1Z23A

The serine-rich domain from crk-associated substrate (p130cas)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
163
structure length
163
Chain Sequence
GSGREPLELEVAVETLARLQQGVSTTVAHLLDLVGSASGPGGWRSTSEPQEPPVQDLKAAVAAVHGAVHELLEFARSAVSSATHTSDRTLHAKLSRQLQKMEDVYQTLVVHGQVLDSGRGGPGFTLDDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The serine-rich domain from Crk-associated substrate (p130cas) is a four-helix bundle.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
molecule keywords CRK-associated substrate
total genus 55
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08824 Serine_rich Serine rich protein interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.830 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1z23A00
1Z23A 2L81A
chains in the Genus database with same CATH superfamily
4PJNA 3DD7A 3IPMO 4CS8C 4DJ9A 4CS9A 2IXPA 4QI2A 3RFYA 2G62A 1ZU4A 3DE8A 3MX3A 1VTMP 2P6VA 3FAPB 4MVRA 2P1AA 2Y69C 1MQVA 4I1MA 3EJNA 4C7OA 2XS8A 5JS5A 1MMNA 1Z23A 1ORSC 2WZLA 5B1BC 4IRUA 5DQTA 5L0HA 3TOMA 5KYUA 1C02A 2IXOA 2KYHA 3AG4C 2QE9A 1GS9A 4MVSA 1S7ZA 1ZVZA 2EILC 1CPQA 2R05A 4MNDA 4EUKB 5E3CA 4MVUA 1ORJA 4MS2A 4YT4A 1V74B 3B71A 4WABA 3UMIA 3UNGC 4MVZA 1HE1A 1XZQA 2DYSC 1QVXA 3LNMB 1WGWA 2IBFA 3MFNA 2R7SA 1OKKA 2YL0A 3C8GD 4XPYA 2J9WA 1T01A 3AG3C 2PF4E 3DI5A 3NYMA 3NYJA 3ZVRA 3QW0A 1M2OA 2ICWG 3CQZA 3L0IA 4D4NA 1FTSA 1JMWA 1D0ZA 1YARO 2YLDA 1VOMA 3TULA 2WL8A 2LP4A 2R03A 5JLIA 2DI3A 1JRAA 1C17M 3TOLA 3DM9B 3I4UA 3S27A 3FDQA 2OJQA 3Q6NA 1E84A 4DVYP 2AP3A 3TK0A 1IW7F 1NG1A 1OKKD 2OJED 2Y3BA 4IJJA 3UMKA 2QUPA 3EHNA 2DYRC 2RD9A 4R32A 3Q7LA 1PCXA 1YAUO 3GODA 4U5HA 5BUOA 3VYWA 4AE4A 3VRCA 2H7VC 1OCZC 2HJ3A 1LKXA 4YN0B 2D4UA 3GORA 4GYTA 2KGOA 3O6XA 1A41A 1Z3IX 2PX3A 2A1DD 1YZAA 1QLEC 3EFOA 4NTAA 3RQFA 1WN0A 3JRMO 4BJ1A 1YDIA 2WZGA 3S90A 5E3AA 1FFHA 4E0IA 4OINF 1TWHA 1LI5A 5TJ5E 2UUHA 4CJGA 1APCA 1HW2A 3LAYA 4JW1A 5DS6A 4O7GA 4U5CE 2H7BA 4LDQA 4PJMA 2NSFA 2C03A 4AX2A 2KJGA 3S0XA 2XS1A 3HJCA 3K1IC 1PD0A 2ZPAA 4JIOA 4NTBA 5DQZA 1A7EA 4BJTA 5KYUB 4MTFA 4NY3A 4PJLA 1LI7A 4DOZA 5B1AC 1B68A 1ZYRF 1NLXA 1WTYA 1OW6A 4Q4ZF 3V5XA 3WAQA 4CDYA 3SEOA 3T6GB 3NRHA 3M79A 4HEAJ 1E2XA 1YJGA 2A6EF 2LFFA 3DWWA 4YT5A 3V7OA 4E18A 2LFDA 2XLOA 2LCHA 3JYYA 4JEAA 4LDKA 1LS1A 1TFKB 1ZHTA 2WVQA 4WJ0A 2ETSA 1O5HA 1YA7O 4YT2A 2A0BA 2CW0F 2NUPA 4JTDB 2L9JA 5DVWA 4FAPB 1OXKA 3SXZA 4HE8D 1H9GA 4I44A 2Q3TA 3GM1A 4JCHA 3EFOB 1BDJB 2KQ9A 3SXYA 1RKEA 1D1BA 1TWCA 3KMIA 1L3PA 3S29A 2A0UA 1S05A 4DBRA 5EGYA 1JAFA 1VLTA 5KYWB 1U0BB 2IM8A 1MMDA 3AQCA 3LLIA 2L7AA 4N4WA 1OCRC 2HS5A 3MYIA 1TWGA 4EWCA 2MHRA 4JCZA 1LM3B 5A6BD 4DRJB 4XLPF 1OR2A 4NC3A 5KYNA 1LPEA 4XEFA 1ZU5A 4JKVA 2J9UA 3C8GA 1CGOA 1WWPA 4ULWA 3QTHA 3DZAA 1ZZPA 4Q5SF 3AJMA 4YL3A 4ZLDA 2L6GA 3U8PA 1FAPB 2VB6A 4FWVA 2J46A 4O6NA 4DRHB 2LK4A 1MMAA 3SZRA 1AVOB 1ZHXA 4IAQA 5EHHA 2P0NA 3IQCA 3BEHA 3O10A 1I5NA 2ZXRA 1NFNA 3S9OA 3EGXA 1TQGA 1Q0FA 3EPVA 1JPJA 4G7ZF 1HMDA 2C04A 1A0BA 3QVZA 4J30B 3I5PA 5AC5A 4HFFB 5BQHA 5A6BA 2NUPB 2W4MA 2Q4FA 1Q0DA 2AWCA 1A7DA 2FFHA 4JRZA 3J06A 3T9OA 3AOUA 3GANA 3U2LA 1NFOA 2L6FA 3NMIA 4ER9A 3ZQVA 2L6HA 1AUEA 2W4BA 3IQ6A 5E33A 1M56C 1V54C 2G3VA 1Y6DA 3PMRA 3EHMA 5IY5C 1T5OA 4W8KA 2HMZA 3EG9A 3ABKC 4ANJA 1LE2A 2BE5F 3W8IA 4PFPA 4YWQA 2BL2A 1DOVA 2FAPB 4G78A 4BEMJ 1KNYA 3EZHA 4WGZA 1J8YF 3GM2A 5CI8A 2O9XA 1I4YA 4NCQA 3O39A 3Q6MA 2NUTB 3W8HA 2F22A 2DGJA 2I15A 2GFHA 3UGOA 1TKNA 1VK5A 3W4YA 3N2ZB 1DOWA 3NDBB 1LE4A 1D0YA 2J7PA 4YL0A 5CIVA 3CEXA 3DM5A 2ZD9A 2ZXPA 3CSKA 4N06A 3JRTA 2OG2A 4X0RA 4E7ZA 1K04A 1M57C 3JT1A 3RW0A 5FCLA 3TJ5A 1I4ZA 1H7IA 2XL4A 3JZ0A 4P9TA 4PJJA 4C3DA 4MW3A 4CIPA 3ATPA 3PHF2 4JJFA 2PP4A 4BJ5C 1H9TA 3UMHA 2MYSA 3ITFA 3S84A 5BQIA 3K33A 1RJ9B 1QQ3A 256BA 4XEKA 4L6RA 2V26A 2EIMC 5AC4A 2XRHA 3W2VA 3OWTA 2WVOA 4MVMA 1U6HA 4IB4A 3VF0A 5L0JA 3C7JA 4K1OA 1GGQA 3KKBA 1KTMA 2EPLX 4U5FE 3T4RA 2J7PD 3N0TA 3RVZA 3DAGA 1QSPA 4JTAB 1Z7Qc 1KU2A 1G4WR 2CCYA 2R7QA 2ZXOA 1LVKA 5FZTA 2XXAB 3LS0A 5AGFA 3AGTA 3DJUB 2QTVA 3BRJA 3IEEA 3QVYA 3ASOC 2GDCA 3F46A 3GM3A 3FOPA 3OA1A 3I5QA 4XPWA 3LNRA 1SYQA 3DE9A 4QDLA 5BQGA 4MTOA 2HKVA 1VLSA 3MYFA 2LIGA 2IXNA 1VB5A 1NSGB 1A7VA 2VCCA 4A2NB 4CSAC 1OCCC 3C8ZA 4JURI 3QMKA 3L34A 5JSLA 2R7WA 2HFIA 3NMJA 2R7RA 4YT8A 4YJWA 1VYKA 4DVZA 5L0DA 3UGPA 2J9BA 2X51A 4PK4A 5KYYB 1E83A 4J7YA 4JJGA 2WVNA 3QW1A 4EIYA 3K1IA 2TMVP 5F28E 4LERA 1BR4A 4IAOA 3AG1C 4MQ9F 4ONSA 5L0GA 1J8MF 1YA9A 3C8GB 3GEIA 2Q9CA 3HNIA 4XEVA 3NKDA 3G4ZA 3ZTZA 3RKOF 1CGME 3KPHA 1MNDA 3V5ZA 3NMKA 4XLNF 2EIKC 3PCVA 5JVEA 2GAQA 3JYHA 3DXJF 2PNOA 1Z6AA 1YYXA 1JOGA 1K40A 1V55C 1RCPA 3GWLA 3H2VA 2GWWA 4PACA 5KYYA 2R7VA 2HV6A 1OW8A 4RBNA 2CYDA 5JRAA 2QLAA 4EHPA 2Y3GA 1WOLA 4K7BA 5COMA 4AE4B 2XL6A 2ZXWC 2Y39A 1UG7A 1QZXA 1ZHYA 2W45A 3W2WA 3EGDA 1N1CA 3ZSUA 3EH1A 4CS9C 2EPKX 1K05A 2AWYA 1GQAA 3K6BA 3SP1A 1OCOC 3Q7GA 2YQYA 4M63A 4NQFA 2HV7A 3DKAA 1VMAA 1NZEA 3ZG1A 4C3BA 1R4TA 4JTCB 4O6YA 1EI7A 2D5RB 3OEOA 4EBBA 5KYXA 2YL7A 2A6HF 2KK1A 5EK0A 4D4XA 1YZCA 2YWAA 2R9RB 1NU7D 3C63A 1M2VB 1RJ9A 5T3WA 4KBLA 2OQMA 1YLMA 4ZLCA 1ZHZA 3U9MA 2XM0A 4CDVA 1JR8A 2OEXA 3M1CB 2KC3A 2WZFA 5T1DB 2HSBA 1BR2A 3DAFA 4GEHA 5CI9A 3V5YA 2A69F 4G7HF 1TR2A 5A6KA 2A68F 4Z9HA 3KL4A 2H7OA 3EGXB 2YEVA 3X2QC 1T6UA 1Y4CA 1G5ZA 2EINC 1FR0A 2OU6A 2XLWA 2H8AA 1SMYF 1C03A 3U8VA 2VASA 2R7TA 1CGNA 2CNWD 3G4XA 3LLKA 1RXQA 1CPRA 1D1AA 1MMGA 3LEVA 4B6IA 4H4KC 2YL1A 1EQ1A 1G8XA 3K7DA 2I8BA 1Q0GA 2LD6A 4E17A 5L0CA 2HUJA 3M4CA 4BJ6A 1R5ID 1HW1A 2XLDA 3FHDA 2VCBA 3AG2C 1XWJA 2YKZA 4CIHA 2YHSA 4P6IC 4DRIB 2B0JA 2IYLD 1M6TA 3NYLA 4RD9A 4U5BE 1BBHA 5COGA 1U89A 3TQOA 3PDMP 3G50A 2JPUA 1RKCA 3ZIBA 1D0XA 2OEVA 2AU5A 2DB4A 2VC9A 3ZWIA 1BZ4A 2J8WA 2Y3HA 1PD1A 2Y3DA 4AK9A 3RH3A 2NSGA 4OD4A 4CS8A 2Q00A 3U3FA 1EKYA 4J7TA 1WATA 4NTFA 3ZDLA 1ORYA 3LUTB 3JCUQ 4U5GA 1YVIA 2XLHA 2ASRA 4QI0A 4JZAA 5K0IA 1E85A 2P7VA 4RDAA 2RSEB 5DS4A 4LLCA 1W2WA 3ABMC 2IOQA 3U2MA 3MBGA 2Q9BA 3R7CA 2VCAA 1SR2A 1OW7A 3HTKC 2Q9AA 2VH3A 3C18A 3X1OA 5JUAA 3U0CA 4I1OB 3O55A 5DLJA 1SZIA 4UDVA 2XLVA 4ULVA 3TJ6A 4YL1A 1JPNA 3CZ6A 4PR9A 2JX0A 2Q7RA 2HMQA 3VM6A 2HSQA 4IGGA 3N24A 1O3UA 2PX0A 2CDQA 3L1MA 5B3IA 3LEOA 4WGYA 5B3SC 3B0UX 4JC7A 4IWBA 4Z9JA 4U9EA 3DJNB 1QKRA 2XLMA 3K66A 2XL8A 3LS1A 4MVQA 4N6CA 1SF8A 3H65A 3HNLA 2PBEA 3RQGA 3JTLO 3VAYA 3ZTMA 2R25A 2B0HA 3A11A 4CDAA 3T6BA 5A6JA 4XTKA 3L8IA 4EKWA 2R7OA 4OIPF 2CNWA 4F4BA 3ZQYA 3HLZA 1H6GA 1LIHA 3GEHA 2YRFA 4EBKA 4G0HA 1OQCA 3JSEO 3LESA 3L8JA 4MW8A 2CGEA 3NG1A 2EPOA 4EBJA 2KW3C 3EG9B 3ASNC 5D91A 2NG1A 2LSEA 2OCCC 4H54A 2XXAA 3ZC4A 3FOOA 3IQ5A 3U3BA 2NPUA 1ZHWA 5COFA 3U9JA 1Q0KA 3CAXA 4XPXA 4OD5A 4C7OB 2E87A 2J0XA 2EIJC 5A6AA 2FGYA 3SXKA 1Z63A 1OR3A 1TWAA 1G4US 1LS4A 1T9KA 2YZSA 1T6IA 2GA0A 3NKEA 3A9CA 3GEEA 1L7CA 5F5HA 4P9FA 1NBBA 3IQTA 4KNWA 4I3MA 1FMWA 5JP7A 2X0CA 3WHNA 4DBQA 3MLGA 3C62A 4OIOF 3RIPA 1F1MA 3EGDB 1FNTc 2YL3A 4JVSA 3JSZA 3EQLF 5JT4A 4J32B 3S28A 5L0IA 2LQGA 3ECSA 4JE9A 2JD3A 1FMVA 1V4AA 3B29A 4Z9IA 3KH2A 4BJ5A 1QPUA 1AEPA 2J9VA 3R2PA 2PFDA 3H2UA 3RQEA 4E7SA 3M4BA 1M2VA 3SYNA 4XWJA 5T3TA 3DMDA 2QY9A 3KYIA 1EA8A 3E70C 4U5EE 2MWQA 1YYJA 5DS5A 3AGUA 4XQ1A 2AVKA 3U5SA 4CBEA 3B0PA 3WODF 5F5FA 2J0WA 4CS7A 1PV3A 2YLIA 4C3EA 5L0FA 1ZW3A 4BG0A 2WB7A 4BPMA 4K0DA 4MTGA 3FAJA 1T6QA 4U5DE 5KYXB 2L81A 3F47A 1UFBA 4KC9A 3LJBA 3T6JA 1TFOB 5E2QA 3HKKA 2UUIA 3RYLA 4HFKB 2V3CC 2EPNA 3GWNA 1RMVA 2Z15A 1XZPA 1HE9A 2QNLA 3TD7A 1HY5A 3AQBA 5HV9A 4CJOA 5L3QA 5HSWA 4CSAA 2IXMA 3EH2A 2R7XA 3E9VA 1FFTC 1ZW2A 2YLGA 1WASA 3FMSA 3SNHA 3B9QA 1HMOA 4LACB 2OOCA 2P61A 2XSEA 3FVYA 4G7OF 3M15A 2XM4A 4IARA 1O87A 3B0VC 1Z5ZA 3KYJA 5GPGB 2G3KA 4LDRA 3QZCA 3ABLC 3POVA 4GQHA 4MVOA 4O79A 4AL0A 4PFOA 4W8PA 1D1CA 4BJ6C 5A69A 4OIQF 2M4EA 3US6A 2BC5A 4DXWA 4JEBA 4CX9A 1BR1A 1RKEB 2KNHA 3IHUA 2HJMA 3RVYA 1MNEA 4N6HA 2OKUA 4AL1A 5KYWA 4E0HA 2HZ8A 3FXHA 4BEJA 4FX5A 2R02A 2YVKA 4O6MA 4U9DA 2KSFA 1VYIA 5D92A 1GM5A 4YK5A 3RF3A 4Q7CA 3K1HA 1OXBA 3EZIA 2XLEA 2W9YA 2EPMX 1NU9C 1E86A 5L3VA 2R7UA 2J45A 4LLEA 1IZMA 2M64A 3HNKA 4OIRF 2NUTA 3SXMA 3UR3C 3HNJA 4KNVA 3WG7C 4A4AA 1ST6A 4FESA 1Q0MA 4KI2A
chains in the Genus database with same CATH topology
4PJNA 3DD7A 4CS8C 4CS9A 2IXPA 4QI2A 3RFYA 2G62A 1ZU4A 3MX3A 2P6VA 2Y69C 4I1MA 3EJNA 4C7OA 1MMNA 1Z23A 2WZLA 5B1BC 4IRUA 5DQTA 5KYUA 2IXOA 3AG4C 1S7ZA 2EILC 4MNDA 5E3CA 4YT4A 3UNGC 3UMIA 2DYSC 2R7SA 1WGWA 1OKKA 2J9WA 3AG3C 2PF4E 3NYMA 3NYJA 3ZVRA 1M2OA 3CQZA 3L0IA 1FTSA 1D0ZA 1VOMA 2WL8A 3DM9B 3I4UA 3S27A 3FDQA 3Q6NA 4DVYP 1IW7F 1NG1A 1OKKD 2Y3BA 4IJJA 3UMKA 3EHNA 2DYRC 3Q7LA 1PCXA 4U5HA 3GODA 5BUOA 3VYWA 4AE4A 2H7VC 1OCZC 1LKXA 4YN0B 4GYTA 2KGOA 3O6XA 1Z3IX 2PX3A 2A1DD 3EFOA 1QLEC 4BJ1A 2WZGA 5E3AA 1FFHA 4OINF 1TWHA 3LAYA 4JW1A 5DS6A 4O7GA 4U5CE 2H7BA 4PJMA 2C03A 4AX2A 2KJGA 3S0XA 3HJCA 5DQZA 3K1IC 1PD0A 2ZPAA 4BJTA 5KYUB 4NY3A 4PJLA 4DOZA 5B1AC 1ZYRF 4Q4ZF 3SEOA 3NRHA 4HEAJ 2A6EF 3V7OA 4YT5A 1LS1A 1ZHTA 2WVQA 4WJ0A 1O5HA 4YT2A 2CW0F 5DVWA 2NUPA 2L9JA 4HE8D 4I44A 2Q3TA 4JCHA 3EFOB 2KQ9A 1D1BA 1TWCA 3KMIA 3S29A 4DBRA 5EGYA 5KYWB 1MMDA 3LLIA 3AQCA 1OCRC 1TWGA 4EWCA 4XLPF 5KYNA 1ZU5A 2J9UA 4ULWA 3DZAA 4Q5SF 4ZLDA 4FWVA 2VB6A 4O6NA 2J46A 1MMAA 3SZRA 1ZHXA 5EHHA 2ZXRA 3EGXA 3EPVA 1JPJA 4G7ZF 4J30B 2C04A 5FCLA 3I5PA 4HFFB 2NUPB 2W4MA 2FFHA 3GANA 2W4BA 5E33A 1M56C 1V54C 2G3VA 3PMRA 3EHMA 5IY5C 4W8KA 3EG9A 4ANJA 3ABKC 2BE5F 3W8IA 4PFPA 4YWQA 3EZHA 1J8YF 5CI8A 2O9XA 3O39A 3Q6MA 2NUTB 3W8HA 3UGOA 2DGJA 2GFHA 1TKNA 1VK5A 3N2ZB 3NDBB 1D0YA 2J7PA 3DM5A 4X0RA 4N06A 2ZXPA 3CSKA 4E7ZA 3JRTA 2OG2A 1M57C 3JT1A 4C3DA 2XL4A 4PJJA 3PHF2 4JJFA 2PP4A 4BJ5C 3UMHA 2MYSA 3ITFA 3K33A 1RJ9B 2V26A 2EIMC 2XRHA 3W2VA 3OWTA 2WVOA 3KKBA 4U5FE 3T4RA 2J7PD 3N0TA 3DAGA 1KU2A 2R7QA 2ZXOA 1LVKA 2XXAB 3LS0A 3DJUB 2QTVA 3IEEA 3ASOC 3F46A 3OA1A 3I5QA 3LNRA 4QDLA 2IXNA 4A2NB 4CSAC 1OCCC 4JURI 3QMKA 3L34A 2R7WA 2R7RA 4YT8A 4YJWA 1VYKA 4DVZA 3UGPA 2X51A 4PK4A 5KYYB 4JJGA 2WVNA 4LERA 1BR4A 4IAOA 3AG1C 4MQ9F 1J8MF 2Q9CA 3NKDA 3RKOF 1MNDA 4XLNF 2EIKC 3JYHA 3DXJF 1Z6AA 1V55C 2R7VA 5KYYA 2HV6A 4RBNA 2Y3GA 4AE4B 4K7BA 2ZXWC 2Y39A 1QZXA 1ZHYA 2W45A 3W2WA 3EGDA 1N1CA 3ZSUA 3EH1A 4CS9C 3K6BA 3SP1A 1OCOC 3Q7GA 4M63A 2HV7A 1VMAA 1NZEA 3ZG1A 4C3BA 4EBBA 4O6YA 2D5RB 3OEOA 5KYXA 2A6HF 5T3WA 4ZLCA 1NU7D 1M2VB 1RJ9A 4KBLA 1ZHZA 3M1CB 2WZFA 5T1DB 1BR2A 3DAFA 4GEHA 5CI9A 2A69F 4G7HF 1TR2A 2A68F 3KL4A 2H7OA 3EGXB 2YEVA 3X2QC 2EINC 1SMYF 2VASA 2R7TA 3LLKA 2CNWD 1D1AA 1MMGA 3LEVA 4B6IA 4H4KC 1G8XA 3K7DA 2I8BA 4BJ6A 3FHDA 3AG2C 4CIHA 2YHSA 4P6IC 2B0JA 2IYLD 3NYLA 4RD9A 4U5BE 3ZIBA 1D0XA 2Y3HA 1PD1A 2Y3DA 4AK9A 3RH3A 4CS8A 4OD4A 3JCUQ 4U5GA 4QI0A 4JZAA 2P7VA 4RDAA 5DS4A 4LLCA 1W2WA 3ABMC 2IOQA 2Q9BA 3HTKC 2Q9AA 2VH3A 3X1OA 4I1OB 5DLJA 1SZIA 1JPNA 3CZ6A 3N24A 2PX0A 2CDQA 5B3SC 3B0UX 4IWBA 3DJNB 3K66A 3LS1A 1SF8A 3H65A 3VAYA 3T6BA 4XTKA 4OIPF 2R7OA 2CNWA 4F4BA 3HLZA 4G0HA 3LESA 2CGEA 3NG1A 2KW3C 3EG9B 3ASNC 5D91A 2NG1A 2LSEA 2OCCC 2XXAA 3ZC4A 1ZHWA 4OD5A 4C7OB 2E87A 2J0XA 2EIJC 1Z63A 2FGYA 1TWAA 3NKEA 2YZSA 5F5HA 4DBQA 4KNWA 4I3MA 1FMWA 4OIOF 3MLGA 3RIPA 3EGDB 4JVSA 3JSZA 3EQLF 4J32B 3S28A 3ECSA 2JD3A 1FMVA 3KH2A 4BJ5A 2J9VA 2PFDA 4E7SA 1M2VA 3SYNA 4XWJA 5T3TA 3DMDA 2QY9A 3E70C 4U5EE 2MWQA 5DS5A 4CBEA 5F5FA 3B0PA 3WODF 2J0WA 4CS7A 4C3EA 4BG0A 2WB7A 4K0DA 3FAJA 4U5DE 5KYXB 2L81A 3F47A 4KC9A 3LJBA 3T6JA 5E2QA 3RYLA 4HFKB 2V3CC 2Z15A 3TD7A 3AQBA 5L3QA 5HSWA 4CSAA 2IXMA 3EH2A 2R7XA 3E9VA 1FFTC 3SNHA 3B9QA 4LACB 3FVYA 2XSEA 4G7OF 3B0VC 1O87A 1Z5ZA 2G3KA 3QZCA 3ABLC 3POVA 4O79A 4PFOA 1D1CA 4BJ6C 4OIQF 2M4EA 1BR1A 2KNHA 1MNEA 5KYWA 4BEJA 4FX5A 4O6MA 1VYIA 5D92A 4Q7CA 3K1HA 3EZIA 2W9YA 2R7UA 1NU9C 5L3VA 2J45A 4LLEA 1IZMA 4OIRF 2NUTA 3UR3C 3WG7C 4KNVA 1ST6A 4FESA 4KI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z23 A;  2L81 A; 
#chains in the Genus database with same CATH topology
 4PJN A;  3DD7 A;  3IPM O;  4CS8 C;  4DJ9 A;  4CS9 A;  2IXP A;  4QI2 A;  3RFY A;  2G62 A;  1ZU4 A;  3DE8 A;  3MX3 A;  1VTM P;  2P6V A;  3FAP B;  4MVR A;  2P1A A;  2Y69 C;  1MQV A;  4I1M A;  3EJN A;  4C7O A;  2XS8 A;  5JS5 A;  1MMN A;  1Z23 A;  1ORS C;  2WZL A;  5B1B C;  4IRU A;  5DQT A;  5L0H A;  3TOM A;  5KYU A;  1C02 A;  2IXO A;  2KYH A;  3AG4 C;  2QE9 A;  1GS9 A;  4MVS A;  1S7Z A;  1ZVZ A;  2EIL C;  1CPQ A;  2R05 A;  4MND A;  4EUK B;  5E3C A;  4MVU A;  1ORJ A;  4MS2 A;  4YT4 A;  1V74 B;  3B71 A;  4WAB A;  3UMI A;  3UNG C;  4MVZ A;  1HE1 A;  1XZQ A;  2DYS C;  1QVX A;  3LNM B;  1WGW A;  2IBF A;  3MFN A;  2R7S A;  1OKK A;  2YL0 A;  3C8G D;  4XPY A;  2J9W A;  1T01 A;  3AG3 C;  2PF4 E;  3DI5 A;  3NYM A;  3NYJ A;  3ZVR A;  3QW0 A;  1M2O A;  2ICW G;  3CQZ A;  3L0I A;  4D4N A;  1FTS A;  1JMW A;  1D0Z A;  1YAR O;  2YLD A;  1VOM A;  3TUL A;  2WL8 A;  2LP4 A;  2R03 A;  5JLI A;  2DI3 A;  1JRA A;  1C17 M;  3TOL A;  3DM9 B;  3I4U A;  3S27 A;  3FDQ A;  2OJQ A;  3Q6N A;  1E84 A;  4DVY P;  2AP3 A;  3TK0 A;  1IW7 F;  1NG1 A;  1OKK D;  2OJE D;  2Y3B A;  4IJJ A;  3UMK A;  2QUP A;  3EHN A;  2DYR C;  2RD9 A;  4R32 A;  3Q7L A;  1PCX A;  1YAU O;  3GOD A;  4U5H A;  5BUO A;  3VYW A;  4AE4 A;  3VRC A;  2H7V C;  1OCZ C;  2HJ3 A;  1LKX A;  4YN0 B;  2D4U A;  3GOR A;  4GYT A;  2KGO A;  3O6X A;  1A41 A;  1Z3I X;  2PX3 A;  2A1D D;  1YZA A;  1QLE C;  3EFO A;  4NTA A;  3RQF A;  1WN0 A;  3JRM O;  4BJ1 A;  1YDI A;  2WZG A;  3S90 A;  5E3A A;  1FFH A;  4E0I A;  4OIN F;  1TWH A;  1LI5 A;  5TJ5 E;  2UUH A;  4CJG A;  1APC A;  1HW2 A;  3LAY A;  4JW1 A;  5DS6 A;  4O7G A;  4U5C E;  2H7B A;  4LDQ A;  4PJM A;  2NSF A;  2C03 A;  4AX2 A;  2KJG A;  3S0X A;  2XS1 A;  3HJC A;  3K1I C;  1PD0 A;  2ZPA A;  4JIO A;  4NTB A;  5DQZ A;  1A7E A;  4BJT A;  5KYU B;  4MTF A;  4NY3 A;  4PJL A;  1LI7 A;  4DOZ A;  5B1A C;  1B68 A;  1ZYR F;  1NLX A;  1WTY A;  1OW6 A;  4Q4Z F;  3V5X A;  3WAQ A;  4CDY A;  3SEO A;  3T6G B;  3NRH A;  3M79 A;  4HEA J;  1E2X A;  1YJG A;  2A6E F;  2LFF A;  3DWW A;  4YT5 A;  3V7O A;  4E18 A;  2LFD A;  2XLO A;  2LCH A;  3JYY A;  4JEA A;  4LDK A;  1LS1 A;  1TFK B;  1ZHT A;  2WVQ A;  4WJ0 A;  2ETS A;  1O5H A;  1YA7 O;  4YT2 A;  2A0B A;  2CW0 F;  2NUP A;  4JTD B;  2L9J A;  5DVW A;  4FAP B;  1OXK A;  3SXZ A;  4HE8 D;  1H9G A;  4I44 A;  2Q3T A;  3GM1 A;  4JCH A;  3EFO B;  1BDJ B;  2KQ9 A;  3SXY A;  1RKE A;  1D1B A;  1TWC A;  3KMI A;  1L3P A;  3S29 A;  2A0U A;  1S05 A;  4DBR A;  5EGY A;  1JAF A;  1VLT A;  5KYW B;  1U0B B;  2IM8 A;  1MMD A;  3AQC A;  3LLI A;  2L7A A;  4N4W A;  1OCR C;  2HS5 A;  3MYI A;  1TWG A;  4EWC A;  2MHR A;  4JCZ A;  1LM3 B;  5A6B D;  4DRJ B;  4XLP F;  1OR2 A;  4NC3 A;  5KYN A;  1LPE A;  4XEF A;  1ZU5 A;  4JKV A;  2J9U A;  3C8G A;  1CGO A;  1WWP A;  4ULW A;  3QTH A;  3DZA A;  1ZZP A;  4Q5S F;  3AJM A;  4YL3 A;  4ZLD A;  2L6G A;  3U8P A;  1FAP B;  2VB6 A;  4FWV A;  2J46 A;  4O6N A;  4DRH B;  2LK4 A;  1MMA A;  3SZR A;  1AVO B;  1ZHX A;  4IAQ A;  5EHH A;  2P0N A;  3IQC A;  3BEH A;  3O10 A;  1I5N A;  2ZXR A;  1NFN A;  3S9O A;  3EGX A;  1TQG A;  1Q0F A;  3EPV A;  1JPJ A;  4G7Z F;  1HMD A;  2C04 A;  1A0B A;  3QVZ A;  4J30 B;  3I5P A;  5AC5 A;  4HFF B;  5BQH A;  5A6B A;  2NUP B;  2W4M A;  2Q4F A;  1Q0D A;  2AWC A;  1A7D A;  2FFH A;  4JRZ A;  3J06 A;  3T9O A;  3AOU A;  3GAN A;  3U2L A;  1NFO A;  2L6F A;  3NMI A;  4ER9 A;  3ZQV A;  2L6H A;  1AUE A;  2W4B A;  3IQ6 A;  5E33 A;  1M56 C;  1V54 C;  2G3V A;  1Y6D A;  3PMR A;  3EHM A;  5IY5 C;  1T5O A;  4W8K A;  2HMZ A;  3EG9 A;  3ABK C;  4ANJ A;  1LE2 A;  2BE5 F;  3W8I A;  4PFP A;  4YWQ A;  2BL2 A;  1DOV A;  2FAP B;  4G78 A;  4BEM J;  1KNY A;  3EZH A;  4WGZ A;  1J8Y F;  3GM2 A;  5CI8 A;  2O9X A;  1I4Y A;  4NCQ A;  3O39 A;  3Q6M A;  2NUT B;  3W8H A;  2F22 A;  2DGJ A;  2I15 A;  2GFH A;  3UGO A;  1TKN A;  1VK5 A;  3W4Y A;  3N2Z B;  1DOW A;  3NDB B;  1LE4 A;  1D0Y A;  2J7P A;  4YL0 A;  5CIV A;  3CEX A;  3DM5 A;  2ZD9 A;  2ZXP A;  3CSK A;  4N06 A;  3JRT A;  2OG2 A;  4X0R A;  4E7Z A;  1K04 A;  1M57 C;  3JT1 A;  3RW0 A;  5FCL A;  3TJ5 A;  1I4Z A;  1H7I A;  2XL4 A;  3JZ0 A;  4P9T A;  4PJJ A;  4C3D A;  4MW3 A;  4CIP A;  3ATP A;  3PHF 2;  4JJF A;  2PP4 A;  4BJ5 C;  1H9T A;  3UMH A;  2MYS A;  3ITF A;  3S84 A;  5BQI A;  3K33 A;  1RJ9 B;  1QQ3 A;  256B A;  4XEK A;  4L6R A;  2V26 A;  2EIM C;  5AC4 A;  2XRH A;  3W2V A;  3OWT A;  2WVO A;  4MVM A;  1U6H A;  4IB4 A;  3VF0 A;  5L0J A;  3C7J A;  4K1O A;  1GGQ A;  3KKB A;  1KTM A;  2EPL X;  4U5F E;  3T4R A;  2J7P D;  3N0T A;  3RVZ A;  3DAG A;  1QSP A;  4JTA B;  1Z7Q c;  1KU2 A;  1G4W R;  2CCY A;  2R7Q A;  2ZXO A;  1LVK A;  5FZT A;  2XXA B;  3LS0 A;  5AGF A;  3AGT A;  3DJU B;  2QTV A;  3BRJ A;  3IEE A;  3QVY A;  3ASO C;  2GDC A;  3F46 A;  3GM3 A;  3FOP A;  3OA1 A;  3I5Q A;  4XPW A;  3LNR A;  1SYQ A;  3DE9 A;  4QDL A;  5BQG A;  4MTO A;  2HKV A;  1VLS A;  3MYF A;  2LIG A;  2IXN A;  1VB5 A;  1NSG B;  1A7V A;  2VCC A;  4A2N B;  4CSA C;  1OCC C;  3C8Z A;  4JUR I;  3QMK A;  3L34 A;  5JSL A;  2R7W A;  2HFI A;  3NMJ A;  2R7R A;  4YT8 A;  4YJW A;  1VYK A;  4DVZ A;  5L0D A;  3UGP A;  2J9B A;  2X51 A;  4PK4 A;  5KYY B;  1E83 A;  4J7Y A;  4JJG A;  2WVN A;  3QW1 A;  4EIY A;  3K1I A;  2TMV P;  5F28 E;  4LER A;  1BR4 A;  4IAO A;  3AG1 C;  4MQ9 F;  4ONS A;  5L0G A;  1J8M F;  1YA9 A;  3C8G B;  3GEI A;  2Q9C A;  3HNI A;  4XEV A;  3NKD A;  3G4Z A;  3ZTZ A;  3RKO F;  1CGM E;  3KPH A;  1MND A;  3V5Z A;  3NMK A;  4XLN F;  2EIK C;  3PCV A;  5JVE A;  2GAQ A;  3JYH A;  3DXJ F;  2PNO A;  1Z6A A;  1YYX A;  1JOG A;  1K40 A;  1V55 C;  1RCP A;  3GWL A;  3H2V A;  2GWW A;  4PAC A;  5KYY A;  2R7V A;  2HV6 A;  1OW8 A;  4RBN A;  2CYD A;  5JRA A;  2QLA A;  4EHP A;  2Y3G A;  1WOL A;  4K7B A;  5COM A;  4AE4 B;  2XL6 A;  2ZXW C;  2Y39 A;  1UG7 A;  1QZX A;  1ZHY A;  2W45 A;  3W2W A;  3EGD A;  1N1C A;  3ZSU A;  3EH1 A;  4CS9 C;  2EPK X;  1K05 A;  2AWY A;  1GQA A;  3K6B A;  3SP1 A;  1OCO C;  3Q7G A;  2YQY A;  4M63 A;  4NQF A;  2HV7 A;  3DKA A;  1VMA A;  1NZE A;  3ZG1 A;  4C3B A;  1R4T A;  4JTC B;  4O6Y A;  1EI7 A;  2D5R B;  3OEO A;  4EBB A;  5KYX A;  2YL7 A;  2A6H F;  2KK1 A;  5EK0 A;  4D4X A;  1YZC A;  2YWA A;  2R9R B;  1NU7 D;  3C63 A;  1M2V B;  1RJ9 A;  5T3W A;  4KBL A;  2OQM A;  1YLM A;  4ZLC A;  1ZHZ A;  3U9M A;  2XM0 A;  4CDV A;  1JR8 A;  2OEX A;  3M1C B;  2KC3 A;  2WZF A;  5T1D B;  2HSB A;  1BR2 A;  3DAF A;  4GEH A;  5CI9 A;  3V5Y A;  2A69 F;  4G7H F;  1TR2 A;  5A6K A;  2A68 F;  4Z9H A;  3KL4 A;  2H7O A;  3EGX B;  2YEV A;  3X2Q C;  1T6U A;  1Y4C A;  1G5Z A;  2EIN C;  1FR0 A;  2OU6 A;  2XLW A;  2H8A A;  1SMY F;  1C03 A;  3U8V A;  2VAS A;  2R7T A;  1CGN A;  2CNW D;  3G4X A;  3LLK A;  1RXQ A;  1CPR A;  1D1A A;  1MMG A;  3LEV A;  4B6I A;  4H4K C;  2YL1 A;  1EQ1 A;  1G8X A;  3K7D A;  2I8B A;  1Q0G A;  2LD6 A;  4E17 A;  5L0C A;  2HUJ A;  3M4C A;  4BJ6 A;  1R5I D;  1HW1 A;  2XLD A;  3FHD A;  2VCB A;  3AG2 C;  1XWJ A;  2YKZ A;  4CIH A;  2YHS A;  4P6I C;  4DRI B;  2B0J A;  2IYL D;  1M6T A;  3NYL A;  4RD9 A;  4U5B E;  1BBH A;  5COG A;  1U89 A;  3TQO A;  3PDM P;  3G50 A;  2JPU A;  1RKC A;  3ZIB A;  1D0X A;  2OEV A;  2AU5 A;  2DB4 A;  2VC9 A;  3ZWI A;  1BZ4 A;  2J8W A;  2Y3H A;  1PD1 A;  2Y3D A;  4AK9 A;  3RH3 A;  2NSG A;  4OD4 A;  4CS8 A;  2Q00 A;  3U3F A;  1EKY A;  4J7T A;  1WAT A;  4NTF A;  3ZDL A;  1ORY A;  3LUT B;  3JCU Q;  4U5G A;  1YVI A;  2XLH A;  2ASR A;  4QI0 A;  4JZA A;  5K0I A;  1E85 A;  2P7V A;  4RDA A;  2RSE B;  5DS4 A;  4LLC A;  1W2W A;  3ABM C;  2IOQ A;  3U2M A;  3MBG A;  2Q9B A;  3R7C A;  2VCA A;  1SR2 A;  1OW7 A;  3HTK C;  2Q9A A;  2VH3 A;  3C18 A;  3X1O A;  5JUA A;  3U0C A;  4I1O B;  3O55 A;  5DLJ A;  1SZI A;  4UDV A;  2XLV A;  4ULV A;  3TJ6 A;  4YL1 A;  1JPN A;  3CZ6 A;  4PR9 A;  2JX0 A;  2Q7R A;  2HMQ A;  3VM6 A;  2HSQ A;  4IGG A;  3N24 A;  1O3U A;  2PX0 A;  2CDQ A;  3L1M A;  5B3I A;  3LEO A;  4WGY A;  5B3S C;  3B0U X;  4JC7 A;  4IWB A;  4Z9J A;  4U9E A;  3DJN B;  1QKR A;  2XLM A;  3K66 A;  2XL8 A;  3LS1 A;  4MVQ A;  4N6C A;  1SF8 A;  3H65 A;  3HNL A;  2PBE A;  3RQG A;  3JTL O;  3VAY A;  3ZTM A;  2R25 A;  2B0H A;  3A11 A;  4CDA A;  3T6B A;  5A6J A;  4XTK A;  3L8I A;  4EKW A;  2R7O A;  4OIP F;  2CNW A;  4F4B A;  3ZQY A;  3HLZ A;  1H6G A;  1LIH A;  3GEH A;  2YRF A;  4EBK A;  4G0H A;  1OQC A;  3JSE O;  3LES A;  3L8J A;  4MW8 A;  2CGE A;  3NG1 A;  2EPO A;  4EBJ A;  2KW3 C;  3EG9 B;  3ASN C;  5D91 A;  2NG1 A;  2LSE A;  2OCC C;  4H54 A;  2XXA A;  3ZC4 A;  3FOO A;  3IQ5 A;  3U3B A;  2NPU A;  1ZHW A;  5COF A;  3U9J A;  1Q0K A;  3CAX A;  4XPX A;  4OD5 A;  4C7O B;  2E87 A;  2J0X A;  2EIJ C;  5A6A A;  2FGY A;  3SXK A;  1Z63 A;  1OR3 A;  1TWA A;  1G4U S;  1LS4 A;  1T9K A;  2YZS A;  1T6I A;  2GA0 A;  3NKE A;  3A9C A;  3GEE A;  1L7C A;  5F5H A;  4P9F A;  1NBB A;  3IQT A;  4KNW A;  4I3M A;  1FMW A;  5JP7 A;  2X0C A;  3WHN A;  4DBQ A;  3MLG A;  3C62 A;  4OIO F;  3RIP A;  1F1M A;  3EGD B;  1FNT c;  2YL3 A;  4JVS A;  3JSZ A;  3EQL F;  5JT4 A;  4J32 B;  3S28 A;  5L0I A;  2LQG A;  3ECS A;  4JE9 A;  2JD3 A;  1FMV A;  1V4A A;  3B29 A;  4Z9I A;  3KH2 A;  4BJ5 A;  1QPU A;  1AEP A;  2J9V A;  3R2P A;  2PFD A;  3H2U A;  3RQE A;  4E7S A;  3M4B A;  1M2V A;  3SYN A;  4XWJ A;  5T3T A;  3DMD A;  2QY9 A;  3KYI A;  1EA8 A;  3E70 C;  4U5E E;  2MWQ A;  1YYJ A;  5DS5 A;  3AGU A;  4XQ1 A;  2AVK A;  3U5S A;  4CBE A;  3B0P A;  3WOD F;  5F5F A;  2J0W A;  4CS7 A;  1PV3 A;  2YLI A;  4C3E A;  5L0F A;  1ZW3 A;  4BG0 A;  2WB7 A;  4BPM A;  4K0D A;  4MTG A;  3FAJ A;  1T6Q A;  4U5D E;  5KYX B;  2L81 A;  3F47 A;  1UFB A;  4KC9 A;  3LJB A;  3T6J A;  1TFO B;  5E2Q A;  3HKK A;  2UUI A;  3RYL A;  4HFK B;  2V3C C;  2EPN A;  3GWN A;  1RMV A;  2Z15 A;  1XZP A;  1HE9 A;  2QNL A;  3TD7 A;  1HY5 A;  3AQB A;  5HV9 A;  4CJO A;  5L3Q A;  5HSW A;  4CSA A;  2IXM A;  3EH2 A;  2R7X A;  3E9V A;  1FFT C;  1ZW2 A;  2YLG A;  1WAS A;  3FMS A;  3SNH A;  3B9Q A;  1HMO A;  4LAC B;  2OOC A;  2P61 A;  2XSE A;  3FVY A;  4G7O F;  3M15 A;  2XM4 A;  4IAR A;  1O87 A;  3B0V C;  1Z5Z A;  3KYJ A;  5GPG B;  2G3K A;  4LDR A;  3QZC A;  3ABL C;  3POV A;  4GQH A;  4MVO A;  4O79 A;  4AL0 A;  4PFO A;  4W8P A;  1D1C A;  4BJ6 C;  5A69 A;  4OIQ F;  2M4E A;  3US6 A;  2BC5 A;  4DXW A;  4JEB A;  4CX9 A;  1BR1 A;  1RKE B;  2KNH A;  3IHU A;  2HJM A;  3RVY A;  1MNE A;  4N6H A;  2OKU A;  4AL1 A;  5KYW A;  4E0H A;  2HZ8 A;  3FXH A;  4BEJ A;  4FX5 A;  2R02 A;  2YVK A;  4O6M A;  4U9D A;  2KSF A;  1VYI A;  5D92 A;  1GM5 A;  4YK5 A;  3RF3 A;  4Q7C A;  3K1H A;  1OXB A;  3EZI A;  2XLE A;  2W9Y A;  2EPM X;  1NU9 C;  1E86 A;  5L3V A;  2R7U A;  2J45 A;  4LLE A;  1IZM A;  2M64 A;  3HNK A;  4OIR F;  2NUT A;  3SXM A;  3UR3 C;  3HNJ A;  4KNV A;  3WG7 C;  4A4A A;  1ST6 A;  4FES A;  1Q0M A;  4KI2 A; 
#chains in the Genus database with same CATH homology
 4PJN A;  3DD7 A;  4CS8 C;  4CS9 A;  2IXP A;  4QI2 A;  3RFY A;  2G62 A;  1ZU4 A;  3MX3 A;  2P6V A;  2Y69 C;  4I1M A;  3EJN A;  4C7O A;  1MMN A;  1Z23 A;  2WZL A;  5B1B C;  4IRU A;  5DQT A;  5KYU A;  2IXO A;  3AG4 C;  1S7Z A;  2EIL C;  4MND A;  5E3C A;  4YT4 A;  3UNG C;  3UMI A;  2DYS C;  2R7S A;  1WGW A;  1OKK A;  2J9W A;  3AG3 C;  2PF4 E;  3NYM A;  3NYJ A;  3ZVR A;  1M2O A;  3CQZ A;  3L0I A;  1FTS A;  1D0Z A;  1VOM A;  2WL8 A;  3DM9 B;  3I4U A;  3S27 A;  3FDQ A;  3Q6N A;  4DVY P;  1IW7 F;  1NG1 A;  1OKK D;  2Y3B A;  4IJJ A;  3UMK A;  3EHN A;  2DYR C;  3Q7L A;  1PCX A;  4U5H A;  3GOD A;  5BUO A;  3VYW A;  4AE4 A;  2H7V C;  1OCZ C;  1LKX A;  4YN0 B;  4GYT A;  2KGO A;  3O6X A;  1Z3I X;  2PX3 A;  2A1D D;  3EFO A;  1QLE C;  4BJ1 A;  2WZG A;  5E3A A;  1FFH A;  4OIN F;  1TWH A;  3LAY A;  4JW1 A;  5DS6 A;  4O7G A;  4U5C E;  2H7B A;  4PJM A;  2C03 A;  4AX2 A;  2KJG A;  3S0X A;  3HJC A;  5DQZ A;  3K1I C;  1PD0 A;  2ZPA A;  4BJT A;  5KYU B;  4NY3 A;  4PJL A;  4DOZ A;  5B1A C;  1ZYR F;  4Q4Z F;  3SEO A;  3NRH A;  4HEA J;  2A6E F;  3V7O A;  4YT5 A;  1LS1 A;  1ZHT A;  2WVQ A;  4WJ0 A;  1O5H A;  4YT2 A;  2CW0 F;  5DVW A;  2NUP A;  2L9J A;  4HE8 D;  4I44 A;  2Q3T A;  4JCH A;  3EFO B;  2KQ9 A;  1D1B A;  1TWC A;  3KMI A;  3S29 A;  4DBR A;  5EGY A;  5KYW B;  1MMD A;  3LLI A;  3AQC A;  1OCR C;  1TWG A;  4EWC A;  4XLP F;  5KYN A;  1ZU5 A;  2J9U A;  4ULW A;  3DZA A;  4Q5S F;  4ZLD A;  4FWV A;  2VB6 A;  4O6N A;  2J46 A;  1MMA A;  3SZR A;  1ZHX A;  5EHH A;  2ZXR A;  3EGX A;  3EPV A;  1JPJ A;  4G7Z F;  4J30 B;  2C04 A;  5FCL A;  3I5P A;  4HFF B;  2NUP B;  2W4M A;  2FFH A;  3GAN A;  2W4B A;  5E33 A;  1M56 C;  1V54 C;  2G3V A;  3PMR A;  3EHM A;  5IY5 C;  4W8K A;  3EG9 A;  4ANJ A;  3ABK C;  2BE5 F;  3W8I A;  4PFP A;  4YWQ A;  3EZH A;  1J8Y F;  5CI8 A;  2O9X A;  3O39 A;  3Q6M A;  2NUT B;  3W8H A;  3UGO A;  2DGJ A;  2GFH A;  1TKN A;  1VK5 A;  3N2Z B;  3NDB B;  1D0Y A;  2J7P A;  3DM5 A;  4X0R A;  4N06 A;  2ZXP A;  3CSK A;  4E7Z A;  3JRT A;  2OG2 A;  1M57 C;  3JT1 A;  4C3D A;  2XL4 A;  4PJJ A;  3PHF 2;  4JJF A;  2PP4 A;  4BJ5 C;  3UMH A;  2MYS A;  3ITF A;  3K33 A;  1RJ9 B;  2V26 A;  2EIM C;  2XRH A;  3W2V A;  3OWT A;  2WVO A;  3KKB A;  4U5F E;  3T4R A;  2J7P D;  3N0T A;  3DAG A;  1KU2 A;  2R7Q A;  2ZXO A;  1LVK A;  2XXA B;  3LS0 A;  3DJU B;  2QTV A;  3IEE A;  3ASO C;  3F46 A;  3OA1 A;  3I5Q A;  3LNR A;  4QDL A;  2IXN A;  4A2N B;  4CSA C;  1OCC C;  4JUR I;  3QMK A;  3L34 A;  2R7W A;  2R7R A;  4YT8 A;  4YJW A;  1VYK A;  4DVZ A;  3UGP A;  2X51 A;  4PK4 A;  5KYY B;  4JJG A;  2WVN A;  4LER A;  1BR4 A;  4IAO A;  3AG1 C;  4MQ9 F;  1J8M F;  2Q9C A;  3NKD A;  3RKO F;  1MND A;  4XLN F;  2EIK C;  3JYH A;  3DXJ F;  1Z6A A;  1V55 C;  2R7V A;  5KYY A;  2HV6 A;  4RBN A;  2Y3G A;  4AE4 B;  4K7B A;  2ZXW C;  2Y39 A;  1QZX A;  1ZHY A;  2W45 A;  3W2W A;  3EGD A;  1N1C A;  3ZSU A;  3EH1 A;  4CS9 C;  3K6B A;  3SP1 A;  1OCO C;  3Q7G A;  4M63 A;  2HV7 A;  1VMA A;  1NZE A;  3ZG1 A;  4C3B A;  4EBB A;  4O6Y A;  2D5R B;  3OEO A;  5KYX A;  2A6H F;  5T3W A;  4ZLC A;  1NU7 D;  1M2V B;  1RJ9 A;  4KBL A;  1ZHZ A;  3M1C B;  2WZF A;  5T1D B;  1BR2 A;  3DAF A;  4GEH A;  5CI9 A;  2A69 F;  4G7H F;  1TR2 A;  2A68 F;  3KL4 A;  2H7O A;  3EGX B;  2YEV A;  3X2Q C;  2EIN C;  1SMY F;  2VAS A;  2R7T A;  3LLK A;  2CNW D;  1D1A A;  1MMG A;  3LEV A;  4B6I A;  4H4K C;  1G8X A;  3K7D A;  2I8B A;  4BJ6 A;  3FHD A;  3AG2 C;  4CIH A;  2YHS A;  4P6I C;  2B0J A;  2IYL D;  3NYL A;  4RD9 A;  4U5B E;  3ZIB A;  1D0X A;  2Y3H A;  1PD1 A;  2Y3D A;  4AK9 A;  3RH3 A;  4CS8 A;  4OD4 A;  3JCU Q;  4U5G A;  4QI0 A;  4JZA A;  2P7V A;  4RDA A;  5DS4 A;  4LLC A;  1W2W A;  3ABM C;  2IOQ A;  2Q9B A;  3HTK C;  2Q9A A;  2VH3 A;  3X1O A;  4I1O B;  5DLJ A;  1SZI A;  1JPN A;  3CZ6 A;  3N24 A;  2PX0 A;  2CDQ A;  5B3S C;  3B0U X;  4IWB A;  3DJN B;  3K66 A;  3LS1 A;  1SF8 A;  3H65 A;  3VAY A;  3T6B A;  4XTK A;  4OIP F;  2R7O A;  2CNW A;  4F4B A;  3HLZ A;  4G0H A;  3LES A;  2CGE A;  3NG1 A;  2KW3 C;  3EG9 B;  3ASN C;  5D91 A;  2NG1 A;  2LSE A;  2OCC C;  2XXA A;  3ZC4 A;  1ZHW A;  4OD5 A;  4C7O B;  2E87 A;  2J0X A;  2EIJ C;  1Z63 A;  2FGY A;  1TWA A;  3NKE A;  2YZS A;  5F5H A;  4DBQ A;  4KNW A;  4I3M A;  1FMW A;  4OIO F;  3MLG A;  3RIP A;  3EGD B;  4JVS A;  3JSZ A;  3EQL F;  4J32 B;  3S28 A;  3ECS A;  2JD3 A;  1FMV A;  3KH2 A;  4BJ5 A;  2J9V A;  2PFD A;  4E7S A;  1M2V A;  3SYN A;  4XWJ A;  5T3T A;  3DMD A;  2QY9 A;  3E70 C;  4U5E E;  2MWQ A;  5DS5 A;  4CBE A;  5F5F A;  3B0P A;  3WOD F;  2J0W A;  4CS7 A;  4C3E A;  4BG0 A;  2WB7 A;  4K0D A;  3FAJ A;  4U5D E;  5KYX B;  2L81 A;  3F47 A;  4KC9 A;  3LJB A;  3T6J A;  5E2Q A;  3RYL A;  4HFK B;  2V3C C;  2Z15 A;  3TD7 A;  3AQB A;  5L3Q A;  5HSW A;  4CSA A;  2IXM A;  3EH2 A;  2R7X A;  3E9V A;  1FFT C;  3SNH A;  3B9Q A;  4LAC B;  3FVY A;  2XSE A;  4G7O F;  3B0V C;  1O87 A;  1Z5Z A;  2G3K A;  3QZC A;  3ABL C;  3POV A;  4O79 A;  4PFO A;  1D1C A;  4BJ6 C;  4OIQ F;  2M4E A;  1BR1 A;  2KNH A;  1MNE A;  5KYW A;  4BEJ A;  4FX5 A;  4O6M A;  1VYI A;  5D92 A;  4Q7C A;  3K1H A;  3EZI A;  2W9Y A;  2R7U A;  1NU9 C;  5L3V A;  2J45 A;  4LLE A;  1IZM A;  4OIR F;  2NUT A;  3UR3 C;  3WG7 C;  4KNV A;  1ST6 A;  4FES A;  4KI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...