1Z23A

The serine-rich domain from crk-associated substrate (p130cas)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
163
structure length
163
Chain Sequence
GSGREPLELEVAVETLARLQQGVSTTVAHLLDLVGSASGPGGWRSTSEPQEPPVQDLKAAVAAVHGAVHELLEFARSAVSSATHTSDRTLHAKLSRQLQKMEDVYQTLVVHGQVLDSGRGGPGFTLDDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CRK-associated substrate
publication title The serine-rich domain from Crk-associated substrate (p130cas) is a four-helix bundle.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 55
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08824 Serine_rich Serine rich protein interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.830 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1z23A00
1Z23A 2L81A
chains in the Genus database with same CATH superfamily
1C03A 1ZYRF 3AG1C 3PCVA 3S84A 3GM1A 1Q0KA 2A0UA 2IXMA 2EPNA 4P9TA 3DKAA 1EQ1A 1LS1A 1MMDA 1OCRC 3JCUQ 2P0NA 3TQOA 1T6UA 4HE8D 3RVYA 5L0FA 2A68F 3KMIA 4J30B 3C63A 4GQHA 3ASNC 4OD4A 1FFTC 2VCAA 1CGOA 4NTAA 3JYYA 5B1AC 1SF8A 2IXNA 2L6GA 3E70C 3V5XA 3ZC4A 2UUIA 3SNHA 4ER9A 1VOMA 4QDLA 2WZFA 3L1MA 3JRMO 3EH2A 4DXWA 1YLMA 4JJFA 3LEVA 2YKZA 2R7QA 4HEAJ 4CSAA 2R7TA 4IARA 5L3QA 1I5NA 4U5DE 4XPYA 3LLIA 5DVWA 1JAFA 3NYMA 1ZW3A 1TWHA 4YWQA 4OIRF 4P6IC 4BJ5C 1EA8A 3I4UA 4MTOA 1LPEA 4MVMA 1H9TA 2HJMA 5BQHA 3US6A 2XM0A 4N4WA 2OEXA 3GODA 1FNTc 4DRJB 2H7VC 4RD9A 4HFFB 1G5ZA 4CDVA 1Q0GA 2R7XA 4BJ1A 2O9XA 2ASRA 2Y3DA 3ASOC 3EJNA 3S29A 3K33A 1D0ZA 3DZAA 2QE9A 2PX0A 2YZSA 5T3WA 4C7OA 2R7VA 3GEHA 2TMVP 1T6QA 3GANA 1OKKD 2VH3A 1G4WR 1A7EA 4JKVA 1NBBA 1JPNA 2Q9CA 3K1IA 2XS8A 4MVQA 1S05A 1AUEA 1LI7A 1Z3IX 2JPUA 4PK4A 2XLVA 4BPMA 1HMOA 5B3SC 3EHNA 4C7OB 4U5GA 4DVZA 1NFNA 1LVKA 4NC3A 2J46A 5KYUB 4O6YA 1DOVA 3X2QC 2XL8A 1JPJA 3F47A 1MMAA 3FOPA 3G4ZA 3W8IA 1JOGA 3S0XA 3DJUB 1K04A 4QI2A 4MVSA 4DVYP 4DRHB 3TOMA 5T3TA 1E84A 2WZGA 3RVZA 4LACB 5JS5A 1Q0DA 2OG2A 4KNVA 4WGZA 3M79A 2Y3BA 1PD0A 2R25A 3S9OA 2AP3A 5F28E 3TOLA 4N06A 2CGEA 2A6HF 3EZHA 3OEOA 3ZTZA 3V5ZA 1UG7A 2IXPA 4JW1A 5E33A 4AL1A 3DJNB 1MMNA 1Z63A 1V55C 1NU7D 2AU5A 1TFKB 3IQ5A 2F22A 4JCHA 4JTAB 4XPWA 1NLXA 2GFHA 3SXKA 4CS8A 1TFOB 1LI5A 2GWWA 1OW7A 3I5PA 2JD3A 4U5CE 4CS9A 1MMGA 3RQFA 2XL6A 4O79A 3U3BA 3HTKC 4OIQF 1T5OA 3MLGA 3FAJA 3B0PA 2KGOA 5K0IA 1U89A 2OOCA 4LDKA 4LLCA 4U9DA 2P7VA 4EBBA 3S28A 1H7IA 2ZPAA 1AVOB 2DGJA 4YJWA 5A69A 2BC5A 2XLWA 1SYQA 2WZLA 3KPHA 3N2ZB 1D1CA 2P6VA 2LK4A 2XXAB 3OWTA 3HNLA 3JT1A 4YN0B 4P9FA 1JRAA 1Y6DA 2B0JA 3CZ6A 3K6BA 2VCBA 3M4CA 1M2VA 3RF3A 3N24A 2OU6A 4FWVA 4E0IA 5JSLA 1BBHA 1IW7F 3RQGA 3MBGA 3KKBA 2QNLA 5B1BC 4CSAC 3QW0A 2EPOA 3KYJA 4XEKA 2MHRA 4MW3A 5A6BD 2OJED 3O39A 1OXBA 3DMDA 1SR2A 1GQAA 3WG7C 1M2VB 3L0IA 3EH1A 2P61A 1A0BA 4CDAA 3PHF2 5JUAA 2R02A 2R7WA 1M56C 2KNHA 1CPQA 3QMKA 1C17M 1WGWA 4NTFA 3BEHA 1PD1A 3CEXA 3Q7LA 5GPGB 2Q00A 3H2VA 2KC3A 5JP7A 1AEPA 4ONSA 3ZTMA 1Z23A 5F5HA 1O3UA 5E2QA 2EINC 1NSGB 2I15A 3B29A 3E9VA 2QUPA 4YL0A 3PMRA 4E7SA 3ZVRA 1RKCA 1T9KA 1YVIA 4MVZA 2HJ3A 1GGQA 2X51A 3IQ6A 4ULWA 5BQGA 3MFNA 4U5HA 3S27A 1CGME 1S7ZA 2GAQA 2KW3C 3U9MA 4IAQA 3AG3C 5EHHA 3K1HA 4PFPA 4IWBA 1ZHTA 1NZEA 2RSEB 3WAQA 3EGXA 5L0HA 4CDYA 5EGYA 3QTHA 4G0HA 2Q4FA 2R7SA 2XLEA 4GEHA 2OJQA 3ZIBA 1V4AA 3ZQYA 3WHNA 3Q7GA 1QKRA 2GA0A 2W4MA 5B3IA 2EPMX 5DQZA 1OXKA 3EGXB 2WVQA 1RJ9A 1G8XA 4JTDB 2NG1A 5L0DA 2DYRC 4LDRA 4CJOA 1RKEA 2CDQA 3K66A 4IGGA 4KC9A 3W4YA 5AC5A 3NRHA 4C3DA 1LS4A 2Q3TA 2LD6A 1ZU5A 3EZIA 3JTLO 4KBLA 5E3CA 2X0CA 4PFOA 1FR0A 1LE2A 3FMSA 1HW1A 1G4US 4K0DA 4W8KA 5COFA 5A6BA 5A6JA 4XLPF 1SZIA 3DAFA 1RJ9B 3DM5A 2PP4A 3GEEA 3J06A 2XLMA 3O6XA 4RDAA 1RKEB 1D0YA 2LCHA 4B6IA 3U8PA 4BG0A 4CJGA 4ZLCA 4CIHA 3FVYA 1OW8A 1WWPA 1U6HA 1Z5ZA 1ZHXA 4CBEA 4JE9A 5KYWA 3IHUA 1ZHYA 1TWAA 3AOUA 3S90A 1MNDA 1TQGA 4M63A 3IPMO 5FZTA 2R9RB 3LNMB 3SXMA 2LIGA 1O5HA 2C04A 1BR1A 1YA9A 4RBNA 1QPUA 3RIPA 3K1IC 1OR3A 3MYIA 1FFHA 5KYWB 1J8MF 2LFFA 3JYHA 3B9QA 3M1CB 3TJ5A 3NMKA 1R4TA 2XM4A 1E85A 2A0BA 2L6HA 5KYUA 2C03A 4PR9A 1T6IA 4Q7CA 2J9VA 3O55A 3JSZA 5DQTA 2IBFA 1VYKA 2GDCA 2YL7A 3F46A 2WVNA 3CAXA 3MYFA 4DBRA 5FCLA 3B0VC 1HE1A 2PF4E 3DE9A 3VAYA 4DRIB 4I1OB 5CIVA 2Y69C 2VB6A 4G7HF 1ORYA 5A6AA 3U2LA 4NY3A 3OA1A 3QVYA 4W8PA 2ETSA 2W4BA 4GYTA 2VCCA 4OIPF 1GS9A 3KH2A 4PACA 2Y3HA 4N6HA 3UMHA 3NDBB 4WJ0A 4CS8C 2L81A 2PNOA 3I5QA 1OCZC 2EIMC 4BJTA 5HSWA 1T01A 3R7CA 4CS9C 3FDQA 1QLEC 1PV3A 1WN0A 2J0WA 2QTVA 3IQCA 4MTFA 4ANJA 1C02A 1FTSA 2Q9AA 4XTKA 1FAPB 256BA 2B0HA 3ABLC 3V7OA 1KTMA 3DXJF 4L6RA 1Q0FA 4C3EA 1KNYA 2XLHA 2XXAA 3B0UX 3T6GB 2AWYA 1YARO 2DB4A 3IEEA 3U9JA 1NG1A 3QZCA 5AGFA 2EPLX 1A7DA 1Z7Qc 4MW8A 2P1AA 3EHMA 4JC7A 4LDQA 3L8IA 3TD7A 3IQTA 2Y3GA 3DM9B 2CCYA 2YLGA 2HUJA 3G4XA 4NQFA 1CGNA 2L7AA 1LKXA 3QW1A 3ZDLA 2J9BA 2IM8A 3FHDA 3L34A 4LERA 3U3FA 1F1MA 2KJGA 3EFOA 3CSKA 3C8ZA 2ZXOA 2A6EF 3UMIA 1H9GA 1SMYF 3NMIA 4JIOA 2NUTA 4EBJA 2LFDA 2YL3A 3C7JA 2OEVA 1ORSC 1D0XA 3FXHA 4NTBA 4KNWA 3EGDA 4PJLA 1O87A 3EFOB 4XWJA 2MYSA 2XL4A 5AC4A 4JTCB 4O6MA 1VLSA 1XZPA 2EPKX 5CI9A 3UMKA 1HY5A 3EG9A 4H54A 2NSFA 4YK5A 2NUTB 3GWLA 3ITFA 1OW6A 4WGYA 2L9JA 3FAPB 1MQVA 1A41A 1YYXA 4O6NA 1E86A 1YZAA 2HZ8A 3W2VA 1YZCA 3AG2C 3C18A 2ZXPA 3BRJA 2G62A 2QLAA 4PJJA 1NFOA 3EGDB 3Q6NA 1J8YF 1OCCC 2L6FA 3LUTB 4J7YA 4XEVA 1BR2A 2XLDA 3LESA 4OD5A 4Z9IA 3N0TA 2YLIA 3EG9B 4MVOA 1V74B 2D5RB 1ZU4A 4MQ9F 4X0RA 2FAPB 5DLJA 2R05A 3UR3C 1WATA 1XWJA 2Y39A 3ZQVA 3NG1A 4BJ6C 2HSBA 3JSEO 3AQBA 5L3VA 4E18A 2AVKA 2OQMA 3GORA 4G78A 5L0JA 4JCZA 5COGA 5BQIA 5BUOA 1Y4CA 2A1DD 2LQGA 2QY9A 1LE4A 5D91A 3U2MA 4I1MA 4E7ZA 3TJ6A 5L0IA 4LLEA 4F4BA 1YYJA 2EIJC 3W8HA 3HJCA 3NYJA 2ICWG 4J7TA 1QQ3A 1TKNA 4U5EE 5HV9A 4YT8A 2VC9A 4ZLDA 3NYLA 2J9WA 4JEBA 1NU9C 4UDVA 4YL3A 1K05A 3HKKA 3AQCA 2NPUA 4AE4B 3R2PA 1HMDA 1K40A 3W2WA 2AWCA 1E2XA 2PX3A 3EPVA 3GM2A 5T1DB 2YLDA 3Q6MA 2G3KA 4QI0A 3T9OA 4JEAA 3NKEA 2HV6A 4O7GA 4FESA 2BE5F 2R7OA 3KYIA 3LEOA 3T6JA 3VRCA 4IRUA 5EK0A 4AK9A 1W2WA 4E0HA 1LIHA 3ATPA 1BDJB 2CNWA 4CX9A 3NKDA 3H65A 4HFKB 4U9EA 3K7DA 4Z9JA 4H4KC 4I3MA 2RD9A 3SZRA 4D4XA 4XLNF 1HE9A 1B68A 2IYLD 5KYXA 2EILC 4JVSA 2HMZA 1RCPA 4DBQA 1TR2A 2V26A 2M64A 2R7RA 1H6GA 2XSEA 3C8GA 2J7PA 2XS1A 4IB4A 1I4ZA 1VTMP 3HNKA 5DS4A 1ORJA 3RFYA 3FOOA 2HV7A 2KQ9A 3H2UA 2YWAA 3L8JA 4MS2A 1V54C 5KYXB 2LSEA 3LLKA 2G3VA 3RH3A 5DS6A 4EHPA 1GM5A 1BR4A 2OKUA 3JRTA 4MVUA 1ZZPA 5DS5A 2WVOA 3PDMP 3C8GB 4MNDA 2H7BA 2IXOA 5KYYA 5F5FA 1EI7A 2YL0A 1TWGA 1XZQA 2EIKC 3EQLF 3HLZA 2VASA 1CPRA 4EIYA 4FX5A 2KYHA 3TULA 4K1OA 2Z15A 2J8WA 4ULVA 2DI3A 2YEVA 2R7UA 5KYYB 5KYNA 3HNIA 2BL2A 4BJ5A 4AL0A 1PCXA 3ECSA 3M4BA 2UUHA 2NSGA 3VYWA 1VK5A 2YRFA 1YA7O 2ZXRA 4BJ6A 1N1CA 4JJGA 3LAYA 1ZVZA 3MX3A 4OINF 3ZSUA 1VMAA 5A6KA 3C62A 4E17A 4CIPA 3GWNA 1KU2A 2HFIA 4DOZA 3SP1A 2H7OA 2NUPA 4A4AA 5JLIA 1WASA 1APCA 2HMQA 4EKWA 4YT4A 5TJ5E 3QVZA 1EKYA 2M4EA 1WOLA 4J32B 1E83A 1L7CA 3LJBA 3ABKC 4EBKA 4FAPB 4OIOF 2J45A 3GEIA 3B71A 4BEJA 4PJNA 2WB7A 1OCOC 1LM3B 3DD7A 1D1AA 5CI8A 4EWCA 2NUPB 1A7VA 2Q9BA 1ZHWA 2I8BA 3O10A 4MVRA 1QSPA 4R32A 2ZD9A 4XQ1A 3X1OA 3LNRA 3ABMC 2YQYA 5L0CA 3AGTA 3DAGA 3RYLA 3SEOA 1UFBA 1TWCA 3T4RA 4YL1A 2DYSC 4K7BA 2E87A 4Z9HA 4IAOA 4D4NA 2J0XA 2PBEA 2H8AA 1VYIA 4G7OF 4MTGA 3AG4C 2D4UA 4WABA 3VF0A 4CS7A 1FMWA 5COMA 3AGUA 2CNWD 4EUKB 3UGOA 4KI2A 3M15A 2MWQA 3U8VA 4G7ZF 2YHSA 1FMVA 1JR8A 1BZ4A 1L3PA 1JMWA 3NMJA 4NCQA 3RKOF 3RW0A 2HKVA 1Z6AA 5JRAA 1OKKA 3POVA 4N6CA 4XEFA 3AJMA 3WODF 4YT2A 2WL8A 3SYNA 1OQCA 1VLTA 3V5YA 3RQEA 3U0CA 1ZHZA 2YVKA 1ST6A 3JZ0A 2Q7RA 3ZWIA 1DOWA 2CYDA 4JZAA 3C8GD 1I4YA 2J7PD 1RMVA 1M6TA 1RXQA 2XRHA 2FFHA 1U0BB 4JURI 3DE8A 3ZG1A 3KL4A 3DI5A 3SXZA 2LP4A 2XLOA 2HSQA 1QZXA 2IOQA 2W45A 1OR2A 2FGYA 3CQZA 4U5BE 3UNGC 4Q4ZF 1HW2A 1VB5A 1YJGA 1ZW2A 4U5FE 4AE4A 4Q5SF 3TK0A 4DJ9A 4IJJA 3U5SA 4PJMA 2A69F 3GM3A 4YT5A 1YAUO 3T6BA 1Q0MA 1R5ID 4I44A 1IZMA 1D1BA 5IY5C 2ZXWC 1M2OA 1MNEA 2KK1A 5D92A 4C3BA 5JVEA 5L0GA 2CW0F 3A9CA 3G50A 3LS0A 2JX0A 3UGPA 2R03A 2J9UA 3HNJA 2V3CC 1M57C 5E3AA 1QVXA 5JT4A 3A11A 2OCCC 2KSFA 1YDIA 2PFDA 4JRZA 3SXYA 2W9YA 3LS1A 4AX2A 4BEMJ 4A2NB 1WTYA 3VM6A 2HS5A 2YL1A 3DWWA 4XPXA
chains in the Genus database with same CATH topology
1ZYRF 3AG1C 2IXMA 1LS1A 1MMDA 1OCRC 3JCUQ 4HE8D 2A68F 3KMIA 4J30B 3ASNC 4OD4A 1FFTC 5B1AC 1SF8A 2IXNA 3E70C 3ZC4A 3SNHA 1VOMA 4QDLA 2WZFA 3EH2A 4JJFA 3LEVA 4HEAJ 2R7QA 2R7TA 5L3QA 4U5DE 3LLIA 5DVWA 3NYMA 1TWHA 4YWQA 4OIRF 4P6IC 4BJ5C 3I4UA 3GODA 2H7VC 4RD9A 4HFFB 2R7XA 4BJ1A 2O9XA 3ASOC 2Y3DA 3EJNA 3S29A 4BJ6C 3K33A 1D0ZA 3DZAA 2R7VA 2PX0A 2YZSA 5T3WA 4C7OA 3GANA 1OKKD 2VH3A 1JPNA 2Q9CA 1Z3IX 4PK4A 5B3SC 3EHNA 4C7OB 4U5GA 4DVZA 1LVKA 2J46A 5KYUB 4O6YA 3X2QC 1JPJA 3F47A 1MMAA 3W8IA 3S0XA 3DJUB 4QI2A 4DVYP 5T3TA 2WZGA 4LACB 2OG2A 4KNVA 2Y3BA 1PD0A 4N06A 2CGEA 2A6HF 3EZHA 3OEOA 2IXPA 4JW1A 5E33A 3DJNB 1MMNA 1Z63A 1V55C 1NU7D 5IY5C 4CS8A 4JCHA 5KYNA 2GFHA 3I5PA 2JD3A 4U5CE 4CS9A 1MMGA 4O79A 4OIQF 3HTKC 3MLGA 3FAJA 3B0PA 2KGOA 4LLCA 4EBBA 2P7VA 3S28A 2ZPAA 2DGJA 4YJWA 3N2ZB 2WZLA 1D1CA 2P6VA 2XXAB 3OWTA 3JT1A 4YN0B 2B0JA 3CZ6A 3K6BA 1M2VA 3N24A 4FWVA 1IW7F 3KKBA 4CSAC 5B1BC 3O39A 3DMDA 3WG7C 3L0IA 1M2VB 3EH1A 3PHF2 2R7WA 1M56C 2KNHA 3QMKA 1WGWA 1PD1A 3Q7LA 1Z23A 5F5HA 5E2QA 2EINC 3E9VA 3PMRA 4E7SA 3ZVRA 4ULWA 2X51A 4U5HA 3S27A 1S7ZA 2KW3C 3AG3C 5EHHA 3K1HA 4PFPA 4IWBA 1ZHTA 1NZEA 3EGXA 5EGYA 4G0HA 2R7SA 4GEHA 3ZIBA 3Q7GA 2W4MA 5DQZA 3EGXB 2WVQA 1RJ9A 1G8XA 2NG1A 2DYRC 2CDQA 3K66A 4KC9A 3NRHA 4C3DA 2Q3TA 1ZU5A 3EZIA 5E3CA 4KBLA 4PFOA 4W8KA 4K0DA 4XLPF 1SZIA 3DAFA 1RJ9B 3DM5A 2PP4A 3O6XA 4RDAA 4CIHA 1D0YA 4B6IA 4ZLCA 4BG0A 3FVYA 1Z5ZA 1ZHXA 4CBEA 5KYWA 1ZHYA 1TWAA 1MNDA 4M63A 1O5HA 2C04A 1BR1A 4RBNA 5KYWB 3RIPA 3K1IC 1FFHA 1J8MF 3JYHA 3M1CB 3B9QA 5KYUA 2C03A 4Q7CA 2J9VA 3JSZA 5DQTA 1VYKA 3F46A 2WVNA 3B0VC 4DBRA 5FCLA 2PF4E 3VAYA 4I1OB 2Y69C 2VB6A 4G7HF 4NY3A 3OA1A 2W4BA 4GYTA 4OIPF 3KH2A 3UMHA 2Y3HA 3NDBB 4WJ0A 4CS8C 2L81A 3I5QA 1OCZC 2EIMC 4BJTA 5HSWA 4CS9C 3FDQA 1QLEC 2J0WA 2QTVA 4ANJA 1FTSA 2Q9AA 4XTKA 3ABLC 3V7OA 3DXJF 4C3EA 2XXAA 3B0UX 3IEEA 1NG1A 3QZCA 3EHMA 3TD7A 2Y3GA 3DM9B 1LKXA 3FHDA 3L34A 4LERA 2KJGA 3EFOA 3CSKA 2ZXOA 2A6EF 3UMIA 1SMYF 2NUTA 1D0XA 4KNWA 3EGDA 4PJLA 1O87A 3EFOB 4XWJA 2MYSA 2XL4A 4O6MA 5CI9A 3UMKA 3EG9A 2NUTB 3ITFA 2L9JA 4O6NA 3W2VA 3AG2C 2ZXPA 4PJJA 2G62A 3EGDB 3Q6NA 1J8YF 1OCCC 1BR2A 3LESA 4OD5A 3N0TA 3EG9B 2D5RB 4MQ9F 1ZU4A 4X0RA 5DLJA 3UR3C 2Y39A 3NG1A 3AQBA 5L3VA 5BUOA 2A1DD 2QY9A 5D91A 4I1MA 4E7ZA 4LLEA 4F4BA 2EIJC 3W8HA 3HJCA 3NYJA 1TKNA 4U5EE 4YT8A 4ZLDA 3NYLA 2J9WA 1NU9C 3AQCA 4AE4B 3W2WA 2PX3A 3EPVA 5T1DB 3Q6MA 2G3KA 4QI0A 3NKEA 2HV6A 4O7GA 4FESA 2BE5F 2R7OA 3T6JA 4AK9A 4IRUA 1W2WA 2CNWA 3NKDA 3H65A 4HFKB 3K7DA 4H4KC 4I3MA 3SZRA 4XLNF 2IYLD 5KYXA 2EILC 4JVSA 4DBQA 1TR2A 2V26A 2R7RA 2XSEA 2J7PA 5DS4A 3RFYA 2HV7A 2KQ9A 5KYXB 1V54C 2LSEA 3LLKA 2G3VA 3RH3A 5DS6A 1BR4A 3JRTA 5DS5A 2WVOA 4MNDA 5KYYA 2H7BA 2IXOA 5F5FA 1TWGA 2EIKC 3EQLF 3HLZA 2VASA 4FX5A 2Z15A 2R7UA 2YEVA 5KYYB 4BJ5A 1PCXA 3ECSA 3VYWA 1VK5A 2ZXRA 4BJ6A 1N1CA 4JJGA 3LAYA 3MX3A 4OINF 3ZSUA 1VMAA 1KU2A 4DOZA 3SP1A 2H7OA 2NUPA 4YT4A 2M4EA 4J32B 3LJBA 3ABKC 4OIOF 2J45A 4BEJA 4PJNA 2WB7A 1OCOC 3DD7A 4EWCA 1D1AA 5CI8A 2NUPB 2Q9BA 1ZHWA 2I8BA 3X1OA 3LNRA 3ABMC 3DAGA 3RYLA 3SEOA 3T4RA 1TWCA 2DYSC 4K7BA 2E87A 4IAOA 2J0XA 1VYIA 4G7OF 3AG4C 4CS7A 1FMWA 2CNWD 3UGOA 4KI2A 2MWQA 4G7ZF 2YHSA 1FMVA 3RKOF 1Z6AA 1OKKA 3POVA 4YT2A 3WODF 2WL8A 3SYNA 1ZHZA 1ST6A 4JZAA 2J7PD 2XRHA 2FFHA 4JURI 3ZG1A 3KL4A 4CSAA 1QZXA 2IOQA 2W45A 3CQZA 2FGYA 4U5BE 3UNGC 4Q4ZF 4AE4A 4U5FE 4Q5SF 4IJJA 4PJMA 2A69F 4YT5A 3T6BA 4I44A 1IZMA 1D1BA 2ZXWC 1M2OA 1MNEA 5D92A 4C3BA 2CW0F 3UGPA 3LS0A 2J9UA 2V3CC 1M57C 5E3AA 2OCCC 2PFDA 2W9YA 3LS1A 4AX2A 4A2NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z23 A;  2L81 A; 
#chains in the Genus database with same CATH topology
 1C03 A;  1ZYR F;  3AG1 C;  3PCV A;  3S84 A;  3GM1 A;  1Q0K A;  2A0U A;  2IXM A;  2EPN A;  4P9T A;  3DKA A;  1EQ1 A;  1LS1 A;  1MMD A;  1OCR C;  3JCU Q;  2P0N A;  3TQO A;  1T6U A;  4HE8 D;  3RVY A;  5L0F A;  2A68 F;  3KMI A;  4J30 B;  3C63 A;  4GQH A;  3ASN C;  4OD4 A;  1FFT C;  2VCA A;  1CGO A;  4NTA A;  3JYY A;  5B1A C;  1SF8 A;  2IXN A;  2L6G A;  3E70 C;  3V5X A;  3ZC4 A;  2UUI A;  3SNH A;  4ER9 A;  1VOM A;  4QDL A;  2WZF A;  3L1M A;  3JRM O;  3EH2 A;  4DXW A;  1YLM A;  4JJF A;  3LEV A;  2YKZ A;  2R7Q A;  4HEA J;  4CSA A;  2R7T A;  4IAR A;  5L3Q A;  1I5N A;  4U5D E;  4XPY A;  3LLI A;  5DVW A;  1JAF A;  3NYM A;  1ZW3 A;  1TWH A;  4YWQ A;  4OIR F;  4P6I C;  4BJ5 C;  1EA8 A;  3I4U A;  4MTO A;  1LPE A;  4MVM A;  1H9T A;  2HJM A;  5BQH A;  3US6 A;  2XM0 A;  4N4W A;  2OEX A;  3GOD A;  1FNT c;  4DRJ B;  2H7V C;  4RD9 A;  4HFF B;  1G5Z A;  4CDV A;  1Q0G A;  2R7X A;  4BJ1 A;  2O9X A;  2ASR A;  2Y3D A;  3ASO C;  3EJN A;  3S29 A;  3K33 A;  1D0Z A;  3DZA A;  2QE9 A;  2PX0 A;  2YZS A;  5T3W A;  4C7O A;  2R7V A;  3GEH A;  2TMV P;  1T6Q A;  3GAN A;  1OKK D;  2VH3 A;  1G4W R;  1A7E A;  4JKV A;  1NBB A;  1JPN A;  2Q9C A;  3K1I A;  2XS8 A;  4MVQ A;  1S05 A;  1AUE A;  1LI7 A;  1Z3I X;  2JPU A;  4PK4 A;  2XLV A;  4BPM A;  1HMO A;  5B3S C;  3EHN A;  4C7O B;  4U5G A;  4DVZ A;  1NFN A;  1LVK A;  4NC3 A;  2J46 A;  5KYU B;  4O6Y A;  1DOV A;  3X2Q C;  2XL8 A;  1JPJ A;  3F47 A;  1MMA A;  3FOP A;  3G4Z A;  3W8I A;  1JOG A;  3S0X A;  3DJU B;  1K04 A;  4QI2 A;  4MVS A;  4DVY P;  4DRH B;  3TOM A;  5T3T A;  1E84 A;  2WZG A;  3RVZ A;  4LAC B;  5JS5 A;  1Q0D A;  2OG2 A;  4KNV A;  4WGZ A;  3M79 A;  2Y3B A;  1PD0 A;  2R25 A;  3S9O A;  2AP3 A;  5F28 E;  3TOL A;  4N06 A;  2CGE A;  2A6H F;  3EZH A;  3OEO A;  3ZTZ A;  3V5Z A;  1UG7 A;  2IXP A;  4JW1 A;  5E33 A;  4AL1 A;  3DJN B;  1MMN A;  1Z63 A;  1V55 C;  1NU7 D;  2AU5 A;  1TFK B;  3IQ5 A;  2F22 A;  4JCH A;  4JTA B;  4XPW A;  1NLX A;  2GFH A;  3SXK A;  4CS8 A;  1TFO B;  1LI5 A;  2GWW A;  1OW7 A;  3I5P A;  2JD3 A;  4U5C E;  4CS9 A;  1MMG A;  3RQF A;  2XL6 A;  4O79 A;  3U3B A;  3HTK C;  4OIQ F;  1T5O A;  3MLG A;  3FAJ A;  3B0P A;  2KGO A;  5K0I A;  1U89 A;  2OOC A;  4LDK A;  4LLC A;  4U9D A;  2P7V A;  4EBB A;  3S28 A;  1H7I A;  2ZPA A;  1AVO B;  2DGJ A;  4YJW A;  5A69 A;  2BC5 A;  2XLW A;  1SYQ A;  2WZL A;  3KPH A;  3N2Z B;  1D1C A;  2P6V A;  2LK4 A;  2XXA B;  3OWT A;  3HNL A;  3JT1 A;  4YN0 B;  4P9F A;  1JRA A;  1Y6D A;  2B0J A;  3CZ6 A;  3K6B A;  2VCB A;  3M4C A;  1M2V A;  3RF3 A;  3N24 A;  2OU6 A;  4FWV A;  4E0I A;  5JSL A;  1BBH A;  1IW7 F;  3RQG A;  3MBG A;  3KKB A;  2QNL A;  5B1B C;  4CSA C;  3QW0 A;  2EPO A;  3KYJ A;  4XEK A;  2MHR A;  4MW3 A;  5A6B D;  2OJE D;  3O39 A;  1OXB A;  3DMD A;  1SR2 A;  1GQA A;  3WG7 C;  1M2V B;  3L0I A;  3EH1 A;  2P61 A;  1A0B A;  4CDA A;  3PHF 2;  5JUA A;  2R02 A;  2R7W A;  1M56 C;  2KNH A;  1CPQ A;  3QMK A;  1C17 M;  1WGW A;  4NTF A;  3BEH A;  1PD1 A;  3CEX A;  3Q7L A;  5GPG B;  2Q00 A;  3H2V A;  2KC3 A;  5JP7 A;  1AEP A;  4ONS A;  3ZTM A;  1Z23 A;  5F5H A;  1O3U A;  5E2Q A;  2EIN C;  1NSG B;  2I15 A;  3B29 A;  3E9V A;  2QUP A;  4YL0 A;  3PMR A;  4E7S A;  3ZVR A;  1RKC A;  1T9K A;  1YVI A;  4MVZ A;  2HJ3 A;  1GGQ A;  2X51 A;  3IQ6 A;  4ULW A;  5BQG A;  3MFN A;  4U5H A;  3S27 A;  1CGM E;  1S7Z A;  2GAQ A;  2KW3 C;  3U9M A;  4IAQ A;  3AG3 C;  5EHH A;  3K1H A;  4PFP A;  4IWB A;  1ZHT A;  1NZE A;  2RSE B;  3WAQ A;  3EGX A;  5L0H A;  4CDY A;  5EGY A;  3QTH A;  4G0H A;  2Q4F A;  2R7S A;  2XLE A;  4GEH A;  2OJQ A;  3ZIB A;  1V4A A;  3ZQY A;  3WHN A;  3Q7G A;  1QKR A;  2GA0 A;  2W4M A;  5B3I A;  2EPM X;  5DQZ A;  1OXK A;  3EGX B;  2WVQ A;  1RJ9 A;  1G8X A;  4JTD B;  2NG1 A;  5L0D A;  2DYR C;  4LDR A;  4CJO A;  1RKE A;  2CDQ A;  3K66 A;  4IGG A;  4KC9 A;  3W4Y A;  5AC5 A;  3NRH A;  4C3D A;  1LS4 A;  2Q3T A;  2LD6 A;  1ZU5 A;  3EZI A;  3JTL O;  4KBL A;  5E3C A;  2X0C A;  4PFO A;  1FR0 A;  1LE2 A;  3FMS A;  1HW1 A;  1G4U S;  4K0D A;  4W8K A;  5COF A;  5A6B A;  5A6J A;  4XLP F;  1SZI A;  3DAF A;  1RJ9 B;  3DM5 A;  2PP4 A;  3GEE A;  3J06 A;  2XLM A;  3O6X A;  4RDA A;  1RKE B;  1D0Y A;  2LCH A;  4B6I A;  3U8P A;  4BG0 A;  4CJG A;  4ZLC A;  4CIH A;  3FVY A;  1OW8 A;  1WWP A;  1U6H A;  1Z5Z A;  1ZHX A;  4CBE A;  4JE9 A;  5KYW A;  3IHU A;  1ZHY A;  1TWA A;  3AOU A;  3S90 A;  1MND A;  1TQG A;  4M63 A;  3IPM O;  5FZT A;  2R9R B;  3LNM B;  3SXM A;  2LIG A;  1O5H A;  2C04 A;  1BR1 A;  1YA9 A;  4RBN A;  1QPU A;  3RIP A;  3K1I C;  1OR3 A;  3MYI A;  1FFH A;  5KYW B;  1J8M F;  2LFF A;  3JYH A;  3B9Q A;  3M1C B;  3TJ5 A;  3NMK A;  1R4T A;  2XM4 A;  1E85 A;  2A0B A;  2L6H A;  5KYU A;  2C03 A;  4PR9 A;  1T6I A;  4Q7C A;  2J9V A;  3O55 A;  3JSZ A;  5DQT A;  2IBF A;  1VYK A;  2GDC A;  2YL7 A;  3F46 A;  2WVN A;  3CAX A;  3MYF A;  4DBR A;  5FCL A;  3B0V C;  1HE1 A;  2PF4 E;  3DE9 A;  3VAY A;  4DRI B;  4I1O B;  5CIV A;  2Y69 C;  2VB6 A;  4G7H F;  1ORY A;  5A6A A;  3U2L A;  4NY3 A;  3OA1 A;  3QVY A;  4W8P A;  2ETS A;  2W4B A;  4GYT A;  2VCC A;  4OIP F;  1GS9 A;  3KH2 A;  4PAC A;  2Y3H A;  4N6H A;  3UMH A;  3NDB B;  4WJ0 A;  4CS8 C;  2L81 A;  2PNO A;  3I5Q A;  1OCZ C;  2EIM C;  4BJT A;  5HSW A;  1T01 A;  3R7C A;  4CS9 C;  3FDQ A;  1QLE C;  1PV3 A;  1WN0 A;  2J0W A;  2QTV A;  3IQC A;  4MTF A;  4ANJ A;  1C02 A;  1FTS A;  2Q9A A;  4XTK A;  1FAP B;  256B A;  2B0H A;  3ABL C;  3V7O A;  1KTM A;  3DXJ F;  4L6R A;  1Q0F A;  4C3E A;  1KNY A;  2XLH A;  2XXA A;  3B0U X;  3T6G B;  2AWY A;  1YAR O;  2DB4 A;  3IEE A;  3U9J A;  1NG1 A;  3QZC A;  5AGF A;  2EPL X;  1A7D A;  1Z7Q c;  4MW8 A;  2P1A A;  3EHM A;  4JC7 A;  4LDQ A;  3L8I A;  3TD7 A;  3IQT A;  2Y3G A;  3DM9 B;  2CCY A;  2YLG A;  2HUJ A;  3G4X A;  4NQF A;  1CGN A;  2L7A A;  1LKX A;  3QW1 A;  3ZDL A;  2J9B A;  2IM8 A;  3FHD A;  3L34 A;  4LER A;  3U3F A;  1F1M A;  2KJG A;  3EFO A;  3CSK A;  3C8Z A;  2ZXO A;  2A6E F;  3UMI A;  1H9G A;  1SMY F;  3NMI A;  4JIO A;  2NUT A;  4EBJ A;  2LFD A;  2YL3 A;  3C7J A;  2OEV A;  1ORS C;  1D0X A;  3FXH A;  4NTB A;  4KNW A;  3EGD A;  4PJL A;  1O87 A;  3EFO B;  4XWJ A;  2MYS A;  2XL4 A;  5AC4 A;  4JTC B;  4O6M A;  1VLS A;  1XZP A;  2EPK X;  5CI9 A;  3UMK A;  1HY5 A;  3EG9 A;  4H54 A;  2NSF A;  4YK5 A;  2NUT B;  3GWL A;  3ITF A;  1OW6 A;  4WGY A;  2L9J A;  3FAP B;  1MQV A;  1A41 A;  1YYX A;  4O6N A;  1E86 A;  1YZA A;  2HZ8 A;  3W2V A;  1YZC A;  3AG2 C;  3C18 A;  2ZXP A;  3BRJ A;  2G62 A;  2QLA A;  4PJJ A;  1NFO A;  3EGD B;  3Q6N A;  1J8Y F;  1OCC C;  2L6F A;  3LUT B;  4J7Y A;  4XEV A;  1BR2 A;  2XLD A;  3LES A;  4OD5 A;  4Z9I A;  3N0T A;  2YLI A;  3EG9 B;  4MVO A;  1V74 B;  2D5R B;  1ZU4 A;  4MQ9 F;  4X0R A;  2FAP B;  5DLJ A;  2R05 A;  3UR3 C;  1WAT A;  1XWJ A;  2Y39 A;  3ZQV A;  3NG1 A;  4BJ6 C;  2HSB A;  3JSE O;  3AQB A;  5L3V A;  4E18 A;  2AVK A;  2OQM A;  3GOR A;  4G78 A;  5L0J A;  4JCZ A;  5COG A;  5BQI A;  5BUO A;  1Y4C A;  2A1D D;  2LQG A;  2QY9 A;  1LE4 A;  5D91 A;  3U2M A;  4I1M A;  4E7Z A;  3TJ6 A;  5L0I A;  4LLE A;  4F4B A;  1YYJ A;  2EIJ C;  3W8H A;  3HJC A;  3NYJ A;  2ICW G;  4J7T A;  1QQ3 A;  1TKN A;  4U5E E;  5HV9 A;  4YT8 A;  2VC9 A;  4ZLD A;  3NYL A;  2J9W A;  4JEB A;  1NU9 C;  4UDV A;  4YL3 A;  1K05 A;  3HKK A;  3AQC A;  2NPU A;  4AE4 B;  3R2P A;  1HMD A;  1K40 A;  3W2W A;  2AWC A;  1E2X A;  2PX3 A;  3EPV A;  3GM2 A;  5T1D B;  2YLD A;  3Q6M A;  2G3K A;  4QI0 A;  3T9O A;  4JEA A;  3NKE A;  2HV6 A;  4O7G A;  4FES A;  2BE5 F;  2R7O A;  3KYI A;  3LEO A;  3T6J A;  3VRC A;  4IRU A;  5EK0 A;  4AK9 A;  1W2W A;  4E0H A;  1LIH A;  3ATP A;  1BDJ B;  2CNW A;  4CX9 A;  3NKD A;  3H65 A;  4HFK B;  4U9E A;  3K7D A;  4Z9J A;  4H4K C;  4I3M A;  2RD9 A;  3SZR A;  4D4X A;  4XLN F;  1HE9 A;  1B68 A;  2IYL D;  5KYX A;  2EIL C;  4JVS A;  2HMZ A;  1RCP A;  4DBQ A;  1TR2 A;  2V26 A;  2M64 A;  2R7R A;  1H6G A;  2XSE A;  3C8G A;  2J7P A;  2XS1 A;  4IB4 A;  1I4Z A;  1VTM P;  3HNK A;  5DS4 A;  1ORJ A;  3RFY A;  3FOO A;  2HV7 A;  2KQ9 A;  3H2U A;  2YWA A;  3L8J A;  4MS2 A;  1V54 C;  5KYX B;  2LSE A;  3LLK A;  2G3V A;  3RH3 A;  5DS6 A;  4EHP A;  1GM5 A;  1BR4 A;  2OKU A;  3JRT A;  4MVU A;  1ZZP A;  5DS5 A;  2WVO A;  3PDM P;  3C8G B;  4MND A;  2H7B A;  2IXO A;  5KYY A;  5F5F A;  1EI7 A;  2YL0 A;  1TWG A;  1XZQ A;  2EIK C;  3EQL F;  3HLZ A;  2VAS A;  1CPR A;  4EIY A;  4FX5 A;  2KYH A;  3TUL A;  4K1O A;  2Z15 A;  2J8W A;  4ULV A;  2DI3 A;  2YEV A;  2R7U A;  5KYY B;  5KYN A;  3HNI A;  2BL2 A;  4BJ5 A;  4AL0 A;  1PCX A;  3ECS A;  3M4B A;  2UUH A;  2NSG A;  3VYW A;  1VK5 A;  2YRF A;  1YA7 O;  2ZXR A;  4BJ6 A;  1N1C A;  4JJG A;  3LAY A;  1ZVZ A;  3MX3 A;  4OIN F;  3ZSU A;  1VMA A;  5A6K A;  3C62 A;  4E17 A;  4CIP A;  3GWN A;  1KU2 A;  2HFI A;  4DOZ A;  3SP1 A;  2H7O A;  2NUP A;  4A4A A;  5JLI A;  1WAS A;  1APC A;  2HMQ A;  4EKW A;  4YT4 A;  5TJ5 E;  3QVZ A;  1EKY A;  2M4E A;  1WOL A;  4J32 B;  1E83 A;  1L7C A;  3LJB A;  3ABK C;  4EBK A;  4FAP B;  4OIO F;  2J45 A;  3GEI A;  3B71 A;  4BEJ A;  4PJN A;  2WB7 A;  1OCO C;  1LM3 B;  3DD7 A;  1D1A A;  5CI8 A;  4EWC A;  2NUP B;  1A7V A;  2Q9B A;  1ZHW A;  2I8B A;  3O10 A;  4MVR A;  1QSP A;  4R32 A;  2ZD9 A;  4XQ1 A;  3X1O A;  3LNR A;  3ABM C;  2YQY A;  5L0C A;  3AGT A;  3DAG A;  3RYL A;  3SEO A;  1UFB A;  1TWC A;  3T4R A;  4YL1 A;  2DYS C;  4K7B A;  2E87 A;  4Z9H A;  4IAO A;  4D4N A;  2J0X A;  2PBE A;  2H8A A;  1VYI A;  4G7O F;  4MTG A;  3AG4 C;  2D4U A;  4WAB A;  3VF0 A;  4CS7 A;  1FMW A;  5COM A;  3AGU A;  2CNW D;  4EUK B;  3UGO A;  4KI2 A;  3M15 A;  2MWQ A;  3U8V A;  4G7Z F;  2YHS A;  1FMV A;  1JR8 A;  1BZ4 A;  1L3P A;  1JMW A;  3NMJ A;  4NCQ A;  3RKO F;  3RW0 A;  2HKV A;  1Z6A A;  5JRA A;  1OKK A;  3POV A;  4N6C A;  4XEF A;  3AJM A;  3WOD F;  4YT2 A;  2WL8 A;  3SYN A;  1OQC A;  1VLT A;  3V5Y A;  3RQE A;  3U0C A;  1ZHZ A;  2YVK A;  1ST6 A;  3JZ0 A;  2Q7R A;  3ZWI A;  1DOW A;  2CYD A;  4JZA A;  3C8G D;  1I4Y A;  2J7P D;  1RMV A;  1M6T A;  1RXQ A;  2XRH A;  2FFH A;  1U0B B;  4JUR I;  3DE8 A;  3ZG1 A;  3KL4 A;  3DI5 A;  3SXZ A;  2LP4 A;  2XLO A;  2HSQ A;  1QZX A;  2IOQ A;  2W45 A;  1OR2 A;  2FGY A;  3CQZ A;  4U5B E;  3UNG C;  4Q4Z F;  1HW2 A;  1VB5 A;  1YJG A;  1ZW2 A;  4U5F E;  4AE4 A;  4Q5S F;  3TK0 A;  4DJ9 A;  4IJJ A;  3U5S A;  4PJM A;  2A69 F;  3GM3 A;  4YT5 A;  1YAU O;  3T6B A;  1Q0M A;  1R5I D;  4I44 A;  1IZM A;  1D1B A;  5IY5 C;  2ZXW C;  1M2O A;  1MNE A;  2KK1 A;  5D92 A;  4C3B A;  5JVE A;  5L0G A;  2CW0 F;  3A9C A;  3G50 A;  3LS0 A;  2JX0 A;  3UGP A;  2R03 A;  2J9U A;  3HNJ A;  2V3C C;  1M57 C;  5E3A A;  1QVX A;  5JT4 A;  3A11 A;  2OCC C;  2KSF A;  1YDI A;  2PFD A;  4JRZ A;  3SXY A;  2W9Y A;  3LS1 A;  4AX2 A;  4BEM J;  4A2N B;  1WTY A;  3VM6 A;  2HS5 A;  2YL1 A;  3DWW A;  4XPX A; 
#chains in the Genus database with same CATH homology
 1ZYR F;  3AG1 C;  2IXM A;  1LS1 A;  1MMD A;  1OCR C;  3JCU Q;  4HE8 D;  2A68 F;  3KMI A;  4J30 B;  3ASN C;  4OD4 A;  1FFT C;  5B1A C;  1SF8 A;  2IXN A;  3E70 C;  3ZC4 A;  3SNH A;  1VOM A;  4QDL A;  2WZF A;  3EH2 A;  4JJF A;  3LEV A;  4HEA J;  2R7Q A;  2R7T A;  5L3Q A;  4U5D E;  3LLI A;  5DVW A;  3NYM A;  1TWH A;  4YWQ A;  4OIR F;  4P6I C;  4BJ5 C;  3I4U A;  3GOD A;  2H7V C;  4RD9 A;  4HFF B;  2R7X A;  4BJ1 A;  2O9X A;  3ASO C;  2Y3D A;  3EJN A;  3S29 A;  4BJ6 C;  3K33 A;  1D0Z A;  3DZA A;  2R7V A;  2PX0 A;  2YZS A;  5T3W A;  4C7O A;  3GAN A;  1OKK D;  2VH3 A;  1JPN A;  2Q9C A;  1Z3I X;  4PK4 A;  5B3S C;  3EHN A;  4C7O B;  4U5G A;  4DVZ A;  1LVK A;  2J46 A;  5KYU B;  4O6Y A;  3X2Q C;  1JPJ A;  3F47 A;  1MMA A;  3W8I A;  3S0X A;  3DJU B;  4QI2 A;  4DVY P;  5T3T A;  2WZG A;  4LAC B;  2OG2 A;  4KNV A;  2Y3B A;  1PD0 A;  4N06 A;  2CGE A;  2A6H F;  3EZH A;  3OEO A;  2IXP A;  4JW1 A;  5E33 A;  3DJN B;  1MMN A;  1Z63 A;  1V55 C;  1NU7 D;  5IY5 C;  4CS8 A;  4JCH A;  5KYN A;  2GFH A;  3I5P A;  2JD3 A;  4U5C E;  4CS9 A;  1MMG A;  4O79 A;  4OIQ F;  3HTK C;  3MLG A;  3FAJ A;  3B0P A;  2KGO A;  4LLC A;  4EBB A;  2P7V A;  3S28 A;  2ZPA A;  2DGJ A;  4YJW A;  3N2Z B;  2WZL A;  1D1C A;  2P6V A;  2XXA B;  3OWT A;  3JT1 A;  4YN0 B;  2B0J A;  3CZ6 A;  3K6B A;  1M2V A;  3N24 A;  4FWV A;  1IW7 F;  3KKB A;  4CSA C;  5B1B C;  3O39 A;  3DMD A;  3WG7 C;  3L0I A;  1M2V B;  3EH1 A;  3PHF 2;  2R7W A;  1M56 C;  2KNH A;  3QMK A;  1WGW A;  1PD1 A;  3Q7L A;  1Z23 A;  5F5H A;  5E2Q A;  2EIN C;  3E9V A;  3PMR A;  4E7S A;  3ZVR A;  4ULW A;  2X51 A;  4U5H A;  3S27 A;  1S7Z A;  2KW3 C;  3AG3 C;  5EHH A;  3K1H A;  4PFP A;  4IWB A;  1ZHT A;  1NZE A;  3EGX A;  5EGY A;  4G0H A;  2R7S A;  4GEH A;  3ZIB A;  3Q7G A;  2W4M A;  5DQZ A;  3EGX B;  2WVQ A;  1RJ9 A;  1G8X A;  2NG1 A;  2DYR C;  2CDQ A;  3K66 A;  4KC9 A;  3NRH A;  4C3D A;  2Q3T A;  1ZU5 A;  3EZI A;  5E3C A;  4KBL A;  4PFO A;  4W8K A;  4K0D A;  4XLP F;  1SZI A;  3DAF A;  1RJ9 B;  3DM5 A;  2PP4 A;  3O6X A;  4RDA A;  4CIH A;  1D0Y A;  4B6I A;  4ZLC A;  4BG0 A;  3FVY A;  1Z5Z A;  1ZHX A;  4CBE A;  5KYW A;  1ZHY A;  1TWA A;  1MND A;  4M63 A;  1O5H A;  2C04 A;  1BR1 A;  4RBN A;  5KYW B;  3RIP A;  3K1I C;  1FFH A;  1J8M F;  3JYH A;  3M1C B;  3B9Q A;  5KYU A;  2C03 A;  4Q7C A;  2J9V A;  3JSZ A;  5DQT A;  1VYK A;  3F46 A;  2WVN A;  3B0V C;  4DBR A;  5FCL A;  2PF4 E;  3VAY A;  4I1O B;  2Y69 C;  2VB6 A;  4G7H F;  4NY3 A;  3OA1 A;  2W4B A;  4GYT A;  4OIP F;  3KH2 A;  3UMH A;  2Y3H A;  3NDB B;  4WJ0 A;  4CS8 C;  2L81 A;  3I5Q A;  1OCZ C;  2EIM C;  4BJT A;  5HSW A;  4CS9 C;  3FDQ A;  1QLE C;  2J0W A;  2QTV A;  4ANJ A;  1FTS A;  2Q9A A;  4XTK A;  3ABL C;  3V7O A;  3DXJ F;  4C3E A;  2XXA A;  3B0U X;  3IEE A;  1NG1 A;  3QZC A;  3EHM A;  3TD7 A;  2Y3G A;  3DM9 B;  1LKX A;  3FHD A;  3L34 A;  4LER A;  2KJG A;  3EFO A;  3CSK A;  2ZXO A;  2A6E F;  3UMI A;  1SMY F;  2NUT A;  1D0X A;  4KNW A;  3EGD A;  4PJL A;  1O87 A;  3EFO B;  4XWJ A;  2MYS A;  2XL4 A;  4O6M A;  5CI9 A;  3UMK A;  3EG9 A;  2NUT B;  3ITF A;  2L9J A;  4O6N A;  3W2V A;  3AG2 C;  2ZXP A;  4PJJ A;  2G62 A;  3EGD B;  3Q6N A;  1J8Y F;  1OCC C;  1BR2 A;  3LES A;  4OD5 A;  3N0T A;  3EG9 B;  2D5R B;  4MQ9 F;  1ZU4 A;  4X0R A;  5DLJ A;  3UR3 C;  2Y39 A;  3NG1 A;  3AQB A;  5L3V A;  5BUO A;  2A1D D;  2QY9 A;  5D91 A;  4I1M A;  4E7Z A;  4LLE A;  4F4B A;  2EIJ C;  3W8H A;  3HJC A;  3NYJ A;  1TKN A;  4U5E E;  4YT8 A;  4ZLD A;  3NYL A;  2J9W A;  1NU9 C;  3AQC A;  4AE4 B;  3W2W A;  2PX3 A;  3EPV A;  5T1D B;  3Q6M A;  2G3K A;  4QI0 A;  3NKE A;  2HV6 A;  4O7G A;  4FES A;  2BE5 F;  2R7O A;  3T6J A;  4AK9 A;  4IRU A;  1W2W A;  2CNW A;  3NKD A;  3H65 A;  4HFK B;  3K7D A;  4H4K C;  4I3M A;  3SZR A;  4XLN F;  2IYL D;  5KYX A;  2EIL C;  4JVS A;  4DBQ A;  1TR2 A;  2V26 A;  2R7R A;  2XSE A;  2J7P A;  5DS4 A;  3RFY A;  2HV7 A;  2KQ9 A;  5KYX B;  1V54 C;  2LSE A;  3LLK A;  2G3V A;  3RH3 A;  5DS6 A;  1BR4 A;  3JRT A;  5DS5 A;  2WVO A;  4MND A;  5KYY A;  2H7B A;  2IXO A;  5F5F A;  1TWG A;  2EIK C;  3EQL F;  3HLZ A;  2VAS A;  4FX5 A;  2Z15 A;  2R7U A;  2YEV A;  5KYY B;  4BJ5 A;  1PCX A;  3ECS A;  3VYW A;  1VK5 A;  2ZXR A;  4BJ6 A;  1N1C A;  4JJG A;  3LAY A;  3MX3 A;  4OIN F;  3ZSU A;  1VMA A;  1KU2 A;  4DOZ A;  3SP1 A;  2H7O A;  2NUP A;  4YT4 A;  2M4E A;  4J32 B;  3LJB A;  3ABK C;  4OIO F;  2J45 A;  4BEJ A;  4PJN A;  2WB7 A;  1OCO C;  3DD7 A;  4EWC A;  1D1A A;  5CI8 A;  2NUP B;  2Q9B A;  1ZHW A;  2I8B A;  3X1O A;  3LNR A;  3ABM C;  3DAG A;  3RYL A;  3SEO A;  3T4R A;  1TWC A;  2DYS C;  4K7B A;  2E87 A;  4IAO A;  2J0X A;  1VYI A;  4G7O F;  3AG4 C;  4CS7 A;  1FMW A;  2CNW D;  3UGO A;  4KI2 A;  2MWQ A;  4G7Z F;  2YHS A;  1FMV A;  3RKO F;  1Z6A A;  1OKK A;  3POV A;  4YT2 A;  3WOD F;  2WL8 A;  3SYN A;  1ZHZ A;  1ST6 A;  4JZA A;  2J7P D;  2XRH A;  2FFH A;  4JUR I;  3ZG1 A;  3KL4 A;  4CSA A;  1QZX A;  2IOQ A;  2W45 A;  3CQZ A;  2FGY A;  4U5B E;  3UNG C;  4Q4Z F;  4AE4 A;  4U5F E;  4Q5S F;  4IJJ A;  4PJM A;  2A69 F;  4YT5 A;  3T6B A;  4I44 A;  1IZM A;  1D1B A;  2ZXW C;  1M2O A;  1MNE A;  5D92 A;  4C3B A;  2CW0 F;  3UGP A;  3LS0 A;  2J9U A;  2V3C C;  1M57 C;  5E3A A;  2OCC C;  2PFD A;  2W9Y A;  3LS1 A;  4AX2 A;  4A2N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...