1Z23A

The serine-rich domain from crk-associated substrate (p130cas)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
163
structure length
163
Chain Sequence
GSGREPLELEVAVETLARLQQGVSTTVAHLLDLVGSASGPGGWRSTSEPQEPPVQDLKAAVAAVHGAVHELLEFARSAVSSATHTSDRTLHAKLSRQLQKMEDVYQTLVVHGQVLDSGRGGPGFTLDDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CRK-associated substrate
publication title The serine-rich domain from Crk-associated substrate (p130cas) is a four-helix bundle.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion
total genus 55
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08824 Serine_rich Serine rich protein interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.830 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1z23A00
1Z23A 2L81A
chains in the Genus database with same CATH superfamily
3UGOA 2J7PA 4N6HA 2GWWA 2AP3A 3LS0A 1E83A 4JRZA 3V5ZA 5AC4A 2J9UA 2E87A 1OW8A 1NZEA 2WZLA 3IPMO 1NU7D 4JKVA 4LDRA 4N06A 4CS7A 3W8HA 4JIOA 1KTMA 3NG1A 4DXWA 5JRAA 4DRJB 2OQMA 2Q7RA 1A7EA 2QTVA 1M2OA 5KYNA 2WVNA 5KYWA 4PJJA 4XEKA 5A6KA 1TR2A 3BEHA 3IQ6A 2A69F 2YL7A 4CSAC 2VB6A 4EWCA 1GM5A 2EPOA 2M4EA 4GEHA 3ZIBA 3UR3C 4Q7CA 3ZWIA 2DYSC 4G78A 5EK0A 4BPMA 5L0JA 1G4US 1RMVA 3U8PA 3ZQVA 3L8JA 4JEAA 3B0UX 2HZ8A 3JT1A 4E7SA 2ZXPA 2W45A 3SZRA 2V3CC 3TULA 2L81A 3C8ZA 3TOMA 1OXBA 4PACA 3CZ6A 1Z6AA 3FXHA 4U5HA 5KYYA 4O7GA 2GA0A 3KMIA 4B6IA 3EFOB 1QKRA 1LI7A 1WATA 3M15A 1VYKA 4MVSA 5T3WA 3O39A 1Z63A 2QNLA 1SZIA 2PNOA 5KYXA 3R2PA 4I44A 3DJUB 3DM5A 5L0HA 4Z9IA 1R4TA 1DOWA 5EHHA 4WABA 2HSBA 1VB5A 1OQCA 1F1MA 3K6BA 1OCOC 3EQLF 4I1OB 4QDLA 3LS1A 3U3FA 1HMOA 1FFTC 3O55A 3QZCA 3M4CA 4MTOA 4OIOF 2XLHA 4C3EA 1LI5A 2O9XA 3NYMA 3ZTMA 3EGDB 3KYIA 5K0IA 4I1MA 2NUPA 2Q3TA 4AX2A 2LP4A 2XXAB 2HKVA 2AU5A 2W9YA 3ABKC 1Q0DA 3NYJA 4KBLA 3GEHA 3JSEO 3V5XA 1O3UA 4MS2A 1D0XA 1TWGA 4CIHA 3CQZA 3KYJA 5DS6A 2FAPB 3DWWA 4U5BE 5E3AA 1GGQA 2D5RB 1MMDA 1T6UA 4JJGA 2ZXOA 4PFOA 3U0CA 1XWJA 1LIHA 1RXQA 1ZHYA 3F47A 2HV7A 1LPEA 1OR3A 2RD9A 2XLMA 1LS1A 3W8IA 4CX9A 3S90A 4Q5SF 1TQGA 5FCLA 2J7PD 1OCZC 4XEVA 4KC9A 4IAOA 4JURI 2R7RA 2HS5A 2DB4A 1N1CA 2YHSA 1AEPA 5D91A 1T6IA 5KYUA 5EGYA 3RFYA 2NSGA 3DXJF 1TFKB 1OW7A 1CPRA 1YLMA 2CNWA 2XLVA 1XZPA 3HNLA 2XS1A 3JRMO 4D4XA 1JAFA 4HFFB 1Y4CA 2W4BA 4DBRA 2R7TA 3K1IC 4UDVA 1ZW3A 4PJLA 4WGYA 1ZW2A 4IAQA 2LFFA 2UUIA 4Z9HA 2A0BA 4JJFA 3VM6A 5KYWB 2IYLD 3QVZA 2CGEA 4AK9A 2WVOA 3GANA 3TJ5A 4A4AA 1S05A 1JPNA 3K66A 4ULVA 4EBKA 5AGFA 3TJ6A 5CI8A 2TMVP 3EJNA 3Q7GA 4CS9C 3DMDA 1Z3IX 1D0ZA 2VASA 1A0BA 3L8IA 4U9EA 4XTKA 3C7JA 3GODA 3HNJA 1YZAA 1TWCA 2WZFA 1Z5ZA 4JTAB 3SXZA 2ICWG 2RSEB 3AG3C 4XPXA 5L0DA 2L9JA 3T6GB 4BJ5A 2J8WA 1V54C 3QW1A 1LE2A 1OCRC 1QSPA 3MYFA 4IB4A 1DOVA 2AWYA 2EILC 5E3CA 3LESA 4CDYA 4QI0A 2LCHA 2R7QA 3ITFA 3O10A 3U9JA 3K7DA 1Y6DA 2I15A 3UMIA 4AE4B 5DLJA 1AVOB 4H4KC 1BDJB 4WJ0A 4KNVA 2NSFA 3NDBB 3I5QA 3AOUA 1U6HA 2J0XA 1MMNA 1E2XA 2Q9CA 4JE9A 4JTDB 2KQ9A 3QMKA 4DRIB 4M63A 3O6XA 4BJ6C 1WOLA 3TD7A 1WASA 3WHNA 5B1BC 2OKUA 3A9CA 3M1CB 1YJGA 3LAYA 1H9GA 3GM1A 3JSZA 1Z7Qc 2NUPB 2YLDA 2PP4A 2WVQA 2OU6A 1AUEA 1JMWA 1ZZPA 2ZPAA 3TOLA 4JCZA 2R7SA 1KNYA 4J7TA 5COMA 2YL3A 2BE5F 2XL8A 1A7DA 2Y3BA 2Z15A 4LERA 3B9QA 2MHRA 1I5NA 2X51A 3JTLO 3H65A 4JW1A 3I4UA 1BZ4A 4YN0B 4NTBA 1RCPA 2ZXRA 3B29A 3RVYA 5E33A 1ZVZA 5COFA 3S29A 2VCBA 2Y69C 3N2ZB 3EGXB 4EBJA 1JPJA 3IHUA 4GQHA 4LDQA 3T9OA 3ASNC 2KW3C 3QTHA 3CAXA 5KYUB 1EA8A 2CNWD 2KNHA 4EUKB 4IGGA 1PD1A 2P1AA 3SEOA 3HNIA 1OR2A 4ONSA 1FTSA 2ETSA 4O6MA 2YKZA 3IQCA 4JEBA 4XEFA 5DS5A 1TWHA 2J9BA 1K05A 4J30B 2H7BA 4DVYP 3ZQYA 3PHF2 1VYIA 2XL6A 4PJMA 1M57C 2A6HF 4H54A 3KPHA 2YEVA 2VCAA 4ANJA 5JS5A 4CSAA 2R7UA 1VK5A 1J8YF 4PJNA 1VOMA 1Q0GA 2Q4FA 2H8AA 4GYTA 4HEAJ 4LACB 2V26A 4RDAA 3W2VA 4CS8C 2CCYA 4FX5A 4ULWA 4AE4A 1JOGA 3ZVRA 4C3BA 4CBEA 5JLIA 4XLPF 1V4AA 1M6TA 3NRHA 1S7ZA 3WAQA 5A6BA 3QVYA 4MW8A 1O87A 2A1DD 3G50A 2J9VA 3DZAA 2ASRA 2YL0A 4MVOA 3C8GB 2C04A 1ZU5A 4Q4ZF 2Y3GA 2QE9A 4J32B 1MNEA 2CW0F 4YL1A 3RQGA 4YT4A 1CPQA 1UG7A 4O79A 3ZG1A 4BG0A 5L3QA 3S0XA 4DRHB 2YL1A 3UGPA 1RJ9A 4XQ1A 1A41A 4EHPA 3NKEA 4N4WA 4YK5A 1ZHWA 1U0BB 4JVSA 3GM2A 1D0YA 3PCVA 1Q0KA 2A68F 3H2UA 4O6NA 1VLSA 3VRCA 4CDVA 1SR2A 2XSEA 3F46A 5JT4A 4BEMJ 1JRAA 1M2VB 1SMYF 2LD6A 2PFDA 3SNHA 2B0HA 1BBHA 2R03A 1QLEC 1OKKA 3QW0A 4E7ZA 3POVA 1BR4A 4R32A 3NMIA 1ZHZA 2HJ3A 3NYLA 4XPYA 4ZLDA 1NSGB 1WTYA 3EGXA 2BC5A 1D1CA 4YL3A 4OINF 3RH3A 5BQHA 4C3DA 2W4MA 4NCQA 3ZC4A 2A6EF 1T6QA 3ABMC 1PV3A 1NFOA 2XRHA 4U5CE 5A6JA 4K0DA 2J9WA 1NBBA 2Q9BA 4P9FA 4LLCA 1WWPA 1MMAA 4IJJA 2CYDA 1QQ3A 3DAGA 3B0PA 3W4YA 1VMAA 4E0IA 2WL8A 1SYQA 4JC7A 2XLDA 4G7HF 3CEXA 3JRTA 3LEOA 3S28A 1C03A 2KC3A 2R05A 2HMZA 3FOPA 2LSEA 4ER9A 5BQIA 4D4NA 3OWTA 2UUHA 1CGNA 2DGJA 3AGTA 3US6A 3U8VA 1LM3B 2EIJC 3JYYA 3RQEA 4EKWA 1UFBA 3DAFA 3LLKA 1EI7A 1QPUA 3UMHA 4P6IC 3MBGA 2EINC 3U2MA 1RKCA 1U89A 1D1BA 3K1IA 1D1AA 1C02A 1J8MF 3L1MA 1APCA 2OEVA 2LQGA 4BJ1A 3HJCA 3M4BA 3MYIA 2EIKC 4WGZA 1ZHTA 3C8GA 2IXMA 4A2NB 4EIYA 4MVUA 5B3IA 3FHDA 4MTGA 1NLXA 2KYHA 4L6RA 4CS9A 5A6BD 2F22A 3GWLA 1FMVA 2PX3A 4N6CA 3I5PA 1K40A 5F28E 2R25A 3WG7C 4FAPB 4MQ9F 2IXPA 2G3VA 1L3PA 1V74B 5E2QA 3C62A 5JSLA 1H9TA 3N0TA 4XLNF 4MVQA 2KJGA 3SXMA 3J06A 1ORJA 2AWCA 2VH3A 2ZXWC 1LKXA 4CJOA 2P0NA 3EH2A 4OIPF 4NC3A 1M2VA 1RJ9B 3FDQA 2XM0A 3DI5A 4G0HA 5HSWA 3PDMP 5L0GA 3EZHA 1OW6A 2LFDA 2KSFA 2XLOA 3VAYA 3KL4A 3U9MA 1XZQA 3G4ZA 4ZLCA 2Y3DA 1Q0FA 3AQCA 1YYJA 4YJWA 3RIPA 2IBFA 3EG9A 2A0UA 3OA1A 1C17M 3RQFA 1CGME 1FMWA 1HE9A 3ASOC 1OKKD 2JD3A 5COGA 2M64A 4PR9A 4BJ6A 3A11A 1HMDA 1K04A 1L7CA 4E18A 3AG4C 4E0HA 3MLGA 4XPWA 3ATPA 3BRJA 1YA7O 2IXNA 1GQAA 1E85A 2R9RB 1I4ZA 1ZU4A 3ABLC 4FWVA 4MVMA 3MX3A 1MNDA 1TFOB 3SXYA 2GDCA 3VF0A 3RW0A 4JZAA 2Q00A 3B71A 4MTFA 1FFHA 2Y39A 1H6GA 3NKDA 4NY3A 5JP7A 2X0CA 1R5ID 2L6HA 2QUPA 2HJMA 3C63A 1ST6A 4X0RA 5DVWA 3ZTZA 4E17A 1EKYA 4LLEA 1YARO 2EPMX 2YQYA 3EH1A 1HE1A 4Z9JA 4DJ9A 3EHNA 2OEXA 5D92A 5L3VA 4KNWA 1TWAA 5F5HA 4BEJA 2XM4A 3K33A 4MVRA 4DBQA 5HV9A 4NTAA 5L0FA 1RKEA 3KH2A 3NMKA 1A7VA 3EHMA 5FZTA 2HUJA 4NQFA 3GEEA 2ZD9A 2J45A 3G4XA 2YLGA 2CDQA 4PK4A 4CDAA 3C8GD 4MNDA 3HNKA 1E86A 1G8XA 5A69A 2I8BA 1B68A 4OD5A 1JR8A 2D4UA 5L0IA 1W2WA 2YLIA 1I4YA 3ZDLA 3FMSA 4OIQF 3T6JA 2WZGA 4CS8A 5CI9A 3T6BA 3AJMA 3DJNB 4AL1A 4YWQA 4CIPA 2R7WA 1SF8A 2KK1A 2NUTB 3HKKA 2LIGA 3JYHA 3FAPB 2G62A 1PCXA 256BA 4U5FE 3TQOA 2VCCA 2JPUA 3M79A 4W8KA 4IARA 4CJGA 2IOQA 4U5GA 1M56C 3L34A 4QI2A 2WB7A 3AG2C 2OJQA 2MYSA 3N24A 5B1AC 2JX0A 3HLZA 4JCHA 2XS8A 4K7BA 3S9OA 4YT8A 3L0IA 4F4BA 5A6AA 1T01A 3MFNA 2PX0A 3E70C 4DOZA 1VTMP 1O5HA 3EG9B 1OCCC 1WN0A 2Y3HA 4IRUA 4JTCB 1KU2A 1HW2A 4YL0A 4I3MA 4C7OA 2H7OA 2FGYA 1BR1A 2R7OA 3DE8A 3KKBA 4RD9A 1TKNA 2OCCC 1ZYRF 1YA9A 3ECSA 4XWJA 3HTKC 2H7VC 1FR0A 1FNTc 3DM9B 1NG1A 3C18A 3GORA 3E9VA 4YT2A 4KI2A 2EIMC 3FVYA 1YZCA 1YYXA 3DKAA 2FFHA 3LJBA 3TK0A 2KGOA 2QY9A 5DQTA 3Q6NA 5T3TA 3RVZA 4BJTA 1T9KA 2J0WA 3U3BA 3B0VC 1V55C 4U5EE 3JZ0A 1G5ZA 3OEOA 4O6YA 4RBNA 1MMGA 2C03A 2XLEA 2GFHA 2YVKA 2PBEA 4LDKA 1BR2A 3W2WA 3UMKA 2AVKA 1QZXA 1YDIA 2P61A 1ORSC 3T4RA 2EPNA 1G4WR 2PF4E 3GM3A 4J7YA 1GS9A 5CIVA 2DYRC 3GEIA 5JVEA 4K1OA 2OG2A 3AGUA 3IQ5A 3LEVA 5IY5C 5L0CA 3IEEA 2R7XA 3NMJA 1T5OA 4HE8D 3LLIA 5GPGB 3RF3A 5DS4A 4OIRF 1EQ1A 3H2VA 1ORYA 2HSQA 3GWNA 3Q6MA 5T1DB 3SP1A 1RKEB 4BJ5C 3U5SA 2P6VA 1OXKA 2XLWA 2GAQA 3DE9A 3JCUQ 4AL0A 4U5DE 3EPVA 1Q0MA 2IXOA 3EFOA 4NTFA 3ZSUA 2NUTA 3PMRA 5BQGA 3U2LA 4PFPA 2IM8A 3AG1C 4MW3A 3FOOA 3V7OA 2YZSA 1NFNA 1QVXA 2DI3A 2YRFA 3EZIA 3Q7LA 3UNGC 2Q9AA 2VC9A 1IW7F 2R7VA 1LE4A 3LUTB 2OJED 1YVIA 1LS4A 3DD7A 2L7AA 5KYYB 3S84A 4OD4A 5TJ5E 4EBBA 2G3KA 3RYLA 2MWQA 3S27A 5DQZA 1E84A 5JUAA 1FAPB 1HY5A 1LVKA 2R02A 3EGDA 2P7VA 3IQTA 3R7CA 1Z23A 5B3SC 5KYXB 5F5FA 1WGWA 2EPLX 2HMQA 2LK4A 4U9DA 4G7ZF 2XXAA 1IZMA 3FAJA 4G7OF 1H7IA 4IWBA 3X2QC 3X1OA 1MQVA 2NPUA 2XL4A 3RKOF 1ZHXA 3K1HA 2OOCA 2B0JA 3AQBA 1PD0A 2L6GA 4HFKB 2L6FA 4W8PA 3SYNA 4FESA 4MVZA 1VLTA 4DVZA 2YWAA 4YT5A 2EPKX 2NG1A 2J46A 4P9TA 3V5YA 1CGOA 5BUOA 3SXKA 4C7OB 3VYWA 3LNRA 3WODF 2BL2A 2HFIA 1HW1A 2HV6A 3LNMB 3CSKA 1NU9C 5AC5A 2QLAA 1YAUO
chains in the Genus database with same CATH topology
3UGOA 2J7PA 3LS0A 2J9UA 2E87A 1NZEA 2WZLA 1NU7D 4N06A 4CS7A 3W8HA 2QTVA 1M2OA 5KYNA 2WVNA 5KYWA 4PJJA 1TR2A 2A69F 4CSAC 2VB6A 4EWCA 2M4EA 4GEHA 3ZIBA 3UR3C 4Q7CA 2DYSC 3B0UX 3JT1A 4E7SA 2ZXPA 2W45A 3SZRA 2V3CC 2L81A 3CZ6A 1Z6AA 4U5HA 5KYYA 4O7GA 3KMIA 4B6IA 3EFOB 1VYKA 5T3WA 3O39A 1Z63A 1SZIA 5KYXA 4I44A 3DJUB 3DM5A 5EHHA 3K6BA 1OCOC 3EQLF 4I1OB 4QDLA 3LS1A 1FFTC 3QZCA 4C3EA 2O9XA 3NYMA 3EGDB 4I1MA 2NUPA 2Q3TA 4AX2A 2XXAB 2W9YA 3ABKC 3NYJA 4KBLA 1D0XA 1TWGA 4CIHA 3CQZA 5DS6A 4U5BE 5E3AA 2D5RB 1MMDA 4JJGA 4PFOA 2ZXOA 1ZHYA 3F47A 2HV7A 4Q5SF 1LS1A 3W8IA 5FCLA 2J7PD 1OCZC 4KC9A 4IAOA 4JURI 2R7RA 1N1CA 2YHSA 5D91A 5EGYA 5KYUA 3RFYA 3DXJF 2CNWA 4HFFB 2W4BA 4DBRA 2R7TA 3K1IC 4PJLA 5KYWB 4JJFA 2IYLD 2CGEA 4AK9A 2WVOA 3GANA 1JPNA 3K66A 5CI8A 3EJNA 3Q7GA 4CS9C 3DMDA 1Z3IX 1D0ZA 2VASA 4OIOF 4XTKA 3GODA 1TWCA 2WZFA 1Z5ZA 3AG3C 2L9JA 4BJ5A 1V54C 1OCRC 2EILC 5E3CA 3LESA 4QI0A 4AE4B 2R7QA 3ITFA 5DLJA 3K7DA 3UMIA 4YT4A 4H4KC 4WJ0A 4KNVA 3NDBB 3I5QA 2J0XA 1MMNA 2Q9CA 2KQ9A 3QMKA 4M63A 3O6XA 4BJ6C 3TD7A 5B1BC 3M1CB 3LAYA 3JSZA 2NUPB 2PP4A 2WVQA 2ZPAA 2R7SA 2BE5F 2Y3BA 2Z15A 4LERA 3B9QA 2X51A 3H65A 4JW1A 3I4UA 4YN0B 2ZXRA 5E33A 3S29A 2Y69C 3N2ZB 3EGXB 1JPJA 3ASNC 2KW3C 5KYUB 2CNWD 2KNHA 1PD1A 3SEOA 1FTSA 4O6MA 5DS5A 1TWHA 4J30B 3PHF2 4DVYP 2H7BA 1VYIA 4PJMA 1M57C 2A6HF 2YEVA 4ANJA 4CSAA 2R7UA 1VK5A 1J8YF 4PJNA 1VOMA 4GYTA 4HEAJ 4LACB 2V26A 4RDAA 3W2VA 4CS8C 4FX5A 4AE4A 4ULWA 4CBEA 4XLPF 3ZVRA 4C3BA 3NRHA 1S7ZA 1O87A 2A1DD 2J9VA 3DZAA 2C04A 1ZU5A 4Q4ZF 2Y3GA 4J32B 1MNEA 2CW0F 3ZG1A 4BG0A 4O79A 5L3QA 3S0XA 3UGPA 1RJ9A 3NKEA 1ZHWA 4JVSA 1D0YA 2A68F 4O6NA 2XSEA 3F46A 1SMYF 1M2VB 2PFDA 3SNHA 1QLEC 1OKKA 4E7ZA 1BR4A 1ZHZA 3NYLA 4ZLDA 3EGXA 1D1CA 4OINF 3RH3A 4C3DA 2W4MA 3ZC4A 2A6EF 3ABMC 2XRHA 4U5CE 4K0DA 2J9WA 2Q9BA 4LLCA 4IJJA 1MMAA 3DAGA 3B0PA 1VMAA 2WL8A 4G7HF 3JRTA 3S28A 2LSEA 3OWTA 2DGJA 2EIJC 3DAFA 3LLKA 3UMHA 4P6IC 2EINC 4EBBA 1D1BA 1D1AA 1J8MF 4BJ1A 3HJCA 2EIKC 1ZHTA 4A2NB 2IXMA 3FHDA 4CS9A 1FMVA 2PX3A 3I5PA 3WG7C 4MQ9F 2IXPA 2G3VA 5E2QA 3N0TA 4XLNF 2KJGA 2VH3A 2ZXWC 1LKXA 3EH2A 4OIPF 3FDQA 1M2VA 1RJ9B 4G0HA 3EZHA 3VAYA 3KL4A 4ZLCA 2Y3DA 3AQCA 4YJWA 3RIPA 3EG9A 3OA1A 1FMWA 3ASOC 1OKKD 2JD3A 4BJ6A 3AG4C 3MLGA 2IXNA 1ZU4A 4FWVA 3ABLC 3MX3A 1MNDA 4JZAA 1FFHA 2Y39A 3NKDA 4NY3A 1ST6A 4X0RA 5DVWA 4LLEA 3EH1A 3EHNA 5D92A 5L3VA 4KNWA 1TWAA 5F5HA 4BEJA 3K33A 4DBQA 3KH2A 3EHMA 4PK4A 2J45A 2CDQA 4MNDA 1G8XA 2I8BA 4OD5A 1W2WA 4OIQF 3T6JA 2WZGA 4CS8A 5CI9A 3T6BA 3DJNB 4YWQA 2R7WA 1SF8A 2NUTB 3JYHA 2G62A 1PCXA 4U5FE 4W8KA 2IOQA 4U5GA 1M56C 3L34A 4QI2A 2WB7A 3AG2C 2MYSA 3N24A 5B1AC 3HLZA 4JCHA 4K7BA 4YT8A 3L0IA 4F4BA 2PX0A 3E70C 4DOZA 1O5HA 3EG9B 1OCCC 2Y3HA 4IRUA 1KU2A 4C7OA 4I3MA 2H7OA 2FGYA 1BR1A 2R7OA 3KKBA 4RD9A 1TKNA 2OCCC 1ZYRF 3ECSA 4XWJA 3HTKC 2H7VC 3DM9B 1NG1A 3E9VA 4YT2A 4KI2A 2EIMC 3FVYA 3LJBA 2FFHA 2KGOA 2QY9A 5DQTA 3Q6NA 5T3TA 4BJTA 2J0WA 3B0VC 1V55C 4U5EE 3OEOA 4O6YA 4RBNA 1MMGA 2C03A 2GFHA 1BR2A 3W2WA 3UMKA 1QZXA 3T4RA 5HSWA 2PF4E 3POVA 2DYRC 5IY5C 2OG2A 3LEVA 3IEEA 2R7XA 5DS4A 4HE8D 3LLIA 4OIRF 3SP1A 5T1DB 3Q6MA 4BJ5C 2P6VA 3JCUQ 4U5DE 3EPVA 2IXOA 3EFOA 3ZSUA 2NUTA 3PMRA 4PFPA 3AG1C 3V7OA 2YZSA 3EZIA 3Q7LA 3UNGC 2Q9AA 1IW7F 2R7VA 3DD7A 5KYYB 4OD4A 2G3KA 3RYLA 2MWQA 3S27A 5DQZA 1LVKA 3EGDA 5B3SC 2P7VA 5KYXB 5F5FA 1Z23A 1WGWA 2XXAA 4G7ZF 1IZMA 3FAJA 4G7OF 4IWBA 3X2QC 3X1OA 2XL4A 3RKOF 1ZHXA 3K1HA 2B0JA 3AQBA 1PD0A 4HFKB 3SYNA 4FESA 4DVZA 4YT5A 2NG1A 2J46A 5BUOA 4C7OB 3VYWA 3LNRA 3WODF 2HV6A 3CSKA 1NU9C 3NG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z23 A;  2L81 A; 
#chains in the Genus database with same CATH topology
 3UGO A;  2J7P A;  4N6H A;  2GWW A;  2AP3 A;  3LS0 A;  1E83 A;  4JRZ A;  3V5Z A;  5AC4 A;  2J9U A;  2E87 A;  1OW8 A;  1NZE A;  2WZL A;  3IPM O;  1NU7 D;  4JKV A;  4LDR A;  4N06 A;  4CS7 A;  3W8H A;  4JIO A;  1KTM A;  3NG1 A;  4DXW A;  5JRA A;  4DRJ B;  2OQM A;  2Q7R A;  1A7E A;  2QTV A;  1M2O A;  5KYN A;  2WVN A;  5KYW A;  4PJJ A;  4XEK A;  5A6K A;  1TR2 A;  3BEH A;  3IQ6 A;  2A69 F;  2YL7 A;  4CSA C;  2VB6 A;  4EWC A;  1GM5 A;  2EPO A;  2M4E A;  4GEH A;  3ZIB A;  3UR3 C;  4Q7C A;  3ZWI A;  2DYS C;  4G78 A;  5EK0 A;  4BPM A;  5L0J A;  1G4U S;  1RMV A;  3U8P A;  3ZQV A;  3L8J A;  4JEA A;  3B0U X;  2HZ8 A;  3JT1 A;  4E7S A;  2ZXP A;  2W45 A;  3SZR A;  2V3C C;  3TUL A;  2L81 A;  3C8Z A;  3TOM A;  1OXB A;  4PAC A;  3CZ6 A;  1Z6A A;  3FXH A;  4U5H A;  5KYY A;  4O7G A;  2GA0 A;  3KMI A;  4B6I A;  3EFO B;  1QKR A;  1LI7 A;  1WAT A;  3M15 A;  1VYK A;  4MVS A;  5T3W A;  3O39 A;  1Z63 A;  2QNL A;  1SZI A;  2PNO A;  5KYX A;  3R2P A;  4I44 A;  3DJU B;  3DM5 A;  5L0H A;  4Z9I A;  1R4T A;  1DOW A;  5EHH A;  4WAB A;  2HSB A;  1VB5 A;  1OQC A;  1F1M A;  3K6B A;  1OCO C;  3EQL F;  4I1O B;  4QDL A;  3LS1 A;  3U3F A;  1HMO A;  1FFT C;  3O55 A;  3QZC A;  3M4C A;  4MTO A;  4OIO F;  2XLH A;  4C3E A;  1LI5 A;  2O9X A;  3NYM A;  3ZTM A;  3EGD B;  3KYI A;  5K0I A;  4I1M A;  2NUP A;  2Q3T A;  4AX2 A;  2LP4 A;  2XXA B;  2HKV A;  2AU5 A;  2W9Y A;  3ABK C;  1Q0D A;  3NYJ A;  4KBL A;  3GEH A;  3JSE O;  3V5X A;  1O3U A;  4MS2 A;  1D0X A;  1TWG A;  4CIH A;  3CQZ A;  3KYJ A;  5DS6 A;  2FAP B;  3DWW A;  4U5B E;  5E3A A;  1GGQ A;  2D5R B;  1MMD A;  1T6U A;  4JJG A;  2ZXO A;  4PFO A;  3U0C A;  1XWJ A;  1LIH A;  1RXQ A;  1ZHY A;  3F47 A;  2HV7 A;  1LPE A;  1OR3 A;  2RD9 A;  2XLM A;  1LS1 A;  3W8I A;  4CX9 A;  3S90 A;  4Q5S F;  1TQG A;  5FCL A;  2J7P D;  1OCZ C;  4XEV A;  4KC9 A;  4IAO A;  4JUR I;  2R7R A;  2HS5 A;  2DB4 A;  1N1C A;  2YHS A;  1AEP A;  5D91 A;  1T6I A;  5KYU A;  5EGY A;  3RFY A;  2NSG A;  3DXJ F;  1TFK B;  1OW7 A;  1CPR A;  1YLM A;  2CNW A;  2XLV A;  1XZP A;  3HNL A;  2XS1 A;  3JRM O;  4D4X A;  1JAF A;  4HFF B;  1Y4C A;  2W4B A;  4DBR A;  2R7T A;  3K1I C;  4UDV A;  1ZW3 A;  4PJL A;  4WGY A;  1ZW2 A;  4IAQ A;  2LFF A;  2UUI A;  4Z9H A;  2A0B A;  4JJF A;  3VM6 A;  5KYW B;  2IYL D;  3QVZ A;  2CGE A;  4AK9 A;  2WVO A;  3GAN A;  3TJ5 A;  4A4A A;  1S05 A;  1JPN A;  3K66 A;  4ULV A;  4EBK A;  5AGF A;  3TJ6 A;  5CI8 A;  2TMV P;  3EJN A;  3Q7G A;  4CS9 C;  3DMD A;  1Z3I X;  1D0Z A;  2VAS A;  1A0B A;  3L8I A;  4U9E A;  4XTK A;  3C7J A;  3GOD A;  3HNJ A;  1YZA A;  1TWC A;  2WZF A;  1Z5Z A;  4JTA B;  3SXZ A;  2ICW G;  2RSE B;  3AG3 C;  4XPX A;  5L0D A;  2L9J A;  3T6G B;  4BJ5 A;  2J8W A;  1V54 C;  3QW1 A;  1LE2 A;  1OCR C;  1QSP A;  3MYF A;  4IB4 A;  1DOV A;  2AWY A;  2EIL C;  5E3C A;  3LES A;  4CDY A;  4QI0 A;  2LCH A;  2R7Q A;  3ITF A;  3O10 A;  3U9J A;  3K7D A;  1Y6D A;  2I15 A;  3UMI A;  4AE4 B;  5DLJ A;  1AVO B;  4H4K C;  1BDJ B;  4WJ0 A;  4KNV A;  2NSF A;  3NDB B;  3I5Q A;  3AOU A;  1U6H A;  2J0X A;  1MMN A;  1E2X A;  2Q9C A;  4JE9 A;  4JTD B;  2KQ9 A;  3QMK A;  4DRI B;  4M63 A;  3O6X A;  4BJ6 C;  1WOL A;  3TD7 A;  1WAS A;  3WHN A;  5B1B C;  2OKU A;  3A9C A;  3M1C B;  1YJG A;  3LAY A;  1H9G A;  3GM1 A;  3JSZ A;  1Z7Q c;  2NUP B;  2YLD A;  2PP4 A;  2WVQ A;  2OU6 A;  1AUE A;  1JMW A;  1ZZP A;  2ZPA A;  3TOL A;  4JCZ A;  2R7S A;  1KNY A;  4J7T A;  5COM A;  2YL3 A;  2BE5 F;  2XL8 A;  1A7D A;  2Y3B A;  2Z15 A;  4LER A;  3B9Q A;  2MHR A;  1I5N A;  2X51 A;  3JTL O;  3H65 A;  4JW1 A;  3I4U A;  1BZ4 A;  4YN0 B;  4NTB A;  1RCP A;  2ZXR A;  3B29 A;  3RVY A;  5E33 A;  1ZVZ A;  5COF A;  3S29 A;  2VCB A;  2Y69 C;  3N2Z B;  3EGX B;  4EBJ A;  1JPJ A;  3IHU A;  4GQH A;  4LDQ A;  3T9O A;  3ASN C;  2KW3 C;  3QTH A;  3CAX A;  5KYU B;  1EA8 A;  2CNW D;  2KNH A;  4EUK B;  4IGG A;  1PD1 A;  2P1A A;  3SEO A;  3HNI A;  1OR2 A;  4ONS A;  1FTS A;  2ETS A;  4O6M A;  2YKZ A;  3IQC A;  4JEB A;  4XEF A;  5DS5 A;  1TWH A;  2J9B A;  1K05 A;  4J30 B;  2H7B A;  4DVY P;  3ZQY A;  3PHF 2;  1VYI A;  2XL6 A;  4PJM A;  1M57 C;  2A6H F;  4H54 A;  3KPH A;  2YEV A;  2VCA A;  4ANJ A;  5JS5 A;  4CSA A;  2R7U A;  1VK5 A;  1J8Y F;  4PJN A;  1VOM A;  1Q0G A;  2Q4F A;  2H8A A;  4GYT A;  4HEA J;  4LAC B;  2V26 A;  4RDA A;  3W2V A;  4CS8 C;  2CCY A;  4FX5 A;  4ULW A;  4AE4 A;  1JOG A;  3ZVR A;  4C3B A;  4CBE A;  5JLI A;  4XLP F;  1V4A A;  1M6T A;  3NRH A;  1S7Z A;  3WAQ A;  5A6B A;  3QVY A;  4MW8 A;  1O87 A;  2A1D D;  3G50 A;  2J9V A;  3DZA A;  2ASR A;  2YL0 A;  4MVO A;  3C8G B;  2C04 A;  1ZU5 A;  4Q4Z F;  2Y3G A;  2QE9 A;  4J32 B;  1MNE A;  2CW0 F;  4YL1 A;  3RQG A;  4YT4 A;  1CPQ A;  1UG7 A;  4O79 A;  3ZG1 A;  4BG0 A;  5L3Q A;  3S0X A;  4DRH B;  2YL1 A;  3UGP A;  1RJ9 A;  4XQ1 A;  1A41 A;  4EHP A;  3NKE A;  4N4W A;  4YK5 A;  1ZHW A;  1U0B B;  4JVS A;  3GM2 A;  1D0Y A;  3PCV A;  1Q0K A;  2A68 F;  3H2U A;  4O6N A;  1VLS A;  3VRC A;  4CDV A;  1SR2 A;  2XSE A;  3F46 A;  5JT4 A;  4BEM J;  1JRA A;  1M2V B;  1SMY F;  2LD6 A;  2PFD A;  3SNH A;  2B0H A;  1BBH A;  2R03 A;  1QLE C;  1OKK A;  3QW0 A;  4E7Z A;  3POV A;  1BR4 A;  4R32 A;  3NMI A;  1ZHZ A;  2HJ3 A;  3NYL A;  4XPY A;  4ZLD A;  1NSG B;  1WTY A;  3EGX A;  2BC5 A;  1D1C A;  4YL3 A;  4OIN F;  3RH3 A;  5BQH A;  4C3D A;  2W4M A;  4NCQ A;  3ZC4 A;  2A6E F;  1T6Q A;  3ABM C;  1PV3 A;  1NFO A;  2XRH A;  4U5C E;  5A6J A;  4K0D A;  2J9W A;  1NBB A;  2Q9B A;  4P9F A;  4LLC A;  1WWP A;  1MMA A;  4IJJ A;  2CYD A;  1QQ3 A;  3DAG A;  3B0P A;  3W4Y A;  1VMA A;  4E0I A;  2WL8 A;  1SYQ A;  4JC7 A;  2XLD A;  4G7H F;  3CEX A;  3JRT A;  3LEO A;  3S28 A;  1C03 A;  2KC3 A;  2R05 A;  2HMZ A;  3FOP A;  2LSE A;  4ER9 A;  5BQI A;  4D4N A;  3OWT A;  2UUH A;  1CGN A;  2DGJ A;  3AGT A;  3US6 A;  3U8V A;  1LM3 B;  2EIJ C;  3JYY A;  3RQE A;  4EKW A;  1UFB A;  3DAF A;  3LLK A;  1EI7 A;  1QPU A;  3UMH A;  4P6I C;  3MBG A;  2EIN C;  3U2M A;  1RKC A;  1U89 A;  1D1B A;  3K1I A;  1D1A A;  1C02 A;  1J8M F;  3L1M A;  1APC A;  2OEV A;  2LQG A;  4BJ1 A;  3HJC A;  3M4B A;  3MYI A;  2EIK C;  4WGZ A;  1ZHT A;  3C8G A;  2IXM A;  4A2N B;  4EIY A;  4MVU A;  5B3I A;  3FHD A;  4MTG A;  1NLX A;  2KYH A;  4L6R A;  4CS9 A;  5A6B D;  2F22 A;  3GWL A;  1FMV A;  2PX3 A;  4N6C A;  3I5P A;  1K40 A;  5F28 E;  2R25 A;  3WG7 C;  4FAP B;  4MQ9 F;  2IXP A;  2G3V A;  1L3P A;  1V74 B;  5E2Q A;  3C62 A;  5JSL A;  1H9T A;  3N0T A;  4XLN F;  4MVQ A;  2KJG A;  3SXM A;  3J06 A;  1ORJ A;  2AWC A;  2VH3 A;  2ZXW C;  1LKX A;  4CJO A;  2P0N A;  3EH2 A;  4OIP F;  4NC3 A;  1M2V A;  1RJ9 B;  3FDQ A;  2XM0 A;  3DI5 A;  4G0H A;  5HSW A;  3PDM P;  5L0G A;  3EZH A;  1OW6 A;  2LFD A;  2KSF A;  2XLO A;  3VAY A;  3KL4 A;  3U9M A;  1XZQ A;  3G4Z A;  4ZLC A;  2Y3D A;  1Q0F A;  3AQC A;  1YYJ A;  4YJW A;  3RIP A;  2IBF A;  3EG9 A;  2A0U A;  3OA1 A;  1C17 M;  3RQF A;  1CGM E;  1FMW A;  1HE9 A;  3ASO C;  1OKK D;  2JD3 A;  5COG A;  2M64 A;  4PR9 A;  4BJ6 A;  3A11 A;  1HMD A;  1K04 A;  1L7C A;  4E18 A;  3AG4 C;  4E0H A;  3MLG A;  4XPW A;  3ATP A;  3BRJ A;  1YA7 O;  2IXN A;  1GQA A;  1E85 A;  2R9R B;  1I4Z A;  1ZU4 A;  3ABL C;  4FWV A;  4MVM A;  3MX3 A;  1MND A;  1TFO B;  3SXY A;  2GDC A;  3VF0 A;  3RW0 A;  4JZA A;  2Q00 A;  3B71 A;  4MTF A;  1FFH A;  2Y39 A;  1H6G A;  3NKD A;  4NY3 A;  5JP7 A;  2X0C A;  1R5I D;  2L6H A;  2QUP A;  2HJM A;  3C63 A;  1ST6 A;  4X0R A;  5DVW A;  3ZTZ A;  4E17 A;  1EKY A;  4LLE A;  1YAR O;  2EPM X;  2YQY A;  3EH1 A;  1HE1 A;  4Z9J A;  4DJ9 A;  3EHN A;  2OEX A;  5D92 A;  5L3V A;  4KNW A;  1TWA A;  5F5H A;  4BEJ A;  2XM4 A;  3K33 A;  4MVR A;  4DBQ A;  5HV9 A;  4NTA A;  5L0F A;  1RKE A;  3KH2 A;  3NMK A;  1A7V A;  3EHM A;  5FZT A;  2HUJ A;  4NQF A;  3GEE A;  2ZD9 A;  2J45 A;  3G4X A;  2YLG A;  2CDQ A;  4PK4 A;  4CDA A;  3C8G D;  4MND A;  3HNK A;  1E86 A;  1G8X A;  5A69 A;  2I8B A;  1B68 A;  4OD5 A;  1JR8 A;  2D4U A;  5L0I A;  1W2W A;  2YLI A;  1I4Y A;  3ZDL A;  3FMS A;  4OIQ F;  3T6J A;  2WZG A;  4CS8 A;  5CI9 A;  3T6B A;  3AJM A;  3DJN B;  4AL1 A;  4YWQ A;  4CIP A;  2R7W A;  1SF8 A;  2KK1 A;  2NUT B;  3HKK A;  2LIG A;  3JYH A;  3FAP B;  2G62 A;  1PCX A;  256B A;  4U5F E;  3TQO A;  2VCC A;  2JPU A;  3M79 A;  4W8K A;  4IAR A;  4CJG A;  2IOQ A;  4U5G A;  1M56 C;  3L34 A;  4QI2 A;  2WB7 A;  3AG2 C;  2OJQ A;  2MYS A;  3N24 A;  5B1A C;  2JX0 A;  3HLZ A;  4JCH A;  2XS8 A;  4K7B A;  3S9O A;  4YT8 A;  3L0I A;  4F4B A;  5A6A A;  1T01 A;  3MFN A;  2PX0 A;  3E70 C;  4DOZ A;  1VTM P;  1O5H A;  3EG9 B;  1OCC C;  1WN0 A;  2Y3H A;  4IRU A;  4JTC B;  1KU2 A;  1HW2 A;  4YL0 A;  4I3M A;  4C7O A;  2H7O A;  2FGY A;  1BR1 A;  2R7O A;  3DE8 A;  3KKB A;  4RD9 A;  1TKN A;  2OCC C;  1ZYR F;  1YA9 A;  3ECS A;  4XWJ A;  3HTK C;  2H7V C;  1FR0 A;  1FNT c;  3DM9 B;  1NG1 A;  3C18 A;  3GOR A;  3E9V A;  4YT2 A;  4KI2 A;  2EIM C;  3FVY A;  1YZC A;  1YYX A;  3DKA A;  2FFH A;  3LJB A;  3TK0 A;  2KGO A;  2QY9 A;  5DQT A;  3Q6N A;  5T3T A;  3RVZ A;  4BJT A;  1T9K A;  2J0W A;  3U3B A;  3B0V C;  1V55 C;  4U5E E;  3JZ0 A;  1G5Z A;  3OEO A;  4O6Y A;  4RBN A;  1MMG A;  2C03 A;  2XLE A;  2GFH A;  2YVK A;  2PBE A;  4LDK A;  1BR2 A;  3W2W A;  3UMK A;  2AVK A;  1QZX A;  1YDI A;  2P61 A;  1ORS C;  3T4R A;  2EPN A;  1G4W R;  2PF4 E;  3GM3 A;  4J7Y A;  1GS9 A;  5CIV A;  2DYR C;  3GEI A;  5JVE A;  4K1O A;  2OG2 A;  3AGU A;  3IQ5 A;  3LEV A;  5IY5 C;  5L0C A;  3IEE A;  2R7X A;  3NMJ A;  1T5O A;  4HE8 D;  3LLI A;  5GPG B;  3RF3 A;  5DS4 A;  4OIR F;  1EQ1 A;  3H2V A;  1ORY A;  2HSQ A;  3GWN A;  3Q6M A;  5T1D B;  3SP1 A;  1RKE B;  4BJ5 C;  3U5S A;  2P6V A;  1OXK A;  2XLW A;  2GAQ A;  3DE9 A;  3JCU Q;  4AL0 A;  4U5D E;  3EPV A;  1Q0M A;  2IXO A;  3EFO A;  4NTF A;  3ZSU A;  2NUT A;  3PMR A;  5BQG A;  3U2L A;  4PFP A;  2IM8 A;  3AG1 C;  4MW3 A;  3FOO A;  3V7O A;  2YZS A;  1NFN A;  1QVX A;  2DI3 A;  2YRF A;  3EZI A;  3Q7L A;  3UNG C;  2Q9A A;  2VC9 A;  1IW7 F;  2R7V A;  1LE4 A;  3LUT B;  2OJE D;  1YVI A;  1LS4 A;  3DD7 A;  2L7A A;  5KYY B;  3S84 A;  4OD4 A;  5TJ5 E;  4EBB A;  2G3K A;  3RYL A;  2MWQ A;  3S27 A;  5DQZ A;  1E84 A;  5JUA A;  1FAP B;  1HY5 A;  1LVK A;  2R02 A;  3EGD A;  2P7V A;  3IQT A;  3R7C A;  1Z23 A;  5B3S C;  5KYX B;  5F5F A;  1WGW A;  2EPL X;  2HMQ A;  2LK4 A;  4U9D A;  4G7Z F;  2XXA A;  1IZM A;  3FAJ A;  4G7O F;  1H7I A;  4IWB A;  3X2Q C;  3X1O A;  1MQV A;  2NPU A;  2XL4 A;  3RKO F;  1ZHX A;  3K1H A;  2OOC A;  2B0J A;  3AQB A;  1PD0 A;  2L6G A;  4HFK B;  2L6F A;  4W8P A;  3SYN A;  4FES A;  4MVZ A;  1VLT A;  4DVZ A;  2YWA A;  4YT5 A;  2EPK X;  2NG1 A;  2J46 A;  4P9T A;  3V5Y A;  1CGO A;  5BUO A;  3SXK A;  4C7O B;  3VYW A;  3LNR A;  3WOD F;  2BL2 A;  2HFI A;  1HW1 A;  2HV6 A;  3LNM B;  3CSK A;  1NU9 C;  5AC5 A;  2QLA A;  1YAU O; 
#chains in the Genus database with same CATH homology
 3UGO A;  2J7P A;  3LS0 A;  2J9U A;  2E87 A;  1NZE A;  2WZL A;  1NU7 D;  4N06 A;  4CS7 A;  3W8H A;  2QTV A;  1M2O A;  5KYN A;  2WVN A;  5KYW A;  4PJJ A;  1TR2 A;  2A69 F;  4CSA C;  2VB6 A;  4EWC A;  2M4E A;  4GEH A;  3ZIB A;  3UR3 C;  4Q7C A;  2DYS C;  3B0U X;  3JT1 A;  4E7S A;  2ZXP A;  2W45 A;  3SZR A;  2V3C C;  2L81 A;  3CZ6 A;  1Z6A A;  4U5H A;  5KYY A;  4O7G A;  3KMI A;  4B6I A;  3EFO B;  1VYK A;  5T3W A;  3O39 A;  1Z63 A;  1SZI A;  5KYX A;  4I44 A;  3DJU B;  3DM5 A;  5EHH A;  3K6B A;  1OCO C;  3EQL F;  4I1O B;  4QDL A;  3LS1 A;  1FFT C;  3QZC A;  4C3E A;  2O9X A;  3NYM A;  3EGD B;  4I1M A;  2NUP A;  2Q3T A;  4AX2 A;  2XXA B;  2W9Y A;  3ABK C;  3NYJ A;  4KBL A;  1D0X A;  1TWG A;  4CIH A;  3CQZ A;  5DS6 A;  4U5B E;  5E3A A;  2D5R B;  1MMD A;  4JJG A;  4PFO A;  2ZXO A;  1ZHY A;  3F47 A;  2HV7 A;  4Q5S F;  1LS1 A;  3W8I A;  5FCL A;  2J7P D;  1OCZ C;  4KC9 A;  4IAO A;  4JUR I;  2R7R A;  1N1C A;  2YHS A;  5D91 A;  5EGY A;  5KYU A;  3RFY A;  3DXJ F;  2CNW A;  4HFF B;  2W4B A;  4DBR A;  2R7T A;  3K1I C;  4PJL A;  5KYW B;  4JJF A;  2IYL D;  2CGE A;  4AK9 A;  2WVO A;  3GAN A;  1JPN A;  3K66 A;  5CI8 A;  3EJN A;  3Q7G A;  4CS9 C;  3DMD A;  1Z3I X;  1D0Z A;  2VAS A;  4OIO F;  4XTK A;  3GOD A;  1TWC A;  2WZF A;  1Z5Z A;  3AG3 C;  2L9J A;  4BJ5 A;  1V54 C;  1OCR C;  2EIL C;  5E3C A;  3LES A;  4QI0 A;  4AE4 B;  2R7Q A;  3ITF A;  5DLJ A;  3K7D A;  3UMI A;  4YT4 A;  4H4K C;  4WJ0 A;  4KNV A;  3NDB B;  3I5Q A;  2J0X A;  1MMN A;  2Q9C A;  2KQ9 A;  3QMK A;  4M63 A;  3O6X A;  4BJ6 C;  3TD7 A;  5B1B C;  3M1C B;  3LAY A;  3JSZ A;  2NUP B;  2PP4 A;  2WVQ A;  2ZPA A;  2R7S A;  2BE5 F;  2Y3B A;  2Z15 A;  4LER A;  3B9Q A;  2X51 A;  3H65 A;  4JW1 A;  3I4U A;  4YN0 B;  2ZXR A;  5E33 A;  3S29 A;  2Y69 C;  3N2Z B;  3EGX B;  1JPJ A;  3ASN C;  2KW3 C;  5KYU B;  2CNW D;  2KNH A;  1PD1 A;  3SEO A;  1FTS A;  4O6M A;  5DS5 A;  1TWH A;  4J30 B;  3PHF 2;  4DVY P;  2H7B A;  1VYI A;  4PJM A;  1M57 C;  2A6H F;  2YEV A;  4ANJ A;  4CSA A;  2R7U A;  1VK5 A;  1J8Y F;  4PJN A;  1VOM A;  4GYT A;  4HEA J;  4LAC B;  2V26 A;  4RDA A;  3W2V A;  4CS8 C;  4FX5 A;  4AE4 A;  4ULW A;  4CBE A;  4XLP F;  3ZVR A;  4C3B A;  3NRH A;  1S7Z A;  1O87 A;  2A1D D;  2J9V A;  3DZA A;  2C04 A;  1ZU5 A;  4Q4Z F;  2Y3G A;  4J32 B;  1MNE A;  2CW0 F;  3ZG1 A;  4BG0 A;  4O79 A;  5L3Q A;  3S0X A;  3UGP A;  1RJ9 A;  3NKE A;  1ZHW A;  4JVS A;  1D0Y A;  2A68 F;  4O6N A;  2XSE A;  3F46 A;  1SMY F;  1M2V B;  2PFD A;  3SNH A;  1QLE C;  1OKK A;  4E7Z A;  1BR4 A;  1ZHZ A;  3NYL A;  4ZLD A;  3EGX A;  1D1C A;  4OIN F;  3RH3 A;  4C3D A;  2W4M A;  3ZC4 A;  2A6E F;  3ABM C;  2XRH A;  4U5C E;  4K0D A;  2J9W A;  2Q9B A;  4LLC A;  4IJJ A;  1MMA A;  3DAG A;  3B0P A;  1VMA A;  2WL8 A;  4G7H F;  3JRT A;  3S28 A;  2LSE A;  3OWT A;  2DGJ A;  2EIJ C;  3DAF A;  3LLK A;  3UMH A;  4P6I C;  2EIN C;  4EBB A;  1D1B A;  1D1A A;  1J8M F;  4BJ1 A;  3HJC A;  2EIK C;  1ZHT A;  4A2N B;  2IXM A;  3FHD A;  4CS9 A;  1FMV A;  2PX3 A;  3I5P A;  3WG7 C;  4MQ9 F;  2IXP A;  2G3V A;  5E2Q A;  3N0T A;  4XLN F;  2KJG A;  2VH3 A;  2ZXW C;  1LKX A;  3EH2 A;  4OIP F;  3FDQ A;  1M2V A;  1RJ9 B;  4G0H A;  3EZH A;  3VAY A;  3KL4 A;  4ZLC A;  2Y3D A;  3AQC A;  4YJW A;  3RIP A;  3EG9 A;  3OA1 A;  1FMW A;  3ASO C;  1OKK D;  2JD3 A;  4BJ6 A;  3AG4 C;  3MLG A;  2IXN A;  1ZU4 A;  4FWV A;  3ABL C;  3MX3 A;  1MND A;  4JZA A;  1FFH A;  2Y39 A;  3NKD A;  4NY3 A;  1ST6 A;  4X0R A;  5DVW A;  4LLE A;  3EH1 A;  3EHN A;  5D92 A;  5L3V A;  4KNW A;  1TWA A;  5F5H A;  4BEJ A;  3K33 A;  4DBQ A;  3KH2 A;  3EHM A;  4PK4 A;  2J45 A;  2CDQ A;  4MND A;  1G8X A;  2I8B A;  4OD5 A;  1W2W A;  4OIQ F;  3T6J A;  2WZG A;  4CS8 A;  5CI9 A;  3T6B A;  3DJN B;  4YWQ A;  2R7W A;  1SF8 A;  2NUT B;  3JYH A;  2G62 A;  1PCX A;  4U5F E;  4W8K A;  2IOQ A;  4U5G A;  1M56 C;  3L34 A;  4QI2 A;  2WB7 A;  3AG2 C;  2MYS A;  3N24 A;  5B1A C;  3HLZ A;  4JCH A;  4K7B A;  4YT8 A;  3L0I A;  4F4B A;  2PX0 A;  3E70 C;  4DOZ A;  1O5H A;  3EG9 B;  1OCC C;  2Y3H A;  4IRU A;  1KU2 A;  4C7O A;  4I3M A;  2H7O A;  2FGY A;  1BR1 A;  2R7O A;  3KKB A;  4RD9 A;  1TKN A;  2OCC C;  1ZYR F;  3ECS A;  4XWJ A;  3HTK C;  2H7V C;  3DM9 B;  1NG1 A;  3E9V A;  4YT2 A;  4KI2 A;  2EIM C;  3FVY A;  3LJB A;  2FFH A;  2KGO A;  2QY9 A;  5DQT A;  3Q6N A;  5T3T A;  4BJT A;  2J0W A;  3B0V C;  1V55 C;  4U5E E;  3OEO A;  4O6Y A;  4RBN A;  1MMG A;  2C03 A;  2GFH A;  1BR2 A;  3W2W A;  3UMK A;  1QZX A;  3T4R A;  5HSW A;  2PF4 E;  3POV A;  2DYR C;  5IY5 C;  2OG2 A;  3LEV A;  3IEE A;  2R7X A;  5DS4 A;  4HE8 D;  3LLI A;  4OIR F;  3SP1 A;  5T1D B;  3Q6M A;  4BJ5 C;  2P6V A;  3JCU Q;  4U5D E;  3EPV A;  2IXO A;  3EFO A;  3ZSU A;  2NUT A;  3PMR A;  4PFP A;  3AG1 C;  3V7O A;  2YZS A;  3EZI A;  3Q7L A;  3UNG C;  2Q9A A;  1IW7 F;  2R7V A;  3DD7 A;  5KYY B;  4OD4 A;  2G3K A;  3RYL A;  2MWQ A;  3S27 A;  5DQZ A;  1LVK A;  3EGD A;  5B3S C;  2P7V A;  5KYX B;  5F5F A;  1Z23 A;  1WGW A;  2XXA A;  4G7Z F;  1IZM A;  3FAJ A;  4G7O F;  4IWB A;  3X2Q C;  3X1O A;  2XL4 A;  3RKO F;  1ZHX A;  3K1H A;  2B0J A;  3AQB A;  1PD0 A;  4HFK B;  3SYN A;  4FES A;  4DVZ A;  4YT5 A;  2NG1 A;  2J46 A;  5BUO A;  4C7O B;  3VYW A;  3LNR A;  3WOD F;  2HV6 A;  3CSK A;  1NU9 C;  3NG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...