1IKFL 1OW0A 4P57A 3WIHL 5E8EA 4BSVA 1CXHA 4MJID 5DHVB 3I6LD 2VB5A 1F4WH 5L2KB 2LV4A 1PJ9A 3RY6A 3MRNB 5T1DL 5HI3D 1ZOXA 3NFNB 4L8SA 5T1MB 1JN6A 1I8KA 1S8DA 3MCLL 5I8OH 1FZJA 1MVFA 3ROOA 4EI5D 3MRQB 1HXYA 4R7DA 3VXPA 5B3JF 3TNMA 2YEZB 4V1DA 1N4XL 2XPGB 3MV11 4PJ8A 2CR6A 1WFNA 3IGAB 4YX2H 5F7DB 2L7UA 2Q8AH 4P2QA 5F7NC 1WBXB 4QY8A 1FNSL 2IGFH 2NX5B 3MRPA 5T3ZH 2G75B 2IG2H 1JF1A 1MQKL 2NW2B 5EOTB 4LVHB 4HJJH 3BKML 4YDLB 1INEH 4X6BB 5DK0B 3OJDB 3SE9H 2H2SC 4PJXA 3MV01 2P5WE 5KSBE 3ZYZA 3QCUL 3T1FB 4ZUVB 1MCJA 4PB9L 1N64L 1E27B 4HT1H 3RNQB 1XCTA 3CX5K 3DMMA 3WFDL 3IDNA 1GGBH 3EBAA 3LN5B 1A4KA 4ZNEE 5F9JB 1WQVT 3G9VA 5HGBA 5K33A 2YPVH 1CD8A 3RWCB 1TQCB 2F74B 1UQSA 4LASL 3BHBA 3WUWG 1NMBL 3SJVA 4PJ5A 2DQUL 3KXFA 5MP6H 2V9TA 1IKNA 2BDNL 4LAJH 4B41A 3MJ7B 2VLRA 4P9HL 3CSGA 1FRGH 4HS8H 4LSVL 4LSDA 2P5ED 4UU9B 3RIAF 2WBJC 2VABB 1AP2B 2F5AH 4L5FH 4PRHB 4NBZB 2AQ1A 3ULVL 5JHDB 3GUTA 1WWCA 2MMXA 1HYRC 3NIDE 4GO6B 4XVJL 2NYYC 4ZUWB 4OBRA 3WNKA 4X6EA 1WT5C 3D69A 5JUEH 4XMKL 2NZIA 2GIYA 1OARL 5C0GB 2GY5A 1R5VB 15C8L 5JHLL 4G6AC 4P4KA 3SY0B 5CINH 1C5BH 5C0BD 2AEQL 1GPOH 1ZTXH 3FZUD 5CKAA 3UCRA 3BGAA 2YK1H 4Y5YA 1J0JA 2VDNH 5ID0A 3MBEB 4PJCB 2DLFL 5TDNA 4Q58C 2JB6B 5KSUB 4X4YA 5ACZA 1XGPA 3EFFA 4BUGA 4GUPB 4HIIA 3KVQA 2RFXB 3PQYA 4CN1A 1KCRL 1S7XA 5IFAH 2FO1A 5I66B 1DQJB 5DS8B 1FO0H 3D3VB 4YHZH 2J6EA 4NO0B 1F4XL 2BJML 5JIHA 5BOZG 2J8UA 2FHCA 5IR1B 3JTTB 5FOBA 1AQDA 3FB5A 1YNTB 4YXKH 3T0EB 4LLUB 4JFEA 1IC5L 5EU4B 1G7MA 1NGWA 1HSBB 3FMGL 1J1PH 1VGKA 3SO5A 2R9HD 1JZ3A 2MKWA 5DVLA 1PD6A 1NEZG 4U31A 5FGBC 4KKAD 4Y4KC 1FQ9C 2VXTH 4FMFA 5E8DL 1F8TH 4JHWL 4FHBD 2EO1A 1LGVA 3OKDA 1S7UB 3ARBD 2QSCL 1ZA3B 3F7VB 3QG6B 4MYWB 4ZXBB 2ZWLT 2CSPA 3B9DA 1CIDA 3KPLA 3CU7A 2CRZA 4PY7B 1OTTC 4LPUA 3PL6B 3SDXF 4XP1L 5JORB 2NY1B 5CJ8A 3H3BC 1V05A 3GMPB 5DGRA 4WNQA 1ZHLA 3MV7A 5HHNB 1TZHA 3ISWA 4CU6A 2WLZA 4LK4A 1A6WH 1X5GA 3UAJD 4GRWH 3HG1A 1X5JA 2H3NB 3CPLA 3K8LA 3TO4D 5FYLH 3TNNA 5JW5A 3SQOH 1A47A 4Z7UB 1OY3B 3C5ZD 3P11H 3ZO0A 3EOBA 3D2UD 1PFCA 4P9ML 1OL0A 2UZYB 4DK6A 4LEOA 4Y4HA 5HDLA 3L7FB 4TTDD 4K2UL 2VH5H 5ALCL 3RTQD 2R1WB 3BUTA 1X3DA 2D4FA 4Y0GA 1FO0B 4JZJB 2XFXB 2ICWA 4Q97A 5DHYA 2F54A 4ONHB 4TVPL 1FL5B 5HHQB 3SBWC 3WFCL 3CD4A 3VXNB 3TCXA 3W2DH 4XP6H 3BZEB 3QXDB 4YUEL 3X11A 1KJ2B 3V5KA 5MEQB 3O11A 4KDTC 4L29B 3TH3T 5FA3A 3KYMA 1CGTA 1CD1A 1U8QA 1ZEAH 5FYJD 4QWWC 1U95A 4KQ3H 4J2XA 2YUWA 1I7UA 4FNLL 4YBLB 1I9RH 1JP5A 4U6TA 1J8HD 5HYJA 2NY6B 1H0DA 1OF2A 3QZWA 4GRMB 2GCYB 4YAQB 4TSAL 3NABL 3WKNA 4MQ7A 5E7BA 4F7MB 4K3JH 4KJPC 5B3NA 3MLZH 3AREC 1CE6B 3BP4B 1ONQB 2I5YH 5F3HA 3NACH 1G9EA 4XPGL 3RVTC 1LP9B 2ICES 5KVDH 5C0CE 2R29L 4JFZH 4L4TB 1K6QH 1P2CA 4U0RB 3ZDXE 4YHYB 5C0FA 4JLRB 3UTSE 2VZTA 2NY7L 5BZDA 1EZVY 3T77A 1WZLA 3PGDB 4LLWA 1VCAA 1Z9MA 4OV5B 1JGDA 3NH7L 4EN3D 4PD4K 2B1AH 3DUUB 3MV9A 2EEDA 1H15B 5I75B 4F9PA 2F19L 4GW4A 1QBBA 4YR6A 1SJHA 1D6EB 2HJKA 1YNKH 2FX9H 5IB5B 2VXVH 3HKFA 1C5DA 1TETL 4KTDH 4GXUN 3DGGB 4HULB 2P43B 5CIPA 1HHIB 3OAZH 1CN4A 1KCVL 2CPCA 3TJHC 1VFBA 4ZUSB 2HT2C 1ACYL 3L3GB 4CW1B 4OCRH 2W60A 5DEFA 3GBMH 3QWOA 4QHNA 2RGSA 4WW2A 4HKZA 4MAYA 5ICZB 5I1JL 1E4XH 5IROA 1GIGL 4EIGB 4L3CA 4WCYL 5A2LH 1I1CA 3RRQA 4CADA 1QPXA 4S11A 4X8XA 3RA7H 2W0FA 1QFUL 1NEZB 3CVIL 4CVZA 1M7XA 1G0YR 3A6BH 3ARGD 4OZFH 1T89A 1BQUA 1MWAA 4LU5L 2D7TL 3QO1B 4JFPA 1BQLH 3OKKA 3VWKC 2YPLB 5D5MA 4AMKH 3EYFB 1CR9H 2YMXL 1S5HA 2PYFA 4JHAL 5A2IH 4YDVB 3MGTB 3QFJB 1ZLWH 4Y2DA 2NY0D 2GTWB 3NN8B 1JNNH 5B39A 3G08B 3TC9A 4DKEL 4RFEB 1OAYH 1CG9A 4NKDB 3OX8A 4U1HA 1I8MA 3UTTE 3NFSH 3KGRA 1DBKH 2PYEE 5BRZE 1KEMH 4GMTL 4LOUC 4Y7MA 3W81A 2X4NB 4LBEA 2P45B 1ZHKA 4XB7A 3KNBA 4XNXH 4M61A 5DD0H 1A0QL 4NM4L 2C7UB 2XA3A 2I26N 4GG8B 2E6QA 3VRLF 3GIVB 3U6RA 4E41D 4LCYB 1MAML 4PJHA 5DUPL 1TIUA 3I3EA 4NJAL 3KPNA 4TVPE 2OJEA 1CICD 5E5RB 4OUUB 5HYEA 4NQVB 5CZXC 1RFDL 3ZLQC 4XCNA 4KU1A 4XVUD 5DMGD 1JZ6A 4OGAC 1SBSH 5I71C 5GRZA 4KRNA 4C59B 2GJ6A 4EZMA 3RUGE 2DIJA 3QIBD 4JO1L 3HCVB 1D5BA 2QHRL 1AY1L 4XGZB 4RISL 3EYVA 3OJMB 3TBTB 1RK0B 4L8DB 2EECA 2FZ3A 5EBLB 1V3LA 5LVEA 4G3YL 3VE0B 2UY6A 3GSVB 3FQXA 4NQDE 4Z7WE 5C07E 3P4LA 1JUFA 4FQHB 2FSEA 2AS5M 3LV3B 2D0FA 3V8OA 4XH2B 3RL2B 5M95B 3WL9A 4JRYD 4DGYL 1PAMA 1C1EH 2ATPA 3ALPA 1NL0H 2A6JA 1IGJA 2H9GA 1XGRA 5A2JH 1JPGA 3VFGH 1MFCL 2AK4A 3V7AE 5DURB 4XVTH 3BUYB 3OKMA 5J9PB 5AD0A 4CL7A 3LIZH 2ITDB 5AYUH 3ARTA 3Q6FA 1EUUA 2C1PA 1F4AA 4YHOL 3WLWC 1LO2H 2XKSA 2NY4C 2I60L 4PYGA 4DK3A 4FQJL 4X4MA 4MAUL 4D9LH 4FABH 5TE4L 2FEDC 1U8KA 3P2TA 4XP4H 5T5FH 4C56D 2YUVA 2ZUSA 4HIJA 2OYPA 4QRUA 1JHLL 5DSCA 5SWZD 5DEZA 3VXTA 2MHAB 2QHLA 1BFVL 3HE6D 4XRCB 1EBPA 1FYTD 1XGTA 1DQMH 3SGEI 1FJ1B 2QTEA 3B8YA 1MCFA 4LNRB 3DECA 5JPNA 1A1NB 4O2EA 1NBZB 4YE4H 3K4ZA 1MHHA 1QFOA 4CVXA 1IE5A 3MNZB 5FOJA 5DK3A 2Q87A 1BX2B 2CRYA 5IB4A 4NKOB 1S3KL 1A6VL 3BJLA 2HT3D 5I1DA 4ZOBA 2J2ZA 1H5BB 1XF4A 3BD4A 4L8CB 3QEQA 2WWKT 1N8ZB 3L6FB 2C3WA 3SDCA 4M43L 1K4CA 1MCWW 4H5SA 1P4IL 2CH8A 1BGXL 3I9GL 4M9OA 35C8L 1J0IA 2WBKA 4OLWL 5FO7A 1GL4B 1TVBB 5TDPA 4KAQH 1ORSB 2H8PB 5IF0A 5C0BA 4JVUA 4PJIB 2ZOKB 4NQXB 4U1GB 5DFVD 3HPLA 2PW2B 4NSKB 4AT6B 5KZCD 4GW1B 2BERA 5D6DC 2VYRE 1LE5B 1YMME 1QPPA 2DWDA 3QUZD 3ZT7A 3S3JA 2XQYK 2IPKA 1OAUL 1HHJA 1KN4H 2VLLA 3P4MA 4OF8A 5GRXG 2E9WA 2HG5A 3GMQB 2B1HL 4M6NL 4Z0XB 2KQMA 4H1LG 2A9MH 2B0SL 1CGWA 2BVQB 2CRMA 3HUJF 4UI2A 5EU3B 5HY9A 1AQKL 1Q9LB 1R3JB 4X8JA 3HMXA 1NEUA 4QRPA 5KANG 2VDQH 1Q1JL 5IKCB 3FTGB 4JFHD 3S37L 4APQC 1UG9A 3TBSA 1GH7A 3C9NA 5I30L 2HTKC 4GLRH 1Z3GL 1BJMA 3BDXA 1FVCA 2QQNH 4N5UA 5I74C 1A14L 5D7IB 3GEWB 4OCXL 1RIVH 2X4OB 2RHEA 4W4NA 4PJFF 4B5EA 3RWFA 3CFCH 3DARA 1NANH 3K3QA 2B5IB 3HPJA 2QR0B 3HZYA 3AROA 4WO4D 3F6IA 3WNLA 5I1HL 4IRSD 3ARBA 1PYWA 3U7WH 4H26A 5D1QC 4CNIA 3TYGH 3B9KC 5KS9E 3HNVL 4I18C 4FQCL 3O2VH 3KPQB 5AZ2H 5KVGL 1DBML 4PGDA 1Q9KB 3D18B 4MNGA 1A21A 1FIGH 4I4WA 2O5ZH 5FK9B 4KH2A 3QUXC 5HDQH 1DBBL 2HLAA 4TSBL 4Z77B 3O3BB 4X7SL 5DJ2B 5KBNC 3VDBA 3LN4B 5B38A 3A67L 4WFGD 1U41A 5JW4R 4WEBH 3CH1B 1AGEA 3RZCB 3V6FB 1JIBA 4JRXE 3O2DH 1FFQA 5HYQA 1F4HA 4UDUB 2W59A 5T5NF 3TO4A 4GAJL 5I1EH 1CT8B 3LRGA 3B3IB 4M7LL 1JMXA 5HI3C 4IS6B 3K1DA 5EU6E 3FONB 2HKFH 3MFFA 2AXFA 4M62L 5CGYC 3TZVA 2XN9A 1NLDH 4GRWF 4OCYL 4Y5XB 4EI5C 2K9UA 1NMCB 3RWHA 1KT2B 2Y07L 1AGCA 4KFZC 1IAKA 4HUVA 3RTQA 5GS0D 1AI1L 4OLXH 1G6RA 1MRFH 1MCEA 4HXBL 2X44D 3VI4E 3OXSB 1FPTH 4R90H 1UT9A 2K7QA 3ULSB 2FR4B 5K9JL 5LXGH 3PHSA 2X10A 5DD5L 5E1HB 2FHFA 2BVOA 3G5ZB 2O5XL 2XIDA 3UTPE 5ICXA 3H9SB 2QSVA 3CSPA 3BO8A 4P2YA 3G6AB 4LNVA 4UT6L 4OIAA 1L6XA 1VGEH 5C0CB 4JGJA 4XCEA 4I1NB 3CFJA 4PRID 4H8WC 2E27L 1P7QD 5KSVA 2ZKHL 2YUXA 3O81A 5HYSA 2J8HA 4XXDA 1EMTH 1JTOA 1UEMA 2M2DA 4GXVL 1NAML 2ZUQB 4X6FA 2G5RA 4ZFGL 5FO9B 4XP9L 4G9FD 3BFOA 1LO0L 1QA9A 2I07A 1KLGA 4K9EH 3L9RA 4DGVH 1A3RH 2CDGA 1U8PB 2BVPA 2AV7B 1BZ7B 4F7TA 5A3ID 1VACA 3GSUA 3IRZA 2VL5B 3BWAB 3BGFC 2LTQC 4P2OB 3QDJD 3QB7C 2JCCA 2R2EB 5KVFL 5D6CB 1BQHB 2F5BL 5HXMA 4Y4FD 4QXGH 1TZGL 3PIQB 2VXUL 1A02N 1ZS8A 4KVNH 4LSPL 2COQA 1PKQA 4H1LB 4Z95H 2IQ9H 3IDYC 3MOBL 2J4WH 5EUKB 1IVLA 1T7ZA 4UNTA 4P5MA 1D5ZB 4HMEA 2QV2A 3SE3A 2VDLH 1IM9D 3VXUD 1R5IA 4LSSL 3QUYD 5FYJU 1NUGA 5BXFB 2VLKE 2V2WA 3T65B 4H25B 1G0DA 4UIMB 4JFOA 1A2YA 1G0XA 3FQWA 3C8HA 3BWUC 3OWEA 4GAYB 3V8CA 4A6YL 1WEJL 4FFVD 1UM5H 5C2BH 1V3JA 3QQ3B 1T1YA 3L3DA 1G84A 2LU4A 4M1CD 4Z7VF 3NTCH 4NNPL 1HKLL 5KOMC 1OAKL 3GNML 2BXZA 4XHJD 3GBNH 1HKFA 4WHTB 5L9DL 2AJXL 1J1XL 1I85C 2VXSL 1P4LA 2ORBL 5D7LB 2PYEA 2W0LA 3K2UH 2ARWA 1X7QA 4TNVF 5CEXA 5I6XB 3QXUA 2EEAA 3CZFB 2R0ZL 3TO2A 2ZOLA 3SCMD 3G5YB 1DDHB 4JFYB 3VRJA 4KKAC 3G6JA 1TCRB 2A1WH 1FSKC 1MCPL 2J88L 4UBDC 5DA0B 5F1OB 3U83A 4R8WH 3FO9A 5DZOA 1MIEL 1C12A 4X6CA 5BS0E 4WV1B 1R24B 3RUGB 3QWRD 1HH9B 4P23D 2SEBA 4HQQH 4R6UA 1CXEA 4XPHH 3K74B 3NAAH 5LJYH 1I9EA 2DQFA 3SDDB 3QXVA 4JKWA 2Q7YA 5GSVB 1M7IB 2JIXD 5EZJA 1UYWL 1ZK9A 1T5WB 5C07B 4Z7WB 3KPOB 4FP8L 1HWHB 5E5MB 1VADA 3QIBA 2J1KA 1GAFL 2ADIB 3U30B 2APFA 3D39A 4XNQB 1CU4H 1KACB 3T4AB 4LLMA 4PJEF 5I17B 3C5ZC 4LARH 1KELL 2AJVH 4HW6A 2Y23A 2J7LA 5GGTL 3V0VA 4AENB 4CBPA 4Z7OE 5JW4M 3U4BH 4UT7L 3L1OL 5D1ZD 5DJ6B 3IFNL 5FECB 2P46B 2Y36L 3S4SA 3E1F1 3ARFD 5J6HA 1HINH 1QYGH 2BFVH 4FA8A 4HIEB 3O45A 1QEWB 3MLRL 5HHME 4Q6IB 1SQ2N 4JRYA 3C09B 4K3HA 5GPRA 1MCIA 2C4FT 1QKZL 1UKSA 1Z9SA 2FGWL 2MQCA 3LS5L 1RJZA 2OMBA 5ANMA 2DJUA 3PDGA 4L3EE 3HNSH 1NDMA 1NFIA 2ZSVA 3SOBH 5DJZB 3ARDC 1OGTB 5L0QB 3NCCB 1ZGLA 4DUWA 1LE9B 1RIHL 2PR4H 2YBRB 1QSED 1RU9H 4X5LA 3V4VH 3QAZB 1FAIH 3H7LA 4PYHA 5KOVC 3JTSB 2X70B 2BNRD 3ARRA 5IOPA 4CRPA 2H26A 2X7LA 2E7HA 5C0AB 3QEHB 4JY5H 1KXVC 1RZIB 4JFXA 4OQTH 4HGMA 1XGYH 3GI9L 3QUML 1IC7H 5J7CC 1IGCL 5C09B 5SWZA 1OAQH 5F89A 3MZTA 5I16B 2B2XH 1T3FA 1MHCB 5J11B 3HE6A 1W72L 4BK5A 3WFEH 4OZIE 2F15A 3DNKA 1WIUA 1UVQB 1I3UA 1UXSB 2CDEB 2ESVE 2PO6C 5IBUG 1EO5A 4ODWA 3NA9H 1TLKA 2OXHA 3HZKA 4Q2ZB 1TXKA 3PWPD 3BPLC 2P8MA 5DR5L 1H3VA 2NZ9C 1AO7D 4O4YH 2H32A 4F9LA 2WBJB 1U93A 2X4PB 3KR3H 4K7PH 3SKOB 3H2WA 2ICWI 4P2RE 1CGUA 3Q48A 3U2SA 1A6UL 4NC0B 7FABH 1RUAH 1BJ8A 3WXVL 4ZAKC 1EEYA 1YY9D 3VH8A 3VW3L 5IQ9B 5C0NC 4LLYB 5KJRH 43CAB 4QF1B 5C9JA 1CYGA 4OCNC 4NYLA 1EAJA 1UKTA 4XXCC 2NXZD 3DURB 3ECBA 1HNFA 2L0DA 2KZWA 4UINL 3C5JA 3LDBB 2VITB 1QLFA 1OGAE 1YEIH 2Y7QB 4GKZA 5IW1A 1H3TA 3KHQA 1INQA 5F7LB 3ARGC 4LCWE 1G7JA 5D96C 1RUQL 5T1LB 4H8WL 4NHUA 4IMLA 4OT1L 3N1MC 1URLA 2NY0C 1UJ3C 3BESR 2E7LA 5JPMB 1OAXH 2DM3A 5BOPA 4R4FL 1D9KA 1KG0B 1QSZA 1RZ8A 4LPVA 1WC7A 4K3DH 5CD3A 5F9WB 1FZOA 3CVHA 2R2BB 1NC2B 2DD8H 4YC2B 4DW2H 3PP4H 4OM1H 5T1KB 2UYLB 5DRZB 3LAFA 3QJHA 3C60A 2AEIT 4FFZL 3SGDH 3GM8A 3U36A 1PX4A 4U3XA 5KS9B 5JQ6H 2R1YB 3IDIB 4WI7A 1CICC 1G7QB 1PY4A 1UM6H 2CMRL 3TBVB 1OB1A 1I9JH 3V0AC 4BELD 1P5VA 3MRFA 4MWFA 5DMGC 4LIQL 4C54A 2D7QA 3KLAB 1F42A 4KMTL 5ISZE 4K23L 1YPZB 5BQ7B 3VMOA 5FDYA 3BW9A 1B6DA 2IH3B 2DQGL 3LEVL 4M1DH 2DJSA 2F9BT 4JRXA 5F96L 3ZTNL 3HC3H 3S36H 5T3XH 4S2SA 3OG4B 1B90A 1TVDA 4ZMAT 4UV7L 1O0VA 1U6AL 5ILTL 1PZ5A 3L3JA 3F7YA 2CLZA 4XC3H 4PY8J 1FVDA 3QIWA 4JO4L 4OI9A 5IBTL 2X41A 4LPXA 3V0WL 4IIQC 1S8DB 3CLEL 5CZKA 4OGYL 3ROOB 3PNWA 1IARB 4MJIE 4FTVE 1HXYB 3VXPB 4FQIH 4YXLH 3QHFH 3TT1L 2GK0B 4PJ8B 1H3PL 3GIZH 2B8OT 4R0LB 4UIKL 1LQSR 4OD1L 5GRWA 4P2QB 4NCC2 3FQRB 4UILH 5CHNB 4PFEA 3RAJH 3GO1H 1JF1B 1OHQA 1HILA 1RULH 5IBUB 1T2QH 5I9QC 5C6TH 1TDQA 2D7PA 3KPRD 1ULVA 1E4WL 3QQNA 3BZ4B 4WWID 5HBBA 4X0KA 3QFDB 1ORQA 2Z31B 3DMMB 1C5CH 3STZA 2DMKA 4U1MB 1DLHB 4PRIA 2VDOH 1VDGA 1P7QA 1A4KB 2OJZL 1CLOH 5HGBB 3S37X 3UDWC 3AREB 3QEGH 2OMNA 5CBEB 3CK0L 1ADQH 1XF1A 2XACC 1IT9H 1X4YA 3SJVB 3VXRD 4I48A 2R0WL 1YNLH 4HBCL 3MCKB 4TUKL 1QR1A 3REWA 4JJ5B 3B83A 4Y1AD 1PSKL 5E00A 3TEUA 3RDTD 1OSPL 3QDJA 4O2CB 4HC1A 3HB3D 2VOTA 1VFOA 3QZWG 1L7TH 3GUTB 3FO2A 1K3ZA 4DEPB 5J89A 4CKVX 4X7CC 1BBDH 1V3KA 2EH7H 2VLKB 2GITA 3MLPA 2P5EE 1AFVH 3V6BR 4Z76A 6FABL 3NCYS 4KRPD 4XC1H 1NQBA 4CU8A 3MXVH 4P4KB 3GI8H 5INDA 2DKMA 5DFVC 4P3CH 1LO4H 1ZSDB 4ODHL 1HNGA 4JPWL 4QGTA 4PP1D 2DF3A 5EO1A 2XG4A 3KLHD 1TTFA 2MCG1 4BH8A 3B4NA 3QUZC 1QNZL 4LIQE 3WIIH 5D9SB 4HJ0D 1ZHNA 5ACZB 1XGPB 3EFFB 3GKWH 4HIIB 4J1UA 2IANA 3IU4L 4QTIL 1U0QA 4GAGL 4JG1L 4PS4L 2VO5A 2DQDH 2BOCA 4R2GB 3LB6D 1U8OA 1F11B 2LE9A 1HI6A 1XGQB 4MXWH 3MA9L 1NFDF 3EOYG 1VB9A 2P44B 2HTLD 4J23A 1CFTB 3TH4T 5D2LA 3AY4A 4YQXL 4CAGA 5I0DA 5FOBB 5D7KD 1AQDB 3OKNA 4ERSH 2YXFA 5HPOA 5BV7C 5BS0B 4R97C 1NGWB 5E5UB 3X12A 1HE7A 2IADB 5DEGA 1Z9LA 3QNZB 3VA6A 1VGKB 3OPZH 4CGTA 3GRWH 3WHXA 2XZQL 4WO4C 3UC0H 3UJIL 5AUMA 1U8NA 4I9WE 1ZLVH 3HRZA 3OKDB 1N5YL 3ILPA 4LCUB 3QWRA 4P3DA 3E6FB 5CCKL 5HD8D 3O4OB 3KPLB 1KV3A 1FNFA 4I5BB 2IEPA 3NGBB 4EQ2A 4ZD3H 2XZAH 5B39G 3NPSC 1NCCL 1YJDH 4YK4B 5EWIL 4Z7QE 1UADC 3IRPX 1ZHLB 1RZGB 4KTEL 1NAMB 5EUOF 5LGJA 3T8XA 4D0DB 1EXUB 3HG1B 3CPLB 5GIRA 3IB4A 5IB2B 4URTB 1MLBB 4GRLA 5HHOA 4MLIA 4QXUL 3QHTC 2LQRA 1JRHH 1IFHL 3VI3F 2MTPA 5HHMB 3EOBB 5GHWH 3RWGA 1JNLH 3S96A 3OG6B 4LEOB 4ZODA 4Y4HB 4M6OH 3W9DB 2VTFA 5GS0C 4RDQG 1ZANL 5TH2A 2DYPA 2XY1A 4HIXL 3MC0A 1XH3A 5CIPH 2ICWB 4ODBD 5E9DD 4X6DF 3EYOA 1QO3A 2EIZA 5C08A 5IUSA 3IAQA 3D0VA 1QBML 3TVMA 2YD8A 2MCPL 1BBJB 3V5KB 3OAYH 4H0HB 3O11B 3QT2A 2VQUA 3PWLA 3O6LL 5FA3B 4Y19D 1JWSA 4PRPD 1CD1B 2V7HB 1A7BA 4PJDF 3GZKA 3V5DA 3H3PL 4XWOD 2E7MA 1BD2E 5FO8B 1QSEA 32C2A 4L3AA 4V2CB 5HYJB 1H0DB 3QZWB 4PGZA 4ZDHA 2BNRA 4AK1A 1Y18B 3I02A 1Q9WA 3RFZC 4NDMA 2NY4B 4OZIB 2FJHA 1CDUA 4NQED 2ESVB 1J8HE 2VDPL 5CEZD 3PE9A 5IVXF 2MKLC 1J11A 1CGSL 2XTJD 5T3ZD 1P2CB 3MRHB 4YHPB 1A6TB 4LCCA 5FV1L 2DAVA 3T77B 1FP5A 2EDEA 1R0AH 2MOVA 4LLWB 4MA8L 3MUGB 5DLMH 4HDIB 1JGDB 4Y4FC 4YHIA 5DUML 3FFCE 2I25N 1A7OL 2WUBL 3MV9B 3NIGF 1AHWC 5CJOL 4GW4B 1RMFL 4D8PA 2CXGA 2AJZB 1SJHB 2F58H 5CBAA 3T0BA 2AERT 1RI8A 1TTUA 3MLTA 4JPIA 5IHBA 5I76A 3F12A 12E8L 2XXCB 5CIPB 3WKML 4JO2L 2Y25A 1VFBB 3HMWH 4LCWB 3GSXB 2O5YH 5DEFB 1XF3B 3KS0H 4LFHD 3RX5A 3T0ED 3QWOB 4QHNB 4HKZB 3P4OA 3LRHA 5E2WH 1JWUA 4MAYB 3BD5A 4K55A 3P9MA 4LHUB 2N56A 2X89D 4L3CB 1O5DT 2QADC 5D7SH 3H42L 4WUUD 5ESVB 1SJVA 2W0FB 4FFVC 3U0PB 5SWSA 1AE6H 2ZUUA 1CDCA 4DTGL 1OP3K 4E0RA 3C08L 1MWAB 3TIDA 4MS8D 1ZLSL 3PGFH 3HI5L 2VLJA 4XHJC 4DVBA 4ZO9A 5JXED 5D5MB 3N9GL 1PX3A 1S5HB 2PYFB 4OZGA 5C0EB 1WBYA 5GGSY 4Y2DB 1BOGA 5B39B 4YDKL 2Y5TB 5GGTA 4NWUH 3PUCA 4X83A 2NQCA 3IDXH 2NY1D 4OIIL 5FUZL 3ARPA 3C8KB 4AEIH 2HWZL 3VFOB 3SCMC 3FN0H 2P8LA 1S7SA 5DVMA 4LBEB 4DZ8B 5IEHA 2AABH 1ZHKB 3WS6A 1S9VB 2OL3L 1CGXA 5I74B 3RVXC 5DRXA 3W0WE 1LDPL 4XWGH 1ZKAA 2E9BA 5TE6H 3ABZA 2YOCA 3KPNB 5CLWA 4GT7A 1KCUH 3P40A 4HUKB 5FGCE 5MI0B 3T0VA 3VDAA 2Q6WA 3HA0A 3N1QC 3H3KA 4PJXF 4XCNB 3UTOA 4MCYB 4K3EL 4E41E 3AB0C 5IJVB 5GRJL 3HE7D 5IFHL 5MEND 4E42A 1RAMA 4I77L 2WM0A 2VDRL 3U4EA 4M6AA 2UZIL 3QDGD 5ESAA 3QDHA 2BOBA 3IXTB 4I2XE 5DJ0A 4F37F 2Y1VA 2FZ3B 3RI5F 4OI8A 4JB9L 4S0SD 1QQDA 5FUOH 1LK3L 1RQ5A 1UZ6F 3FQXB 4DQOH 2AAVA 1JUFB 5GGUA 4XPAL 2PN5A 3T3ME 3L5WA 2PUQT 3EJJX 3SDXA 1EGJH 2DLTA 2B39A 1HYSD 3OB8A 4POZC 3MRBA 3WL9B 4EI5B 2VQ1B 3F7QA 2FDBP 4PJBE 3IVKA 4UOW0 2ATPB 5BV7L 5DJYA 4WU7A 5IQ7L 3QWQB 2A6JB 4I3SL 3HC4L 5KAQF 3JWOC 4ODSH 1IGJB 4HWZB 3EO1B 2H9GB 4L4TD 1QRNA 1RZ7L 1WSST 5ALBH 2AK4B 1I8IA 4MHHG 5FYLD 1FCGA 4FFYH 1RJYA 1KBGL 5AD0B 3KPRA 3L3OA 1ES0B 1BPVA 2UVEA 3ORJA 5I1AA 1ZVSA 3Q6FB 4KMLB 1DQLL 2C1PB 5JIPA 4TSCH 2DQJH 2LU7A 3B9AA 1C7TA 5ICYA 1S9WA 1LNUA 2V7NB 2XOTA 1VA9A 3QIUC 3VFSB 3WIHH 1BFSA 5CP7A 1EFQA 3LZFL 2NY3D 4M6ML 3QDMD 5JOFA 2APTA 3VRIB 3FFDB 4HIJB 1W2KT 3HMXH 4QRUB 4L4VD 4Z18A 1A1MB 3KPSA 4HKJA 3VXTB 4EDWL 3D25A 4NNYA 3TM6A 1AKJD 3VXRA 4PJGE 4OFVA 1BJ1H 4HWBL 4ZPTB 5HGHA 3MCLH 3BEVA 3PGCA 1PDKA 3H8NA 4WI3A 2P8PA 4C56E 3EDJA 1LD9A 1I7TA 4YEEA 4O2EB 1FL6A 3ZYIA 4G80A 3ZKXC 1M71A 1MHHB 1MY5A 2LVEA 2J8UF 5ACLA 1JBJA 1YY8B 1N4XH 2D9QB 2XY2A 4Y8DC 3EYUL 1A7RH 3GMOB 2P5EB 3BGFB 5GS0L 3BI9X 3DRTA 2N7BA 1FYTE 4PJ9A 4YZFE 5GS1A 3QEQB 4OLEA 5A2KH 1FN4A 2HVKB 2YD5A 3QFJD 1K4CB 3RBGA 5HYSG 4HHAA 3UZEA 4H5SB 3RL1A 4KI5F 3QXWA 2EYSA 2EDYA 3IDYB 5DJCA 2GQHA 1TQBC 5DQDL 2HVJA 2J8OA 4W6YB 3QCUH 5TDPB 4HLJA 4PB9H 2NXZC 5IF0B 5C0BB 2P47B 4JVPA 5INCA 1CFVL 3WFDH 4ZQKA 1FBIL 4OSUH 3HPLB 2VERN 1FFOB 2VZ1A 5EC1A 3VG0L 3IFOA 1NLBL 3NCJH 3IKKA 3JWNC 2DWDB 5DK2A 2VNCA 3K4AA 2W65A 4WHYG 3MOAH 3ZHKA 2VKXA 3QP3A 1HHJB 5F9OL 4DN3L 1WAAE 2W9EL 3BGMA 2HG5B 2BDNH 3T2QA 4KHTL 4OI7A 3FRUB 3AC0A 1G6RH 4P9HH 2JJVA 4X8JB 4LSVH 5L88H 2EDJA 2ED7A 4Q0XH 1KXTB 3C9NB 5EB9A 3JV5A 3IDJB 1G9MC 3UBXI 3ULVH 2Z8WC 3IF1A 1FVCB 5E08H 4S1SH 4ZUUB 2NY5C 5DRWB 1RSFA 3RHWF 3TP4A 3OBAA 2OZ4L 3RWFB 4XMKH 1N3NA 3TN0A 3O41A 4S10A 4XVSL 4F57L 5JHLH 1DVFA 3HPJB 2ZCLH 3HZYB 3BX7C 4MA1C 5GGRA 2AEQH 4LLDA 4JZNA 3ARBB 4G7YH 3GMMA 3HC0B 1T22B 4LSRL 4EOWH 4LVOC 4CNIB 4L9LC 2NCMA 4WEMB 4MQXD 1HXMB 5E2UL 4NRXB 4PGDB 2C3HA 5DI8A 4I4WB 1J05B 2WWKO 1MEXL 3ZKND 4PRAA 5JR1H 2HLAB 3B2VL 3ARVA 3IDMA 1UWEL 4Y16A 1AGEB 2XKNA 1SM3H 2BRRH 5HYQB 2CKNA 3X3GL 3LMJH 4RGOL 3BZDA 3TO4B 4P46D 4N8CL 4HPYL 2DL2A 3OKLB 5AWNL 1EO8L 4JGUA 5IP4A 4O9HL 1F4XH 3P9LA 2AXFB 4WHYH 3C5ZB 3TZVB 4WFGE 4YLQT 1NGQL 4Z8FH 5CWSA 5SX4I 4MNQA 2UVFA 1N2RB 1A5FL 1ZLUH 3RWHB 1L9NA 3P30L 5EO9B 1IAKB 3RTQB 4GG6E 4FZ8L 1G6RB 3MZGB 4Q9RH 3GJFH 2EKSA 4BZ2H 1CFBA 1V5JA 2CUMA 3MREB 5E9DA 5JA8B 3ZL4H 2EE9A 4LEXH 3EHBD 3VXSA 5E8DH 1VPOH 4JHWH 4JG0L 4G8EA 4UQ3B 3UTQA 4M9PA 1JHKH 4QHUB 4ZO7A 5DFTA 1S9KC 5EG6C 3U0TA 4ODTH 2BCKA 5JXAH 3BQUA 2BVOB 4OLUL 3IKCA 3MV8D 4P59H 5ICXB 2DIBA 3RIAK 3OV6A 5D1XC 3BO8B 4JAMB 4WW2F 3O3DA 5DD1L 4LP5A 1J8HB 4XCEB 4EJ1C 2EIDA 3IETA 3ZMRA 3S4SG 5E24E 4JDZA 2YD3A 5KSVB 2DM2A 2G9HA 2PCPB 5HYSB 3BKCL 4XXDB 5F93C 1KTLA 4YHKL 5FDWA 4R26H 4UT9H 4NQEA 4RBPK 2W38A 2Z4QA 4P9MH 3MX0A 1QA9B 3U0WL 4IHOA 2V5RA 2VUOA 4HS3A 2CDGB 2BVPB 1T66C 3TA3D 5ALCH 2ZCKL 2EDBA 2J5LC 4GBXD 1VACB 3RDTC 3GSUB 4RQQB 4KKBD 4DN4L 3EDEA 4EVNB 1MCOH 3HB3C 1T2JA 2AKRA 4EN3B 3WFCH 2LU3A 4G9FE 3VJ6B 3TIEA 3WCYA 3O6FC 5I1LA 5D2NA 2HFFA 2Q20A 1ZS8B 1KOAA 1REIA 3O2WH 1YDPB 3L5IA 4FFWD 2DQCH 3PG2A 4XMPL 3DI3B 4LSUL 4P48A 4PJHF 1FC1A 4KRPC 2LAAA 5DTFA 4PREA 4IDLA 4FNLH 1S5IL 4JRWA 1T0NB 2BSRA 5MEOA 4G6MH 4YFEA 3TBYA 3N85L 4PG2C 4OCSH 3B8SA 3E2HC 4TSAH 4PP1C 2Z91B 3GJEA 4TULL 1UWGL 3W39A 4OLVL 4ODVL 3S88L 1OTUD 2M26A 5FFLA 1A7QL 4HJ0C 1R3HA 1A2YB 2AK1L 3BIAX 1JF5A 5JW3L 3VXUE 4YPGA 4DWHA 4U0QB 3ARGB 3MLUH 1JJUA 1T1YB 3L3DB 4Z7NF 4G8GD 3WMSA 1UFUA 3LB6C 2QQLL 3UYOD 3DUHA 3WDJA 1RZKC 2NY7H 1F97A 4RFOH 1E6JL 3V9FA 1Q0YH 4WDIA 3VXMA 2NY0B 3MRMB 1X5KA 1P4LB 1ZHBB 3NH7H 2IAMD 3QG7H 4QYOB 3VH8G 3RGVD 3TFKD 4QNPE 5I8EA 4ZTOH 2PXYD 1A8JH 4HCRL 1NMAL 1CE1L 4LPWA 3G5XA 4RAUA 1I1FA 3TO2B 1D5IL 1TETH 4IMKC 5FA4A 3QBTB 3VRJB 4JDVB 1I7RA 2FB4H 2WINB 4U6YA 3G6JB 3LQAH 1KCVH 3VGFA 4HGWA 5CJQL 4E41B 3HUJA 3FO9B 3INUL 1ACYH 4OZ4A 3IAGC 3MLSL 4ZS7L 3KLDA 4X6CB 2R0LH 4KPHL 1HQ4A 3WBDA 3DUSA 5KSBF 1CF8H 4AH2B 1CICB 4JFFA 5FHBH 4PD4J 4X5WA 4UOW1 3TBWA 4I2XB 1I3RB 1U42A 4TRPH 3LQZA 2DQFB 5TPWL 4OKVA 1F6FB 4HLZG 1QFUH 3CVIH 2Q7YB 1V7MH 3KYAA 5EOCL 3HE7A 4PJFA 3WNMA 4LU5H 3EUUA 2IMMA 1VADB 3QIBB 5JW4Q 3GHBL 4LVHC 4JN1L 1KEGL 3QEUB 3D39B 2YMXH 4NQCD 4LLMB 5DQ9B 3H9SD 2DBLL 4KKCD 3V0VB 4MJ5B 1TENA 5C7XL 4PJBB 5DA4A 2H32H 1T20A 2APXA 2XWTA 3SE8L 1NPUA 2EIBA 3I50L 3O3AA 3S4SB 5J6HB 4GMTH 3VFMA 2A83A 1DANU 1BQSA 4DUVA 1ZT1A 3O45B 4NO3A 1TQCC 4PLJD 1A0QH 4NM4H 1XR8B 3BPOC 1MFNA 4JRYB 1G9ML 3LEXA 2AJSL 4LCIL 3OB0K 2C3VA 4N0RA 4JKLA 1VFAB 1RJZB 2NY5L 4NBXB 3BE1H 5ANMB 1IEBB 1NDMB 1IGYB 1NFIB 1T0PB 3EAKA 1RFDH 2ZSVB 4XWOC 1PGRB 3GK8L 1HWGB 1MI5D 3O6KL 1ZGLB 1JPFA 1YQ2A 3G5VA 4LSQH 5BZWA 1W0VA 1FORH 3P4NB 4UQ2B 1CDHA 1QLRA 4JCMA 2QHRH 3TT3H 4YXHL 5SX5K 5IOPB 1MFEH 2VDKL 4UB0L 1LO3L 4PJGB 4YHNA 3CLFL 5HJ3B 4JFXB 3QULA 1R3IL 1T1XB 3HI6L 4HLZH 3VFRA 4G3YH 5B3JE 3PV6A 4CU7A 5SWZB 4L4VA 5F89B 2MWCA 5F8RC 3QNXB 2XTJC 2VZ3A 4PP2B 3HE6B 1AKJA 5L8LB 1FL3A 3CVHH 1FYTB 1WISA 3MBEC 1H3WM 3UBXB 1G7IB 2V2TA 2NW3A 4JCLA 4ODWB 4OFYA 2A38A 5DMIH 1LEKA 4IRZH 5E6ID 3F7RA 2XKUA 3A6CL 4NKQB 5GZOD 1HEZA 1L0XA 5FF6A 5JLZA 1U93B 3M8OL 1MFCH 5I1GL 4BFBD 4RZCB 3U2SB 1FH5L 4RAVA 3IXAA 5ERWA 1E0OB 3PWPE 4O58L 1KYOK 4W4OA 1AO7E 4MJ6A 3MJGX 4WTWA 5L2JA 4ZSOA 3T0EC 3DX6A 4D9RD 2PW1A 2ATKA 1RZJH 1B9ZA 4FQJH 1GZPA 3C5JB 3I6GB 3MNWA 2BY0A 5KZCB 4TQEL 5TE4H 4FXKA 4GKZB 4QT5A 3MLVL 2X9WA 3PWJA 1G7JB 1JHLH 4KQ4L 2HRPL 4FZEL 4WIQA 1K8DA 1MNUL 3QUZB 4NHUB 4IMLB 5JXEC 1BIIA 4ZXBC 1KNOA 4LF3A 4P4RB 3Q1SH 2A6KB 5EBMB 1PZUB 3PL6C 2A6IB 3SPVA 1S7WB 2NY1C 2AEPL 2GT9A 3KYKL 1D9KB 3MYZA 4CN6A 5GRUL 1CGVA 1WC7B 2DQEL 2F53D 1KCKA 1EH9A 1TFHA 1NCAL 5EULV 2LAGB 3AU1A 4U3CA 3OAUL 3WSQH 3FOLA 5BV7B 4M43H 3MRJA 4NZUL 1P4IH 1BGXH 2GYSA 4WHCA 4WUKL 3FO0L 3ULVF 1HSAA 35C8H 1CLYH 3C6LA 3IJHA 4F7EB 1JV5A 3OJVC 4EI6A 2CKBA 1TJHL 3MRFB 4WO4B 2X4TA 5FKAA 1GC1C 4JZJC 4IRSB 4PJAB 5DJXA 3HI1B 1FLRH 2I27N 1HHGA 3WUZA 2WUCL 1L0YA 4UNVA 3SEPA 5ITFA 3ZKMD 3QI9D 3FKUS 3SDAA 2DQHL 5FAAA 4HZLA 4X98A 5KVEL 4S2SB 4JREB 5DQJA 3BSZH 3T2PA 3EOTH 1J1OL 1ND0A 1U8MA 1N6QL 1YYLH 2DJ4A 1AQKH 1PZ5B 2C1OA 3S34L 1N5AA 4P5TA 3L3JB 4JM2A 4UTBH 4WJ5B 4HH9A 2CLZB 2NY6C 1Q1JH 2R0KH 3QIWB 4HPOL 4HC1H 3S37H 5KSAD 4ISVA 3MRCA 1RZKL 5TDOA 4QHKJ 5D93B 1HYSC 5I30H 4HWBA 1Z3GH 3GSOA 1P7KA 3EOAA 4Z6AT 5C0AD 4PJ7E 2JCCF 1A14H 2YA1A 1DL7L 1KJVA 4F8TA 3I3DA 4H88L 4X9FA 1FCCA 5DUBB 1F4YH 2EYRA 1NBVH 4PJEA 5ITBH 3DX7A 3VWJA 5I1HH 4AM0B 4RFNC 1YQVL 4XCCL 3X17A 3B6SB 3OSKA 4A2MA 1CS6A 1F00I 4GAFB 5D70H 4WWKD 2WNGA 4NUGH 2JELL 1FG2A 1IC1A 5KVGH 3RVWD 2ZPKH 4E5XA 2QKIA 4PIRF 2CLVA 4X0KB 4HUMB 4X7SH 4XCFH 2AI0H 3RU8L 5GGSA 4DJMA 3STZB 3SGKC 2Q1EA 4PRIB 3SE4C 3B43A 3C8DA 2NY3C 1P7QB 3BOVA 1IGIH 4KI1A 2FX7L 2ADJA 4GAJH 5AG8A 3WLBA 1XIWD 1QSFD 1KF9B 4M7LH 4S0TD 4X9BA 3MYJA 3UYRL 2QQKL 4I48B 4G9FB 2NTFB 3JSSA 3MUJA 1QR1B 2Y07H 4P0DA 4OUOA 3REWB 1LWRA 5JO5B 5ID1A 2C3XA 3GDBA 4GBXA 1DFBL 5DDHA 3QDJB 5T1LD 2HAZA 3QHZL 1RUKL 5IV2A 3BDYL 3IJYA 4I3GA 5TQ0L 4MNHA 2NY2D 4K7FB 3D85D 3O4LD 4LKXA 4QOKA 1AHWB 4CN4A 3FO2B 4EUPB 5K9JH 5HGDA 1IEAB 4Y1AE 5DD5H 3TPUB 1FNEA 2O5XH 4Q9CA 2UUDH 3GMNB 1G1CA 1EFXA 3K8KA 4X6CF 1F6AA 1YEEH 1MFDH 3AS1A 1BECA 1BVLB 3KJ4B 3DJ9A 4GJTB 3UTZB 5INDB 1IM9B 3VXUB 3QUYB 2E9IA 2YD7A 5C0RH 3L3HB 2ZKHH 1QBAA 3QPQC 2DWEA 3QJFA 3T09A 4MXQD 2XWJA 4BH8B 2JJSC 3BZFA 1WTGT 1S9YA 2VJXA 1P1ZB 5I8OL 1XGUA 3CFDB 3GSQB 4NO5A 4RMWA 1B2WH 3LKNA 4XP9H 2EIEA 4J1UB 1LO0H 2DKSA 3GMLA 3KWWA 1IJ9A 5K9OB 3FCTA 4ZUTB 4G8GA 4OTXH 2PNDA 2Z35A 1UWXK 1EHNA 4PB0L 3O8XA 3ZDZF 2Q8AL 4YIQB 3D87B 2W1NA 5T3ZL 1HI6B 2R39A 3U82B 4XX1E 2IAMA 3AFLA 2F5BH 5IW6A 4HJJL 5I2IB 2HFEB 4L8BB 1TZGH 2RBLA 3W82A 5D2LB 4HUNB 3RGVA 1T21B 5FHAH 2VXUH 3OKNB 3SE9L 2PXYA 4PRBB 1RK1A 5DO2D 2ZJSL 1K3IA 5DEGB 2YD2A 5CJBA 1F2XK 5FCUL 3T3PE 2WLYA 4BH7A 1GGBL 3QCTH 3WHXB 1G7HB 3ZSTA 4LRIA 1DUYB 1U8NB 5LAXB 4IRJA 2YPVL 4LSSH 3HRZB 2IF7A 4LVEA 3ILPB 4TOYL 4P23B 4MQXC 2GUOA 5L2KE 5MP6L 5GJTL 2A6DB 4V1DD 4PJ8D 1YN6A 3QNYA 2JIXB 4A6YH 1BREA 5LG1A 1WICA 4PGEA 1WEJH 3FQUB 5CS7A 4P2QD 1IAIH 1FRGL 4N0UA 5D7JA 2UV3A 1MHPL 4NGHL 3DSFH 2UWEA 1OAKH 4O2FA 3MLXH 1KIQA 4L5FL 2YWYA 5LGJB 3ULUH 4NQCA 2AEWA 3D9AH 5GIRB 1C08A 2AJXH 4XI5C 5L9DH 1JGLH 1J1XH 2ORBH 4R4ND 4HK0A 3F5WA 3UPAA 3VRLE 4Z78A 5ETUB 9CGTA 2NX5E 5D1ZB 5JUEL 3DMMD 3S96B 1AXSA 1J86A 4CJ0A 4TYUA 2GTZA 3R1GL 3ARFB 2R0ZH 2E6PA 5DMJB 1C5BL 4HAGA 5IIEA 4WRLA 5TH2B 1GPOL 3PWNA 3EHBC 1DBJH 1I3GL 3FQNB 1MCPH 5C08B 2YK1L 3O3EB 2VDNL 4PJ5D 1MIEH 3KXFD 5T3XD 5CJXC 4GW5A 4NUJA 3PWLB 4NFBA 5ENWB 2VLRD 1JWSB 3V5DB 4G8IA 4BUHA 3WXWH 5IFAL 4JO3L 4NHCH 1H5BC 3LPWA 1QSEB 1GC1L 4CDGC 1CDYA 1FO0L 3HS0A 32C2B 4HMDA 1A6PA 2CGRH 2E8YA 4ZDHB 5IBLC 1IEHA 1GAFH 3ES6A 4Y19E 2BNRB 4PRPE 3MGAA 1MVUA 3NMEA 3U7YH 2D31A 2FJHB 1B4JL 4O02H 4AL8L 3FRPA 1WBZA 5GGTH 4PRHE 1J1PL 2M8XA 3TWCH 5JHDE 5CSZA 5DF0A 2YHGA 5A40E 4HX1A 1CFNA 1OWRM 4FS0A 5C2UB 1LVEA 2Y36H 3OAZK 1J8KA 4LCCB 3QQ4A 2D4DA 5CGMA 1R6VA 2A74A 3MJ9L 2VXTL 3L5HA 1F8TL 4KKBC 2DTSA 3L3KB 3M45A 1UZ8A 1YEJL 1U8JA 3RWIA 1X5FA 3MRLA 3ZKXB 4B0MM 5IMKB 1NH6A 3PWPB 5E6IA 3TJEH 2XTJE 4UDTA 1AO7B 1OM3H 4HZAA 5T3ZE 1UB5A 2FGWH 3PQYD 1HIMH 2Q7NA 4D8PB 4FFWC 4HUWA 1QACA 5CBAB 5AZEH 1IGTA 1OCWH 2Q3ZA 5BCAA 3SGJC 4PJCE 4JPIB 1PEWA 1FG9C 3BP5A 3F12B 4FQ1H 5KN5A 2R8SL 1A6WL 4YHMH 2BNQA 1ZLWK 2XT1B 5FYLL 4TNVK 3SQOL 3MA7A 4JFED 1OTUC 4LHQB 2Z8VC 3VFTA 3P11L 4IOFC 3D3VE 3P9MB 5E8NA 1S7QA 1S7TB 4EDXA 1HHKA 2A9NL 1KIRA 1J5OH 5SWSB 1KPUB 2VH5L 4E0RB 2OQJA 4KI5D 4G6JH 3T0EE 3OR7B 2FIKA 4YDJA 4DUXA 4H20H 3HAEH 5E2VL 4Z0BL 3V5HA 1ITBB 4FQXD 1KPVA 3W2DL 3BAEH 4WUUE 1WBYB 5HI4D 1BOGB 2BSTA 3BYYA 1XZ0A 2IBBA 3V6OA 2YWZA 5DR5H 1ZEAL 3RZCC 4F7PB 4NZJA 2HT4D 3VI4F 3RJQB 3MV7D 3ILQC 1I9RL 2P8LB 1S7SB 3K81A 4RGMB 1JYVA 5IEHB 3HG1D 4L9DA 5DRXB 1BFTA 5GGVY 2ICEA 3ZKSD 3QA3A 4K3JL 4BM7A 5BJTB 4Y5XC 3MLZL 5IMOA 5LGHL 1NCWH 2I5YL 2IC2A 3VW3H 3V52H 5EIIA 2C3GA 3NACL 2EYTA 4QGYA 2FATH 5KVDL 3WJJA 1B0GA 4NKMA 5JDJA 4PV8B 4UINH 3RNKA 2OP4H 2ZCHL 2Y6SD 4JFZL 4AEFA 3MQIA 1K6QL 2F54D 3DV6A 3FT4A 4LVOB 5E99H 5SWQA 4L9LB 4OF7A 5IJKC 4LKCB 4E42B 4H8WH 3LKSB 1U3ZA 3U4EB 1CTNA 4OT1H 5ESAB 2B1AL 4MMZC 4PV9B 3DROB 4O51B 1XCQA 4U1LB 5CUSH 5IMLB 3E8UH 2X4RA 5F1KC 5MENE 4B7LA 2YXMA 1YNKL 3E3QC 1CZ8H 2FX9L 3CFBA 4NRYB 1TNNA 3MNVA 3LH2H 2VXVL 4KTDL 5HYJD 1P84J 3QDGE 4NBYB 4N0YH 3SDXB 1WWWX 1OSZA 1SJEB 4R7NA 4HV8A 1QOKA 3ZKQD 4PLJC 4OCRL 4X99A 3OB0H 2ZUQC