1Z23A

The serine-rich domain from crk-associated substrate (p130cas)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
163
structure length
163
Chain Sequence
b'GSGREPLELEVAVETLARLQQGVSTTVAHLLDLVGSASGPGGWRSTSEPQEPPVQDLKAAVAAVHGAVHELLEFARSAVSSATHTSDRTLHAKLSRQLQKMEDVYQTLVVHGQVLDSGRGGPGFTLDDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CRK-associated substrate
publication title The serine-rich domain from Crk-associated substrate (p130cas) is a four-helix bundle.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 55
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08824 Serine_rich Serine rich protein interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.830 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1z23A00
2L81A 1Z23A
chains in the Genus database with same CATH superfamily
4AE4B 1ZU4A 4AX2A 2R25A 3ZG1A 1O87A 3TK0A 2UUHA 4XLPF 4AL0A 1AUEA 2J7PD 4EBJA 1F1MA 4R32A 5F5HA 3LEOA 3LEVA 3QMKA 2LCHA 3WODF 3ZQYA 1PD0A 3FAPB 4RD9A 1TWHA 2R9RB 1U0BB 2IM8A 3EGDA 4I44A 4CDVA 1H7IA 4U5BE 256BA 1MMAA 3JRMO 4XQ1A 4DOZA 1V55C 1Z3IX 4M63A 5D92A 1YA7O 2YLIA 4DRJB 2H7VC 3S28A 2WZGA 3LS1A 2YL3A 1Z5ZA 3EG9A 2CYDA 2HMZA 3NMIA 4C7OB 4UDVA 3TQOA 1O5HA 3BRJA 4MNDA 2WVNA 1OW8A 3NYLA 4MVQA 2KSFA 1TR2A 1OCZC 3Q7GA 3NMJA 4NTFA 1HE1A 2UUIA 4NY3A 3AGTA 5B1AC 4U9DA 2F22A 4YK5A 1FFHA 2L6HA 5TJ5E 3ZTZA 5B3IA 2IXPA 4J32B 4N4WA 2R7UA 3EQLF 2J9VA 2OEVA 4PACA 2NUPA 1LI5A 3RQGA 2R7XA 1HMOA 2DYRC 3MLGA 4MVSA 2P6VA 3LJBA 4DRHB 4EKWA 1A41A 4KC9A 2H7BA 1TWCA 1BDJB 4WJ0A 4KBLA 3T9OA 1T6IA 3NG1A 3NRHA 2ICWG 4JTDB 4LLCA 3UGOA 1H9GA 2HJMA 3KL4A 4JZAA 3NKEA 4MTGA 2XLDA 4J7YA 3FOPA 1OKKD 2HV6A 4NTAA 5KYUB 1V4AA 1WWPA 3JTLO 4BEJA 4MQ9F 1NSGB 2V26A 3LS0A 4K0DA 4CS9A 3PDMP 5L0CA 3ZQVA 4O6MA 4HFFB 5EHHA 2HMQA 2C03A 5CI9A 1Z23A 1PD1A 3JSZA 1YAUO 3K6BA 3US6A 2W4BA 3C7JA 3V7OA 4MTOA 4D4NA 2JX0A 4QI0A 3SXMA 4JJFA 4AK9A 5F5FA 2WVQA 1D0XA 5DS5A 3V5XA 3KKBA 1S05A 3GM3A 3MFNA 3T4RA 1ORJA 3W2VA 1MMGA 3S27A 1T9KA 1M2VB 4CJGA 2NSGA 4BPMA 5BQIA 2A0UA 2JPUA 3SXKA 4BJTA 2KGOA 2LP4A 2VB6A 3AGUA 5KYYA 3KYJA 5E3CA 3JYHA 1SMYF 1J8MF 2YEVA 4CS8C 2D4UA 3EGXB 2KC3A 3CAXA 4I1MA 4JRZA 4JVSA 5T3TA 3KMIA 2IXNA 3UNGC 4CX9A 3QW0A 5JRAA 3TOMA 2OCCC 1PV3A 1KNYA 1FTSA 1OR3A 2HS5A 2IXOA 2OJQA 2Y39A 3MYIA 4OIQF 2QTVA 3L8JA 3DE8A 2XXAB 4FAPB 3SEOA 1HE9A 2R7VA 2CGEA 2KYHA 1LM3B 3EFOA 4OINF 3CEXA 3U2LA 1T5OA 1AEPA 3GANA 3M1CB 3CQZA 4IAQA 4Z9HA 3ZTMA 3T6JA 3NYMA 4JIOA 4NQFA 2YZSA 2RD9A 1FMWA 3WG7C 3M15A 1Q0GA 1NFOA 3E9VA 4YJWA 4YL1A 3Q6MA 1YZAA 4BJ6C 2XL4A 3SZRA 4CIPA 3EH1A 1BR2A 2QE9A 2RSEB 2J7PA 1Z63A 4YT2A 1ZW3A 5FCLA 3U5SA 2JD3A 1B68A 1LE2A 1S7ZA 4L6RA 1LVKA 1JOGA 2YLDA 4DBQA 4KI2A 1C17M 1H6GA 1YVIA 1QZXA 5A6BA 1A7EA 1VTMP 3ITFA 4MS2A 2ZXPA 1ZVZA 3C18A 1ZU5A 2YRFA 4O6YA 2PFDA 1ZYRF 2KW3C 3I4UA 1QQ3A 1TKNA 3ASNC 5F28E 1NFNA 2LK4A 2XM0A 2WZLA 5COFA 3R7CA 3U9MA 4E7ZA 2G3VA 1G5ZA 4MVRA 1MMNA 4FX5A 4Q4ZF 4P6IC 1OW6A 2Y3GA 4JKVA 4U5HA 1K40A 2NUTB 1D0YA 2D5RB 3ASOC 3DM5A 4LDRA 4PK4A 1RCPA 3SXYA 4BJ5C 1JRAA 3DAGA 2DYSC 1D0ZA 3C8GB 2Z15A 3OWTA 3B29A 4C7OA 2XSEA 1IW7F 2R7QA 3K1IC 3L0IA 1WOLA 4W8KA 3IPMO 1R4TA 1JR8A 1XWJA 3U0CA 3T6BA 4YT4A 4G78A 1VLSA 4K7BA 1M6TA 3I5PA 3EH2A 4DXWA 5DVWA 4IGGA 1EKYA 2IOQA 2LFDA 3RW0A 2PX3A 2EIKC 5AC5A 4X0RA 2Q3TA 3DAFA 1KTMA 4MVOA 4RBNA 4XPWA 2EINC 3LNMB 3O39A 3EZHA 3UGPA 3VAYA 2H7OA 4EWCA 2OOCA 3TD7A 3CZ6A 4PFPA 3R2PA 1RKEB 3AG1C 4U5EE 1NG1A 3RF3A 4JURI 1I4YA 1ZHXA 2HUJA 4U9EA 3G4XA 3L8IA 3ZDLA 1AVOB 4MVUA 2VCCA 4W8PA 4C3EA 3B0UX 5A6BD 3POVA 4H4KC 4JCZA 3RQEA 5KYNA 4QI2A 2YKZA 3O6XA 1LI7A 1E85A 1OCRC 3VF0A 4IWBA 3E70C 2GA0A 3AQCA 1G4WR 2Q00A 3TOLA 3B0PA 5HSWA 4GEHA 4DJ9A 3M4CA 3RVZA 1ORSC 2C04A 3EHNA 2CDQA 4ZLCA 1D1BA 2I8BA 1TQGA 5DQTA 1L7CA 4U5GA 3SNHA 2EIMC 1Y6DA 2XS1A 1M2VA 3FHDA 5E33A 5KYXB 4GYTA 4YT5A 2O9XA 2PX0A 1ZHWA 3OA1A 5CI8A 1NU7D 2Q9AA 2X0CA 1SZIA 3RFYA 5AGFA 5EK0A 3NDBB 2XLMA 3HNIA 4LDKA 3QVYA 1KU2A 1HW2A 2J9WA 3EGXA 3EJNA 1N1CA 3RVYA 1MQVA 2R7OA 3NKDA 4IJJA 3U8VA 2HZ8A 3A11A 1HY5A 1ZW2A 2VASA 1K04A 2B0HA 5L0FA 2XXAA 3B71A 2VH3A 1SYQA 3DD7A 2BE5F 2X51A 1CGME 4ONSA 3DZAA 3FAJA 4A2NB 3W8IA 1WN0A 4EIYA 1OXBA 2XLVA 5CIVA 1E86A 1EQ1A 2B0JA 2Y3HA 1VLTA 2OKUA 3H2VA 4HE8D 1ST6A 1GS9A 2NPUA 3O55A 1L3PA 3L1MA 3EGDB 4JJGA 5JUAA 3GODA 3HNKA 3PHF2 2YLGA 3JZ0A 2NG1A 1FNTc 2Q9CA 3U3BA 2J8WA 4XWJA 1UFBA 2KJGA 4XPYA 2YQYA 2L6FA 3EHMA 3MX3A 3QTHA 1LS4A 2FFHA 3EG9B 3ABKC 3IQTA 3VM6A 3IQCA 1QPUA 4XEFA 3C63A 3S29A 3U3FA 4IARA 4CSAA 1RXQA 2XS8A 2KNHA 4JEAA 4ZLDA 1G8XA 3I5QA 3W4YA 1LS1A 1SR2A 2CW0F 4LACB 4Z9JA 1FR0A 3NMKA 4BJ5A 2R7RA 3OEOA 1WASA 2YL1A 5COGA 3O10A 5KYWB 2EPKX 3QZCA 2A0BA 3ECSA 2LSEA 3K1IA 3G50A 1GGQA 1GM5A 4B6IA 2QUPA 5BQHA 2DB4A 2AWYA 2OQMA 3G4ZA 2R7TA 1TWGA 1NBBA 1YLMA 2A6EF 1Q0MA 3HJCA 5T3WA 1O3UA 2P1AA 4JW1A 4CJOA 2W45A 4MW8A 3DXJF 3JYYA 2NUTA 2Q9BA 2ZXRA 4K1OA 1Q0DA 3U2MA 5D91A 1LE4A 1SF8A 3C8GA 3IQ6A 1XZQA 2G3KA 4NTBA 1MMDA 2A69F 2DI3A 1DOVA 4Z9IA 3RKOF 1C03A 2A1DD 1PCXA 3AG2C 2ZXOA 3ZC4A 3ABLC 1DOWA 2CNWA 3DE9A 4DBRA 2EPLX 4U5DE 4ULWA 4AE4A 3J06A 1U6HA 2PBEA 1VYKA 1RJ9B 2Y3DA 4E17A 2TMVP 2W4MA 3HNLA 4BJ1A 1TFKB 3W8HA 4CS9C 4XEKA 1H9TA 1VB5A 2AU5A 3HLZA 3GEEA 5JP7A 2XLHA 4JE9A 4H54A 2HV7A 3RQFA 2E87A 2FAPB 3X1OA 4WABA 2R7SA 1RKEA 5KYYB 2HJ3A 1C02A 2XRHA 2WZFA 3GORA 4E7SA 1M2OA 2XL6A 3TJ6A 3TULA 1A7DA 4HFKB 3ZVRA 3GM2A 2AP3A 3WAQA 3GEHA 3HTKC 4CBEA 5A6JA 2YVKA 2ASRA 4P9FA 3EFOB 3MYFA 3QVZA 2L7AA 3M79A 2ZPAA 4D4XA 2QNLA 2Y3BA 2AWCA 2GAQA 4OIOF 3S0XA 2R7WA 2MWQA 4YN0B 1OQCA 2L6GA 3RIPA 5L0IA 3WHNA 1LKXA 3F47A 3IEEA 4XPXA 5DS6A 1MNDA 4DVZA 5L0DA 3C8GD 4OIPF 2XM4A 1JPNA 2OU6A 1FAPB 3PCVA 3K66A 3UMIA 4YWQA 3S84A 4QDLA 2GFHA 4C3DA 4WGZA 5A6KA 5BUOA 4PFOA 5DLJA 1ZZPA 5KYUA 2CNWD 2L81A 2EPNA 3DJNB 2LD6A 3RH3A 4CIHA 1ZHZA 1T01A 3CSKA 2XLEA 2LQGA 4EBBA 1NLXA 4U5CE 2ZXWC 1XZPA 1VOMA 1ZHYA 1J8YF 2PF4E 4LERA 1U89A 5BQGA 3A9CA 3LLIA 3UMKA 4CS8A 4NC3A 3QW1A 4WGYA 3UR3C 2WB7A 1OXKA 4G0HA 5DQZA 4CDAA 5B1BC 3K33A 1TWAA 2DGJA 2P0NA 1A7VA 1VYIA 3M4BA 4IAOA 4J30B 4ULVA 3B0VC 3EZIA 3B9QA 4U5FE 1YYXA 4YT8A 2OEXA 1YYJA 4PJJA 3KYIA 4P9TA 3VYWA 3JCUQ 3V5ZA 3F46A 1OR2A 5B3SC 1QLEC 1BR4A 3AJMA 3AQBA 4MTFA 1RKCA 4A4AA 3RYLA 4Q5SF 4MVZA 3VRCA 5A6AA 2R05A 4Q7CA 4IB4A 2W9YA 2XLOA 3AOUA 2HSBA 4BJ6A 3GM1A 3DMDA 3ZSUA 4G7OF 3AG3C 3GWLA 4FWVA 3FOOA 3UMHA 2M64A 3C62A 3DKAA 2NSFA 2QLAA 3Q7LA 1ORYA 4XTKA 4IRUA 3AG4C 1Q0FA 3HKKA 2A68F 2Q7RA 2KQ9A 4E0IA 4G7HF 4AL1A 4JC7A 2EIJC 3BEHA 4O7GA 4OD4A 5KYWA 1R5ID 4CS7A 2P7VA 3EPVA 2MHRA 3DWWA 3JRTA 4PJMA 4BG0A 1VK5A 4O79A 3TJ5A 3GWNA 1I5NA 4MVMA 1E2XA 1BZ4A 1FFTC 1YA9A 5JVEA 1EA8A 4N06A 2HSQA 2MYSA 4KNWA 2V3CC 1T6UA 1D1CA 5L3QA 2A6HF 4I3MA 4J7TA 3T6GB 2GWWA 2EILC 1E84A 3S9OA 2BC5A 1TFOB 1QKRA 4EBKA 3LAYA 5JT4A 2J9UA 2HKVA 2PP4A 4JTCB 1CGNA 1Y4CA 4I1OB 5GPGB 5L0JA 2J0WA 3L34A 3V5YA 2QY9A 4OIRF 2KK1A 2ZD9A 5L0HA 3N24A 4YL3A 2EPMX 3H65A 4PJLA 3JSEO 1OCCC 3S90A 4FESA 2P61A 1LIHA 3SXZA 4E0HA 5K0IA 4N6HA 1V74B 2AVKA 2PNOA 5E2QA 1RJ9A 1HMDA 4PR9A 5COMA 2NUPB 3DI5A 2CCYA 2VCBA 3SP1A 3W2WA 2G62A 1G4US 5JLIA 3NYJA 4JCHA 2ETSA 3FVYA 5JS5A 3MBGA 1IZMA 4ER9A 1YDIA 4DRIB 3LNRA 5E3AA 2Y69C 1APCA 2YHSA 1FMVA 1WGWA 2YL0A 3ZWIA 1WTYA 1NZEA 3ABMC 4NCQA 4O6NA 1YARO 1OW7A 1MNEA 3U8PA 1D1AA 1UG7A 3DJUB 4EUKB 4BEMJ 4N6CA 5A69A 4GQHA 1ZHTA 4PJNA 2M4EA 3X2QC 2I15A 4LLEA 3IQ5A 5IY5C 1A0BA 4EHPA 3FDQA 1VMAA 2IYLD 3ZIBA 4G7ZF 2IXMA 1K05A 2L9JA 4JTAB 1Z6AA 4DVYP 5EGYA 1EI7A 4OD5A 5JSLA 1QSPA 5HV9A 4E18A 1BBHA 1OCOC 5L3VA 1JMWA 1QVXA 3DM9B 2LIGA 4JEBA 3SYNA 2J45A 1CGOA 1CPRA 2VCAA 2H8AA 4MW3A 4F4BA 1M57C 2BL2A 3K1HA 1JPJA 4KNVA 2HFIA 4XLNF 1BR1A 2YL7A 3N0TA 1RMVA 2XL8A 3LLKA 3Q6NA 1CPQA 4XEVA 1I4ZA 2R03A 2WL8A 1W2WA 1GQAA 2J46A 2XLWA 2EPOA 3KH2A 2R02A 3KPHA 3LUTB 3K7DA 2VC9A 3N2ZB 3U9JA 4LDQA 5DS4A 2GDCA 1E83A 1M56C 3PMRA 3JT1A 5KYXA 2Q4FA 1JAFA 2FGYA 2J9BA 2OG2A 2WVOA 5FZTA 5T1DB 4CSAC 2YWAA 1HW1A 2LFFA 3IHUA 1YZCA 1YJGA 3H2UA 5AC4A 1LPEA 3ATPA 3LESA 3GEIA 3C8ZA 1T6QA 1Q0KA 4RDAA 1Z7Qc 4YL0A 4CDYA 4C3BA 3FXHA 1NU9C 4ANJA 5L0GA 1OKKA 1WATA 3FMSA 3HNJA 2J0XA 1V54C 2OJED 2IBFA 4HEAJ
chains in the Genus database with same CATH topology
4AE4B 1ZU4A 4AX2A 3ZG1A 1O87A 4XLPF 2J7PD 5F5HA 3LEVA 3QMKA 3WODF 1PD0A 4RD9A 1TWHA 4I44A 3EGDA 4U5BE 1MMAA 4DOZA 1V55C 1Z3IX 4M63A 5D92A 2H7VC 3S28A 2WZGA 3LS1A 1Z5ZA 3EG9A 4C7OB 1O5HA 4MNDA 2WVNA 3NYLA 3Q7GA 1TR2A 1OCZC 4NY3A 5B1AC 1FFHA 2IXPA 4J32B 2R7UA 3EQLF 2J9VA 2NUPA 2R7XA 2DYRC 3MLGA 2P6VA 3LJBA 4KC9A 2H7BA 1TWCA 4WJ0A 4KBLA 3NG1A 3NRHA 3UGOA 4LLCA 3KL4A 4JZAA 3NKEA 1OKKD 2HV6A 5KYUB 4CS9A 4BEJA 4MQ9F 2V26A 3LS0A 4K0DA 5EHHA 4O6MA 4HFFB 2C03A 5CI9A 1Z23A 1PD1A 3JSZA 3K6BA 2W4BA 3V7OA 4QI0A 4AK9A 4JJFA 5F5FA 2WVQA 1D0XA 5DS5A 3KKBA 3T4RA 3W2VA 1MMGA 3S27A 1M2VB 4BJTA 2KGOA 2VB6A 5KYYA 5E3CA 3JYHA 1SMYF 1J8MF 2YEVA 4CS8C 3EGXB 4I1MA 4JVSA 5T3TA 3UNGC 3KMIA 2IXNA 2OCCC 1FTSA 2IXOA 4OIQF 2Y39A 2QTVA 2XXAB 3SEOA 2R7VA 2CGEA 3EFOA 4OINF 3GANA 3M1CB 3CQZA 3T6JA 3NYMA 2YZSA 1FMWA 3WG7C 3E9VA 4YJWA 4BJ6C 3Q6MA 2XL4A 3SZRA 3EH1A 1BR2A 2J7PA 1Z63A 4YT2A 5FCLA 2JD3A 1S7ZA 1LVKA 4DBQA 4KI2A 1QZXA 3ITFA 2ZXPA 1ZU5A 4O6YA 2PFDA 1ZYRF 2KW3C 3I4UA 1TKNA 3ASNC 4E7ZA 2WZLA 2G3VA 4Q4ZF 1MMNA 4FX5A 4P6IC 2Y3GA 4U5HA 2NUTB 3ASOC 1D0YA 2D5RB 3DM5A 4PK4A 4BJ5C 3DAGA 2DYSC 1D0ZA 2Z15A 3OWTA 4C7OA 2XSEA 1IW7F 2R7QA 3K1IC 3L0IA 4W8KA 3T6BA 4YT4A 4K7BA 3I5PA 3EH2A 5DVWA 2IOQA 2PX3A 2EIKC 4X0RA 2Q3TA 3DAFA 4RBNA 2EINC 3O39A 3EZHA 3UGPA 3VAYA 2H7OA 4EWCA 3TD7A 3CZ6A 4PFPA 3AG1C 4U5EE 1NG1A 4JURI 1ZHXA 3B0UX 4C3EA 3POVA 4H4KC 5KYNA 4QI2A 3O6XA 1OCRC 4IWBA 3E70C 3AQCA 3B0PA 5HSWA 4GEHA 2C04A 3EHNA 2CDQA 4ZLCA 1D1BA 2I8BA 5DQTA 4U5GA 3SNHA 2EIMC 3FHDA 5E33A 1M2VA 5KYXB 4GYTA 4YT5A 2O9XA 2PX0A 1ZHWA 3OA1A 5CI8A 1NU7D 2Q9AA 1SZIA 3RFYA 3NDBB 1KU2A 2J9WA 3EGXA 3EJNA 1N1CA 2R7OA 4IJJA 3NKDA 2VASA 2XXAA 2VH3A 3DD7A 2BE5F 2X51A 3DZAA 3FAJA 4A2NB 3W8IA 2B0JA 2Y3HA 4HE8D 1ST6A 3EGDB 4JJGA 3GODA 3PHF2 2NG1A 2Q9CA 4XWJA 2KJGA 3EHMA 3MX3A 2FFHA 3EG9B 3ABKC 3S29A 4CSAA 2KNHA 4ZLDA 1G8XA 3I5QA 1LS1A 2CW0F 4LACB 4BJ5A 2R7RA 3OEOA 5KYWB 3QZCA 3ECSA 2LSEA 2R7TA 4B6IA 1TWGA 2A6EF 3HJCA 5T3WA 4JW1A 2W45A 3DXJF 2NUTA 2Q9BA 2ZXRA 5D91A 1SF8A 2G3KA 1MMDA 2A69F 3RKOF 2A1DD 3AG2C 1PCXA 2ZXOA 3ZC4A 3ABLC 2CNWA 4DBRA 4U5DE 4ULWA 4AE4A 1VYKA 1RJ9B 2Y3DA 2W4MA 4BJ1A 4CS9C 3W8HA 3HLZA 2HV7A 3X1OA 2E87A 2R7SA 5KYYB 2XRHA 2WZFA 4E7SA 1M2OA 4HFKB 3ZVRA 3HTKC 3EFOB 2ZPAA 2Y3BA 4OIOF 3S0XA 2R7WA 2MWQA 4YN0B 3RIPA 1LKXA 3F47A 3IEEA 5DS6A 1MNDA 4DVZA 4OIPF 1JPNA 3K66A 3UMIA 4YWQA 4QDLA 2GFHA 4C3DA 5BUOA 4PFOA 5DLJA 5KYUA 2CNWD 2L81A 3DJNB 3RH3A 4CIHA 1ZHZA 3CSKA 4EBBA 4U5CE 2ZXWC 1VOMA 1ZHYA 1J8YF 2PF4E 4LERA 3LLIA 3UMKA 4CS8A 3UR3C 2WB7A 4G0HA 5DQZA 5B1BC 3K33A 1TWAA 2DGJA 4J30B 4IAOA 1VYIA 3B0VC 3EZIA 3B9QA 4U5FE 4YT8A 4PJJA 3VYWA 3JCUQ 3F46A 5B3SC 1QLEC 1BR4A 3AQBA 4Q5SF 3RYLA 4Q7CA 2W9YA 4BJ6A 4G7OF 3DMDA 3ZSUA 3AG3C 4FWVA 3UMHA 3Q7LA 4XTKA 4IRUA 3AG4C 2A68F 2KQ9A 4G7HF 2EIJC 4O7GA 4OD4A 5KYWA 4CS7A 2P7VA 3EPVA 3JRTA 4PJMA 4BG0A 1VK5A 4O79A 1FFTC 4N06A 2V3CC 2MYSA 4KNWA 5L3QA 1D1CA 2A6HF 4I3MA 2EILC 3LAYA 2J9UA 2PP4A 4I1OB 2J0WA 3L34A 2QY9A 4OIRF 3N24A 3H65A 4PJLA 1OCCC 4FESA 5E2QA 1RJ9A 2NUPB 3SP1A 3W2WA 2G62A 3NYJA 4JCHA 3FVYA 1IZMA 3LNRA 5E3AA 2Y69C 2YHSA 1FMVA 1WGWA 1NZEA 3ABMC 4O6NA 1MNEA 1D1AA 3DJUB 1ZHTA 4PJNA 2M4EA 3X2QC 4LLEA 5IY5C 3FDQA 1VMAA 2IYLD 3ZIBA 4G7ZF 2IXMA 2L9JA 1Z6AA 4DVYP 5EGYA 4OD5A 1OCOC 5L3VA 3DM9B 3SYNA 2J45A 4F4BA 1M57C 3K1HA 4KNVA 1JPJA 4XLNF 1BR1A 3N0TA 3LLKA 3Q6NA 2WL8A 1W2WA 2J46A 3KH2A 3K7DA 3N2ZB 5DS4A 1M56C 3PMRA 3JT1A 5KYXA 2FGYA 2WVOA 2OG2A 4CSAC 5T1DB 3LESA 4RDAA 4C3BA 1NU9C 4ANJA 1OKKA 2J0XA 1V54C 4CBEA 4HEAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L81 A;  1Z23 A; 
#chains in the Genus database with same CATH topology
 4AE4 B;  1ZU4 A;  4AX2 A;  2R25 A;  3ZG1 A;  1O87 A;  3TK0 A;  2UUH A;  4XLP F;  4AL0 A;  1AUE A;  2J7P D;  4EBJ A;  1F1M A;  4R32 A;  5F5H A;  3LEO A;  3LEV A;  3QMK A;  2LCH A;  3WOD F;  3ZQY A;  1PD0 A;  3FAP B;  4RD9 A;  1TWH A;  2R9R B;  1U0B B;  2IM8 A;  3EGD A;  4I44 A;  4CDV A;  1H7I A;  4U5B E;  256B A;  1MMA A;  3JRM O;  4XQ1 A;  4DOZ A;  1V55 C;  1Z3I X;  4M63 A;  5D92 A;  1YA7 O;  2YLI A;  4DRJ B;  2H7V C;  3S28 A;  2WZG A;  3LS1 A;  2YL3 A;  1Z5Z A;  3EG9 A;  2CYD A;  2HMZ A;  3NMI A;  4C7O B;  4UDV A;  3TQO A;  1O5H A;  3BRJ A;  4MND A;  2WVN A;  1OW8 A;  3NYL A;  4MVQ A;  2KSF A;  1TR2 A;  1OCZ C;  3Q7G A;  3NMJ A;  4NTF A;  1HE1 A;  2UUI A;  4NY3 A;  3AGT A;  5B1A C;  4U9D A;  2F22 A;  4YK5 A;  1FFH A;  2L6H A;  5TJ5 E;  3ZTZ A;  5B3I A;  2IXP A;  4J32 B;  4N4W A;  2R7U A;  3EQL F;  2J9V A;  2OEV A;  4PAC A;  2NUP A;  1LI5 A;  3RQG A;  2R7X A;  1HMO A;  2DYR C;  3MLG A;  4MVS A;  2P6V A;  3LJB A;  4DRH B;  4EKW A;  1A41 A;  4KC9 A;  2H7B A;  1TWC A;  1BDJ B;  4WJ0 A;  4KBL A;  3T9O A;  1T6I A;  3NG1 A;  3NRH A;  2ICW G;  4JTD B;  4LLC A;  3UGO A;  1H9G A;  2HJM A;  3KL4 A;  4JZA A;  3NKE A;  4MTG A;  2XLD A;  4J7Y A;  3FOP A;  1OKK D;  2HV6 A;  4NTA A;  5KYU B;  1V4A A;  1WWP A;  3JTL O;  4BEJ A;  4MQ9 F;  1NSG B;  2V26 A;  3LS0 A;  4K0D A;  4CS9 A;  3PDM P;  5L0C A;  3ZQV A;  4O6M A;  4HFF B;  5EHH A;  2HMQ A;  2C03 A;  5CI9 A;  1Z23 A;  1PD1 A;  3JSZ A;  1YAU O;  3K6B A;  3US6 A;  2W4B A;  3C7J A;  3V7O A;  4MTO A;  4D4N A;  2JX0 A;  4QI0 A;  3SXM A;  4JJF A;  4AK9 A;  5F5F A;  2WVQ A;  1D0X A;  5DS5 A;  3V5X A;  3KKB A;  1S05 A;  3GM3 A;  3MFN A;  3T4R A;  1ORJ A;  3W2V A;  1MMG A;  3S27 A;  1T9K A;  1M2V B;  4CJG A;  2NSG A;  4BPM A;  5BQI A;  2A0U A;  2JPU A;  3SXK A;  4BJT A;  2KGO A;  2LP4 A;  2VB6 A;  3AGU A;  5KYY A;  3KYJ A;  5E3C A;  3JYH A;  1SMY F;  1J8M F;  2YEV A;  4CS8 C;  2D4U A;  3EGX B;  2KC3 A;  3CAX A;  4I1M A;  4JRZ A;  4JVS A;  5T3T A;  3KMI A;  2IXN A;  3UNG C;  4CX9 A;  3QW0 A;  5JRA A;  3TOM A;  2OCC C;  1PV3 A;  1KNY A;  1FTS A;  1OR3 A;  2HS5 A;  2IXO A;  2OJQ A;  2Y39 A;  3MYI A;  4OIQ F;  2QTV A;  3L8J A;  3DE8 A;  2XXA B;  4FAP B;  3SEO A;  1HE9 A;  2R7V A;  2CGE A;  2KYH A;  1LM3 B;  3EFO A;  4OIN F;  3CEX A;  3U2L A;  1T5O A;  1AEP A;  3GAN A;  3M1C B;  3CQZ A;  4IAQ A;  4Z9H A;  3ZTM A;  3T6J A;  3NYM A;  4JIO A;  4NQF A;  2YZS A;  2RD9 A;  1FMW A;  3WG7 C;  3M15 A;  1Q0G A;  1NFO A;  3E9V A;  4YJW A;  4YL1 A;  3Q6M A;  1YZA A;  4BJ6 C;  2XL4 A;  3SZR A;  4CIP A;  3EH1 A;  1BR2 A;  2QE9 A;  2RSE B;  2J7P A;  1Z63 A;  4YT2 A;  1ZW3 A;  5FCL A;  3U5S A;  2JD3 A;  1B68 A;  1LE2 A;  1S7Z A;  4L6R A;  1LVK A;  1JOG A;  2YLD A;  4DBQ A;  4KI2 A;  1C17 M;  1H6G A;  1YVI A;  1QZX A;  5A6B A;  1A7E A;  1VTM P;  3ITF A;  4MS2 A;  2ZXP A;  1ZVZ A;  3C18 A;  1ZU5 A;  2YRF A;  4O6Y A;  2PFD A;  1ZYR F;  2KW3 C;  3I4U A;  1QQ3 A;  1TKN A;  3ASN C;  5F28 E;  1NFN A;  2LK4 A;  2XM0 A;  2WZL A;  5COF A;  3R7C A;  3U9M A;  4E7Z A;  2G3V A;  1G5Z A;  4MVR A;  1MMN A;  4FX5 A;  4Q4Z F;  4P6I C;  1OW6 A;  2Y3G A;  4JKV A;  4U5H A;  1K40 A;  2NUT B;  1D0Y A;  2D5R B;  3ASO C;  3DM5 A;  4LDR A;  4PK4 A;  1RCP A;  3SXY A;  4BJ5 C;  1JRA A;  3DAG A;  2DYS C;  1D0Z A;  3C8G B;  2Z15 A;  3OWT A;  3B29 A;  4C7O A;  2XSE A;  1IW7 F;  2R7Q A;  3K1I C;  3L0I A;  1WOL A;  4W8K A;  3IPM O;  1R4T A;  1JR8 A;  1XWJ A;  3U0C A;  3T6B A;  4YT4 A;  4G78 A;  1VLS A;  4K7B A;  1M6T A;  3I5P A;  3EH2 A;  4DXW A;  5DVW A;  4IGG A;  1EKY A;  2IOQ A;  2LFD A;  3RW0 A;  2PX3 A;  2EIK C;  5AC5 A;  4X0R A;  2Q3T A;  3DAF A;  1KTM A;  4MVO A;  4RBN A;  4XPW A;  2EIN C;  3LNM B;  3O39 A;  3EZH A;  3UGP A;  3VAY A;  2H7O A;  4EWC A;  2OOC A;  3TD7 A;  3CZ6 A;  4PFP A;  3R2P A;  1RKE B;  3AG1 C;  4U5E E;  1NG1 A;  3RF3 A;  4JUR I;  1I4Y A;  1ZHX A;  2HUJ A;  4U9E A;  3G4X A;  3L8I A;  3ZDL A;  1AVO B;  4MVU A;  2VCC A;  4W8P A;  4C3E A;  3B0U X;  5A6B D;  3POV A;  4H4K C;  4JCZ A;  3RQE A;  5KYN A;  4QI2 A;  2YKZ A;  3O6X A;  1LI7 A;  1E85 A;  1OCR C;  3VF0 A;  4IWB A;  3E70 C;  2GA0 A;  3AQC A;  1G4W R;  2Q00 A;  3TOL A;  3B0P A;  5HSW A;  4GEH A;  4DJ9 A;  3M4C A;  3RVZ A;  1ORS C;  2C04 A;  3EHN A;  2CDQ A;  4ZLC A;  1D1B A;  2I8B A;  1TQG A;  5DQT A;  1L7C A;  4U5G A;  3SNH A;  2EIM C;  1Y6D A;  2XS1 A;  1M2V A;  3FHD A;  5E33 A;  5KYX B;  4GYT A;  4YT5 A;  2O9X A;  2PX0 A;  1ZHW A;  3OA1 A;  5CI8 A;  1NU7 D;  2Q9A A;  2X0C A;  1SZI A;  3RFY A;  5AGF A;  5EK0 A;  3NDB B;  2XLM A;  3HNI A;  4LDK A;  3QVY A;  1KU2 A;  1HW2 A;  2J9W A;  3EGX A;  3EJN A;  1N1C A;  3RVY A;  1MQV A;  2R7O A;  3NKD A;  4IJJ A;  3U8V A;  2HZ8 A;  3A11 A;  1HY5 A;  1ZW2 A;  2VAS A;  1K04 A;  2B0H A;  5L0F A;  2XXA A;  3B71 A;  2VH3 A;  1SYQ A;  3DD7 A;  2BE5 F;  2X51 A;  1CGM E;  4ONS A;  3DZA A;  3FAJ A;  4A2N B;  3W8I A;  1WN0 A;  4EIY A;  1OXB A;  2XLV A;  5CIV A;  1E86 A;  1EQ1 A;  2B0J A;  2Y3H A;  1VLT A;  2OKU A;  3H2V A;  4HE8 D;  1ST6 A;  1GS9 A;  2NPU A;  3O55 A;  1L3P A;  3L1M A;  3EGD B;  4JJG A;  5JUA A;  3GOD A;  3HNK A;  3PHF 2;  2YLG A;  3JZ0 A;  2NG1 A;  1FNT c;  2Q9C A;  3U3B A;  2J8W A;  4XWJ A;  1UFB A;  2KJG A;  4XPY A;  2YQY A;  2L6F A;  3EHM A;  3MX3 A;  3QTH A;  1LS4 A;  2FFH A;  3EG9 B;  3ABK C;  3IQT A;  3VM6 A;  3IQC A;  1QPU A;  4XEF A;  3C63 A;  3S29 A;  3U3F A;  4IAR A;  4CSA A;  1RXQ A;  2XS8 A;  2KNH A;  4JEA A;  4ZLD A;  1G8X A;  3I5Q A;  3W4Y A;  1LS1 A;  1SR2 A;  2CW0 F;  4LAC B;  4Z9J A;  1FR0 A;  3NMK A;  4BJ5 A;  2R7R A;  3OEO A;  1WAS A;  2YL1 A;  5COG A;  3O10 A;  5KYW B;  2EPK X;  3QZC A;  2A0B A;  3ECS A;  2LSE A;  3K1I A;  3G50 A;  1GGQ A;  1GM5 A;  4B6I A;  2QUP A;  5BQH A;  2DB4 A;  2AWY A;  2OQM A;  3G4Z A;  2R7T A;  1TWG A;  1NBB A;  1YLM A;  2A6E F;  1Q0M A;  3HJC A;  5T3W A;  1O3U A;  2P1A A;  4JW1 A;  4CJO A;  2W45 A;  4MW8 A;  3DXJ F;  3JYY A;  2NUT A;  2Q9B A;  2ZXR A;  4K1O A;  1Q0D A;  3U2M A;  5D91 A;  1LE4 A;  1SF8 A;  3C8G A;  3IQ6 A;  1XZQ A;  2G3K A;  4NTB A;  1MMD A;  2A69 F;  2DI3 A;  1DOV A;  4Z9I A;  3RKO F;  1C03 A;  2A1D D;  1PCX A;  3AG2 C;  2ZXO A;  3ZC4 A;  3ABL C;  1DOW A;  2CNW A;  3DE9 A;  4DBR A;  2EPL X;  4U5D E;  4ULW A;  4AE4 A;  3J06 A;  1U6H A;  2PBE A;  1VYK A;  1RJ9 B;  2Y3D A;  4E17 A;  2TMV P;  2W4M A;  3HNL A;  4BJ1 A;  1TFK B;  3W8H A;  4CS9 C;  4XEK A;  1H9T A;  1VB5 A;  2AU5 A;  3HLZ A;  3GEE A;  5JP7 A;  2XLH A;  4JE9 A;  4H54 A;  2HV7 A;  3RQF A;  2E87 A;  2FAP B;  3X1O A;  4WAB A;  2R7S A;  1RKE A;  5KYY B;  2HJ3 A;  1C02 A;  2XRH A;  2WZF A;  3GOR A;  4E7S A;  1M2O A;  2XL6 A;  3TJ6 A;  3TUL A;  1A7D A;  4HFK B;  3ZVR A;  3GM2 A;  2AP3 A;  3WAQ A;  3GEH A;  3HTK C;  4CBE A;  5A6J A;  2YVK A;  2ASR A;  4P9F A;  3EFO B;  3MYF A;  3QVZ A;  2L7A A;  3M79 A;  2ZPA A;  4D4X A;  2QNL A;  2Y3B A;  2AWC A;  2GAQ A;  4OIO F;  3S0X A;  2R7W A;  2MWQ A;  4YN0 B;  1OQC A;  2L6G A;  3RIP A;  5L0I A;  3WHN A;  1LKX A;  3F47 A;  3IEE A;  4XPX A;  5DS6 A;  1MND A;  4DVZ A;  5L0D A;  3C8G D;  4OIP F;  2XM4 A;  1JPN A;  2OU6 A;  1FAP B;  3PCV A;  3K66 A;  3UMI A;  4YWQ A;  3S84 A;  4QDL A;  2GFH A;  4C3D A;  4WGZ A;  5A6K A;  5BUO A;  4PFO A;  5DLJ A;  1ZZP A;  5KYU A;  2CNW D;  2L81 A;  2EPN A;  3DJN B;  2LD6 A;  3RH3 A;  4CIH A;  1ZHZ A;  1T01 A;  3CSK A;  2XLE A;  2LQG A;  4EBB A;  1NLX A;  4U5C E;  2ZXW C;  1XZP A;  1VOM A;  1ZHY A;  1J8Y F;  2PF4 E;  4LER A;  1U89 A;  5BQG A;  3A9C A;  3LLI A;  3UMK A;  4CS8 A;  4NC3 A;  3QW1 A;  4WGY A;  3UR3 C;  2WB7 A;  1OXK A;  4G0H A;  5DQZ A;  4CDA A;  5B1B C;  3K33 A;  1TWA A;  2DGJ A;  2P0N A;  1A7V A;  1VYI A;  3M4B A;  4IAO A;  4J30 B;  4ULV A;  3B0V C;  3EZI A;  3B9Q A;  4U5F E;  1YYX A;  4YT8 A;  2OEX A;  1YYJ A;  4PJJ A;  3KYI A;  4P9T A;  3VYW A;  3JCU Q;  3V5Z A;  3F46 A;  1OR2 A;  5B3S C;  1QLE C;  1BR4 A;  3AJM A;  3AQB A;  4MTF A;  1RKC A;  4A4A A;  3RYL A;  4Q5S F;  4MVZ A;  3VRC A;  5A6A A;  2R05 A;  4Q7C A;  4IB4 A;  2W9Y A;  2XLO A;  3AOU A;  2HSB A;  4BJ6 A;  3GM1 A;  3DMD A;  3ZSU A;  4G7O F;  3AG3 C;  3GWL A;  4FWV A;  3FOO A;  3UMH A;  2M64 A;  3C62 A;  3DKA A;  2NSF A;  2QLA A;  3Q7L A;  1ORY A;  4XTK A;  4IRU A;  3AG4 C;  1Q0F A;  3HKK A;  2A68 F;  2Q7R A;  2KQ9 A;  4E0I A;  4G7H F;  4AL1 A;  4JC7 A;  2EIJ C;  3BEH A;  4O7G A;  4OD4 A;  5KYW A;  1R5I D;  4CS7 A;  2P7V A;  3EPV A;  2MHR A;  3DWW A;  3JRT A;  4PJM A;  4BG0 A;  1VK5 A;  4O79 A;  3TJ5 A;  3GWN A;  1I5N A;  4MVM A;  1E2X A;  1BZ4 A;  1FFT C;  1YA9 A;  5JVE A;  1EA8 A;  4N06 A;  2HSQ A;  2MYS A;  4KNW A;  2V3C C;  1T6U A;  1D1C A;  5L3Q A;  2A6H F;  4I3M A;  4J7T A;  3T6G B;  2GWW A;  2EIL C;  1E84 A;  3S9O A;  2BC5 A;  1TFO B;  1QKR A;  4EBK A;  3LAY A;  5JT4 A;  2J9U A;  2HKV A;  2PP4 A;  4JTC B;  1CGN A;  1Y4C A;  4I1O B;  5GPG B;  5L0J A;  2J0W A;  3L34 A;  3V5Y A;  2QY9 A;  4OIR F;  2KK1 A;  2ZD9 A;  5L0H A;  3N24 A;  4YL3 A;  2EPM X;  3H65 A;  4PJL A;  3JSE O;  1OCC C;  3S90 A;  4FES A;  2P61 A;  1LIH A;  3SXZ A;  4E0H A;  5K0I A;  4N6H A;  1V74 B;  2AVK A;  2PNO A;  5E2Q A;  1RJ9 A;  1HMD A;  4PR9 A;  5COM A;  2NUP B;  3DI5 A;  2CCY A;  2VCB A;  3SP1 A;  3W2W A;  2G62 A;  1G4U S;  5JLI A;  3NYJ A;  4JCH A;  2ETS A;  3FVY A;  5JS5 A;  3MBG A;  1IZM A;  4ER9 A;  1YDI A;  4DRI B;  3LNR A;  5E3A A;  2Y69 C;  1APC A;  2YHS A;  1FMV A;  1WGW A;  2YL0 A;  3ZWI A;  1WTY A;  1NZE A;  3ABM C;  4NCQ A;  4O6N A;  1YAR O;  1OW7 A;  1MNE A;  3U8P A;  1D1A A;  1UG7 A;  3DJU B;  4EUK B;  4BEM J;  4N6C A;  5A69 A;  4GQH A;  1ZHT A;  4PJN A;  2M4E A;  3X2Q C;  2I15 A;  4LLE A;  3IQ5 A;  5IY5 C;  1A0B A;  4EHP A;  3FDQ A;  1VMA A;  2IYL D;  3ZIB A;  4G7Z F;  2IXM A;  1K05 A;  2L9J A;  4JTA B;  1Z6A A;  4DVY P;  5EGY A;  1EI7 A;  4OD5 A;  5JSL A;  1QSP A;  5HV9 A;  4E18 A;  1BBH A;  1OCO C;  5L3V A;  1JMW A;  1QVX A;  3DM9 B;  2LIG A;  4JEB A;  3SYN A;  2J45 A;  1CGO A;  1CPR A;  2VCA A;  2H8A A;  4MW3 A;  4F4B A;  1M57 C;  2BL2 A;  3K1H A;  1JPJ A;  4KNV A;  2HFI A;  4XLN F;  1BR1 A;  2YL7 A;  3N0T A;  1RMV A;  2XL8 A;  3LLK A;  3Q6N A;  1CPQ A;  4XEV A;  1I4Z A;  2R03 A;  2WL8 A;  1W2W A;  1GQA A;  2J46 A;  2XLW A;  2EPO A;  3KH2 A;  2R02 A;  3KPH A;  3LUT B;  3K7D A;  2VC9 A;  3N2Z B;  3U9J A;  4LDQ A;  5DS4 A;  2GDC A;  1E83 A;  1M56 C;  3PMR A;  3JT1 A;  5KYX A;  2Q4F A;  1JAF A;  2FGY A;  2J9B A;  2OG2 A;  2WVO A;  5FZT A;  5T1D B;  4CSA C;  2YWA A;  1HW1 A;  2LFF A;  3IHU A;  1YZC A;  1YJG A;  3H2U A;  5AC4 A;  1LPE A;  3ATP A;  3LES A;  3GEI A;  3C8Z A;  1T6Q A;  1Q0K A;  4RDA A;  1Z7Q c;  4YL0 A;  4CDY A;  4C3B A;  3FXH A;  1NU9 C;  4ANJ A;  5L0G A;  1OKK A;  1WAT A;  3FMS A;  3HNJ A;  2J0X A;  1V54 C;  2OJE D;  2IBF A;  4HEA J; 
#chains in the Genus database with same CATH homology
 4AE4 B;  1ZU4 A;  4AX2 A;  3ZG1 A;  1O87 A;  4XLP F;  2J7P D;  5F5H A;  3LEV A;  3QMK A;  3WOD F;  1PD0 A;  4RD9 A;  1TWH A;  4I44 A;  3EGD A;  4U5B E;  1MMA A;  4DOZ A;  1V55 C;  1Z3I X;  4M63 A;  5D92 A;  2H7V C;  3S28 A;  2WZG A;  3LS1 A;  1Z5Z A;  3EG9 A;  4C7O B;  1O5H A;  4MND A;  2WVN A;  3NYL A;  3Q7G A;  1TR2 A;  1OCZ C;  4NY3 A;  5B1A C;  1FFH A;  2IXP A;  4J32 B;  2R7U A;  3EQL F;  2J9V A;  2NUP A;  2R7X A;  2DYR C;  3MLG A;  2P6V A;  3LJB A;  4KC9 A;  2H7B A;  1TWC A;  4WJ0 A;  4KBL A;  3NG1 A;  3NRH A;  3UGO A;  4LLC A;  3KL4 A;  4JZA A;  3NKE A;  1OKK D;  2HV6 A;  5KYU B;  4CS9 A;  4BEJ A;  4MQ9 F;  2V26 A;  3LS0 A;  4K0D A;  5EHH A;  4O6M A;  4HFF B;  2C03 A;  5CI9 A;  1Z23 A;  1PD1 A;  3JSZ A;  3K6B A;  2W4B A;  3V7O A;  4QI0 A;  4AK9 A;  4JJF A;  5F5F A;  2WVQ A;  1D0X A;  5DS5 A;  3KKB A;  3T4R A;  3W2V A;  1MMG A;  3S27 A;  1M2V B;  4BJT A;  2KGO A;  2VB6 A;  5KYY A;  5E3C A;  3JYH A;  1SMY F;  1J8M F;  2YEV A;  4CS8 C;  3EGX B;  4I1M A;  4JVS A;  5T3T A;  3UNG C;  3KMI A;  2IXN A;  2OCC C;  1FTS A;  2IXO A;  4OIQ F;  2Y39 A;  2QTV A;  2XXA B;  3SEO A;  2R7V A;  2CGE A;  3EFO A;  4OIN F;  3GAN A;  3M1C B;  3CQZ A;  3T6J A;  3NYM A;  2YZS A;  1FMW A;  3WG7 C;  3E9V A;  4YJW A;  4BJ6 C;  3Q6M A;  2XL4 A;  3SZR A;  3EH1 A;  1BR2 A;  2J7P A;  1Z63 A;  4YT2 A;  5FCL A;  2JD3 A;  1S7Z A;  1LVK A;  4DBQ A;  4KI2 A;  1QZX A;  3ITF A;  2ZXP A;  1ZU5 A;  4O6Y A;  2PFD A;  1ZYR F;  2KW3 C;  3I4U A;  1TKN A;  3ASN C;  4E7Z A;  2WZL A;  2G3V A;  4Q4Z F;  1MMN A;  4FX5 A;  4P6I C;  2Y3G A;  4U5H A;  2NUT B;  3ASO C;  1D0Y A;  2D5R B;  3DM5 A;  4PK4 A;  4BJ5 C;  3DAG A;  2DYS C;  1D0Z A;  2Z15 A;  3OWT A;  4C7O A;  2XSE A;  1IW7 F;  2R7Q A;  3K1I C;  3L0I A;  4W8K A;  3T6B A;  4YT4 A;  4K7B A;  3I5P A;  3EH2 A;  5DVW A;  2IOQ A;  2PX3 A;  2EIK C;  4X0R A;  2Q3T A;  3DAF A;  4RBN A;  2EIN C;  3O39 A;  3EZH A;  3UGP A;  3VAY A;  2H7O A;  4EWC A;  3TD7 A;  3CZ6 A;  4PFP A;  3AG1 C;  4U5E E;  1NG1 A;  4JUR I;  1ZHX A;  3B0U X;  4C3E A;  3POV A;  4H4K C;  5KYN A;  4QI2 A;  3O6X A;  1OCR C;  4IWB A;  3E70 C;  3AQC A;  3B0P A;  5HSW A;  4GEH A;  2C04 A;  3EHN A;  2CDQ A;  4ZLC A;  1D1B A;  2I8B A;  5DQT A;  4U5G A;  3SNH A;  2EIM C;  3FHD A;  5E33 A;  1M2V A;  5KYX B;  4GYT A;  4YT5 A;  2O9X A;  2PX0 A;  1ZHW A;  3OA1 A;  5CI8 A;  1NU7 D;  2Q9A A;  1SZI A;  3RFY A;  3NDB B;  1KU2 A;  2J9W A;  3EGX A;  3EJN A;  1N1C A;  2R7O A;  4IJJ A;  3NKD A;  2VAS A;  2XXA A;  2VH3 A;  3DD7 A;  2BE5 F;  2X51 A;  3DZA A;  3FAJ A;  4A2N B;  3W8I A;  2B0J A;  2Y3H A;  4HE8 D;  1ST6 A;  3EGD B;  4JJG A;  3GOD A;  3PHF 2;  2NG1 A;  2Q9C A;  4XWJ A;  2KJG A;  3EHM A;  3MX3 A;  2FFH A;  3EG9 B;  3ABK C;  3S29 A;  4CSA A;  2KNH A;  4ZLD A;  1G8X A;  3I5Q A;  1LS1 A;  2CW0 F;  4LAC B;  4BJ5 A;  2R7R A;  3OEO A;  5KYW B;  3QZC A;  3ECS A;  2LSE A;  2R7T A;  4B6I A;  1TWG A;  2A6E F;  3HJC A;  5T3W A;  4JW1 A;  2W45 A;  3DXJ F;  2NUT A;  2Q9B A;  2ZXR A;  5D91 A;  1SF8 A;  2G3K A;  1MMD A;  2A69 F;  3RKO F;  2A1D D;  3AG2 C;  1PCX A;  2ZXO A;  3ZC4 A;  3ABL C;  2CNW A;  4DBR A;  4U5D E;  4ULW A;  4AE4 A;  1VYK A;  1RJ9 B;  2Y3D A;  2W4M A;  4BJ1 A;  4CS9 C;  3W8H A;  3HLZ A;  2HV7 A;  3X1O A;  2E87 A;  2R7S A;  5KYY B;  2XRH A;  2WZF A;  4E7S A;  1M2O A;  4HFK B;  3ZVR A;  3HTK C;  3EFO B;  2ZPA A;  2Y3B A;  4OIO F;  3S0X A;  2R7W A;  2MWQ A;  4YN0 B;  3RIP A;  1LKX A;  3F47 A;  3IEE A;  5DS6 A;  1MND A;  4DVZ A;  4OIP F;  1JPN A;  3K66 A;  3UMI A;  4YWQ A;  4QDL A;  2GFH A;  4C3D A;  5BUO A;  4PFO A;  5DLJ A;  5KYU A;  2CNW D;  2L81 A;  3DJN B;  3RH3 A;  4CIH A;  1ZHZ A;  3CSK A;  4EBB A;  4U5C E;  2ZXW C;  1VOM A;  1ZHY A;  1J8Y F;  2PF4 E;  4LER A;  3LLI A;  3UMK A;  4CS8 A;  3UR3 C;  2WB7 A;  4G0H A;  5DQZ A;  5B1B C;  3K33 A;  1TWA A;  2DGJ A;  4J30 B;  4IAO A;  1VYI A;  3B0V C;  3EZI A;  3B9Q A;  4U5F E;  4YT8 A;  4PJJ A;  3VYW A;  3JCU Q;  3F46 A;  5B3S C;  1QLE C;  1BR4 A;  3AQB A;  4Q5S F;  3RYL A;  4Q7C A;  2W9Y A;  4BJ6 A;  4G7O F;  3DMD A;  3ZSU A;  3AG3 C;  4FWV A;  3UMH A;  3Q7L A;  4XTK A;  4IRU A;  3AG4 C;  2A68 F;  2KQ9 A;  4G7H F;  2EIJ C;  4O7G A;  4OD4 A;  5KYW A;  4CS7 A;  2P7V A;  3EPV A;  3JRT A;  4PJM A;  4BG0 A;  1VK5 A;  4O79 A;  1FFT C;  4N06 A;  2V3C C;  2MYS A;  4KNW A;  5L3Q A;  1D1C A;  2A6H F;  4I3M A;  2EIL C;  3LAY A;  2J9U A;  2PP4 A;  4I1O B;  2J0W A;  3L34 A;  2QY9 A;  4OIR F;  3N24 A;  3H65 A;  4PJL A;  1OCC C;  4FES A;  5E2Q A;  1RJ9 A;  2NUP B;  3SP1 A;  3W2W A;  2G62 A;  3NYJ A;  4JCH A;  3FVY A;  1IZM A;  3LNR A;  5E3A A;  2Y69 C;  2YHS A;  1FMV A;  1WGW A;  1NZE A;  3ABM C;  4O6N A;  1MNE A;  1D1A A;  3DJU B;  1ZHT A;  4PJN A;  2M4E A;  3X2Q C;  4LLE A;  5IY5 C;  3FDQ A;  1VMA A;  2IYL D;  3ZIB A;  4G7Z F;  2IXM A;  2L9J A;  1Z6A A;  4DVY P;  5EGY A;  4OD5 A;  1OCO C;  5L3V A;  3DM9 B;  3SYN A;  2J45 A;  4F4B A;  1M57 C;  3K1H A;  4KNV A;  1JPJ A;  4XLN F;  1BR1 A;  3N0T A;  3LLK A;  3Q6N A;  2WL8 A;  1W2W A;  2J46 A;  3KH2 A;  3K7D A;  3N2Z B;  5DS4 A;  1M56 C;  3PMR A;  3JT1 A;  5KYX A;  2FGY A;  2WVO A;  2OG2 A;  4CSA C;  5T1D B;  3LES A;  4RDA A;  4C3B A;  1NU9 C;  4ANJ A;  1OKK A;  2J0X A;  1V54 C;  4CBE A;  4HEA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...