1Z1ZA

Nmr structure of the gpu tail protein from lambda bacteriophage
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
129
structure length
129
Chain Sequence
b'KHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Minor tail protein U
publication title The NMR structure of the gpU tail-terminator protein from bacteriophage lambda: identification of sites contributing to Mg(II)-mediated oligomerization and biological function.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Viral protein
total genus 28
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06141 Phage_tail_U Phage minor tail protein U
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1700 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1z1zA00
3FZ2A 3FZBA 1Z1ZA
chains in the Genus database with same CATH superfamily
5E3PA 3DKDA 4LBIA 5LT5A 3FJ2A 1P1TA 5BXIA 3MM5B 4MIWA 2JEJA 1SQEA 1XQIA 1S6PB 2E1RA 1LFPA 2CJKA 2FJAB 2XSJA 1TK5A 2HNZA 4NXNJ 1PBAA 1W2IA 3UPFA 4L72B 2ZJPQ 4PWWA 3I6PA 2GO9A 1JK9B 1R7IA 4MMOA 1CSJA 3W5XA 4IR1A 1RI7A 4BS2A 3OT9A 4U67Q 5D4PA 3RRGA 5HSPA 1YZ6A 4NYPA 4ZJLA 2XGQA 4DN9A 2LECA 5IC6B 4JB8B 1S1XA 2OUGA 4ED6A 4LVOP 1PKUA 2OELA 4J9VA 2HFOA 1QAIA 5ADZA 4QR0A 3DRPA 1X4DA 1QAJA 2HFNA 3H4BA 4DZ6A 3NCRA 4CZCA 4LF8J 4NCBA 1Q79A 4YR0A 3RW6A 4B3RF 3KKFA 1D9DA 2V6AA 2G0CA 4WFYA 2VC1A 3NXZA 2E9TA 5A8RB 2H5IB 3M8YA 3N6MA 4ZPBA 1SJRA 2VODA 4RW8B 2CNLB 4QYZK 4ILLA 4X4NA 3QSYB 3HHLA 3QMQA 3R5JB 2BDPA 2RUGA 2QG9B 2R7SA 4FVCA 2W2QP 4DMZA 4IFVA 3A8JA 1MLAA 4O3OA 5KFMA 4WZQA 5HVGA 1KC8T 3C15B 1XNQJ 3O2IA 1KLNA 2Z58B 1S6QB 3JQMA 3V2UC 2DGVA 1CJKB 2WVBA 3QLHB 1RHKB 3BQ2A 2QC3A 3DXBA 1IR1A 3SQGA 2R2UA 3MECB 1CJVA 4HI2A 4Y00A 3BSOA 2R7WA 4MKAA 2CQGA 5EDWA 1H98A 2ZNZA 3RAMA 1TKXA 1G6BA 1RCOB 4JI0J 4K5RA 2DGXA 3NKYA 1VC6A 1VFJA 3GLJA 2HHXA 4IR9A 2I9SA 4LFCJ 1D0EA 4F4XA 2H54B 1FTCA 3WQPA 3Q89A 4YB5A 2MKYA 6FD1A 3QT6A 5KFRA 1REVB 2LDIA 5HJYA 1FJEB 4MK7A 2M70A 1HPZA 4IKAA 3HSDA 2EC0A 4ITSA 3D6MB 4BDPA 3I5BA 2YNGA 3HJVA 3MCOA 1ZAWA 2RF2A 2CWKA 4XDDA 2HIQA 1N5YB 3HHDA 2D9PA 4TY8A 2FVSA 1FT8A 5A8WA 2X1FA 3IWLA 4P52A 3VF0B 4DF8A 1M5PC 2ATCB 2BV3A 2KVQE 1V6HA 4K4TA 4OV6A 4NLWA 3HPOA 1WUUA 3G8TA 4PG5A 1FHTA 5M2RA 1TKTA 1JLQB 1GFWB 3GIRA 2LEPA 4I6WA 3FSIA 2VL1A 5LXYA 1TL3B 4LQ9A 3PW4A 2FQQB 3NBPB 1HNZF 2B4VA 5EWGA 2FZKB 2JL9A 3MPDA 4YY3F 3PJ9A 5C7PA 4PUOA 1ZOTA 3MMJA 2J0QD 1SL2A 2E1CA 2JH3A 2D74B 3DFEA 2QV6A 4JV0A 5KFSA 1C1BA 5M2UA 4Q45A 4ZHRA 3MR7A 5D3GB 4DV4J 3ZO7A 4DL2A 1RT3B 3DOKA 4J9MA 5IWAJ 3KDNA 1QTNB 8ATCB 1VISA 4TY9A 2GA7A 3RR8A 4K4ZA 1WC3A 4K4WA 2VPWB 2A2CA 4KIAA 4RNNA 3JQJA 4DR4J 4LFAJ 1YRTA 2CPIA 2JC1A 4E2FB 3PRVA 2RT3A 2DNNA 4UW2A 1KP6A 2VFVA 3GJQB 1RE1B 5EWFA 1NKEA 4ED2A 2V4JB 2AD9A 1EIYB 4RBTA 1QUPA 2CJYB 3GCXP 3CMAS 5H1SV 2DPJA 5I42A 1WI8A 3DGVA 4R5PB 4HHHA 4QIFA 3MUMP 2C3YA 1J5EJ 2YQ0A 2XCPA 4AL5A 4DSIA 4NCGB 3DDKA 4M8LA 1WKKA 2WOMB 1WHXA 2OPSA 3BKUA 2JEFA 2YXLA 3FGVA 1ZA2B 2CQ1A 2G2ZA 1SVDA 3GCWP 4X66F 1DQ9A 3CWJA 2UUAF 3M8QA 2W24A 4HI1A 4LIRA 4HACB 5DZ7A 5LJ5Y 4CH0S 2NZCA 2XYHB 3PTWA 3BJYA 3CD6S 3V6JA 4PG7A 3POTA 4ZCKA 3IXQA 3PYDA 3D0HE 1GT8A 1FVSA 3A8KA 3B6BA 3D68A 3HHLD 1YK9A 2HHQA 4B9NA 1WHYA 1Y7PA 4USJC 2G4BA 4ILMA 3J81U 3FBBA 3FQKA 1QVFR 2MZQA 2KG0A 3FCHA 3IR7B 1X4FA 4V19J 2DXEA 2NXUA 2Q6BA 3UD4P 1JMTA 1YG0A 5KFUA 4DV6J 5F9NA 5G4DA 2X3GA 5IM0B 2XSFA 3SV4A 2YNFB 3M8WA 1JJHA 3EZUA 2OEKA 3KUEA 3QWPA 4ZLLA 4OX6A 3VVTA 4OIXA 3IAM9 4I67A 1JKHA 4EYIB 3QYYA 3IM9A 3BH6B 2QX0A 4Q2MA 2DCLA 4ICLB 3G9CA 2KYZA 3FSYA 3OFEA 3LP1B 5EX0A 1QM9A 3HHKA 1NCLA 1NNDA 3BYRA 3K7RA 3MEEA 1U49A 2DH8A 1YHQS 5G0RB 2GQQA 4LR9A 3T1YF 3AQOA 1X0PA 4KGZB 3TAMA 5KT2A 2VZ9A 4DSJA 2PIIA 3OV7A 4KKOA 1DTQA 3PW2A 5DS7A 3TJ9A 4PPDA 3NS6A 3SCIE 1U1RA 2DGQA 5CABA 2YH1A 3KLVA 1VRTB 1T02A 4OHWA 4RW4A 2MMYA 1OY6A 4ES1A 2QTWA 2W7PA 3BR8A 3OR2A 1RA7A 4DQRA 3QFHA 4FF1A 4C8YA 4DCJB 4NZ6A 2FHJA 3ZC4A 2CDRB 3EM1A 3HMJG 1C0UA 1FRLA 2XEXA 1YRXA 4CO1A 3JQKA 2U2FA 1RT6B 2E7VA 1S9EB 4M5MA 2BOPA 1Y11A 2G0IA 5GAHU 4HYKA 3UVJB 2ZWOA 1BXNA 5CYQA 3DLHA 2UV8G 2A1BA 2V63A 1OY9A 1LFWA 1N6QA 3CMQA 2MHEA 2FHOB 2G1DA 2WONB 1VQKS 4MFBB 2Y1JA 4ATNA 1WJ9A 4AXJA 4QU7A 3FNNA 1BUXA 4P75A 2JEGA 1XEZA 3RTVA 4ZCIA 1WD6A 3MR6A 4QWEA 5EGYA 1WKLA 3KK3B 1DTTA 4CYUB 4G1IA 3E01A 4F25A 3KJVB 1Z1ZA 2B6AB 4AL7A 4IOCQ 1M5OC 2CJBA 3ZZTA 2ZC3A 1J5OA 1RT4B 2AEFA 2MSTA 4B9VA 2C22A 2PI5A 1M1GA 3IRXB 2BABA 2DISA 1N4LA 4DFPA 2QA2A 3QBCA 1OSDA 4FF2A 4H54A 4DL6A 2EXUA 3MAAA 5KFZA 1HA1A 2P9CA 4X4RA 2DHGA 1UWBB 2UXCF 4OZ3A 1FK9A 1WI6A 4G3IA 3CCSS 4IDKB 5DG8A 3OVAA 4RO0A 5F8HA 2EVZA 3KUHA 3MDFA 4LF6F 4K4UA 4QCLA 1BMQB 5FIIA 4ILRA 3RYLA 2HQDA 3U1NA 2M4MA 2UXDJ 1JJCB 4K0KF 2NS1B 1ZS6A 4DV7F 2O01C 4ECZA 1NK4A 2IC3B 1UP1A 2DVIA 3IS9A 2PEHA 1IBMJ 1SUQB 4J9PA 5HMWA 3J81j 1NK7A 3GIJA 2RAQA 4TQRA 1URRA 1RT7B 4Z7YA 5L8RC 1OPZA 2AYEA 1RBOB 1V5IB 1ZM4A 2PA8D 3OFFA 2YKOA 2K2PA 4MIAA 4DEZA 2B7BB 1WORA 3KJFB 4K4XA 2CWXA 1AUDA 2A10A 2C2RA 3BBFA 3KDOA 5CCLA 2MQLA 4ZK7M 4DDFA 3DLEB 1IXKA 4B9MA 4YUDA 1FDAA 4X2BA 2L9NA 2DITA 4ZITA 2ZJRQ 1UA0A 2CIMA 3CIZA 4QR2A 1S1VB 2C28A 1GXTA 4NEYA 2M52A 4YOEA 1HR0J 2ZC4A 4A8QA 1RBLA 1KOOA 1YDLA 4LJMA 3CXCR 2V50A 4LF1A 1N33F 3BPDA 3TEGA 2IMOA 3CDBA 5ITHA 2RD5C 2CPFA 1G4CA 3MTKA 2MPUA 3QGIA 1YSJA 1D9FA 3R3TA 3VWSA 3RB6A 2OP5A 4EU0A 1H0HB 3US5A 5E41A 2DCUB 1SV5A 1K47A 4X4SA 4PXDA 3OTBA 3AA9A 4WZMA 3OFHA 4I1TA 1VBXA 3T6BA 4EGLA 4DSFA 1YVFA 4KGKA 3MXHP 3DOMB 4WTYA 4DUZF 4ZP7A 3QO9A 2ZE2A 2VG7B 1WEYA 2LCWA 2XS5A 3J7A1 1I94J 2ZH4A 3HP6A 4X65J 1VJWA 5L1KA 4ALZA 2J0XA 5K8MA 1N8RT 4WFXA 4BLGA 3BQ1A 1IBKF 4C8MA 3V4MA 4WTOB 2DIUA 4PXCA 5E3RA 5JVGQ 4QWBA 1KSPA 3H2UB 1SQGA 2ZM6F 3ZZYA 4OZ5A 3H5XA 3VGTA 2NPFA 3CCUS 1S72S 5FDLB 4CO0A 2HMIB 1E6YB 5KOXA 1VQSA 4NL5A 2YKAA 2CQPA 5I3UA 3CJ2A 2AJ4A 3WX8A 3J7YI 1FDDA 1V9OA 5KG7A 4OI1A 3M6WA 4C97A 3DLKA 4CLSA 2IFXA 3KG4A 4FYXB 1XERA 3EGWB 4CRJA 2F4FA 4NZ0A 1O8BA 3N4WA 2L9DA 3MMAA 5LOQA 1RU1A 3CCES 1IWGA 4CWBA 4C2MA 3HF5A 2OPPA 1BQNB 4I69A 5HATA 5GAGU 2FIUA 1GX6A 3BKFA 3QT7A 2H5JB 2VF3A 3C2PA 2ZHAA 3MEKA 5CAAA 4O23A 1XR6A 2DHAA 2UU9J 1HPZB 4NPOA 4W98A 2DKOB 3M30A 3TX8A 2X3DA 4FF4A 3UDEA 3HM9A 3GR0A 2V94A 4MJKA 5KTQA 4KFBB 1YBTA 2PE8A 3HT0A 1B3TA 4ID5A 3IRWP 2M9KA 1IBLJ 2ZOGA 1WOPA 3CDAA 4DPYA 5CH7B 1T94A 2R8KA 4DS5A 3GYXB 4LF5J 4PRFA 2ROPA 3IG1B 2HQFA 3UR3C 2E7WA 1RUSA 4QYRA 4OLOA 5KG0A 4M94A 1QLNA 1VCTA 2MKKA 1OO0B 3GTYX 2XO7A 3M8PB 1ITPA 4ZA1A 1F0XA 1C1CB 1GAOA 4PAAA 1C4AA 4OYMA 4O3QA 4X64J 3GZ7A 2IAJB 2MSSA 1M5HA 4CLWA 3VTIA 3G82B 2LVWA 4U6PA 3NGKA 1T05B 1QY7A 3JSMB 1TL5A 2HAFA 2HNDB 4N47A 1TV6A 1FKPA 4HEA9 2WB4A 1BQMB 4HDGA 4Q44A 1DJ0A 2F8MA 2DH7A 4RWWA 2X1AA 1UCNA 3R5BA 2CQIA 4GRSA 4Y34A 1MWZA 2KM8C 3FFIA 1GMVA 5KFBA 2R7VA 4FZVA 3OL8A 2PDAA 3A3NB 2GVDA 3MZIA 3PDNA 1VBYA 4YY3J 4C4WA 3G6VA 5T7LA 2HQCA 4I2QB 1RWMB 4FPRA 1KDNA 1M5SA 1S0OA 3GV7B 2B5JA 4ED3A 2Z4PA 4GC6A 2IMWP 2FZGB 4M5DA 4OX9J 3PYFA 1FNMA 1P9YA 1RT1A 1YGYA 2IDEA 2FDNA 1G3OA 1EZZB 1S59A 3AJDA 1F2HA 4JV2A 5CYMA 1NJIT 2YX1A 3CT9A 3CD0A 2VG5B 2NR0A 5E0OA 3I0RA 4I0WA 3LOUA 3T19A 1GXLA 2XWYA 2HRYA 2BQ3A 1U47A 3Q8SB 2EWHA 3GFZA 2EKNA 5DQGA 3DLGA 4RPFA 2LKZA 2V68A 5I3QA 5KFLA 4B9TA 1LV5A 1FDNA 2CQ2A 2EBEA 2M8HA 1U1NA 4NRTA 5DLFA 2W2NP 2IM1A 1JLCA 1X4CA 1S1WA 2ZH5A 2BJ8A 3VZIA 2KG1A 1NO8A 2F8EX 4I2PA 1WOOA 5D4OA 3BKTA 2GJ2A 2F4VF 4CM2A 3ITHA 1L5UA 1VI7A 4KAIA 1ACMB 3DRSA 4CO4A 2IY5B 1NSKL 3GE9A 3G86A 1R0CB 3Q22A 5KFCA 2OGUA 2YNIA 5AJ3F 3CJ4A 3DRRA 3H5SA 2E5GA 3CJ8A 4HT5A 1VR6A 3KLIB 1PBUA 1AYEA 3M05A 4FS2A 3MEEB 3R6GB 3F41A 3DMJA 1HW8A 5KT6A 3DDNA 1CLFA 3LGNA 3HLUA 1TMMA 4M95A 4Y3CA 1WKJA 4AE5A 1HMVB 2XTJP 3Q8QB 1CQMA 1MMNA 2HFVA 1UEUA 2NSCA 1FD2A 4KC5A 2LXUA 2ILYA 2F63A 1RHQB 1U24A 3SDEA 2K7JA 2JRSA 3M2RA 3W5ZA 5F8JA 4QIVA 2BE7D 3DRXA 4B3OB 4K8RA 2KT2A 5DRKA 4H4KA 4DR1J 1S49A 3ILIA 3E8OA 4MYTA 4B3TF 5KG6A 1X9MA 4PYDA 1HBNB 4K4VA 3I5CA 5GAEI 1RWUA 2AJ1A 4IOBA 4CO3A 5HQ8A 2MKJA 4R0EA 3BYPA 4V19X 5K20B 4WYWA 4DR3F 5J2PB 3JTPA 1YJRA 2R2SA 3EPGA 4YP3A 2UUBF 4DSLA 1K8AT 1ZAXA 3DGPA 4PG6A 2Z2MA 2IDLA 4F50A 3LANA 3MEDA 3W9IA 1N34J 1WDDA 4B9UA 4YB6A 3UDLA 2DHSA 3D54A 3D3BJ 2MJUA 3JSRA 4DQPA 4FKXA 1B70B 4B3SJ 2M88A 2ZBPA 1WG1A 4C3LA 1F5BA 2AIRB 4UUWA 2F7VA 4AD6A 3KLFB 1T03B 2B3TB 1XMOJ 4PWDA 1IKVA 1QTMA 1SJFA 5MAOA 1Q53A 2FVPA 4RNFA 5D77A 2COLA 2KRRA 4MK8A 3LH2S 2RJZA 2GIRA 4UT4A 3VAHA 1U0SA 3EXYA 3T5LA 4ZPAA 3Q8YA 5C24A 3SV3A 2M8DB 2BOAA 4RNMA 1GMWD 3N6LA 4ZP9A 2MKIA 2RUSA 4Z37A 1VIXA 1WF0A 2ZVIA 1IKWB 2XG8A 3NAHA 4HKQA 5KT5A 3S1TA 4H4MA 2BW7A 1ELOA 1P6TA 3QGHA 3PKMA 3G87A 2GVZA 4EEYA 3PW0A 2Y1RI 2H9ZA 4LRAA 4F4ZA 2GHPA 3V6KA 3D3CJ 5IZHA 1LW0B 3NCPA 1PYSB 3D0GE 1IQZA 3TUIC 1H2UX 4IH5A 3OL7A 2AYGA 2HLUA 2CQ3A 3OUYA 1L3UA 2DK2A 1H72C 4WWSA 2P9GA 3D1HA 5T14A 3LUYA 3BO2A 3W9JA 4NYOA 3HDSA 1MROB 1FJ7A 3KLGA 3CCWA 3GFXA 4HT7A 2HS3A 4IG3A 3V6DA 4WF9Q 4CO2A 1QSSA 9RUBA 2XO6A 1YITS 2XYGB 4YB1P 2UXCJ 3LGMA 3BR9A 4DSEA 4DQQA 5D0GA 3M9MB 1I6JA 3BGRB 4IQXA 2ROGA 4LR8A 5KFHA 4ZVFA 4AFFA 3K5MA 1VDHA 2DGTA 3H40A 4K0KJ 4PQUB 3T5JA 1QDUB 1KVJA 3Q86A 4DV7J 1NJXA 1HNVA 4PZVA 1UFLA 2V2KA 3CCZA 3GSIA 1TMJA 1YKWA 4KQZA 1NBEB 1WC5A 1AFJA 1S77D 5DDOC 2JEIA 4C6AA 4K2JA 2OFHX 2Z2ZA 1H7XA 2C2ZB 2GFFA 1BHNA 4IFYA 1YQHA 3GYNA 4JUZA 3PZPA 2HS0A 4U9RA 2KHDA 3RB4A 1EQMA 4KO0A 4ZIVA 2M7SA 3C16A 2V9KA 3WC2A 3TWZA 1FDBA 2GX8A 3CW2C 3Q0AA 3I31A 3TR5A 1TAQA 4A8MP 2WVFA 4X4VA 1Q5YA 1Q0NA 1VK3A 4XDCA 2VV5A 2OFGX 2JLEA 2BJ7A 4M5HA 3GSDA 4M5LA 2AZ3A 2KFYA 5HVFA 2OTLS 2K1RB 3GIKA 3BPSP 4F36A 3D66A 1ZH5A 2C3PA 1R8CA 4L3NA 2NCKL 4UQGA 3B8HA 3DOLB 1RP5A 4GVBB 1HQ2A 1N33J 4IUFA 2MKSA 2MQNA 5LM7E 4YR3A 1U7LA 1KLMA 3CVKA 4P74A 3GG0A 3OHBA 1HBMB 5F41A 5LJ3Y 4A8SA 4DHVA 1EARA 1FD8A 2NXCA 3O8WA 1FI4A 1HQEB 4G1QA 2ZZMA 4PXEA 1LOUA 4HTJA 3J7AN 4DPXA 1NJZA 5KFOA 1UVIA 4O44A 1UVJA 4KPYA 4WE1B 3MM6B 4WKRA 4CLUA 1KRPA 2BJ3A 4DUZJ 1SL1A 1FKAF 2DGUA 1PIEA 2OH2A 2OIHA 1R8BA 5HJXA 3KFWX 3M7VA 2P6TA 4OYIA 1LWCB 2DO0A 3TVYA 2KZZA 2BRKA 1IBKJ 1TFYA 1RT5A 3FEXB 3TANA 3ISNC 2G9OA 3OQ2A 2HHWA 5A0YB 3MF5A 3C46A 3MUTP 2ZM6J 2LMIA 2AGOA 4F4AA 1X4BA 1SC6A 4CLTA 4UUXA 3V4IB 3KMQA 3MM5A 2PGCA 4N77A 2HVIA 2V4RA 4DCPB 3ONQA 3EX7B 1VQ5S 3X1LB 2ROEA 4NMLA 4OI2A 1S6PA 2LU2A 3R1HA 3ZZRA 2BR0A 2ZBIA 3QIDA 2NUUG 3MWBA 2OO4A 3NWRA 5M2PA 3KUGA 3CJ0A 2FY1A 3D6TB 3VQSA 1SH2A 1IVZA 3C6UB 1IJFB 2HBZB 2MZTA 1Q1KA 1LK5A 2J5AA 2QSFA 3K58A 1GX5A 3HO1A 3H42A 3N5BA 1L3VA 5HQMA 2L08A 5BYQA 1TL7B 4FDFA 4DUYF 2AZ1A 4ZJQA 4U95A 3R1LA 4DR2J 2DNOA 1B0TA 3CULA 1C0TB 2OMLA 3BF4A 1WSVA 1H74A 2YH0A 2ZKTA 4ELTA 2AJQA 3L9ZA 4P6QA 4YMEA 4QW8A 1HD0A 1RGVA 4JV5J 1DARA 2HK2A 1ZTWA 1UVLA 4MK9A 4O3PA 3BZQA 2OTJS 4USIA 5A8RA 4ZLJA 4EFAC 3LPEA 4C48A 4ZP6A 2W01A 4RW8A 2M3DA 2BM1A 1UZHA 3P49B 3LP0B 1VRQC 2L41A 3W1YC 1N56A 1HD1A 2OD6A 3GG1A 1Q4RA 4FBUA 5H9EJ 3A12A 2BXJA 2ZH9A 4OYPA 1TKDA 3C15A 1S6OA 2CFXA 4ED1A 5D4NA 1ROFA 2IA6A 2VFSA 1S6QA 1FERA 3Q24A 1CJKA 3QLHA 3SXLA 2FVCA 3PO4A 1KTVA 4I6YA 2LFVA 4LF9F 4YHHF 1F60B 2B4UA 3MECA 1BE4A 3FMBA 1WELA 4CH1A 3CSKA 4C8OA 1IWAA 3ZTQA 4NLTA 2VBWA 4KHRA 4ZDNA 4WFAQ 1EETB 2DT9A 2QEXS 4OI0A 1U02A 3N5FA 1LWEB 2YKMB 1S99A 3B82A 4NLVA 1NB7A 1MN9A 3KHGA 2FC9A 3SYZA 4JP8A 5D0EA 4CLLA 2B9XA 2IHR1 3OFGA 2D3OR 3MPVA 4ZPDA 2HG4A 2HHTA 1REVA 4DS4A 3HD2A 2DYAA 4CDIA 2WTFA 1SPBP 3LAKA 3GONA 2AKWB 4I7FB 2VICA 5FLXU 4CLKA 2Z56B 1IR0A 3OVSA 3OL6A 1WEZA 1OWXA 4ENOA 3QAUA 4R0JA 2GW8A 2BQUA 1R8PA 4WU2A 4JI6J 1E6VB 1UAWA 3IA0A 1N5YA 3TARA 3HVTB 2HEKA 2R7TA 4NXMJ 4K4YA 2CKWA 4HLBA 4LF7F 2W25A 1CPZA 3FKBA 3ZTSA 1W2BR 1SC1B 4DBQA 4USTA 5CD4A 2XWXA 1XJWB 3MEGB 2LLZA 3EDQB 2VOPA 1W7WA 1JLQA 2QL5B 2VASA 1TL3A 4MH8A 3NBPA 4UZCA 1AT1B 2HS4A 3TQEA 3ZZOA 5H9EK 3QSIA 5AXNA 2POKA 2GJFA 4JYAF 4JI5J 4OHVA 2J76E 2WSCC 4DLEA 5GAHI 3QZ8A 1S9FA 5D3GA 4NLSA 4HDHA 2HFUA 2VG6B 4ZCLA 1RT3A 1GK8A 4EZ6A 2QMXA 3FMWA 2FLOA 2XZDB 2W9BB 4OI3A 2E5IA 1JJ4A 1I1GA 1Q16B 1R0AB 1PSDA 4I56A 4FKYA 2FYXA 4LRCA 2C2MB 4WKYA 4L6V3 2WBRA 2C1EB 2O5DA 2GZOA 5J1EB 2HVHA 1SC4B 1MU2B 4XPCA 1F5AA 3FBFA 2V4JA 1N0VC 3OLBA 2EG2A 2IJFA 2RILA 5IT0A 4R5PA 3RG6A 4ZOSA 2DHHA 1OQ6A 5JJBA 1Y4ZB 4LRBA 1ZETA 4NCGA 1UTAA 1HQUB 2FHMA 4DU8A 4J9SA 2LXIA 1V3SA 4JI2F 4KV8B 1ICEB 2WOMA 2JJ4D 3EZOA 2EFOA 3P5TL 4K4SA 2VD3A 1VQPS 5LMUJ 1IM6A 4OYXA 1TVRB 2V2QA 1SC3B 1N52B 1U2CA 3EICA 4DG1B 4KY3A 2V5HG 4NZ7A 4HACA 4C8LA 3MOZA 1HNIB 4XO0A 1AA1B 2QLBB 2D3UA 3IWXA 2KXNB 4OZJA 1RZMA 3P5BP 2BZ2A 1XR7A 4BWJA 2ZD1B 2W9CB 3BGUA 4DV3J 2NXJA 1V5VA 3E3XA 3W64A 3THVA 5E5NA 3GILA 1FRXA 3BV8A 1CJUB 2UUBJ 1QSYA 1HNXF 1S57A 1GTHA 5IM0A 5ETPA 2EPIA 2CUYA 4PG4A 2YNFA 3C14B 4ZVTB 1BLUA 4LUBA 3F73A 3R9LA 1BWVA 3TUJC 3HKWA 4CTAB 1NPPA 2G2YA 4EUVA 3PFEA 2QZ8A 3CD7A 5CD4H 1DBDA 4ICLA 4ECWA 1SH3A 2ERRA 3I82A 2QT7A 4USWA 1RTIB 2M2BA 5HQLA 3N01A 2JWNA 2P5VA 4QWCA 3SSRA 2FGOA 3LP1A 5I4MA 3IM8A 1S48A 2HNYB 2E5LF 2GC8A 4IOAQ 1T9XA 2FJEB 3KK1B 1FRKA 2UVRA 3MM9B 3TEHB 3LWMA 5G0RA 4CNZA 2OEJA 3PX6A 1WNEA 3HI9A 3R5AA 2RQMA 1IUJA 1N5TA 2DO4A 1U1QA 2UP1A 3QRRA 2HLTA 2B56A 1N32F 5FLXY 4LSLB 2VPXB 4RWXA 2B51A 2OPRB 5J2QB 2R7QA 2OKQA 1FNOA 3GP9A 1GEHA 3UNGC 1RAFB 1YLXA 3GJTB 4EK2A 1LWFB 3BEGB 3PO5A 3OLAA 3FDSA 5J2MB 3PRBA 4IQMA 1VRTA 3DLLQ 4LQ3A 1K0VA 2WAQD 2GIFA 3K5PA 3AFGA 3RBZA 1PGZA 2FD2A 1SIWB 1ZA1B 4OV1A 1FA0A 2O1PA 3RBDA 1O5JA 1NKBA 3NCQA 2AF6A 5LMNF 5ETOA 3PR5B 2GMJA 4F7VA 2B43A 2HHHF 3G2XA 5SUHA 1HFEL 4LF4F 1RT6A 1S9EA 1NM2A 2P8IA 1VC5A 1UJ4A 3UVJA 3UFCX 4E0DA 4PABA 1VHFA 2KKHA 3NG8A 1UFWA 2GGPB 4F2RA 1T9VA 2A18A 4DX5A 4F02A 1WF1A 2WONA 4MFBA 4JI8J 1VRUB 2IIHA 4ZVHA 4QQBA 2OSRA 3P96A 2WK4A 2MQMA 2E9RX 1GXUA 2IPOB 4KSEB 3KK3A 3CJTA 4CYUA 3MM8B 2UXBF 4RL1A 2GJIA 1OJ4A 5A8KB 2E5JA 5DM7Q 3KJVA 2B6AA 5HK4A 4ECRA 1Q7LB 3HSZA 5GAEU 4FYVB 1NJYA 1RT4A 1XC9A 2XLJA 1HARA 5IXUA 2E44A 2VA3A 4OZLA 2XCAA 3I0SB 2APOA 5K8PA 2IVFB 3GFHA 4U7CA 3KHHA 4IRKA 2XS2A 3BSNA 3W7BA 2K8GA 2KRBA 3IRXA 4BCAA 2PEBA 1VQYA 3WIVA 1VYAA 3I4PA 4OQJA 4DF4A 1U25A 1UWBA 2CG8A 4QBUA 1HYSB 1X31C 3DNCA 1KWMA 1WEXA 4IDKA 4NLPA 3CJKB 3HSGA 2DY9A 4NLXA 2R8IA 2MY8A 2KT5A 4P7VA 5J1NA 4B17A 1QSLA 3W61A 2V8DA 3OTOF 4OYAA 2R4FA 2IC3A 4TU7A 1SUQA 2MLYA 4OFZA 2BMBA 2ZH6A 1Q78A 3AY0A 1IKXB 2RH3A 3NL0A 2JVRA 3ISZA 1RQ0A 1RT7A 2H48B 3HFZB 2DNQA 2XQCA 4ELUA 3A3OB 1HBOB 2DRDA 3G6ES 4DV2J 2HBYB 2XMUA 2EFNA 3FUYA 2Z8QA 2K7KA 4Q8EA 3B54A 4OJGA 2DNLA 1N36J 1VOMA 1H6KX 3DYAB 1TUVA 3DLEA 4D3HA 4DR7J 3BREA 4DX7A 1R8HA 2Z57B 4F0HA 2SXLA 3EWGA 3R5GA 4Y28C 5A76A 1AUSL 1SJ4P 4O4GB 1S1VA 2AJ2A 5DJBA 4EWTA 3KG0A 4ECVA 3EVMA 2I6WA 5CCMA 5B0AA 4DV1F 2HQ3A 4LREA 1YJVA 2MQOA 1SIZA 3ICLA 3OPKA 2B0GA 2BA9A 3UE2A 2HZCA 1JXEA 3QNWB 2H5EA 1AZSB 1Q8LA 2QMWA 3CC7S 3UI3A 4L75A 3O3LA 2VFUA 2KJWA 4DJBA 2CZ4A 2XY7A 1HI1A 3KTQA 2UVVA 5K9FA 5HROB 2XZTB 2ZDOA 1M1KT 5CZXA 3SIPB 1RHMB 1HBUB 2B9EA 1YJ9S 2WVDA 3DOMA 1PAEX 3RR7A 2VG7A 4DQIA 4NYZA 4IH6A 3NNCA 4DUYJ 2MYFA 2D3O1 3MMBB 4URSA 1FWKA 1X4EA 3QGGA 4C9DA 2JHEA 5GMEA 3OHAA 4EBDA 4MKYA 2LQ8A 4Q2LA 2AX1A 1FXLA 1Q8IA 3CDEA 5FDLA 2HMIA 1E6YA 3D2WA 1C2PA 3AJ1A 5I3PA 1XNRF 3VAJA 1RABB 1OIAA 3BDEA 4F67A 4NXNF 2YPYA 2KI2A 1CC8A 2XHWA 1BQNA 3EMTA 4U7UK 3ZNUA 3GV5B 2AEMA 1AXQA 1HHQA 5B0FA 1TK0A 3T1HF 3R27A 5KG4A 2J9CA 3QT8A 3H7HB 3TZXA 4GKJJ 4LSNB 2VH7A 3S8SA 1HWJA 1NDKA 2C2DA 1XBWA 1YJ7A 5D8HB 4LR7A 1X8DA 4WYLA 4LF9J 3L95X 4KFBA 1F3FA 2CXEA 5KG3A 4GKKF 1ZPVA 4JOUA 2PC6A 3SMZA 1UFKA 1X4GA 4WIIA 2V69A 1KD1T 1RWWB 3UD5A 2RE1A 2FB0A 5KFPA 3R5DA 4KHMA 3UQSA 1NXIA 2HFSA 2MZSA 2YQ3A 3IG1A 3F0NA 1FJCA 2M0GB 1EKRA 3VAKA 3R2DJ 5KFNA 1RT2B 1YRUA 4EI2A 1RAEB 1VJQA 2MKCA 1NDLA 2D3ZA 3DU5A 1ZM3A 3M8PA 1C1CA 1JLEB 1XNQF 3A4TA 4DI6A 2IAJA 2WVCA 1U1OA 3DCAA 2R7RA 2AQ4A 3P3DA 2CPEA 2L3MA 4ZVRB 4A4JA 3G82A 3S6EA 2XHCA 1D8ZA 4HVZA 2C3OA 5HLFB 1S4FA 4KTQA 4OZ1A 2KYXA 1T05A 3JSMA 1ZYQA 2HNDA 2CVEA 1NHKL 1REGX 1FJGF 3IC1A 2GQCA 1NK8A 5KFEA 1UETA 2XNRA 1BQMA 4JI0F 1Q81T 3BBCA 3J7ZT 2RHSB 1FFSB 1FEHA 3A8IA 3PRDA 4WJBA 1SL0A 2BVZA 2IRYA 3D1OA 2V2VA 2HFZA 2L48A 5EWEA 1V3ZA 4I2QA 4JYAJ 3BBBA 4C98A 2J8AA 4UZBA 4YQWA 1NEEA 5B0BA 4F4KA 1N5VA 4DV5F 1SJ1A 1NK0A 3K57A 2VG5A 3CJQA 2Y9HA 4DLGA 3G71S 1JLGB 1AFIA 1JQGA 4FXVA 2KM8B 1KHVA 4CLZA 3N79A 4OYZA 1KFSA 3THTA 3N9UC 4HH1A 2DRAA 1NH7A 2XMMA 4UY8T 4WFBQ 5KG5A 1NK5A 1XMQJ 4B3MJ 1BY9A 3CGIA 3BN4A 2JLGA 1Z2LA 3PIPQ 2KT3A 1DZ5A 2XULA 3C6TA 5JUMA 1PC4A 3QQCD 1M5KC 2PMWA 1RA6A 2KU7A 4ERDA 3OR1B 3PNIA 4ED7A 3TOQA 1RISA 3M2UB 3QGPA 1X4AA 1YX2A 3SI8A 5L1JA 1W25A 2BANB 3RZAA 5E2QA 1SKRA 4EO8A 4KB7A 4DR4F 1SB6A 3LPYA 5B08A 1FO1A 4G1PA 5SZTA 1C4CA 4DR5F 3QZ7A 3UN2A 2HVEA 3I9ZA 3KLIA 3NOGA 2KVIA 4Y0FA 5KFAA 2PSZA 5D4LA 2NLWA 1NH8A 3Q8VA 4YFUA 1FFWB 1HMVA 1AROP 3EGNA 3ZNJ1 2HWTA 4J9NA 5KFKA 1HNXJ 2I38A 2BACA 5HO4A 1ZM2A 1JNRB 3K5NA 3FC9A 3W63A 2N3LA 2LP4A 4QIGA 2YKPA 2J8SA 3C8YA 3U1LA 1UPMB 2FC8A 3P45B 3G6YA 2RS2A 2W4CA 3E2EA 3BS9A 3S7RA 2RDIA 2FJWA 1RK8A 4KHPJ 4B3OA 4KH0B 1XTZA 2EC2A 2CQ4A 4L76A 3OL9A 4YEAA 2CJAA 3W65A 4HTIA 1HBNA 2YX7A 3MM7B 1N54B 2KL8A 1VQ9S 3I4HX 2VA2A 4GC7A 5C25B 2Q79A 3MR5A 4F26A 4NX9A 4DCOB 5CZVA 2ACMA 2VUGA 3QWUA 5J2PA 2ACYA 3CTRA 4J37A 1RAHB 4MIBA 4MAKA 1N32J 2NZ4A 1F1BB 1RHRB 4PKDB 3ZXWA 4DV6F 5DGAA 1UMJA 3ISND 5KG2A 4EO6A 2VPZB 2AJ0A 1Y10A 5CXTA 5BJRA 2WB1D 4LFBJ 3TI0A 2ZBQA 2YKNB 4ID8A 3CC4S 4I6AA 2ZOFA 2GMHA 2AGPA 2I5JB 4OL8A 4XK8C 1RBAA 3M1VB 3KLFA 1T03A 4IG0B 1TP7A 3FEYB 4QPXA 5LMNJ 2VDIA 4UOHA 2HHHJ 1DLOB 2CA9A 2FLPA 2G13A 1T11A 5MLCV 4WPAA 4NCAA 1IM4A 4AYBD 3RUBL 4ANDA 1UVKA 2AMCB 3R97A 2VQFJ 4NLQA 5E3AA 4LSZB 2QO3A 1QJHA 5F9LA 3ENWA 1DAXA 4PXBA 2FY8A 1LWXA 1QD1A 1IKWA 4ZVEA 4EZ9A 3LQVA 3MHYA 4JI1J 3KK2B 1LNQA 1H38A 3R7NB 1B4SA 4N56A 2WBMA 1S1UB 3LF0A 2BW2A 3W9HA 4RW6B 4IRDA 1RTDB 2LEAA 1LW0A 3RB3A 5EUHA 2GS8A 3JXOA 3NWGA 2RS8A 2YWKA 2AYBA 1U2FA 1FXRA 2IRUA 3QFWA 4OJHA 1FX4A 3DM2B 2RSQA 4FS1A 1H2VZ 4UOGA 3QT5A 3RAXA 4RKUC 1U8SA 2VBXA 3K8VA 3PEJA 2V8GA 1U4BA 1MROA 3UCUP 2DY1A 1CS4B 4GMKA 4ZMMA 3VAGA 1WC1A 3VGVA 4DXLA 1D1UA 5ETTA 1YJUA 1RTHB 4V1Ak 3UWTA 4MKVA 1T3OA 2YNHB 2EG1A 1O51A 1WC6A 2PFDA 3CO9A 3BGRA 3PHTA 3ZZZA 1MWQA 2BE2B 2JDJA 1KTQA 2HHSA 2CNNB 5C5JA 5IC4B 2HHVA 2HIYA 5F3ZA 4PQUA 2LEBA 4KBIA 3VAFA 3HZGA 4P2SA 5DG9A 1TK8A 4Y2KA 4HHJA 2FZCB 4C3MA 4USMA 5IT9U 2H65B 2KXFA 3M4XA 3K2YA 1NSQA 3HT3A 3WIUA 3U7JA 2PI4A 1CULB 3H2LA 3MAHA 2VHGA 3T9NA 4K50A 1A0OB 1LKZA 4R8UB 3CCLS 1F9EB 1FNXH 4PQAA 1OS5A 2J0SD 1H7WA 4QPTA 2K1RA 4UQTA 1RTJB 2HRUA 2JSXA 3W2WA 3AH6A 3PY8A 3ILJA 3GQCA 2GMLA 3EUNA 2JX2A 3DOLA 1P27B 4GVBA 3FRZA 4RU2A 1IBMF 3IBWA 4AT1B 1TZ0A 1NSAA 4A48A 2ZOMA 4EBCA 3BM7A 4RBVA 2C3UA 2B8QA 5ETQA 2BKNA 1HBMA 2BJEA 4WBFA 3TAPA 4B3RJ 5AE1A 4JI4F 1AB8A 2C2OB 4L73A 1HQEA 2HKEA 3G8SA 5A2QU 5CHCB 5EN1A 1MWYA 1OYDA 2RIJA 2CQDA 2H4WB 4RJVA 5LSRA 1QE1B 4RW9B 4WE1A 3MM6A 2IRXA 5KT3A 1R31A 2CG4A 2RU3A 1NLKL 2UUCF 1LQ9A 1EHWA 3HD1A 3JYTB 3MPYA 2XMAA 1LWCA 1CC7A 4OJ1A 1EB0A 1FRHA 2JNJA 3BSCA 5A0YA 2PMZD 3TX0A 1JXLA 1I5OB 5KOWA 3V4IA 3Q8RB 2FPHX 7AT1B 1UJ6A 4DZDA 1U6BA 4U96A 3FZ2A 2RQKA 5A6PA 1JWWA 4NA2A 3HJFA 5HANA 2IBOA 2HRTA 1XNRJ 2R8JA 1WF2A 3E51A 1NSPA 1Z4UA 1FWPA 2PMHA 1CJTB 5E3CA 3C6UA 5D6GA 4M5KA 1BGXT 1RB0A 1VBZA 2C2NA 1S12A 4MYUA 3LAMA 4KGVB 3OBIA 1AW0A 1VBKA 2KFNA 4CM0A 2AT1B 3T1HJ 1TL7A 1G1XA 5U47A 4O0IA 1I94F 2BYCA 3MR2A 4QW9A 2CQBA 4X65F 3N28A 1HLWA 1WTFA 1C0TA 4HL9A 1H3DA 5HBMA 2P6SA 3P6YC 2QLXA 3TJ8A 2ZEJA 3MFIA 3L7OA 1Q8KA 4FF3A 2AWZA 4Q5VA 3FVYA 3F44A 2RVJA 1N88A 1T8EA 4GKKJ 2V8VA 3AB2B 3QJJA 1TKZB 2VKZG 2RRAA 2J9EA 4ZVGA 4F4WA 2MY7A 2QE5A 3EGVA 2VONA 1SJQA 1T95A 4TLRA 2G2OA 2EFQA 3ENQA 3LP0A 4NLUA 1GH8A 2DXFA 3N0VA 3AODA 4H4OB 3V81B 4C8ZA 3MCSA 1RXOB 1TUGB 4ES2A 3CPWR 3EJMA 5HAOA 1B0VA 1HNZJ 5L38A 2AU0A 5B0CA 5K14B 1UW4A 2FUG9 4F04B 3KMSA 3OVBA 2DNPA 5KFQA 4KYZA 3ZZUA 1KQGB 3EXCX 3LO3A 1GMWA 3TVKA 1YJNS 3BB5A 3ELHA 2UU9F 2A2DA 3NGSA 5DLGA 2B8PA 4M5NA 1QAXA 2ZH8A 3NLCA 2HPUA 2MGZB 2MEWA 2LQ5A 5IT9Y 1A6LA 2I2YA 2CPXA 3OXFA 3B4MA 3Q8PB 1FJGJ 2CJXB 2ASDA 3UW1A 3GYGA 4OYWA 1EETA 3BO3A 1IBLF 4NI2B 4S0MA 2FLLA 3IBCB 1LWEA 5KFYA 5IOLA 5LSOA 2YKMA 1SQFA 4X62F 1RAOA 1U0HB 4FXDA 1NDPA 2CPDA 2FJDB 1VLYA 2DNRA 4LF5F 1TL1B 3RB0A 3PJWA 2MKHA 3QIPB 3SBMA 4M63A 1SKWA 4RW7B 2ABYA 7FD1A 1QUVA 2CPHA 2UV8A 4I7FA 1HWLA 1TL4A 2MLZA 4Q0BB 5EHHA 1RAAB 3PKYA 4X64F 4UOCA 3AXKA 5ETRA 1E6VA 3C6TB 2FJBB 1RYSA 3HVTA 5KFDA 4A8XA 2DBBA 2WW4A 2DD8S 1MMLA 3FK4A 1T9TA 3GB0A 4DV5J 2O66A 2CJQA 2DHXA 1X7VA 1S0NA 3RBXA 3WZ0A 5A2QY 4F3MA 4X66J 3MEGA 4IH7A 2UUAJ 5IS2A 1U6ZA 3PW5A 1S1TB 1PYTA 1P9QC 4ZJOA 4H4KC 4C8NA 5D0RA 2ZH2A 3FQLA 2HQGA 2BKPA 3CCTA 4FNIA 2UUTA 2CDQA 4ECQA 4BBYA 4P7TA 4ZIWA 5K8OA 2QA1A 4GO7X 3M2VB 3GIMA 4J9KA 5L46A 2F40A 3FSXA 5AE3A 1KQSR 2D9OA 1BQXA 4MKBA 4C11B 4Y65A 2VG6A 5F0WA 2QLJB 2DEIA 4OX9F 4RZRA 5IT4A 1VQ6S 3DU6A 4ZCMA 2W9BA 3FCVA 4CP5A 2E29A 3CEDA 2N7CA 3QRQA 4P71A 4ECXA 2V67A 1PJ5A 2F9JA 1R0AA 4NASA 3P4UB 4XTTA 3HKZD 2QFJA 2GAGC 4N8OA 3AXMA 1LW2B 4A47A 2ZFHA 3KNAA 1JLFB 3KJNB 5J1EA 5IQ6A 3SQOP 3GR1A 3RRKA 1U8WA 5B0GA 1MU2A 3NAIA 1A7GE 4DR5J 4URGA 2BQRA 3ETOA 3TZWA 2DB1A 1XIQA 1KVKA 3BDPA 2LA4A 4CLYA 1PYOB 1YBAA 4DR6F 4I4BA 1G7CB 2C2EA 1TAUA 5GMKa 2W9AA 3RBEA 1Q5VA 1RWVB 3T1YJ 2EEYA 1WOSA 3HVAA 5J2NB 1FEEA 4BC7A 2CADA 4QWAA 3HX9A 1YJWS 1HQUA 4FNHA 1X5TA 3R5CA 2E9ZA 3FRYA 3RW7A 1HHTP 4KV8A 3QJLA 2WSFC 3NS7B 2HK3A 1S79A 3SSQA 1TVRA 5L9XA 1JLBB 2OLWA 4DG1A 1RWNB 2MDAA 3IN5A 5L1LA 1Y5LB 4ANEA 4ED5A 1K9MT 1KONA 3K8WA 2UUWA 1HNIA 2XY5A 4GO5X 4JI7F 1DFDA 2DR9A 5HMXA 2BKOA 2HW3A 3SFUA 2QJ3A 2L9WA 2NXEA 2ZD1A 1O0PA 2QLFB 2W9CA 2LQBA 1F3VA 4ZVUB 1S97A 2RQ4A 1RJJA 3O5TB 2ZBCA 5B0EA 2YKQA 1RTZA 4TU8A 1CJUA 3TA1A 3B4DA 2Q66A 4KH1B 3A13A 3DI6B 4NLOA 3DN9A 1R0BG 4KRWA 2MZRA 8RUCA 3C14A 1XMBA 3CCRS 3GPAA 2F65A 1GQEA 3KLEB 4YS2A 4IYQA 1XR5A 4CTAA 2D41A 1FX2A 3M8ZA 5KFJA 5AE2A 2G1HA 2E66A 2DR7A 1RTIA 1VQ8S 1NMEB 3EVOA 3V6HA 3L7PA 4ECYA 1CQNA 5HP1B 4DPUA 1WC0A 2VB6A 3PXGa 4DR1F 3LP2B 2KFZA 2HNYA 1R43A 4YR2A 2VJUA 3KK1A 2MTLA 3MM9A 1HNWF 2ZJQQ 4NLGA 3RGIA 1U2RA 2JFKA 4A8WA 2XLKA 4ETXA 2MXYA 5ETNA 2XY6A 1JLAB 3KLHB 3BO4A 4LSLA 4NEZA 2OPRA 5J2QA 1RWXB 4DL0C 2LU1A 4ZN3A 3MMCB 2K3IA 3PCOB 5B0DA 1NJWA 3H4DA 1LWFA 1N34F 4P9SA 1Q8BA 2ZNYA 5C42B 1R8AA 5J2MA 2LQJA 3JAMU 4J91A 1FKOB 4Q7AA 4RBUA 3MURP 1OSCA 5A6WA 4LF6J 4PEOA 1NU4A 1S7IA 2BJ9A 1D8YA 4B3SF 2IVYA 4B08A 3M32B 5BR8F 3UN5A 4URQU 2MQPA 2V2ZA 3IGNA 4K5SA 3WX4A 3RAQA 1XMOF 3K5LA 4C0BA 2YWWA 1RWPB 2ZVSA 4WK1A 4ECSA 3D0IE 1LEOA 3CB4A 4CLPA 3I32A 4OZ0A 4FN5A 3W2VB 1Y3KA 2GGPA 3AHPA 4K59A 1S9GB 2IJRA 1VRUA 4FVMA 2J7KA 3H25A 1HHSA 1PCAA 2YWHA 4OHYA 2KJVA 2R7UA 4FYDA 4DFKA 1WDTA 3TP2A 3Q23A 3W66A 2ZZNA 3MM8A 3UNYA 1FWLA 5A8KA 7FDRA 1M0SA 4PWUA 1W26A 1G2EA 3EPIA 4TQSA 1FTRA 3RU0A 3CCQS 3H5UA 2Y0BB 4J9RA 3W2WB 3ET6B 4F2SA 2DNZA 1YI2S 4BC9A 3VGUA 3I0SA 2XYPB 3DXSX 1B7FA 4GVLA 3D6HB 2CQ0A 4P72A 2CPJA 3PG9A 5THWA 2CPZA 2IVMA 2GCFA 3EE3A 3IR6B 2FLNA 3KJQB 3TZYA 2XNQA 3M6XA 4F3OA 5KFTA 1HYSA 2PO4A 1OPIA 3SFGA 4JBCA 4USUA 3PHEA 3AAWB 3CJKA 1F9FA 1KQKA 4PG8A 2OPQB 1S76D 2X51A 2VQEF 2Y1LB 2KH9A 5L1IA 1R27B 4DV0F 2RDJA 2QFIA 2OJ3A 2Y8YA 3CDUA 5DDQC 1IKXA 4ZPVR 3R7SB 1L3KA 3BH7B 1EP4B 4ZKAA 2R8HA 1B7YB 2RKIB 1A9NB 1MMDA 3I56S 1OMSA 1X5SA 3OW2R 4NE9C 1HBOA 3GV8B 3J81Y 3H8YA 3NMRA 4C8KA 4JI4J 3HVRA 3EGZA 1KQFB 1FE0A 3IGVA 3HULA 1Y0HA 3DYAA 4X4TA 4W92B 1F2GA 4FBTA 4HR2A 2XSJB 3I87A 2DRBA 2HNZB 2N4DA 2U1AA 3MD1A 4UTGA 1R6VA 4JI3F 4TU9A 2EK1A 5GADU 4O4GA 2UUCJ 1R89A 4QJVA 3LWLA 3CMES 4MT1A 3J80U 1PAUB 2B4OA 1S1XB 1RWOB 3K0JA 3GU0A 5HBMB 2QGFB 3M6UA 2H51B 3DRPB 5DZ6A 1AZSA 5KFWA 3VZHA 4OX7A 1NHVA 2KZMA 3QPIA 3DC2A 4J9OA 2QRRA 4NLYA 2R8GA 5HROA 1NPRA 1Q86T 3TRGA 1R6YA 1HBUA 2KDOA 1SI9A 4ZLPA 2P2CB 2QMUB 5CQGA 2MLXA 2K3KA 3HHLB 4Y2IA 4AQYF 1JX4A 3JAMY 4ANCA 2EI5A 1UEVA 1MW7A 4N5SA 1ZTTA 4F4YA 4IFVB 1KBRA 3MMBA 2B9WA 1S4EA 4IO9Q 3UN3A 1GNKA 4KGXB 2CAJA 2GV1A 1T7PA 3T5KA 3OD2A 5ETVA 2DIVA 2N82B 4CI0B 4OI4A 3PJXA 3NY0A 2HZAA 3Q2TC 3ZZPA 3SQGB 5F8NA 2J7WA 1FRIA 2FHJD 2ZWPA 4Z2XA 4G6VB 4CH7A 2RMLA 1HIYA 1URNA 3O44A 4M1KA 1CJVB 4C3KA 1VS3A 4USHA 1OYEA 3LA0A 4DFJA 4NRUA 1V3RA 1LXJA 1TKXB 3NGTA 2IJNA 2WHOA 3PW7A 5CA5A 2LA6A 3M9NB 4J9LA 1RSCA 2QL9B 1U1PA 1ZZFA 3C3LA 2GQ2A 3H0PA 4NA1A 3CJ3A 2ZH1A 2DNMA 2EW9A 3UCZP 3D4JA 1PC5A 2YWGA 1D09B 2VFTA 2MJNA 4AL6A 1Q82T 4LSNA 4DR2F 2J9DE 2QYGA 2RHQB 2CNKB 1F9HA 1PJ7A 1VHIA 2A3JA 4QU6A 1SCJB 1UJ5A 2YNGB 1B0PA 2G0JA 2RF2B 2KXHA 4JV5F 3AD8C 2A0FB 4TY8B 2ZHOA 2BBEA 3PM9A 5A8WB 2ASJA 3D1QA 3ZFVA 1L3SA 3I5AA 1JNZB 1KS2A 4MTPA 1XK8A 2DXDA 4X62J 5ETSA 3Q2SC 5F8IA 1TKTB 5F8GA 2XMJA 3BGFA 1RT2A 3OTCA 3TYTA 3IBFB 1WACA 2W8KA 3CE8A 3CJSA 2DNYA 1UKUA 3QJPA 1OY8A 4WP3A 2YY3A 1K1SA 1HI8A 1VK8A 1JLEA 3TO8A 3TA2A 5IV3A 2AP6A 3I55S 3MAQA 1RACB 4PUOB 4F8RA 2YX4A 1T3NA 4WP8A 5DG7A 4KPCA 3MUVP 1UPPA 3JTNA 1C1BB 5HLFA 4ZHRB 4U8VA 4Y2CA 3HSJA 1DRZA 2EBGA 3DHXA 2F4VJ 2FTRA 1ZBTA 3DOKB 2I0XA 4Q43A 5AXKA 3W5YA 1UZDA 3IMQJ 4P10A 2BUNA 2DNGA 2V8PA 5AJ3J 2F9DA 4TNOA 2R3VA 3U1MA 1OQ3A 2DGSA 4ZVQB 3OXLA 4F0KA 2J6UA 4P2MA 1X5PA 2VU5A 5D15A 1P8GA 1KVIA 2OEMA 1KOHA 2NREA 1RCXB 3RRHA 2K06A 1IN0A 2J6TA 4HH0A 3J80Y 4DL3A 2GHWA 2HBQB 5D0HA 1K44A 3UCGA 5I42B 3HXMA 5BYRA 3MPUB 2ZDPA 4F0MA 2J6SA 5E33A 1U09A 1X5OA 2HGLA 4NLDA 4JI6F 1TU0B 2ADBA 1XN9A 4C7QA 1RWKB 4QWDA 5K8NA 4DPOA 3AOCA 1T9YA 4TVAB 4NXMF 2HYIB 1JIHA 3VR1A 4X4PA 1X4HA 3FBCA 2UVUA 4A8OA 2OPSB 3UDVA 1ZM9A 1P1LA 4YDDB 4ZN1A 3PIOQ 1B99A 1U1KA 1JLGA 3M8QB 1VQ4S 5F8LA 1M90T 4B3TJ 2I8EA 3TJAA 3EZ5A 4A8YA 3POTB 4LRFA 3NGRA 1SKUB 2DH9A 2ZZTA 4DUTA 2NYHA 1YBUA 4OHZA 4DR6J 1WHWA 2LYVA 4X4QA 4DR3J 3LW5C 5LSLA 4JI5F 3IR5B 1NK6A 3EVWA 2AJFE 2WRMA 2BJDA 3OR1A 4NMXA 3BN7A 3DLJA 3M2UA 2E1PA 1RADB 4BHQA 3NNAA 3AD7C 5KFGA 2BANA 4C0HA 3OTEA 4J7CA 1JKHB 4XPEA 2GHVC 3TNVA 2YWEA 4JI7J 4CT8A 3NP5A 2OMOA 1PG5B 3JSYA 3WHIA 4O3NA 2ZUGA 4NLRA 1M5VC 1WSRA 1YZ7A 2BJ1A 5DO2A 3PVXA 3O1LA 2R2TA 2WVEA 2MB0B 4DL5A 2ZH3A 3WBZA 4AUKA 4ZPTR 1S7HA 1KHWA 1TQLA 2KB2A 1WTBA 4R25A 1Q7YT 1RAJA 3TAMB 2N3OA 1O6XA 3BQ0A 3FZBA 1K73T 3CF5Q 4KKOB 3TZZA 1DTQB 4FP9A 3IWNC 1NAQA 2AX0A 3A8EA 5LMUF 2ZUAA 4WIQA 2GO8A 3Q8UA 3TUZC 1S0MA 4RW4B 4WXOA 2CRLA 3M8SA 3TVZA 4N7TA 3PFOA 5IV4A 3OR2B 1CVJA 3MM7A 1RDRA 4UOFA 2DPIA 1KFDA 4XAKA 1HNWJ 5C25A 2W7OA 1TFWA 2EFPA 2J0WA 2M5YA 4ETZA 5H9FJ 4DV3F 1C0UB 3GJSB 4RNHA 3KOAA 1VQOS 4EYHB 1CEZA 2XZWA 4OMFG 3PYGA 2ZITA 2FHKA 2HSEB 3NGDA 3TA0A 3HFKA 5B7WA 4BWMA 5KG1A 5CYQB 2VOOA 1YJTA 1KR4A 5E7OB 5HVHA 4WXWA 3FCWA 2DR6A 4DU7A 1WG5A 1N6QB 5EX3A 1Y9OA 4RX6A 3ETMA 3HHNB 2YKNA 4DQSA 2B7CB 2I5JA 4ZS6A 2D1CA 1DTTB 3M1VA 4TYBA 3JB9k 3MR3A 2R7XA 5BR8J 2Z2YB 5KT4A 4IG0A 3E01B 2JZ5A 2ZH7A 4TLQA 5FD1A 1NZAA 2Z30B 2X1BA 3MGJA 1DLOA 2YVSA 1X9SA 1T9WA 1J5OB 3D5MA 2CVIA 2YQ1A 3C66A 2F5GA 3GJRB 4OYBA 3A1YG 4ZVOB 2P9EA 1H73A 3R2CJ 2CZ9A 2I1RA 3TQ1A 3PR4A 3RJMB 4ES3A 4CNYA 4LMZA 2R7OA 1FFGB 4WCEQ 4PYAA 4CT9A 4G65A 3MAAB 4ED8A 2V9WA 2IBKA 4E8UA 5KT7A 3KK2A 1Y3JA 1JJ2R 3O6QA 1FK9B 5KFXA 2J7UA 2W2OP 1S1UA 3VVUA 3T6JA 4RW6A 1RTDA 4KJIA 3H90A 2YWFA 5DETA 2HHPA 4DX8H 2MQQA 2W7AA 5F8MA 1VQLS 4KR0B 1S5ZA 3CCJS 2HHUA 2NQPA 3DM2A 3IS9B 4TYAA 2OI2A 2KO1A 1NZ8A 2NSBA 2Q6CA 4RUAA 5H9FK 3SCKE 2W4DA 3SCJE 1NB2A 1CS4A 3OXGA 4DFMA 2N4CA 2VFRA 2W4PA 1R3NA 2CNOB 4IRCA 1SKSA 1RTHA 4CO5A 1Z2ZA 2YNHA 4AXIA 3M6VA 2Z0GA 3G6XA 2JOQA 4JI8F 4KE5A 3KWMA 2CQHA 1H2TZ 3K5OA 3CD5A 4RR5A 2BE2A 1QAYA 1VLOA 2NUHA 4M5JA 1M1HA 4WFZA 5KFFA 2ASYA 1U45A 3P8BB 1BC6A 3HHLC 2VQEJ 3MOJB 2HBRB 4DV0J 1RLCL 1KN6A 4ZVSB 2XS7A 5LL6d 3M8RA 2MZ1A 3DHWC 4QIWD 1UL3A 4RUCA 3ZTOA 3LGHA 4NOHA 2YTCA 1RLDA 3G4SS 1EAYC 4P73A 2LXFA 4Y2AA 5JVHQ 3KXDA 3CIMA 1U1LA 1HKAA 1CULA 1WHVA 5D78A 2F3JA 1U6FA 2W8LA 4Y2MA 1NHUA 1SV5B 3L7UA 2CJ9A 4FYYB 4R8UA 1WG4A 2PA3A 1YWXA 2Z2LA 5HI7A 2F8HA 4ED0A 2LQ9A 3CJRA 5LXRA 3AB4B 4JI3J 3TAQA 4ER8A 1SJ3P 1RTJA 1FRMA 1ULRA 2PT0A 1MN7A 1KNZA 4B9LA 2BRLA 3QO9B 2ZE2B 4O4RA 1U1MA 1APSA 1SH0A 2DJWA 4DN0A 3GWCA 5JXSA 6AT1B 3SEOA 1EQ0A 4PR6A 2YBVA 2XBPA 3WC0A 1FCAA 1F5CA 4DV2F 4HHUA 3ENVA 4W4MA 1UW9A 1L3TA 2E1AA 5I3UB 2D69A 4FPIA 2HURA 5L9NA 1RKJA 3W3SA 2VC0A 3DLKB 1N36F 4M5GA 1QE1A 4RW9A 1T0TV 4DR7F 2Q3PA 5HN0A 2BEFA 2WW8A 1MNEA 5T41A 3EYZA 4ZPCA 4N76A 4AQYJ 2W2PP 3MMAB 4E98A 4NA3A 4RLEA 2IM0A 2MHNA 3LALA 2H4YB 2OPPB 4DOZA 2XGPA 4UF4A 1VGYA 2C42A 1U26A 5K5MA 4RUHA 3JYTA 3T1AA 3BGOP 3ZZ0A 3CJ5A 2ALYB 4P2XA 1IKYA 2RB7A 1IBCB 3MCMA 3MD3A 1NK9A 3HCXA 2DR8A 2AEJA 5ETMA 3V5RA 3VV2B 3VQTA 3M30B 4YHHJ 2V4QA 5DDRC 2QYCA 3THPA 4LBPA 1FF2A 1S0VA 4LF8F 2VPYB 4ID5B 4IO1A 4K7QA 1TELA 1CJTA 1JXVA 3W60A 3K89A 1HWKA 5L39A 2NPIA 2DR5A 3PYEA 3T9ZA 5GVQA 1HI0P 4B02A 4KGMA 4LBHA 4FXWA 2IM3A 1IJEB 3OJSA 2N7YA 4J9UE 4QIEA 1RKIA 3PACA 2DTJA 1KEKA 2WCXA 2PN6A 1HL6A 2XMVA 4OHXA 3W8PA 4LIWA 3MFHA 3IP0A 3DLBA 2GAHC 4WFNQ 1FESA 4OZ2A 5ETKA 3JTOA 2XM3A 4W90B 1I51B 1NRKA 3NGUA 4B9SA 2ATLA 5ETLA 4USVA 5IFMA 1UWAA 2Y0SD 1TKZA 2E5HA 3NMAA 2CQCA 4LF7J 4YN3B 2RRBA 1TV6B 3AQPA 4C0OC 1EJ7L 3L4BC 1FKPB 3Q83A 1RAIB 5DQHA 2UZAA 1WC4A 4LRDA 1X60A 3W62A 4H4OA 4CLFA 3V81A 1MSWD 4L74A 2GIQA 5KFVA 4I68A 2DNKA 5FJ4A 3UR0A 1X9WA 2XMWA 3AA8A 3FFIB 2VBYA 4FYWB 5C2GA 5KFIA 3D6FB 4LFCF 5K14A 3F56A 3GMGA 4N8NA 2GVDB 3BSAA 2LDYA 1VC0A 2MZJA 3QATA 3HZEA 2IYGA 2XLIA 2FGCA 5T7LB 4GKJF 1MG7A 3PEHA 4TXSA 2WSEC 2WZ1A 3VAIA 2DNHA 3BGLA 3OSNA 2B5JB 2MGZA 4J9QA 4ELVA 2IM2A 3K17A 4M5DB 4DL4A 1RT1B 4P2FA 4F3QA 4J5OA 5AXLA 3HHEA 4NI2A 3KNGA 2VKRA 1YIJS 5CYMB 2DEJA 2R2RA 1U0HA 2DGWA 3VGSA 3I0RB 4DSKA 1TL1A 2ASLA 3CCMS 3QIPA 4X4OA 4YB7A 4RW7A 2CZVC 1CG2A 3KYLA 4WP9A 3DLGB 4PCQA 2PD1A 3OTDA 3AOAA 1Y5IB 4WK3A 3CNQP 2XI3A 4M5IA 3AOBA 2Y8WA 4X84A 1VQ7S 1UA1A 1HWIA 1DQ8A 4Q0BA 5HL7Q 2HAIA 4J90A 2ZBRA 4OLPA 3EDRB 1JLCB 3OJUA 5F0UA 1S1WB 3SCLE 3C19A 1EKSA 2RU9A 2CPYA 4DV4F 4I2PB 2UVWA 4JI2J 4A8KA 4CIOA 2O3DA 3ITHB 4TKTA 3J7YU 2R42A 2FVQA 1J2VA 3CCVS 5IWAF 3G8QA 3DRSB 2VIHA 4OYOA 2XMKA 3SSSA 5J1PA 3QRPA 3CUNA 3L3CA 1S1TA 2YNIB 5E3QA 4LFAF 3DRRB 2W2MP 3G96A 3FBEA 4LF2A 2AW0A 5RUBA 2VBZA 2XI2A 3UDCA 3M2VA 2XC9A 3DMJB 2QSWA 2OD4A 3AD9C 4DL7A 4C11A 3H2VE 5AT1B 2QA4G 3R6LB 2C3MA 2OAUA 1J5EF 4OZNA 3GIIA 1PO6A 1RHUB 1FE4A 3AT1B 3IAS9 4NWBA 3SDEB 2QA4S 3CO0P 5HMYA 2CYYA 3M2RB 4ECTA 2AYMA 1LW2A 1S10A 1JLFA 1FVQA 2J9DA 1FXDA 3ENAA 1VMBA 2RRNA 3ULHA 2E5LJ 1EX8A 4LT6A 3DRYA 1J27A 2HGMA 4N41A 4O3RA 3NS5A 3NEKA 1LXNA 1XMQF 4B3MF 2EFGA 2MQ8A 3MCNA 4QR1A 3CDWA 3B78A 1GMUA 5B09A 2QLWA 2D7SA 4OI6A 4ZP8A 5J2NA 2E7XA 1BD6A 1Y5NB 3R7BB 4DWIA 3ZTPA 1KKHA 2PFFB 1N5SA 1Q95G 3DGPB 4CQ1A 2AGQA 3MEDB 2EKYA 3JS9A 3FEZA 4K2XA 1JLBA 4OJ3A 5HMZA 2DGOA 2FVRA 1DURA 2B9YA 3MI7X 1HWUA 3TUPA 1NDCA 4PPZA 4XIUA 3HK2A 2ALZA 3NOCA 2IYIA 6FDRA 4YDXA 4PWDB 1IKVB 4D3GA 4QOTA 2NYIA 2E1MC 3I96A 4LF4J 3ILOA 4DPWA 1SXLA 3WDOA 3MPWA 4ZPWR 3DI6A 3KHRA 2A6MA 1XWLA 3SZ2A 5C24B 4I64A 2NXNA 3NNHA 2AHOB 2VDHA 3KLEA 3ILLA 2HQIA 4A46A 2OSQA 3H59A 3T5HA 1SBRA 1VQNS 4H4MB 2KN4A 2Q1LA 1N5QA 2UXBJ 4KHPF 3N6NA 1D9AA 3TW0A 3JSBA 1VIOA 2GVZB 3LTOA 5HP1A 5DQIA 5GADI 5KAKA 3KG1A 3DDIA 2V34A 3LP2A 1S6UA 3AJ2A 3U27A 1Y00A 1GTEA 2HVDA 3QAEA 3ZTRA 2EK6A 1UEKA 3J7Z5 3D67A 1F6TA 2RQCA 1VQMS 4ZLNA 3OUYB 1RYRA 4CCHA 1NPKA 4LVNP 4RU9A 3IFEA 3ADAC 1NUEA 1QVGR 1JLAA 3KLHA 3U02A 2FJVA 3GFYA 1BWEA 2QL7B 3KLGB 3VHQA 2XMTA 2Y3YA 1UVMA 5IQQA 4L3KA 4IG3B 2R9LA 3V6DB 3MMCA 1YTYA 1RU2A 1B64A 3T41A 2W1BA 5C2CA 3D28A 1DQAA 4A8FA 1DY3A 5C42A 1K1QA 1I3OB 1TR0A 4LFBF 1FKOA 3H98A 2HGNA 2AV5A 8AT1B 5GMDA 4U7UD 3IO1A 3M32A 2A6OA 5AXMA 2IA0A 1T9UA 3OTOJ 1ZPWX 3H20A 2RNEA 1ZZNA 3UO0A 2QIFA 3UD3P 3S01A 4EMDA 3D9BA 1HNVB 2JFDA 3K59A 3A3PB 3HVWA 4RUBA 1U48A 2QN6B 2X1GA 4UY85 2RDDA 2BX6A 3W2VA 4IFYB 4U8YA 1TTHB 4RNOA 2VQFF 2FJXA 1S9GA 1RAGB 3T3FA 2V0NA 4KT0C 4KO0B 2BM0A 3C16B 4ECUA 1X0FA 2H1YA 3PX4A 2HWIA 2X7IA 1WWHA 5DDPC 2V8HA 4JI1F 2BE9B 5DGBA 1ZAVA 3L09A 1HW9A 2JLFA 2EFVA 2ZKUA 5GAGI 4DX6A 4TN2A 1JB0C 2UXDF 1UVNA 3VCDA 2F1FA 2O67A 4Y6IA 3ET6A 4WU3A 2ILZA 1FRJA 4ZVPB 4X4UA 1IQTA 2HZVA 4DV1J 2GNKA 2HWHA 3PV8A 2KHCA 3I9V9 4JV1A 3D7SB 3HFVA 2KTQA 4ED4A 5BYSA 1K0TA 3PX0A 3VALA 2HVZA 4EBEA 1PILA 2YPZA 1KLMB 4Q8FA 3W8GA 2ADCA 3H5YA 4O3SA 1PJ6A 1D3WA 2VJVA 3NRBA 5JMNA 3R8YA 3VAMA 4QZVB 1RHJB 4OX8A 1LK7A 4G1QB 4QYZJ 1DHMA 4O0NA 3MTJA 4DPTA 2XB2D 5DM6Q 2JVOA 3CC2S 2ZHBA 4O44B 1IR2A 5CYJA 2OHDA 2Q43A 2OPQA 4Z7CA 2Y1IA 4USKA 3KHLA 1N0UA 1CBKA 1TUWA 3X3UA 1N48A 1NKCA 9ATCB 2JC0A 1HR0F 5F3TA 2H3EB 1EP4A 3OSPA 1IKYB 2RKIA 3M9OB 1RT5B 2B4PA 2C2KB
chains in the Genus database with same CATH topology
2HLUA 5E3PA 2BBEA 3PM9A 5A8WB 4DR4F 2ASJA 2CQ3A 3D1QA 5LT5A 3FJ2A 3ZFVA 3OUYA 1SB6A 1L3SA 3I5AA 1L3UA 2DK2A 3LPYA 1JNZB 1KS2A 1P1TA 5B08A 4MTPA 1XK8A 3MM5B 2P9GA 4MIWA 2JEJA 3D1HA 1FO1A 4G1PA 5T14A 3LUYA 3BO2A 3Q2SC 5F8IA 5SZTA 4NYOA 1C4CA 1SQEA 3HDSA 4DR5F 3QZ7A 1MROB 1S6PB 3I9ZA 2E1RA 3KLIA 1FJ7A 3KLGA 1LFPA 2KVIA 4Y0FA 3CCWA 5KFAA 2PSZA 2CJKA 3GFXA 1TKTB 5D4LA 2FJAB 4HT7A 2HS3A 2NLWA 1NH8A 4IG3A 5F8GA 2XMJA 2XSJA 3V6DA 3BGFA 4WF9Q 1TK5A 2HNZA 1RT2A 4YFUA 3OTCA 3TYTA 4CO2A 1WACA 1QSSA 2W8KA 1HMVA 3CE8A 1AROP 1W2IA 3EGNA 2DNYA 2HWTA 3UPFA 5KFKA 4J9NA 4L72B 1UKUA 2I38A 2ZJPQ 2BACA 5HO4A 1ZM2A 1YITS 3QJPA 4YB1P 3I6PA 2GO9A 2YY3A 1JK9B 1K1SA 1HI8A 3BR9A 3LGMA 4DQQA 4DSEA 1JNRB 1VK8A 1R7IA 4MMOA 3K5NA 1CSJA 1JLEA 4IR1A 3M9MB 2N3LA 1RI7A 3TA2A 3TO8A 2AP6A 3I55S 3MAQA 3BGRB 1I6JA 4IQXA 4QIGA 2ROGA 4PUOB 2YKPA 3C8YA 4BS2A 3U1LA 4F8RA 2YX4A 1T3NA 4U67Q 2FC8A 5D4PA 5DG7A 3RRGA 5KFHA 4ZVFA 3MUVP 3G6YA 4AFFA 3K5MA 2RS2A 2W4CA 3JTNA 4NYPA 1C1BB 3E2EA 3BS9A 2XGQA 2DGTA 3H40A 4DN9A 5HLFA 3S7RA 2LECA 4ZHRB 3T5JA 4PQUB 1KVJA 1S1XA 2RDIA 4Y2CA 4ED6A 1DRZA 4LVOP 2EBGA 2FJWA 1RK8A 3DHXA 1NJXA 2HFOA 1QAIA 5ADZA 1HNVA 2FTRA 4B3OA 1UFLA 1XTZA 2CQ4A 2V2KA 4QR0A 1ZBTA 3CCZA 3DRPA 3DOKB 2I0XA 3OL9A 1X4DA 4YEAA 1QAJA 2HFNA 4Q43A 5AXKA 3H4BA 2CJAA 4KQZA 3NCRA 4HTIA 2BUNA 4CZCA 4NCBA 1HBNA 2YX7A 1Q79A 5DDOC 1S77D 2JEIA 1AFJA 3MM7B 4YR0A 3RW6A 2OFHX 1N54B 1VQ9S 2DNGA 1H7XA 4B3RF 3I4HX 3KKFA 2GFFA 2VA2A 1D9DA 4IFYA 2F9DA 4TNOA 2G0CA 5C25B 4GC7A 4WFYA 2Q79A 3U1MA 1YQHA 3MR5A 2VC1A 4F26A 4NX9A 2E9TA 1OQ3A 2DGSA 3GYNA 5A8RB 4JUZA 3PZPA 3N6MA 3OXLA 5CZVA 4ZPBA 2J6UA 2VUGA 2HS0A 1SJRA 2VODA 3QWUA 1X5PA 4RW8B 4U9RA 2KHDA 5J2PA 3RB4A 2ACYA 3CTRA 1P8GA 4J37A 4KO0A 4ILLA 1KVIA 4X4NA 4MIBA 2M7SA 3HHLA 3QMQA 4MAKA 2NZ4A 1KOHA 2V9KA 3WC2A 3Q0AA 1FDBA 2GX8A 4PKDB 2BDPA 2RUGA 2NREA 2R7SA 3I31A 4FVCA 3RRHA 3TR5A 1IN0A 1TAQA 4HH0A 4DV6F 2J6TA 3J80Y 4A8MP 5DGAA 1UMJA 4DL3A 2GHWA 4DMZA 4IFVA 3ISND 5KG2A 4X4VA 4O3OA 3UCGA 4EO6A 1VK3A 2VPZB 5KFMA 4XDCA 2AJ0A 2VV5A 2OFGX 5I42B 4WZQA 2JLEA 5BJRA 5CXTA 3GSDA 3HXMA 5BYRA 2ZDPA 2KFYA 2WB1D 2OTLS 1KC8T 2J6SA 2K1RB 5E33A 3GIKA 3TI0A 1U09A 1X5OA 2HGLA 2YKNB 4ID8A 4NLDA 4JI6F 3O2IA 1KLNA 2ADBA 3CC4S 1S6QB 4I6AA 1ZH5A 1XN9A 4C7QA 2ZOFA 2GMHA 2C3PA 5K8NA 4QWDA 4DPOA 1R8CA 4L3NA 2AGPA 2I5JB 3V2UC 2DGVA 4UQGA 4NXMF 3QLHB 4OL8A 3BQ2A 3B8HA 1JIHA 3DXBA 4XK8C 2HYIB 3DOLB 3VR1A 4X4PA 1RP5A 3M1VB 3SQGA 1X4HA 2UVUA 4A8OA 2R2UA 4IUFA 2OPSB 3KLFA 2MKSA 2MQNA 3MECB 1T03A 4IG0B 4HI2A 4Y00A 1TP7A 4YR3A 1ZM9A 1P1LA 1U7LA 3FEYB 4YDDB 3PIOQ 2R7WA 1KLMA 3BSOA 1JLGA 4QPXA 4MKAA 2CQGA 3CVKA 5EDWA 1H98A 2ZNZA 3M8QB 3RAMA 1VQ4S 5F8LA 1DLOB 3GG0A 3OHBA 1TKXA 2FLPA 2G13A 1M90T 1HBMB 1G6BA 5F41A 5LJ3Y 4K5RA 4A8SA 2DGXA 2I8EA 3EZ5A 4A8YA 3NKYA 4DHVA 1VC6A 5MLCV 3POTB 1VFJA 1FD8A 4NCAA 1IM4A 4AYBD 2DH9A 3O8WA 1HQEB 2HHXA 4G1QA 4IR9A 1UVKA 2ZZMA 2I9SA 4OHZA 4PXEA 4NLQA 1LOUA 1WHWA 4HTJA 2LYVA 5E3AA 4X4QA 1D0EA 2QO3A 1QJHA 5F9LA 4F4XA 3ENWA 3LW5C 5LSLA 1NJZA 4JI5F 5KFOA 3IR5B 1FTCA 1DAXA 4PXBA 1NK6A 1UVIA 4O44A 1UVJA 4KPYA 2AJFE 4YB5A 6FD1A 4WE1B 3MM6B 4WKRA 5KFRA 1REVB 1IKWA 4ZVEA 1KRPA 2WRMA 4EZ9A 2LDIA 1FJEB 3LQVA 3MHYA 4MK7A 1SL1A 1FKAF 2DGUA 2M70A 3KK2B 2BJDA 3OR1A 1H38A 1HPZA 2OH2A 2OIHA 4N56A 1R8BA 2WBMA 4IKAA 3KFWX 1S1UB 3LF0A 2EC0A 2BW2A 3BN7A 4ITSA 3DLJA 3M2UA 4BDPA 4RW6B 2P6TA 4IRDA 3I5BA 1RTDB 2LEAA 2YNGA 1LWCB 4BHQA 2DO0A 1LW0A 1ZAWA 3TVYA 3RB3A 3NNAA 2RF2A 2KZZA 2BRKA 5KFGA 4XDDA 2BANA 1TFYA 5EUHA 4C0HA 3OTEA 3NWGA 2RS8A 1RT5A 1JKHB 2YWKA 2HIQA 3FEXB 3TANA 3HHDA 3ISNC 2G9OA 3OQ2A 2D9PA 4XPEA 4TY8A 2HHWA 2GHVC 1U2FA 2FVSA 3TNVA 1FXRA 5A0YB 2IRUA 3MF5A 1FT8A 5A8WA 3C46A 2YWEA 2X1FA 3MUTP 3IWLA 2LMIA 2AGOA 4OJHA 1X4BA 1SC6A 4CT8A 3VF0B 4UUXA 4DF8A 3DM2B 3NP5A 2RSQA 4FS1A 3V4IB 1M5PC 2OMOA 3KMQA 1H2VZ 2BV3A 3MM5A 3JSYA 2PGCA 4N77A 3RAXA 2HVIA 4RKUC 2V4RA 4O3NA 1U8SA 2VBXA 3K8VA 3PEJA 1V6HA 2V8GA 3ONQA 2ZUGA 4K4TA 4NLRA 3EX7B 4NLWA 3HPOA 1M5VC 1U4BA 1VQ5S 3X1LB 2ROEA 4NMLA 4OI2A 1MROA 3G8TA 1S6PA 2LU2A 3UCUP 3R1HA 3ZZRA 2BR0A 2ZBIA 5DO2A 3QIDA 2NUUG 4GMKA 4PG5A 3MWBA 4ZMMA 3VAGA 5M2RA 1FHTA 1TKTA 3O1LA 3PVXA 2R2TA 2OO4A 5M2PA 1JLQB 3CJ0A 4DL5A 2MB0B 2FY1A 2LEPA 2ZH3A 4I6WA 3WBZA 3FSIA 2VL1A 5LXYA 1D1UA 1TL3B 1YJUA 4LQ9A 3VQSA 1SH2A 1RTHB 4AUKA 3PW4A 3NBPB 4ZPTR 1S7HA 1KHWA 3UWTA 1TQLA 1IJFB 2B4VA 3C6UB 1HNZF 5EWGA 1T3OA 2JL9A 2MZTA 2YNHB 2EG1A 1Q1KA 2KB2A 1LK5A 1O51A 2J5AA 1WTBA 2QSFA 4R25A 3K58A 3CO9A 4YY3F 1Q7YT 1RAJA 3BGRA 3ZZZA 1GX5A 3TAMB 2N3OA 4PUOA 3HO1A 1ZOTA 3MMJA 3N5BA 2J0QD 3BQ0A 3FZBA 1K73T 1SL2A 1L3VA 2JH3A 2E1CA 2BE2B 2L08A 3CF5Q 2JDJA 2D74B 3DFEA 1KTQA 2HHSA 4KKOB 1DTQB 2QV6A 5BYQA 4JV0A 4FP9A 5C5JA 4DUYF 5KFSA 2HHVA 5F3ZA 3IWNC 1C1BA 3R1LA 5M2UA 4Q45A 1NAQA 4ZHRA 4PQUA 2DNOA 1B0TA 5D3GB 2AX0A 3A8EA 5LMUF 3CULA 2LEBA 1C0TB 4KBIA 2OMLA 2GO8A 3BF4A 4DL2A 3VAFA 3HZGA 4P2SA 3TUZC 1S0MA 1RT3B 5DG9A 3DOKA 4RW4B 1TK8A 2YH0A 4Y2KA 4J9MA 4WXOA 2CRLA 2ZKTA 4ELTA 3M8SA 2AJQA 4P6QA 3TVZA 4YMEA 4HHJA 4TY9A 4QW8A 3PFOA 2GA7A 1HD0A 3RR8A 3OR2B 1RGVA 4K4ZA 1CVJA 4K4WA 1DARA 3MM7A 4C3MA 1RDRA 2DPIA 1ZTWA 1KFDA 2VPWB 2A2CA 4XAKA 1UVLA 4KIAA 4MK9A 5C25A 2W7OA 2KXFA 4O3PA 3M4XA 4RNNA 1TFWA 1YRTA 2CPIA 2EFPA 2JC1A 3BZQA 2J0WA 2M5YA 2OTJS 4ETZA 4USIA 3K2YA 5A8RA 3HT3A 5H9FJ 4DV3F 2RT3A 4EFAC 1C0UB 4RNHA 4ZP6A 2DNNA 4UW2A 4RW8A 3KOAA 2M3DA 1VQOS 3U7JA 4EYHB 2PI4A 3H2LA 1CEZA 2VFVA 2XZWA 4OMFG 2BM1A 3P49B 2ZITA 3LP0B 2FHKA 2L41A 3MAHA 1N56A 5EWFA 3NGDA 1HD1A 3TA0A 3T9NA 1NKEA 2OD6A 4K50A 4ED2A 3GG1A 3HFKA 5B7WA 2V4JB 4BWMA 2AD9A 5KG1A 5CYQB 1LKZA 1Q4RA 2VOOA 4R8UB 1YJTA 4RBTA 3CCLS 1QUPA 4FBUA 1KR4A 5E7OB 1FNXH 3CMAS 4PQAA 5H9EJ 1OS5A 5H1SV 4WXWA 2DPJA 2J0SD 5I42A 2BXJA 1N6QB 1WG5A 5EX3A 1WI8A 1Y9OA 2ZH9A 1TKDA 1H7WA 4QPTA 4RX6A 4R5PB 2K1RA 1S6OA 5IT9Y 4QIFA 2YKNA 3HHNB 2CFXA 4ED1A 4DQSA 5D4NA 4UQTA 1ROFA 2C3YA 1RTJB 2HRUA 2JSXA 2VFSA 3MUMP 2IA6A 1S6QA 2XCPA 4AL5A 2B7CB 3W2WA 4DSIA 1FERA 3AH6A 2I5JA 4NCGB 3PY8A 3GQCA 3Q24A 2GMLA 4ZS6A 3QLHA 2D1CA 3DDKA 3EUNA 4M8LA 2JX2A 3SXLA 2FVCA 3DOLA 1DTTB 1P27B 3M1VA 1KTVA 3FRZA 4TYBA 3PO4A 3JB9k 3MR3A 2R7XA 4I6YA 4RU2A 2WOMB 1IBMF 3IBWA 4LF9F 1WHXA 2OPSA 1TZ0A 4YHHF 1F60B 5KT4A 2B4UA 3MECA 4IG0A 2JEFA 3FMBA 4A48A 3E01B 2JZ5A 2ZOMA 1WELA 4CH1A 3CSKA 3FGVA 2CQ1A 4TLQA 2ZH7A 5FD1A 1NZAA 4C8OA 4X66F 1DQ9A 3CWJA 4EBCA 2UUAF 2X1BA 3BM7A 3M8QA 4RBVA 3MGJA 1DLOA 2YVSA 2W24A 2C3UA 4HI1A 4LIRA 4NLTA 2VBWA 4KHRA 5LJ5Y 4ZDNA 1X9SA 1HBMA 4WFAQ 4CH0S 1J5OB 3D5MA 1EETB 2DT9A 2QEXS 3BJYA 2BJEA 4OI0A 3CD6S 3V6JA 3TAPA 4PG7A 3POTA 3N5FA 1LWEB 2CVIA 5AE1A 4JI4F 2YKMB 1HQEA 3C66A 1S99A 3B82A 4NLVA 4ZCKA 3G8SA 3IXQA 1NB7A 3KHGA 3D0HE 5CHCB 1GT8A 1FVSA 2FC9A 5EN1A 3A1YG 1MWYA 2P9EA 3SYZA 2I1RA 3TQ1A 3PR4A 2RIJA 3HHLD 4ES3A 2B9XA 2HHQA 2CQDA 4CNYA 2IHR1 3OFGA 4B9NA 4LMZA 2D3OR 1WHYA 1Y7PA 2R7OA 4USJC 2G4BA 4ILMA 4WCEQ 5LSRA 1QE1B 4CT9A 3FQKA 4RW9B 1QVFR 2MZQA 3MPVA 2KG0A 3FCHA 3IR7B 4ZPDA 2HG4A 1X4FA 4WE1A 3MM6A 2HHTA 1REVA 4V19J 4DS4A 2NXUA 4ED8A 2IRXA 2WTFA 2Q6BA 3UD4P 2V9WA 2IBKA 4E8UA 1JMTA 5KT7A 5KT3A 3KK2A 1R31A 1YG0A 5KFUA 2CG4A 3LAKA 1Y3JA 5G4DA 5F9NA 3O6QA 1JJ2R 2X3GA 4I7FB 1FK9B 2XSFA 5IM0B 5KFXA 2J7UA 2RU3A 1IR0A 2UUCF 1S1UA 2YNFB 3SV4A 1JJHA 3T6JA 1LQ9A 3EZUA 3OVSA 3OL6A 1WEZA 1OWXA 3QWPA 4RW6A 3QAUA 3JYTB 1RTDA 3MPYA 4KJIA 1LWCA 1CC7A 4R0JA 2GW8A 2BQUA 4OJ1A 1R8PA 2YWFA 4WU2A 1E6VB 1FRHA 1UAWA 4OX6A 5DETA 2HHPA 3IA0A 4OIXA 4DX8H 3IAM9 4I67A 1JKHA 4EYIB 3QYYA 1N5YA 3BSCA 3TARA 2MQQA 3HVTB 2W7AA 5F8MA 5A0YA 2R7TA 1VQLS 4KR0B 2PMZD 3CCJS 2HHUA 4Q2MA 4K4YA 1JXLA 2NQPA 2DCLA 2CKWA 4ICLB 3DM2A 5KOWA 3V4IA 4HLBA 3IS9B 4LF7F 3Q8RB 2FPHX 1UJ6A 2W25A 1U6BA 1CPZA 4TYAA 1W2BR 4DBQA 3G9CA 3FZ2A 2KO1A 2KYZA 2RQKA 2NSBA 3FSYA 5A6PA 1JWWA 2Q6CA 3OFEA 4RUAA 3LP1B 4NA2A 5EX0A 3SCKE 3HJFA 2XWXA 2W4DA 1QM9A 3HHKA 3MEGB 2LLZA 3SCJE 2IBOA 3OXGA 4DFMA 1NNDA 2VOPA 1JLQA 2N4CA 2VFRA 3K7RA 3MEEA 2R8JA 1WF2A 3E51A 1U49A 2DH8A 1YHQS 2W4PA 5G0RB 2GQQA 1R3NA 1Z4UA 4IRCA 2VASA 1TL3A 1SKSA 2PMHA 1RTHA 4MH8A 3NBPA 4CO5A 5E3CA 3C6UA 5D6GA 1Z2ZA 2YNHA 4AXIA 1BGXT 2HS4A 3M6VA 2Z0GA 3G6XA 2JOQA 1VBZA 4JI8F 3ZZOA 3T1YF 3AQOA 1X0PA 4KE5A 4MYUA 5AXNA 3LAMA 2POKA 3KWMA 2CQHA 3TAMA 3OBIA 1H2TZ 3K5OA 1AW0A 3CD5A 5KT2A 2KFNA 2VZ9A 4DSJA 2BE2A 4JYAF 1QAYA 4OHVA 2PIIA 2J76E 2WSCC 3OV7A 4KKOA 1DTQA 2NUHA 4DLEA 5DS7A 5GAHI 3PW2A 1G1XA 4PPDA 4WFZA 5U47A 4O0IA 5KFFA 1I94F 2BYCA 3QZ8A 2ASYA 3MR2A 1S9FA 1U45A 5D3GA 4QW9A 2CQBA 3NS6A 3SCIE 4X65F 3N28A 1BC6A 3HHLC 1WTFA 4NLSA 4HDHA 2DGQA 1U1RA 1C0TA 4HL9A 1H3DA 2YH1A 2VG6B 3MOJB 3KLVA 4ZCLA 1RT3A 5HBMA 2P6SA 1VRTB 1KN6A 1T02A 4OHWA 4RW4A 2XS7A 3P6YC 2QLXA 2MMYA 4EZ6A 2QMXA 5LL6d 3FMWA 2FLOA