1Z24A

The molecular structure of insecticyanin from the tobacco hornworm manduca sexta l. at 2.6 a resolution.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
189
structure length
189
Chain Sequence
b'GDIFYPGYCPDVKPVNDFDLSAFAGAWHEIAKLPLENENQGKCTIAEYKYDGKKASVYNSFVSNGVKEYMEGDLEIAPDAKYTKQGKYVMTFKFGQRVVNLVPWVLATDYKNYAINYNCDYHPDKKAHSIHAWILSKSKVLEGNTKEVVDNVLKTFSHLIDASKFISNDFSEAACQYSTTYSLTGPDRH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Insecticyanin A form
publication title The molecular structure of insecticyanin from the tobacco hornworm Manduca sexta L. at 2.6 A resolution.
pubmed rcsb
molecule tags Lipid binding protein
total genus 52
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1z24A00
2K62A 3ELZA 4QYNA 3VG5A 3FLLA 1KT4A 2FR2A 4AZPA 1MUPA 4IMNA 1CBQA 1CJ5A 3S26A 1NP1A 2FS6A 3C76X 4KIIA 3TGAA 4NYQA 2X45A 5LJBA 1BLRA 1EW3A 4I3DA 4YGZA 1DV9A 1GT1A 4Y0RA 1QWDA 4IAXA 1L6MA 2L5PA 2CM4A 3KFFA 1DFVA 4ZHCA 5KHPA 3KFGA 3OJYC 2JU7A 5F58A 3F8AA 1QY0A 3PH5A 1QFVA 2AT6X 2ACOA 4M6SA 3TGBA 2LKKA 2LB6A 1BRQA 4A60A 1DZKA 1UZ2X 1B8EA 3ZQ3A 5EDCA 3PEDA 4QYPA 4QGWA 1SY1A 1LKEA 5DG4A 4TKBA 5LJKA 1B0OA 2FTBA 4HPAA 4QGVA 1FE3A 5HTEA 4YFRA 1ZNKA 2MO5A 1QG5A 3HK1A 2KTDA 4UU2A 3NQ9A 4R0BA 3RSWA 4OS0A 1BSOA 2R74A 4O9SA 4BOEA 1BBPA 2HZRA 1QY1A 5HBSA 1E5PA 1QFTA 1YP6A 2LBVA 1ZNDA 3F9DA 2EU7X 3FR4A 1OPAA 5HZ5A 4MVKA 5HA0A 2JU3A 5IO6A 1CRBA 2WQ9A 4A1YA 1FEMA 1R0UA 2G79A 1SXUA 2HLVA 1ALBA 1PEEA 3P6EA 1D2UA 3HWGA 1LIEA 3CQNA 3I17A 2BLGA 1TOUA 4RUUA 4D6AA 2RCQA 5L8OA 2RQ0A 2F73A 2G7BA 2L68A 3NPOA 4M7MA 3VG6A 1ZNHA 4DQ4A 4YH0A 4TNNA 2A0AA 4RUNA 2HYSA 2G78A 3BX8A 2A3FX 3RZYA 1JBHA 4IB8A 4ES7A 4WBKA 4XMHA 3B2KA 1LICA 1X71A 2HMBA 3O22A 1BJ7A 4IAWA 3HWFA 1A18A 2FRSA 5LJEA 1GKAA 1U17A 4GNYA 1BWYA 1A57A 5H8TA 4HPDA 3WVMA 4HPCA 4YDBA 4BQUA 2CBSA 1GGLA 1SY0A 4ORUA 5KICA 1LFOA 4XMGA 4ORSA 3FA8A 1OPBA 2R56A 3WJEA 3U9PC 2WUTA 3ZUOA 3C77X 5LKEA 1EPAA 1KXOA 4A1HA 2OFRX 3CMPA 4CK4A 3EBWA 4A8ZA 1CBIA 1HBQA 3G7XA 3K3LA 3STMX 3P6HA 1U18A 1X8QA 2ASNX 3WXQA 4EFGA 1HMSA 2GC9A 3FA6A 2P8GA 5C0NA 4LZUA 1MDCA 5HCEC 4ZHGA 1KT3A 1G7NA 3FEKA 3KFIA 1N0SA 2A2GA 3VG7A 4TQ2A 4TKJA 3BS2A 3FW4A 2AT0X 1XKIA 1H91A 3BU9A 3UEUA 3MVFA 3NADA 1HBPA 2JOZA 2GJ5A 3FENA 2A2UA 5LJDA 5FFHA 2NP1A 2LFOA 3WJFA 1LF7A 4I9SA 3STNA 1A3YA 2WWPA 2ANSA 4Y0SA 3U03A 3WBGA 1DZMA 3BDRA 1KT7A 4HFOA 1GM6A 3C78X 3P6GA 1O1UA 4ZJ0A 4YDAA 1A2DA 3BY0A 1T0VA 3BRNA 2W2AA 1OEEA 2MJIA 4ORWA 5DPQA 2QO4A 4ZH6A 4XMCA 4LKTA 2FT9A 5IO7A 5EEDA 5H9NA 4XMDA 1TW4A 2FLJA 2WR6A 1BM5A 5HZ8A 2E4JA 2IFBA 3B2IA 2OFMX 2QM9A 5CE4A 4NNTA 4DQ3A 4QGXA 2FR3A 2L9CA 3CQRA 4TKHA 2DM5A 1HMRA 1Z24A 3ELXA 3VG3A 1LNMA 1S7DA 2WEXA 2XSTA 4GETA 2KT4B 1OBPA 4PSQA 1QABE 5H9AA 1B4MA 1O8VA 4IB7A 3UEVA 5LKFA 3FEPA 3VG4A 2HZQA 3D95A 1I04A 3Q6LA 1E02A 3DTQA 1YWAA 2CBRA 4YMYA 1YP7A 4ORXA 1JJJA 3U0DA 5HTDA 1OBQA 4AZQA 1GT5A 1OEKA 2QO5A 3BLGA 3SAOA 4AZOA 3HWEA 3UEWA 2FWVA 3VG2A 3B2HA 1MVGA 4Y0PA 4NLJA 4YKMA 4GRJA 1B56A 3O19A 1I05A 2Q4NA 5EZ2A 5LJHA 3CBCA 3GAQA 4YBPA 3JS1A 4LKPA 3ZUIA 2LBAA 5D8JA 4ALBA 1HMTA 3NR3A 1ICNA 1T8VA 3B2LA 1VPRA 3D96A 3EMMA 5L8NA 1I06A 3DSZA 3PECA 1SY3A 4ORRA 1KQXA 1JZUA 4AZRA 5BVQA 4ZHFA 2XKLA 1EIIA 1LIFA 3D97A 4GE1A 1P6PA 1HQPA 1KGLA 2A13A 1PM1X 2YG2A 4I3CA 1KOIA 2OVAA 4QZUA 3MBTA 5BVTA 5F6BA 1OEJA 4WFUA 4IB6A 4TLJA 5IO5A 1TVQA 1JYDA 1AB0A 4YFQA 4ZHHA 3EBKA 1TOWA 2HNXA 4IB9A 1XCAA 1O1VA 3HWDA 1CBRA 2ACPX 1TXLA 3P6CA 5D47A 1MX7A 2RA6A 2JU8A 1DC9A 3NX1A 1AELA 1FTPA 1ERXA 2X46A 1EPBA 2OZQA 4YGGA 1EIOA 4NNSA 1SXYA 3KQ0A 2QOSC 1ACDA 1YWBA 3APWA 4K19A 4AYHA 5HAEA 3AKMA 1LIBA 5K06A 1NP4A 3CR6A 4UU3A 5HWZA 5H9LA 4GNWA 1BRPA 4ALOA 3PPTA 5AQ6A 2WEWA 4LZVA 4YBUA 4YFPA 2ALLX 4ZFXA 4ARHA 5B27A 4IBAA 1AVGI 3I0AA 2CZUA 1IFBA 2Q9SA 3WJCA 3TGCA 1E00A 1YUPA 1ML7A 4YCEA 3T1DA 1EQDA 1JYJA 2W2BA 2CZTA 4ORYA 4EEJA 1ZNGA 1X8NA 4ZH9A 2AT3X 4HPBA 1X89A 1QY2A 3FIQA 3WJDA 4AZMA 1ZRYA 4N7CA 1PMPA 2Q2PA 3FR5A 1RBPA 4QAEA 3APUA 3P6FA 1X8OA 1GX8A 2R73A 4ZGUA 1VYFA 5FENA 2PY1A 1SXXA 4YCHA 2NNEA 3O2YA 1GXAA 1CBSA 5LJCA 1JV4A 4ZCBA 3FW5A 2NNDA 2AH7X 4TJZA 2OVEA 2W2FA 3NP1A 4I3BA 1G85A 3TF6A 1KQWA 1PBOA 4IMOA 3QKGA 2AT5X 3FELA 3IA8A 5HCDC 4N7DA 4BVMA 1FELA 1UREA 2K23A 4YKOA 2GTFX 1IKEA 1YWDA 1SXWA 5LJGA 2AMMX 5D45A 3NQ3A 1RLBE 1KT5A 2JN3A 5FAZA 1IIUA 1T68X 1ZNLA 4OMWA 5EPQA 4NP1A 3APXA 4NLIA 1AQBA 4MVLA 4ZHDA 3FA9A 5JR8A 1OBUA 4QZTA 3FMZA 1DZPA 4AW8A 1LIDA 3KFHA 2L67A 5KIDA 4ODDA 1GT3A 3PP6A 1SA8A 2MM3A 3IFBA 5L8IA 5B29A 3P6DA 1ICMA 5EEEA 3WJGA 1D3SA 5BVSA 1FDQA 1X8UA 5HA1A 2AL0X 3FA7A 2QO6A 4EDEA 1I4UA 4XMFA 5F7GA 1FENA 5D4AA 5F6ZA 4D6BA 3APVA 1ADLA 5H9KA 1G5WA 1KT6A 1EXSA 3NX2A 2WQAE 1IKJA 1KZWA 1S2PA 1G74A 1U0XA 2O62A 2Q39A 2FS7A 4Y0QA 5F1EA 3L4RA 2RCTA 1MX8A 4WFVA 1ZNEA 3EM0A 4YGHA 4OS3A 4NYRA 4EXZA 1X8PA 1SY2A 2AT8X 3WJBA 3EYCA 3KZAA 4GH7A 1GT4A 3UEXA 5HZ9A 1QQSA 5D48A 4GKCA 1JJXA 2OVDA 1GKAB 1EALA 1IW2A 2AKQA 4AZNA 4I9RA 3STKA 3CBSA 3JSQA 1IFCA 3BSZE 1KZXA 1YWCA 2Q2MA 3BX7A 5EDBA 3TZSA 1LPJA 4OS8A 1E06A 1DF3A 2CM9A 1NGLA 3PH6A 3CWKA 3FR2A 1BSYA 1EUOA 1VYGA 2NNQA 4ZR2A 3B2JA 1S44A 4MVIA 5HCCC 1YIVA 1BEBA 1HN2A 1DZJA 3BU1A 1ERBA 1BSQA 3AKNA 2POAA 5HZ6A 5HZQA 4XMEA 4OMXA 2WSJA 1GX9A 2N93A 2RD7C
chains in the Genus database with same CATH superfamily
2K62A 1SWUA 2BT9A 3ELZA 4QYNA 3VG5A 1HY2A 3FLLA 1KT4A 2RTBB 2FR2A 2IZFB 4AZPA 2M4LA 1MUPA 4IMNA 1CBQA 1N9MA 3ZW0A 1CJ5A 3S26A 1NP1A 1WBIA 2FS6A 3C76X 2OY7A 4GDAA 5B11O 3EC5A 4KIIA 3TGAA 4NYQA 1IJ8A 2X45A 2Z4HA 2C4IA 5L3YA 2FKJA 5LJBA 3NQKA 3SLJA 1BLRA 1EW3A 4I3DA 4YGZA 1DV9A 1GT1A 3EW2A 1QWDA 4Y0RA 4IAXA 1L6MA 1SWOA 2L5PA 2CM4A 3KFFA 1DFVA 4ZHCA 5KHPA 3KFGA 3OJYC 2C1QA 2JU7A 1SWJA 5F58A 3VHHA 2IZDB 4DCBA 2I5VO 3F8AA 1N43A 1QY0A 3PH5A 2GTLM 4JHQA 1QFVA 2AT6X 4O4UA 1VWRB 1KL4A 2ACOA 2UYWA 2LKKA 2RTGB 4M6SA 3TGBA 2LB6A 3RDQA 1BRQA 4A60A 1DZKA 4C5PA 1UZ2X 1B8EA 3ZQ3A 5EDCA 3PEDA 4QYPA 2OVSA 4QGWA 1SWLA 4Z27A 2A5CA 1WUBA 2YMSA 2MWHA 1SY1A 3RDMA 3VHMA 1LKEA 5AEOA 2ZAGA 2OFBA 5DG4A 4TKBA 5LJKA 4DNEA 1B0OA 1RXJA 1SWNA 2FTBA 2RTMA 4HPAA 1UYOX 4CPHA 4QGVA 1LDOA 1FE3A 2X4MA 1ZNKA 4KC8A 5HTEA 1VWIB 4YFRA 2MO5A 1QG5A 3HK1A 2KTDA 4UU2A 3NQ9A 4R0BA 3RSWA 4OS0A 1BSOA 2R74A 4BX5B 2OFAA 4O9SA 4BOEA 1BBPA 2RTLA 2HZRA 1QY1A 5HBSA 3VGWA 1SLFB 2I5ZO 1E5PA 1QFTA 1YP6A 3LV4A 1VWAB 2LBVA 3T6LA 4CV7A 1ZNDA 3F9DA 2EU7X 1HQQA 2MHDA 3FR4A 1OPAA 5HZ5A 3MG5A 1SREA 3PQSA 4MVKA 5HA0A 2X34A 4CPHB 2JU3A 3SZHA 1SWRA 5IO6A 1CRBA 2WQ9A 4A1YA 1FEMA 2GH7A 3RWXA 1R0UA 2G79A 1SXUA 1Y52X 2HLVA 4CPIA 1ALBA 3VPJE 1PEEA 3P6EA 1D2UA 3HWGA 1LIEA 5CSEA 3CQNA 3I17A 2BLGA 4U9CA 1TOUA 4RUUA 4D6AA 2RCQA 5L8OA 2RQ0A 3WZPA 2F73A 2G7BA 2L68A 3NPOA 4M7MA 3VG6A 1ZNHA 4DQ4A 3H3IA 2RTNB 4Z2VA 4YH0A 4TNNA 2A0AA 4RUNA 2HYSA 2G78A 2FGSA 1SLDB 2GTLO 2A3FX 3BX8A 3RBYA 3RZYA 1JBHA 4IB8A 4ES7A 4WBKA 1LCZA 3B2KA 4XMHA 1LICA 1X71A 2HMBA 3O22A 4ON1A 1BJ7A 4GGRA 4IAWA 3HWFA 3ZZVA 1A18A 1GX3A 1LELA 1Y0GA 1GKAA 2FRSA 1U17A 5LJEA 2Y3FA 4GNYA 4KC7A 1BWYA 4FGIB 1A57A 5H8TA 4HPDA 3WYPA 1MM9A 1JIWI 2IZHB 3WVMA 4HPCA 4JNJA 1Y9LA 4YDBA 4BQUA 3N91A 2CBSA 1I9HA 1GGLA 5CHKA 1SY0A 3JQOA 4ORUA 5KICA 1LFOA 4ML7B 3ZI8A 4XMGA 4ORSA 4GUZA 4LQZA 3FA8A 4O49A 1OPBA 1SWHA 2R56A 3WJEA 3U9PC 2WUTA 3ZUOA 3C77X 5LKEA 1KXOA 1EPAA 4A1HA 2OFRX 3CMPA 4BX6A 3OE3A 4CK4A 2JGSA 1STSB 2IZEB 4U8UM 3EBWA 3LTWA 4A8ZA 1CBIA 1HBQA 1SWCA 3G7XA 4U3QA 1JJUA 3K3LA 3STMX 4INNA 1VWJB 2BC3A 3P6HA 1U18A 2F01A 2OY8A 1X8QA 3WZOA 2ASNX 3F6ZB 3WXQA 4MEEA 3P02A 4EFGA 1HMSA 4O3WA 2GC9A 3FA6A 1LCVA 2P8GA 2FHNX 5FQ6E 5C0NA 4LZUA 4KCAA 1MDCA 5HCEC 4BX6B 4ZHGA 1KT3A 4OELA 3ZW1A 1G7NA 3FEKA 3KFIA 3S60A 2RTHB 2AVIA 5IRWA 1N0SA 2A2GA 3VG7A 4TQ2A 4CPEA 4TKJA 3SOTA 3BS2A 3FW4A 2AT0X 5FQ7E 1XKIA 1SRHA 1H91A 1VWFB 3MX7A 3BU9A 3UEUA 3MVFA 3NADA 1HBPA 3ZW1B 2JOZA 2GJ5A 3FENA 2A2UA 5LJDA 5FFHA 2NP1A 2LFOA 4IABA 3WJFA 1LF7A 4I9SA 3STNA 2BS6A 1A3YA 2WWPA 2ANSA 3VE1A 4Y0SA 3U03A 3WBGA 1DZMA 3BDRA 1KT7A 2A5BA 4HFOA 1GM6A 2IZIA 3C78X 3P6GA 1O1UA 4ZJ0A 4YDAA 1A2DA 3FDCA 1FJ1E 3BY0A 4U8UN 2ZSCA 1T0VA 1MEPA 3BRNA 1HXLA 2KTSA 3PDFA 2W2AA 1OEEA 2MJIA 4ORWA 5DPQA 2QO4A 4ZH6A 2UZ2A 4XMCA 4LKTA 2FT9A 4U8UO 3T2WA 1NDJA 3QQ2A 4Z2OA 5IO7A 5EEDA 4CDEA 2AF5A 4CDDA 5H9NA 4XMDA 1TW4A 2FLJA 4COTA 2WR6A 1BM5A 5HZ8A 2RTDB 4FBRA 1SMPI 4WHIA 4BX5A 2E4JA 2IFBA 3B2IA 2OFMX 4L1NA 2QM9A 5CE4A 4NNTA 4BX7A 4QGXA 4DQ3A 2FR3A 3WOVA 2L9CA 3CQRA 4TKHA 2DM5A 1HMRA 4OKAA 1Z24A 3ELXA 3SLOA 4YVBA 3VG3A 2RTCB 2OL6O 1JMXA 1LNMA 1S7DA 2DJFA 2WEXA 2XSTA 4GETA 2KT4B 1OBPA 1SWDA 2OF8A 4PSQA 1QABE 5H9AA 1B4MA 1RSUB 1LDQA 1O8VA 4IB7A 1SWTA 2IZBA 5LKFA 3UEVA 2IZGB 1Y55X 3FEPA 2HZQA 3D95A 3FYFA 4NV7A 3VG4A 4BX7B 1I04A 2MF6A 1E02A 3Q6LA 5B5GA 3DTQA 1YWAA 2CBRA 2RTFB 3RY1A 3V8UA 4YMYA 1YP7A 4ORXA 1JJJA 3U0DA 5HTDA 3VE2A 1OBQA 4AZQA 1GT5A 2G8CO 1OEKA 1HXZA 2QO5A 2QMIA 3BLGA 4FQBB 3SAOA 4OEMA 4AZOA 3HWEA 3UEWA 2FWVA 2VFBA 3VG2A 3B2HA 1MVGA 4Y0PA 4EKVA 4NLJA 4YKMA 1SWBA 4GRJA 3RE6A 2X8FA 5IXGA 5B2AO 2GTLN 1B56A 2IZJA 3O19A 2G5LA 5B10O 1I05A 2Q4NA 3OD9A 5EZ2A 4CDFA 5LJHA 3CBCA 3GAQA 4YBPA 3JS1A 4LKPA 2RTKA 3ZUIA 3CKGA 2LBAA 5D8JA 4ALBA 1PBYA 4MISA 1LUQA 1HMTA 3GE2A 4B55A 3NR3A 1AVEA 1ICNA 2KW1A 4QAEA 1T8VA 3B2LA 1VPRA 2IZAA 3D96A 3EMMA 1I06A 3WYQA 5L8NA 2JMBA 3DSZA 3PECA 4O4XA 4GGTA 4BBOA 1SY3A 4Z2PA 1DF8A 4GK9A 4ORRA 1KQXA 1KFFA 2IZKA 4AZRA 1VWPB 5BVQA 3LHNA 4ZHFA 2XKLA 1JZUA 2Y32A 1Y9TA 1EIIA 1LIFA 3D97A 4GE1A 1P6PA 1HQPA 3FIDA 1KGLA 2IZCB 2A13A 5FQ8E 1PM1X 4BJ8A 2YG2A 4I3CA 1KOIA 1STPA 2OVAA 3MBTA 4QZUA 5F6BA 5BVTA 3RE5A 1OEJA 4WFUA 4IB6A 4TLJA 5HZ9A 5IO5A 4I60A 1TVQA 1JYDA 1AB0A 4YFQA 4ZHHA 3EBKA 2X8TA 1TOWA 2HNXA 4IB9A 1XCAA 1KL5A 2PI3O 1SLEB 4CPFA 1O1VA 3HWDA 1CBRA 4O3ZA 2ACPX 1TXLA 3P6CA 3D4RA 5D47A 1MX7A 1N9YA 2RA6A 3UAQA 2JU8A 4AYHA 1DC9A 3NX1A 1AELA 1FTPA 1ERXA 1PTSA 2X46A 1EPBA 4Y59A 2OZQA 4YGGA 2OL7A 1NC9A 1VWOB 1SRJA 1EIOA 4NNSA 1SXYA 3T6FA 3KQ0A 2QOSC 1ACDA 1YWBA 1SWGA 2RTJA 3APWA 4K19A 3AKMA 1AVDA 1LIBA 1RXKA 4GD9A 1NP4A 3CR6A 3WZNA 4ZGFA 5K06A 4UU3A 3HTYA 2X32A 5HWZA 5H9LA 5CYBA 4GNWA 1BRPA 4GJVA 4ALOA 3PPTA 4PJ2A 1JMZA 5AQ6A 2WEWA 4LZVA 4YBUA 4YFPA 2ALLX 4ZFXA 4ARHA 4Y5DA 5B27A 5IRAA 4IBAA 1AVGI 3HOEA 3SZIA 3ZWEA 3I0AA 2CZUA 4GJSA 2RTOB 1IFBA 2Q9SA 3WJCA 3TGCA 3AEHA 1E00A 1YUPA 1ML7A 4YCEA 5K68A 4O3YA 3T1DA 1SWKA 1EQDA 1JYJA 2W2BA 2CZTA 4ORYA 4EEJA 1ZNGA 1X8NA 4ZH9A 2AT3X 1W6FA 4HPBA 3SLTA 1X89A 2OF9A 1QY2A 1Y53X 3FIQA 2Y3EA 3WJDA 4AZMA 1SWEA 1ZRYA 4N7CA 4QQ1A 5AJBA 4I95A 2RTQB 1SWSA 1PMPA 1VWQB 1VWHB 2Q2PA 5BYPA 3VU1A 1SWFA 1RBPA 2BSZA 3FR5A 3APUA 1JQPA 3OBLA 3P6FA 1X8OA 1N7YA 3PQUA 1GX8A 2R73A 5F2BA 3X00A 4ZGUA 4JGLA 5B5FA 1VWBB 1VYFA 2RTIB 4NV8A 1UYNX 3Q34A 5FENA 2PY1A 2X56A 3D9WA 1SXXA 4GDZA 2VFCA 4YCHA 2NNEA 3O2YA 1GXAA 4GZVA 1CBSA 1KL3A 1MK5A 5LJCA 1NQMA 1JV4A 3ZW0B 4Z6JA 3RKGA 4ZCBA 3RDSA 3FW5A 2NNDA 2RTPB 1SWQA 2AH7X 3AUMO 4TJZA 2OVEA 2W2FA 3NP1A 4I3BA 1G85A 4U46A 3TF6A 1KQWA 1PBOA 4IMOA 4FBOA 3QKGA 4O4OA 2AT5X 4MVEA 4O3XB 1VWNB 2HKDA 3CKFA 3FELA 3IA8A 4EQAC 4JO6A 1EI5A 5HCDC 3SZJA 1VYOA 4N7DA 5B3MO 4CDCA 4BVMA 1FELA 1UREA 2K23A 2OY1O 2GTFX 3P24A 4YKOA 1IKEA 1YWDA 2LA7A 1SXWA 5LJGA 2AMMX 2IZLB 4HWMA 2A8GA 5D45A 3NQ3A 2VDFA 1RLBE 1KT5A 2JN3A 5FAZA 1IIUA 1T68X 3RY2A 1ZNLA 4OMWA 5EPQA 2KD2A 4NP1A 1RXHA 3S5VA 3APXA 3NBXX 4NLIA 1AQBA 2FKGA 2QCBA 4MVLA 4ZHDA 1SWPA 4GGZA 3FA9A 5JR8A 1OBUA 4QZTA 1SRGA 5K67A 1K24A 2DJGA 3FMZA 1DZPA 4AW8A 1LIDA 3MM0A 4O4SA 1VWMB 4L3RA 1SLGB 3KFHA 1VWDB 2OY5O 2L67A 1E2TA 4QRLA 5KIDA 3RDXA 4ODDA 1GT3A 4MIRA 3PP6A 1SA8A 2MM3A 2X55A 3IFBA 5L8IA 1NQNA 2QOMA 5B29A 4FBVA 3T2XA 3P6DA 4KT5A 1ICMA 4ID2A 5EEEA 2BS5A 2JW1A 5IRUA 1LCWA 1D3SA 3WJGA 5BVSA 1X8UA 1FDQA 1SRFA 1STRB 2AL0X 2QO6A 3FA7A 1I4UA 5HA1A 4BCSA 4EDEA 4XMFA 5F7GA 1FENA 5D4AA 1VWLB 5F6ZA 4D6BA 3APVA 1ADLA 5H9KA 1G5WA 1KT6A 1EXSA 3NX2A 1RAVA 1OSPO 2WQAE 2RTEB 2Z4IA 2RTRB 1IKJA 2OL8O 1SWAA 2F09A 1S2PA 4IRWA 1G74A 1KZWA 1U0XA 2O62A 2Q39A 2FS7A 3VHIA 4Y0QA 2X8SA 5F1EA 3L4RA 5JD2A 2RCTA 4Z28A 2RTAA 1MX8A 4WFVA 1W5RA 1ZNEA 2BHVA 3EM0A 4YGHA 4OS3A 4NYRA 1NBXA 1X8PA 4EXZA 1SY2A 2AT8X 3E3CA 3EYCA 3RDUA 3WJBA 3KZAA 4GH7A 1GT4A 2CAMA 3UEXA 3EW1A 1QQSA 5D48A 4GKCA 3WZQA 3ZW2A 1JJXA 2OVDA 1GKAB 1EALA 1IW2A 2AKQA 4AZNA 4I9RA 3STKA 3PK2A 1I78A 2C1SA 3CBSA 1IFCA 3BSZE 3JSQA 2FHLA 4KH8A 1KZXA 1W4TA 1YWCA 2Q2MA 2WPUA 2ZAIA 3BX7A 5EDBA 1SRIA 3TZSA 1LPJA 4OS8A 1E06A 1VWGB 1DF3A 2CM9A 1VWKB 4GU8A 4NW4A 1RSTB 1NGLA 3RDOA 3PH6A 4BGFA 3CWKA 3FR2A 5HAEA 1BSYA 1MOYA 1EUOA 1VYGA 2NNQA 4ZR2A 1VWEB 3B2JA 1S44A 4MVIA 1K3BA 4I6SA 5HCCC 2RN4A 4QNIA 1YIVA 1VWCB 3HOLA 1BEBA 1HN2A 1DZJA 3KVNA 3BU1A 3S5XA 1ERBA 2OYBO 1BSQA 3AKNA 2POAA 5HZ6A 5HZQA 4CSBA 4XMEA 3HPEA 1N4JA 4OMXA 2WSJA 1GX9A 2N93A 5AJCA 2RD7C
chains in the Genus database with same CATH topology
2K62A 3ELZA 2BT9A 4QYNA 3VG5A 3FLLA 1KT4A 2FR2A 4AZPA 2M4LA 1MUPA 4IMNA 1CBQA 3ZW0A 1CJ5A 3S26A 1NP1A 2FS6A 3C76X 4KIIA 3TGAA 4NYQA 2X45A 2Z4HA 5LJBA 3NQKA 1BLRA 1EW3A 4I3DA 4YGZA 1DV9A 1GT1A 4Y0RA 1QWDA 4IAXA 1L6MA 2L5PA 2CM4A 3KFFA 1DFVA 4ZHCA 5KHPA 3KFGA 3OJYC 2JU7A 5F58A 3F8AA 1QY0A 3PH5A 2GTLM 1QFVA 2AT6X 4O4UA 2ACOA 4M6SA 3TGBA 2LKKA 2LB6A 1BRQA 4A60A 1DZKA 1UZ2X 1B8EA 3ZQ3A 5EDCA 3PEDA 4QYPA 2OVSA 4QGWA 2YMSA 2MWHA 1SY1A 1LKEA 5AEOA 2ZAGA 5DG4A 4TKBA 5LJKA 1B0OA 2FTBA 4HPAA 4QGVA 1FE3A 5HTEA 4KC8A 1ZNKA 4YFRA 2MO5A 1QG5A 3HK1A 2KTDA 4UU2A 3NQ9A 4R0BA 3RSWA 4OS0A 1BSOA 2R74A 4O9SA 4BOEA 1BBPA 2HZRA 1QY1A 5HBSA 1E5PA 1QFTA 1YP6A 3LV4A 4CV7A 2LBVA 1ZNDA 3F9DA 2EU7X 3FR4A 2MHDA 1OPAA 5HZ5A 4MVKA 3PQSA 5HA0A 2JU3A 5IO6A 1CRBA 2WQ9A 4A1YA 1FEMA 3RWXA 1R0UA 2G79A 1SXUA 2HLVA 1ALBA 3VPJE 1PEEA 3P6EA 1D2UA 3HWGA 1LIEA 3CQNA 3I17A 2BLGA 4U9CA 1TOUA 4RUUA 4D6AA 2RCQA 5L8OA 2RQ0A 2F73A 2G7BA 2L68A 3NPOA 4M7MA 3VG6A 1ZNHA 4DQ4A 3H3IA 4YH0A 4TNNA 2A0AA 4RUNA 2HYSA 2G78A 2GTLO 2A3FX 3BX8A 3RBYA 3RZYA 1JBHA 4IB8A 4ES7A 4WBKA 4XMHA 3B2KA 1LICA 1X71A 2HMBA 3O22A 4ON1A 1BJ7A 4IAWA 3HWFA 3ZZVA 1A18A 2FRSA 5LJEA 1GKAA 1U17A 4GNYA 4KC7A 1BWYA 4FGIB 1A57A 5H8TA 4HPDA 1JIWI 3WVMA 4HPCA 1Y9LA 4YDBA 4BQUA 3N91A 2CBSA 1GGLA 1SY0A 3JQOA 4ORUA 5KICA 1LFOA 4ML7B 3ZI8A 4XMGA 4ORSA 4LQZA 3FA8A 4O49A 1OPBA 2R56A 3WJEA 3U9PC 2WUTA 3ZUOA 3C77X 5LKEA 1EPAA 1KXOA 4A1HA 2OFRX 3CMPA 3OE3A 4CK4A 4U8UM 3EBWA 4A8ZA 1CBIA 1HBQA 3G7XA 4U3QA 3K3LA 3STMX 4INNA 3P6HA 1U18A 1X8QA 2ASNX 3F6ZB 3WXQA 3P02A 4EFGA 1HMSA 4O3WA 2GC9A 3FA6A 2P8GA 5FQ6E 5C0NA 4LZUA 4KCAA 1MDCA 5HCEC 4ZHGA 1KT3A 3ZW1A 1G7NA 3FEKA 3KFIA 3S60A 1N0SA 2A2GA 3VG7A 4TQ2A 4TKJA 3SOTA 3BS2A 3FW4A 2AT0X 5FQ7E 1XKIA 1H91A 3MX7A 3BU9A 3UEUA 3MVFA 3NADA 1HBPA 3ZW1B 2JOZA 2GJ5A 3FENA 2A2UA 5LJDA 5FFHA 2NP1A 2LFOA 3WJFA 1LF7A 4I9SA 3STNA 2BS6A 1A3YA 2WWPA 2ANSA 3VE1A 4Y0SA 3U03A 3WBGA 1DZMA 3BDRA 1KT7A 4HFOA 1GM6A 3C78X 3P6GA 1O1UA 4ZJ0A 4YDAA 1A2DA 3BY0A 4U8UN 1T0VA 3BRNA 2KTSA 2W2AA 1OEEA 2MJIA 4ORWA 5DPQA 2QO4A 4ZH6A 4XMCA 4LKTA 2FT9A 4U8UO 5IO7A 5EEDA 5H9NA 4XMDA 1TW4A 2FLJA 4COTA 2WR6A 1BM5A 5HZ8A 4FBRA 1SMPI 4WHIA 2E4JA 2IFBA 3B2IA 2OFMX 4L1NA 2QM9A 5CE4A 4NNTA 4DQ3A 4QGXA 2FR3A 3WOVA 2L9CA 3CQRA 4TKHA 2DM5A 1HMRA 1Z24A 3ELXA 3VG3A 1LNMA 1S7DA 2WEXA 2XSTA 4GETA 2KT4B 1OBPA 4PSQA 1QABE 5H9AA 1B4MA 1O8VA 4IB7A 3UEVA 5LKFA 3FEPA 3VG4A 2HZQA 3D95A 3FYFA 1I04A 3Q6LA 1E02A 3DTQA 1YWAA 2CBRA 3V8UA 4YMYA 1YP7A 4ORXA 1JJJA 3U0DA 5HTDA 3VE2A 1OBQA 4AZQA 1GT5A 1OEKA 2QO5A 2QMIA 3BLGA 4FQBB 3SAOA 4AZOA 3HWEA 3UEWA 2FWVA 3VG2A 3B2HA 1MVGA 4Y0PA 4NLJA 4YKMA 4GRJA 2X8FA 2GTLN 1B56A 3O19A 1I05A 2Q4NA 3OD9A 5EZ2A 5LJHA 3CBCA 3GAQA 4YBPA 3JS1A 4LKPA 3ZUIA 2LBAA 5D8JA 4ALBA 4MISA 3GE2A 1HMTA 3NR3A 1ICNA 2KW1A 1T8VA 3B2LA 1VPRA 3D96A 3EMMA 5L8NA 1I06A 2JMBA 3DSZA 3PECA 4O4XA 1SY3A 4GK9A 4ORRA 1KQXA 1JZUA 4AZRA 5BVQA 4ZHFA 3LHNA 2XKLA 1Y9TA 1EIIA 1LIFA 3D97A 4GE1A 1P6PA 1HQPA 1KGLA 2A13A 5FQ8E 1PM1X 2YG2A 4I3CA 1KOIA 2OVAA 4QZUA 3MBTA 5BVTA 5F6BA 1OEJA 4WFUA 4IB6A 4TLJA 5IO5A 1TVQA 1JYDA 1AB0A 4YFQA 4ZHHA 3EBKA 2X8TA 1TOWA 2HNXA 4IB9A 1XCAA 1O1VA 3HWDA 1CBRA 4O3ZA 2ACPX 1TXLA 3P6CA 3D4RA 5D47A 1MX7A 2RA6A 3UAQA 2JU8A 1DC9A 3NX1A 1AELA 1FTPA 1ERXA 2X46A 1EPBA 2OZQA 4YGGA 1EIOA 4NNSA 1SXYA 3KQ0A 2QOSC 1ACDA 1YWBA 3APWA 4K19A 4AYHA 5HAEA 3AKMA 1LIBA 4ZGFA 1NP4A 3CR6A 5K06A 4UU3A 3HTYA 5HWZA 5H9LA 5CYBA 4GNWA 1BRPA 4ALOA 3PPTA 4PJ2A 5AQ6A 2WEWA 4LZVA 4YBUA 4YFPA 2ALLX 4ZFXA 4ARHA 5B27A 3ZWEA 4IBAA 1AVGI 3HOEA 3I0AA 2CZUA 1IFBA 2Q9SA 3WJCA 3TGCA 1E00A 1YUPA 1ML7A 4YCEA 4O3YA 3T1DA 1EQDA 1JYJA 2W2BA 2CZTA 4ORYA 4EEJA 1ZNGA 1X8NA 4ZH9A 2AT3X 4HPBA 1X89A 1QY2A 3FIQA 3WJDA 4AZMA 1ZRYA 4N7CA 4QQ1A 5AJBA 4I95A 5BYPA 1PMPA 2Q2PA 3VU1A 3FR5A 1RBPA 4IABA 4QAEA 3APUA 3PQUA 3OBLA 3P6FA 1X8OA 1GX8A 2R73A 4ZGUA 4JGLA 1VYFA 5FENA 2PY1A 1SXXA 4GDZA 4YCHA 2NNEA 3O2YA 1GXAA 4GZVA 1CBSA 5LJCA 1JV4A 3ZW0B 3RKGA 4ZCBA 3FW5A 2NNDA 2AH7X 4TJZA 2OVEA 2W2FA 3NP1A 4I3BA 1G85A 3TF6A 1KQWA 1PBOA 4IMOA 4FBOA 3QKGA 4O4OA 2AT5X 4MVEA 4O3XB 3FELA 3IA8A 4EQAC 1EI5A 5HCDC 4N7DA 4BVMA 1FELA 1UREA 2K23A 3P24A 2GTFX 4YKOA 1IKEA 1YWDA 2LA7A 1SXWA 5LJGA 2AMMX 4HWMA 5D45A 3NQ3A 1RLBE 1KT5A 2JN3A 5FAZA 1IIUA 1T68X 1ZNLA 4OMWA 5EPQA 2KD2A 4NP1A 3S5VA 3APXA 3NBXX 4NLIA 1AQBA 4MVLA 4ZHDA 3FA9A 5JR8A 1OBUA 4QZTA 3FMZA 1DZPA 4AW8A 1LIDA 4O4SA 4L3RA 3KFHA 2L67A 4QRLA 5KIDA 4ODDA 1GT3A 4MIRA 3PP6A 1SA8A 2MM3A 3IFBA 5L8IA 5B29A 4FBVA 3P6DA 4KT5A 1ICMA 4ID2A 5EEEA 2BS5A 2JW1A 3WJGA 1D3SA 5BVSA 1FDQA 1X8UA 5HA1A 2AL0X 3FA7A 2QO6A 4EDEA 1I4UA 4XMFA 5F7GA 1FENA 5D4AA 5F6ZA 4D6BA 3APVA 1ADLA 5H9KA 1G5WA 1KT6A 1EXSA 3NX2A 2WQAE 2Z4IA 1IKJA 2F09A 1KZWA 1S2PA 1G74A 1U0XA 2O62A 2Q39A 2FS7A 4Y0QA 2X8SA 5F1EA 3L4RA 2RCTA 1MX8A 4WFVA 1ZNEA 2BHVA 3EM0A 4YGHA 4OS3A 4NYRA 4EXZA 1X8PA 1SY2A 2AT8X 3E3CA 3EYCA 3WJBA 3KZAA 4GH7A 1GT4A 3UEXA 5HZ9A 1QQSA 5D48A 4GKCA 3ZW2A 1JJXA 2OVDA 1GKAB 1EALA 1IW2A 2AKQA 4AZNA 4I9RA 3STKA 3CBSA 3JSQA 1IFCA 3BSZE 4KH8A 1KZXA 1YWCA 2Q2MA 3BX7A 2ZAIA 5EDBA 3TZSA 1LPJA 4OS8A 1E06A 1DF3A 2CM9A 4GU8A 4NW4A 1NGLA 3PH6A 3CWKA 3FR2A 1BSYA 1EUOA 1VYGA 2NNQA 4ZR2A 3B2JA 1S44A 4MVIA 4I6SA 5HCCC 2RN4A 4QNIA 1YIVA 3HOLA 3S5XA 1BEBA 1HN2A 1DZJA 3BU1A 1ERBA 1BSQA 3AKNA 2POAA 5HZ6A 5HZQA 4CSBA 4XMEA 4OMXA 2WSJA 1GX9A 2N93A 5AJCA 2RD7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K62 A;  3ELZ A;  4QYN A;  3VG5 A;  3FLL A;  1KT4 A;  2FR2 A;  4AZP A;  1MUP A;  4IMN A;  1CBQ A;  1CJ5 A;  3S26 A;  1NP1 A;  2FS6 A;  3C76 X;  4KII A;  3TGA A;  4NYQ A;  2X45 A;  5LJB A;  1BLR A;  1EW3 A;  4I3D A;  4YGZ A;  1DV9 A;  1GT1 A;  4Y0R A;  1QWD A;  4IAX A;  1L6M A;  2L5P A;  2CM4 A;  3KFF A;  1DFV A;  4ZHC A;  5KHP A;  3KFG A;  3OJY C;  2JU7 A;  5F58 A;  3F8A A;  1QY0 A;  3PH5 A;  1QFV A;  2AT6 X;  2ACO A;  4M6S A;  3TGB A;  2LKK A;  2LB6 A;  1BRQ A;  4A60 A;  1DZK A;  1UZ2 X;  1B8E A;  3ZQ3 A;  5EDC A;  3PED A;  4QYP A;  4QGW A;  1SY1 A;  1LKE A;  5DG4 A;  4TKB A;  5LJK A;  1B0O A;  2FTB A;  4HPA A;  4QGV A;  1FE3 A;  5HTE A;  4YFR A;  1ZNK A;  2MO5 A;  1QG5 A;  3HK1 A;  2KTD A;  4UU2 A;  3NQ9 A;  4R0B A;  3RSW A;  4OS0 A;  1BSO A;  2R74 A;  4O9S A;  4BOE A;  1BBP A;  2HZR A;  1QY1 A;  5HBS A;  1E5P A;  1QFT A;  1YP6 A;  2LBV A;  1ZND A;  3F9D A;  2EU7 X;  3FR4 A;  1OPA A;  5HZ5 A;  4MVK A;  5HA0 A;  2JU3 A;  5IO6 A;  1CRB A;  2WQ9 A;  4A1Y A;  1FEM A;  1R0U A;  2G79 A;  1SXU A;  2HLV A;  1ALB A;  1PEE A;  3P6E A;  1D2U A;  3HWG A;  1LIE A;  3CQN A;  3I17 A;  2BLG A;  1TOU A;  4RUU A;  4D6A A;  2RCQ A;  5L8O A;  2RQ0 A;  2F73 A;  2G7B A;  2L68 A;  3NPO A;  4M7M A;  3VG6 A;  1ZNH A;  4DQ4 A;  4YH0 A;  4TNN A;  2A0A A;  4RUN A;  2HYS A;  2G78 A;  3BX8 A;  2A3F X;  3RZY A;  1JBH A;  4IB8 A;  4ES7 A;  4WBK A;  4XMH A;  3B2K A;  1LIC A;  1X71 A;  2HMB A;  3O22 A;  1BJ7 A;  4IAW A;  3HWF A;  1A18 A;  2FRS A;  5LJE A;  1GKA A;  1U17 A;  4GNY A;  1BWY A;  1A57 A;  5H8T A;  4HPD A;  3WVM A;  4HPC A;  4YDB A;  4BQU A;  2CBS A;  1GGL A;  1SY0 A;  4ORU A;  5KIC A;  1LFO A;  4XMG A;  4ORS A;  3FA8 A;  1OPB A;  2R56 A;  3WJE A;  3U9P C;  2WUT A;  3ZUO A;  3C77 X;  5LKE A;  1EPA A;  1KXO A;  4A1H A;  2OFR X;  3CMP A;  4CK4 A;  3EBW A;  4A8Z A;  1CBI A;  1HBQ A;  3G7X A;  3K3L A;  3STM X;  3P6H A;  1U18 A;  1X8Q A;  2ASN X;  3WXQ A;  4EFG A;  1HMS A;  2GC9 A;  3FA6 A;  2P8G A;  5C0N A;  4LZU A;  1MDC A;  5HCE C;  4ZHG A;  1KT3 A;  1G7N A;  3FEK A;  3KFI A;  1N0S A;  2A2G A;  3VG7 A;  4TQ2 A;  4TKJ A;  3BS2 A;  3FW4 A;  2AT0 X;  1XKI A;  1H91 A;  3BU9 A;  3UEU A;  3MVF A;  3NAD A;  1HBP A;  2JOZ A;  2GJ5 A;  3FEN A;  2A2U A;  5LJD A;  5FFH A;  2NP1 A;  2LFO A;  3WJF A;  1LF7 A;  4I9S A;  3STN A;  1A3Y A;  2WWP A;  2ANS A;  4Y0S A;  3U03 A;  3WBG A;  1DZM A;  3BDR A;  1KT7 A;  4HFO A;  1GM6 A;  3C78 X;  3P6G A;  1O1U A;  4ZJ0 A;  4YDA A;  1A2D A;  3BY0 A;  1T0V A;  3BRN A;  2W2A A;  1OEE A;  2MJI A;  4ORW A;  5DPQ A;  2QO4 A;  4ZH6 A;  4XMC A;  4LKT A;  2FT9 A;  5IO7 A;  5EED A;  5H9N A;  4XMD A;  1TW4 A;  2FLJ A;  2WR6 A;  1BM5 A;  5HZ8 A;  2E4J A;  2IFB A;  3B2I A;  2OFM X;  2QM9 A;  5CE4 A;  4NNT A;  4DQ3 A;  4QGX A;  2FR3 A;  2L9C A;  3CQR A;  4TKH A;  2DM5 A;  1HMR A;  1Z24 A;  3ELX A;  3VG3 A;  1LNM A;  1S7D A;  2WEX A;  2XST A;  4GET A;  2KT4 B;  1OBP A;  4PSQ A;  1QAB E;  5H9A A;  1B4M A;  1O8V A;  4IB7 A;  3UEV A;  5LKF A;  3FEP A;  3VG4 A;  2HZQ A;  3D95 A;  1I04 A;  3Q6L A;  1E02 A;  3DTQ A;  1YWA A;  2CBR A;  4YMY A;  1YP7 A;  4ORX A;  1JJJ A;  3U0D A;  5HTD A;  1OBQ A;  4AZQ A;  1GT5 A;  1OEK A;  2QO5 A;  3BLG A;  3SAO A;  4AZO A;  3HWE A;  3UEW A;  2FWV A;  3VG2 A;  3B2H A;  1MVG A;  4Y0P A;  4NLJ A;  4YKM A;  4GRJ A;  1B56 A;  3O19 A;  1I05 A;  2Q4N A;  5EZ2 A;  5LJH A;  3CBC A;  3GAQ A;  4YBP A;  3JS1 A;  4LKP A;  3ZUI A;  2LBA A;  5D8J A;  4ALB A;  1HMT A;  3NR3 A;  1ICN A;  1T8V A;  3B2L A;  1VPR A;  3D96 A;  3EMM A;  5L8N A;  1I06 A;  3DSZ A;  3PEC A;  1SY3 A;  4ORR A;  1KQX A;  1JZU A;  4AZR A;  5BVQ A;  4ZHF A;  2XKL A;  1EII A;  1LIF A;  3D97 A;  4GE1 A;  1P6P A;  1HQP A;  1KGL A;  2A13 A;  1PM1 X;  2YG2 A;  4I3C A;  1KOI A;  2OVA A;  4QZU A;  3MBT A;  5BVT A;  5F6B A;  1OEJ A;  4WFU A;  4IB6 A;  4TLJ A;  5IO5 A;  1TVQ A;  1JYD A;  1AB0 A;  4YFQ A;  4ZHH A;  3EBK A;  1TOW A;  2HNX A;  4IB9 A;  1XCA A;  1O1V A;  3HWD A;  1CBR A;  2ACP X;  1TXL A;  3P6C A;  5D47 A;  1MX7 A;  2RA6 A;  2JU8 A;  1DC9 A;  3NX1 A;  1AEL A;  1FTP A;  1ERX A;  2X46 A;  1EPB A;  2OZQ A;  4YGG A;  1EIO A;  4NNS A;  1SXY A;  3KQ0 A;  2QOS C;  1ACD A;  1YWB A;  3APW A;  4K19 A;  4AYH A;  5HAE A;  3AKM A;  1LIB A;  5K06 A;  1NP4 A;  3CR6 A;  4UU3 A;  5HWZ A;  5H9L A;  4GNW A;  1BRP A;  4ALO A;  3PPT A;  5AQ6 A;  2WEW A;  4LZV A;  4YBU A;  4YFP A;  2ALL X;  4ZFX A;  4ARH A;  5B27 A;  4IBA A;  1AVG I;  3I0A A;  2CZU A;  1IFB A;  2Q9S A;  3WJC A;  3TGC A;  1E00 A;  1YUP A;  1ML7 A;  4YCE A;  3T1D A;  1EQD A;  1JYJ A;  2W2B A;  2CZT A;  4ORY A;  4EEJ A;  1ZNG A;  1X8N A;  4ZH9 A;  2AT3 X;  4HPB A;  1X89 A;  1QY2 A;  3FIQ A;  3WJD A;  4AZM A;  1ZRY A;  4N7C A;  1PMP A;  2Q2P A;  3FR5 A;  1RBP A;  4QAE A;  3APU A;  3P6F A;  1X8O A;  1GX8 A;  2R73 A;  4ZGU A;  1VYF A;  5FEN A;  2PY1 A;  1SXX A;  4YCH A;  2NNE A;  3O2Y A;  1GXA A;  1CBS A;  5LJC A;  1JV4 A;  4ZCB A;  3FW5 A;  2NND A;  2AH7 X;  4TJZ A;  2OVE A;  2W2F A;  3NP1 A;  4I3B A;  1G85 A;  3TF6 A;  1KQW A;  1PBO A;  4IMO A;  3QKG A;  2AT5 X;  3FEL A;  3IA8 A;  5HCD C;  4N7D A;  4BVM A;  1FEL A;  1URE A;  2K23 A;  4YKO A;  2GTF X;  1IKE A;  1YWD A;  1SXW A;  5LJG A;  2AMM X;  5D45 A;  3NQ3 A;  1RLB E;  1KT5 A;  2JN3 A;  5FAZ A;  1IIU A;  1T68 X;  1ZNL A;  4OMW A;  5EPQ A;  4NP1 A;  3APX A;  4NLI A;  1AQB A;  4MVL A;  4ZHD A;  3FA9 A;  5JR8 A;  1OBU A;  4QZT A;  3FMZ A;  1DZP A;  4AW8 A;  1LID A;  3KFH A;  2L67 A;  5KID A;  4ODD A;  1GT3 A;  3PP6 A;  1SA8 A;  2MM3 A;  3IFB A;  5L8I A;  5B29 A;  3P6D A;  1ICM A;  5EEE A;  3WJG A;  1D3S A;  5BVS A;  1FDQ A;  1X8U A;  5HA1 A;  2AL0 X;  3FA7 A;  2QO6 A;  4EDE A;  1I4U A;  4XMF A;  5F7G A;  1FEN A;  5D4A A;  5F6Z A;  4D6B A;  3APV A;  1ADL A;  5H9K A;  1G5W A;  1KT6 A;  1EXS A;  3NX2 A;  2WQA E;  1IKJ A;  1KZW A;  1S2P A;  1G74 A;  1U0X A;  2O62 A;  2Q39 A;  2FS7 A;  4Y0Q A;  5F1E A;  3L4R A;  2RCT A;  1MX8 A;  4WFV A;  1ZNE A;  3EM0 A;  4YGH A;  4OS3 A;  4NYR A;  4EXZ A;  1X8P A;  1SY2 A;  2AT8 X;  3WJB A;  3EYC A;  3KZA A;  4GH7 A;  1GT4 A;  3UEX A;  5HZ9 A;  1QQS A;  5D48 A;  4GKC A;  1JJX A;  2OVD A;  1GKA B;  1EAL A;  1IW2 A;  2AKQ A;  4AZN A;  4I9R A;  3STK A;  3CBS A;  3JSQ A;  1IFC A;  3BSZ E;  1KZX A;  1YWC A;  2Q2M A;  3BX7 A;  5EDB A;  3TZS A;  1LPJ A;  4OS8 A;  1E06 A;  1DF3 A;  2CM9 A;  1NGL A;  3PH6 A;  3CWK A;  3FR2 A;  1BSY A;  1EUO A;  1VYG A;  2NNQ A;  4ZR2 A;  3B2J A;  1S44 A;  4MVI A;  5HCC C;  1YIV A;  1BEB A;  1HN2 A;  1DZJ A;  3BU1 A;  1ERB A;  1BSQ A;  3AKN A;  2POA A;  5HZ6 A;  5HZQ A;  4XME A;  4OMX A;  2WSJ A;  1GX9 A;  2N93 A;  2RD7 C; 
#chains in the Genus database with same CATH topology
 2K62 A;  1SWU A;  2BT9 A;  3ELZ A;  4QYN A;  3VG5 A;  1HY2 A;  3FLL A;  1KT4 A;  2RTB B;  2FR2 A;  2IZF B;  4AZP A;  2M4L A;  1MUP A;  4IMN A;  1CBQ A;  1N9M A;  3ZW0 A;  1CJ5 A;  3S26 A;  1NP1 A;  1WBI A;  2FS6 A;  3C76 X;  2OY7 A;  4GDA A;  5B11 O;  3EC5 A;  4KII A;  3TGA A;  4NYQ A;  1IJ8 A;  2X45 A;  2Z4H A;  2C4I A;  5L3Y A;  2FKJ A;  5LJB A;  3NQK A;  3SLJ A;  1BLR A;  1EW3 A;  4I3D A;  4YGZ A;  1DV9 A;  1GT1 A;  3EW2 A;  1QWD A;  4Y0R A;  4IAX A;  1L6M A;  1SWO A;  2L5P A;  2CM4 A;  3KFF A;  1DFV A;  4ZHC A;  5KHP A;  3KFG A;  3OJY C;  2C1Q A;  2JU7 A;  1SWJ A;  5F58 A;  3VHH A;  2IZD B;  4DCB A;  2I5V O;  3F8A A;  1N43 A;  1QY0 A;  3PH5 A;  2GTL M;  4JHQ A;  1QFV A;  2AT6 X;  4O4U A;  1VWR B;  1KL4 A;  2ACO A;  2UYW A;  2LKK A;  2RTG B;  4M6S A;  3TGB A;  2LB6 A;  3RDQ A;  1BRQ A;  4A60 A;  1DZK A;  4C5P A;  1UZ2 X;  1B8E A;  3ZQ3 A;  5EDC A;  3PED A;  4QYP A;  2OVS A;  4QGW A;  1SWL A;  4Z27 A;  2A5C A;  1WUB A;  2YMS A;  2MWH A;  1SY1 A;  3RDM A;  3VHM A;  1LKE A;  5AEO A;  2ZAG A;  2OFB A;  5DG4 A;  4TKB A;  5LJK A;  4DNE A;  1B0O A;  1RXJ A;  1SWN A;  2FTB A;  2RTM A;  4HPA A;  1UYO X;  4CPH A;  4QGV A;  1LDO A;  1FE3 A;  2X4M A;  1ZNK A;  4KC8 A;  5HTE A;  1VWI B;  4YFR A;  2MO5 A;  1QG5 A;  3HK1 A;  2KTD A;  4UU2 A;  3NQ9 A;  4R0B A;  3RSW A;  4OS0 A;  1BSO A;  2R74 A;  4BX5 B;  2OFA A;  4O9S A;  4BOE A;  1BBP A;  2RTL A;  2HZR A;  1QY1 A;  5HBS A;  3VGW A;  1SLF B;  2I5Z O;  1E5P A;  1QFT A;  1YP6 A;  3LV4 A;  1VWA B;  2LBV A;  3T6L A;  4CV7 A;  1ZND A;  3F9D A;  2EU7 X;  1HQQ A;  2MHD A;  3FR4 A;  1OPA A;  5HZ5 A;  3MG5 A;  1SRE A;  3PQS A;  4MVK A;  5HA0 A;  2X34 A;  4CPH B;  2JU3 A;  3SZH A;  1SWR A;  5IO6 A;  1CRB A;  2WQ9 A;  4A1Y A;  1FEM A;  2GH7 A;  3RWX A;  1R0U A;  2G79 A;  1SXU A;  1Y52 X;  2HLV A;  4CPI A;  1ALB A;  3VPJ E;  1PEE A;  3P6E A;  1D2U A;  3HWG A;  1LIE A;  5CSE A;  3CQN A;  3I17 A;  2BLG A;  4U9C A;  1TOU A;  4RUU A;  4D6A A;  2RCQ A;  5L8O A;  2RQ0 A;  3WZP A;  2F73 A;  2G7B A;  2L68 A;  3NPO A;  4M7M A;  3VG6 A;  1ZNH A;  4DQ4 A;  3H3I A;  2RTN B;  4Z2V A;  4YH0 A;  4TNN A;  2A0A A;  4RUN A;  2HYS A;  2G78 A;  2FGS A;  1SLD B;  2GTL O;  2A3F X;  3BX8 A;  3RBY A;  3RZY A;  1JBH A;  4IB8 A;  4ES7 A;  4WBK A;  1LCZ A;  3B2K A;  4XMH A;  1LIC A;  1X71 A;  2HMB A;  3O22 A;  4ON1 A;  1BJ7 A;  4GGR A;  4IAW A;  3HWF A;  3ZZV A;  1A18 A;  1GX3 A;  1LEL A;  1Y0G A;  1GKA A;  2FRS A;  1U17 A;  5LJE A;  2Y3F A;  4GNY A;  4KC7 A;  1BWY A;  4FGI B;  1A57 A;  5H8T A;  4HPD A;  3WYP A;  1MM9 A;  1JIW I;  2IZH B;  3WVM A;  4HPC A;  4JNJ A;  1Y9L A;  4YDB A;  4BQU A;  3N91 A;  2CBS A;  1I9H A;  1GGL A;  5CHK A;  1SY0 A;  3JQO A;  4ORU A;  5KIC A;  1LFO A;  4ML7 B;  3ZI8 A;  4XMG A;  4ORS A;  4GUZ A;  4LQZ A;  3FA8 A;  4O49 A;  1OPB A;  1SWH A;  2R56 A;  3WJE A;  3U9P C;  2WUT A;  3ZUO A;  3C77 X;  5LKE A;  1KXO A;  1EPA A;  4A1H A;  2OFR X;  3CMP A;  4BX6 A;  3OE3 A;  4CK4 A;  2JGS A;  1STS B;  2IZE B;  4U8U M;  3EBW A;  3LTW A;  4A8Z A;  1CBI A;  1HBQ A;  1SWC A;  3G7X A;  4U3Q A;  1JJU A;  3K3L A;  3STM X;  4INN A;  1VWJ B;  2BC3 A;  3P6H A;  1U18 A;  2F01 A;  2OY8 A;  1X8Q A;  3WZO A;  2ASN X;  3F6Z B;  3WXQ A;  4MEE A;  3P02 A;  4EFG A;  1HMS A;  4O3W A;  2GC9 A;  3FA6 A;  1LCV A;  2P8G A;  2FHN X;  5FQ6 E;  5C0N A;  4LZU A;  4KCA A;  1MDC A;  5HCE C;  4BX6 B;  4ZHG A;  1KT3 A;  4OEL A;  3ZW1 A;  1G7N A;  3FEK A;  3KFI A;  3S60 A;  2RTH B;  2AVI A;  5IRW A;  1N0S A;  2A2G A;  3VG7 A;  4TQ2 A;  4CPE A;  4TKJ A;  3SOT A;  3BS2 A;  3FW4 A;  2AT0 X;  5FQ7 E;  1XKI A;  1SRH A;  1H91 A;  1VWF B;  3MX7 A;  3BU9 A;  3UEU A;  3MVF A;  3NAD A;  1HBP A;  3ZW1 B;  2JOZ A;  2GJ5 A;  3FEN A;  2A2U A;  5LJD A;  5FFH A;  2NP1 A;  2LFO A;  4IAB A;  3WJF A;  1LF7 A;  4I9S A;  3STN A;  2BS6 A;  1A3Y A;  2WWP A;  2ANS A;  3VE1 A;  4Y0S A;  3U03 A;  3WBG A;  1DZM A;  3BDR A;  1KT7 A;  2A5B A;  4HFO A;  1GM6 A;  2IZI A;  3C78 X;  3P6G A;  1O1U A;  4ZJ0 A;  4YDA A;  1A2D A;  3FDC A;  1FJ1 E;  3BY0 A;  4U8U N;  2ZSC A;  1T0V A;  1MEP A;  3BRN A;  1HXL A;  2KTS A;  3PDF A;  2W2A A;  1OEE A;  2MJI A;  4ORW A;  5DPQ A;  2QO4 A;  4ZH6 A;  2UZ2 A;  4XMC A;  4LKT A;  2FT9 A;  4U8U O;  3T2W A;  1NDJ A;  3QQ2 A;  4Z2O A;  5IO7 A;  5EED A;  4CDE A;  2AF5 A;  4CDD A;  5H9N A;  4XMD A;  1TW4 A;  2FLJ A;  4COT A;  2WR6 A;  1BM5 A;  5HZ8 A;  2RTD B;  4FBR A;  1SMP I;  4WHI A;  4BX5 A;  2E4J A;  2IFB A;  3B2I A;  2OFM X;  4L1N A;  2QM9 A;  5CE4 A;  4NNT A;  4BX7 A;  4QGX A;  4DQ3 A;  2FR3 A;  3WOV A;  2L9C A;  3CQR A;  4TKH A;  2DM5 A;  1HMR A;  4OKA A;  1Z24 A;  3ELX A;  3SLO A;  4YVB A;  3VG3 A;  2RTC B;  2OL6 O;  1JMX A;  1LNM A;  1S7D A;  2DJF A;  2WEX A;  2XST A;  4GET A;  2KT4 B;  1OBP A;  1SWD A;  2OF8 A;  4PSQ A;  1QAB E;  5H9A A;  1B4M A;  1RSU B;  1LDQ A;  1O8V A;  4IB7 A;  1SWT A;  2IZB A;  5LKF A;  3UEV A;  2IZG B;  1Y55 X;  3FEP A;  2HZQ A;  3D95 A;  3FYF A;  4NV7 A;  3VG4 A;  4BX7 B;  1I04 A;  2MF6 A;  1E02 A;  3Q6L A;  5B5G A;  3DTQ A;  1YWA A;  2CBR A;  2RTF B;  3RY1 A;  3V8U A;  4YMY A;  1YP7 A;  4ORX A;  1JJJ A;  3U0D A;  5HTD A;  3VE2 A;  1OBQ A;  4AZQ A;  1GT5 A;  2G8C O;  1OEK A;  1HXZ A;  2QO5 A;  2QMI A;  3BLG A;  4FQB B;  3SAO A;  4OEM A;  4AZO A;  3HWE A;  3UEW A;  2FWV A;  2VFB A;  3VG2 A;  3B2H A;  1MVG A;  4Y0P A;  4EKV A;  4NLJ A;  4YKM A;  1SWB A;  4GRJ A;  3RE6 A;  2X8F A;  5IXG A;  5B2A O;  2GTL N;  1B56 A;  2IZJ A;  3O19 A;  2G5L A;  5B10 O;  1I05 A;  2Q4N A;  3OD9 A;  5EZ2 A;  4CDF A;  5LJH A;  3CBC A;  3GAQ A;  4YBP A;  3JS1 A;  4LKP A;  2RTK A;  3ZUI A;  3CKG A;  2LBA A;  5D8J A;  4ALB A;  1PBY A;  4MIS A;  1LUQ A;  1HMT A;  3GE2 A;  4B55 A;  3NR3 A;  1AVE A;  1ICN A;  2KW1 A;  4QAE A;  1T8V A;  3B2L A;  1VPR A;  2IZA A;  3D96 A;  3EMM A;  1I06 A;  3WYQ A;  5L8N A;  2JMB A;  3DSZ A;  3PEC A;  4O4X A;  4GGT A;  4BBO A;  1SY3 A;  4Z2P A;  1DF8 A;  4GK9 A;  4ORR A;  1KQX A;  1KFF A;  2IZK A;  4AZR A;  1VWP B;  5BVQ A;  3LHN A;  4ZHF A;  2XKL A;  1JZU A;  2Y32 A;  1Y9T A;  1EII A;  1LIF A;  3D97 A;  4GE1 A;  1P6P A;  1HQP A;  3FID A;  1KGL A;  2IZC B;  2A13 A;  5FQ8 E;  1PM1 X;  4BJ8 A;  2YG2 A;  4I3C A;  1KOI A;  1STP A;  2OVA A;  3MBT A;  4QZU A;  5F6B A;  5BVT A;  3RE5 A;  1OEJ A;  4WFU A;  4IB6 A;  4TLJ A;  5HZ9 A;  5IO5 A;  4I60 A;  1TVQ A;  1JYD A;  1AB0 A;  4YFQ A;  4ZHH A;  3EBK A;  2X8T A;  1TOW A;  2HNX A;  4IB9 A;  1XCA A;  1KL5 A;  2PI3 O;  1SLE B;  4CPF A;  1O1V A;  3HWD A;  1CBR A;  4O3Z A;  2ACP X;  1TXL A;  3P6C A;  3D4R A;  5D47 A;  1MX7 A;  1N9Y A;  2RA6 A;  3UAQ A;  2JU8 A;  4AYH A;  1DC9 A;  3NX1 A;  1AEL A;  1FTP A;  1ERX A;  1PTS A;  2X46 A;  1EPB A;  4Y59 A;  2OZQ A;  4YGG A;  2OL7 A;  1NC9 A;  1VWO B;  1SRJ A;  1EIO A;  4NNS A;  1SXY A;  3T6F A;  3KQ0 A;  2QOS C;  1ACD A;  1YWB A;  1SWG A;  2RTJ A;  3APW A;  4K19 A;  3AKM A;  1AVD A;  1LIB A;  1RXK A;  4GD9 A;  1NP4 A;  3CR6 A;  3WZN A;  4ZGF A;  5K06 A;  4UU3 A;  3HTY A;  2X32 A;  5HWZ A;  5H9L A;  5CYB A;  4GNW A;  1BRP A;  4GJV A;  4ALO A;  3PPT A;  4PJ2 A;  1JMZ A;  5AQ6 A;  2WEW A;  4LZV A;  4YBU A;  4YFP A;  2ALL X;  4ZFX A;  4ARH A;  4Y5D A;  5B27 A;  5IRA A;  4IBA A;  1AVG I;  3HOE A;  3SZI A;  3ZWE A;  3I0A A;  2CZU A;  4GJS A;  2RTO B;  1IFB A;  2Q9S A;  3WJC A;  3TGC A;  3AEH A;  1E00 A;  1YUP A;  1ML7 A;  4YCE A;  5K68 A;  4O3Y A;  3T1D A;  1SWK A;  1EQD A;  1JYJ A;  2W2B A;  2CZT A;  4ORY A;  4EEJ A;  1ZNG A;  1X8N A;  4ZH9 A;  2AT3 X;  1W6F A;  4HPB A;  3SLT A;  1X89 A;  2OF9 A;  1QY2 A;  1Y53 X;  3FIQ A;  2Y3E A;  3WJD A;  4AZM A;  1SWE A;  1ZRY A;  4N7C A;  4QQ1 A;  5AJB A;  4I95 A;  2RTQ B;  1SWS A;  1PMP A;  1VWQ B;  1VWH B;  2Q2P A;  5BYP A;  3VU1 A;  1SWF A;  1RBP A;  2BSZ A;  3FR5 A;  3APU A;  1JQP A;  3OBL A;  3P6F A;  1X8O A;  1N7Y A;  3PQU A;  1GX8 A;  2R73 A;  5F2B A;  3X00 A;  4ZGU A;  4JGL A;  5B5F A;  1VWB B;  1VYF A;  2RTI B;  4NV8 A;  1UYN X;  3Q34 A;  5FEN A;  2PY1 A;  2X56 A;  3D9W A;  1SXX A;  4GDZ A;  2VFC A;  4YCH A;  2NNE A;  3O2Y A;  1GXA A;  4GZV A;  1CBS A;  1KL3 A;  1MK5 A;  5LJC A;  1NQM A;  1JV4 A;  3ZW0 B;  4Z6J A;  3RKG A;  4ZCB A;  3RDS A;  3FW5 A;  2NND A;  2RTP B;  1SWQ A;  2AH7 X;  3AUM O;  4TJZ A;  2OVE A;  2W2F A;  3NP1 A;  4I3B A;  1G85 A;  4U46 A;  3TF6 A;  1KQW A;  1PBO A;  4IMO A;  4FBO A;  3QKG A;  4O4O A;  2AT5 X;  4MVE A;  4O3X B;  1VWN B;  2HKD A;  3CKF A;  3FEL A;  3IA8 A;  4EQA C;  4JO6 A;  1EI5 A;  5HCD C;  3SZJ A;  1VYO A;  4N7D A;  5B3M O;  4CDC A;  4BVM A;  1FEL A;  1URE A;  2K23 A;  2OY1 O;  2GTF X;  3P24 A;  4YKO A;  1IKE A;  1YWD A;  2LA7 A;  1SXW A;  5LJG A;  2AMM X;  2IZL B;  4HWM A;  2A8G A;  5D45 A;  3NQ3 A;  2VDF A;  1RLB E;  1KT5 A;  2JN3 A;  5FAZ A;  1IIU A;  1T68 X;  3RY2 A;  1ZNL A;  4OMW A;  5EPQ A;  2KD2 A;  4NP1 A;  1RXH A;  3S5V A;  3APX A;  3NBX X;  4NLI A;  1AQB A;  2FKG A;  2QCB A;  4MVL A;  4ZHD A;  1SWP A;  4GGZ A;  3FA9 A;  5JR8 A;  1OBU A;  4QZT A;  1SRG A;  5K67 A;  1K24 A;  2DJG A;  3FMZ A;  1DZP A;  4AW8 A;  1LID A;  3MM0 A;  4O4S A;  1VWM B;  4L3R A;  1SLG B;  3KFH A;  1VWD B;  2OY5 O;  2L67 A;  1E2T A;  4QRL A;  5KID A;  3RDX A;  4ODD A;  1GT3 A;  4MIR A;  3PP6 A;  1SA8 A;  2MM3 A;  2X55 A;  3IFB A;  5L8I A;  1NQN A;  2QOM A;  5B29 A;  4FBV A;  3T2X A;  3P6D A;  4KT5 A;  1ICM A;  4ID2 A;  5EEE A;  2BS5 A;  2JW1 A;  5IRU A;  1LCW A;  1D3S A;  3WJG A;  5BVS A;  1X8U A;  1FDQ A;  1SRF A;  1STR B;  2AL0 X;  2QO6 A;  3FA7 A;  1I4U A;  5HA1 A;  4BCS A;  4EDE A;  4XMF A;  5F7G A;  1FEN A;  5D4A A;  1VWL B;  5F6Z A;  4D6B A;  3APV A;  1ADL A;  5H9K A;  1G5W A;  1KT6 A;  1EXS A;  3NX2 A;  1RAV A;  1OSP O;  2WQA E;  2RTE B;  2Z4I A;  2RTR B;  1IKJ A;  2OL8 O;  1SWA A;  2F09 A;  1S2P A;  4IRW A;  1G74 A;  1KZW A;  1U0X A;  2O62 A;  2Q39 A;  2FS7 A;  3VHI A;  4Y0Q A;  2X8S A;  5F1E A;  3L4R A;  5JD2 A;  2RCT A;  4Z28 A;  2RTA A;  1MX8 A;  4WFV A;  1W5R A;  1ZNE A;  2BHV A;  3EM0 A;  4YGH A;  4OS3 A;  4NYR A;  1NBX A;  1X8P A;  4EXZ A;  1SY2 A;  2AT8 X;  3E3C A;  3EYC A;  3RDU A;  3WJB A;  3KZA A;  4GH7 A;  1GT4 A;  2CAM A;  3UEX A;  3EW1 A;  1QQS A;  5D48 A;  4GKC A;  3WZQ A;  3ZW2 A;  1JJX A;  2OVD A;  1GKA B;  1EAL A;  1IW2 A;  2AKQ A;  4AZN A;  4I9R A;  3STK A;  3PK2 A;  1I78 A;  2C1S A;  3CBS A;  1IFC A;  3BSZ E;  3JSQ A;  2FHL A;  4KH8 A;  1KZX A;  1W4T A;  1YWC A;  2Q2M A;  2WPU A;  2ZAI A;  3BX7 A;  5EDB A;  1SRI A;  3TZS A;  1LPJ A;  4OS8 A;  1E06 A;  1VWG B;  1DF3 A;  2CM9 A;  1VWK B;  4GU8 A;  4NW4 A;  1RST B;  1NGL A;  3RDO A;  3PH6 A;  4BGF A;  3CWK A;  3FR2 A;  5HAE A;  1BSY A;  1MOY A;  1EUO A;  1VYG A;  2NNQ A;  4ZR2 A;  1VWE B;  3B2J A;  1S44 A;  4MVI A;  1K3B A;  4I6S A;  5HCC C;  2RN4 A;  4QNI A;  1YIV A;  1VWC B;  3HOL A;  1BEB A;  1HN2 A;  1DZJ A;  3KVN A;  3BU1 A;  3S5X A;  1ERB A;  2OYB O;  1BSQ A;  3AKN A;  2POA A;  5HZ6 A;  5HZQ A;  4CSB A;  4XME A;  3HPE A;  1N4J A;  4OMX A;  2WSJ A;  1GX9 A;  2N93 A;  5AJC A;  2RD7 C; 
#chains in the Genus database with same CATH homology
 2K62 A;  3ELZ A;  2BT9 A;  4QYN A;  3VG5 A;  3FLL A;  1KT4 A;  2FR2 A;  4AZP A;  2M4L A;  1MUP A;  4IMN A;  1CBQ A;  3ZW0 A;  1CJ5 A;  3S26 A;  1NP1 A;  2FS6 A;  3C76 X;  4KII A;  3TGA A;  4NYQ A;  2X45 A;  2Z4H A;  5LJB A;  3NQK A;  1BLR A;  1EW3 A;  4I3D A;  4YGZ A;  1DV9 A;  1GT1 A;  4Y0R A;  1QWD A;  4IAX A;  1L6M A;  2L5P A;  2CM4 A;  3KFF A;  1DFV A;  4ZHC A;  5KHP A;  3KFG A;  3OJY C;  2JU7 A;  5F58 A;  3F8A A;  1QY0 A;  3PH5 A;  2GTL M;  1QFV A;  2AT6 X;  4O4U A;  2ACO A;  4M6S A;  3TGB A;  2LKK A;  2LB6 A;  1BRQ A;  4A60 A;  1DZK A;  1UZ2 X;  1B8E A;  3ZQ3 A;  5EDC A;  3PED A;  4QYP A;  2OVS A;  4QGW A;  2YMS A;  2MWH A;  1SY1 A;  1LKE A;  5AEO A;  2ZAG A;  5DG4 A;  4TKB A;  5LJK A;  1B0O A;  2FTB A;  4HPA A;  4QGV A;  1FE3 A;  5HTE A;  4KC8 A;  1ZNK A;  4YFR A;  2MO5 A;  1QG5 A;  3HK1 A;  2KTD A;  4UU2 A;  3NQ9 A;  4R0B A;  3RSW A;  4OS0 A;  1BSO A;  2R74 A;  4O9S A;  4BOE A;  1BBP A;  2HZR A;  1QY1 A;  5HBS A;  1E5P A;  1QFT A;  1YP6 A;  3LV4 A;  4CV7 A;  2LBV A;  1ZND A;  3F9D A;  2EU7 X;  3FR4 A;  2MHD A;  1OPA A;  5HZ5 A;  4MVK A;  3PQS A;  5HA0 A;  2JU3 A;  5IO6 A;  1CRB A;  2WQ9 A;  4A1Y A;  1FEM A;  3RWX A;  1R0U A;  2G79 A;  1SXU A;  2HLV A;  1ALB A;  3VPJ E;  1PEE A;  3P6E A;  1D2U A;  3HWG A;  1LIE A;  3CQN A;  3I17 A;  2BLG A;  4U9C A;  1TOU A;  4RUU A;  4D6A A;  2RCQ A;  5L8O A;  2RQ0 A;  2F73 A;  2G7B A;  2L68 A;  3NPO A;  4M7M A;  3VG6 A;  1ZNH A;  4DQ4 A;  3H3I A;  4YH0 A;  4TNN A;  2A0A A;  4RUN A;  2HYS A;  2G78 A;  2GTL O;  2A3F X;  3BX8 A;  3RBY A;  3RZY A;  1JBH A;  4IB8 A;  4ES7 A;  4WBK A;  4XMH A;  3B2K A;  1LIC A;  1X71 A;  2HMB A;  3O22 A;  4ON1 A;  1BJ7 A;  4IAW A;  3HWF A;  3ZZV A;  1A18 A;  2FRS A;  5LJE A;  1GKA A;  1U17 A;  4GNY A;  4KC7 A;  1BWY A;  4FGI B;  1A57 A;  5H8T A;  4HPD A;  1JIW I;  3WVM A;  4HPC A;  1Y9L A;  4YDB A;  4BQU A;  3N91 A;  2CBS A;  1GGL A;  1SY0 A;  3JQO A;  4ORU A;  5KIC A;  1LFO A;  4ML7 B;  3ZI8 A;  4XMG A;  4ORS A;  4LQZ A;  3FA8 A;  4O49 A;  1OPB A;  2R56 A;  3WJE A;  3U9P C;  2WUT A;  3ZUO A;  3C77 X;  5LKE A;  1EPA A;  1KXO A;  4A1H A;  2OFR X;  3CMP A;  3OE3 A;  4CK4 A;  4U8U M;  3EBW A;  4A8Z A;  1CBI A;  1HBQ A;  3G7X A;  4U3Q A;  3K3L A;  3STM X;  4INN A;  3P6H A;  1U18 A;  1X8Q A;  2ASN X;  3F6Z B;  3WXQ A;  3P02 A;  4EFG A;  1HMS A;  4O3W A;  2GC9 A;  3FA6 A;  2P8G A;  5FQ6 E;  5C0N A;  4LZU A;  4KCA A;  1MDC A;  5HCE C;  4ZHG A;  1KT3 A;  3ZW1 A;  1G7N A;  3FEK A;  3KFI A;  3S60 A;  1N0S A;  2A2G A;  3VG7 A;  4TQ2 A;  4TKJ A;  3SOT A;  3BS2 A;  3FW4 A;  2AT0 X;  5FQ7 E;  1XKI A;  1H91 A;  3MX7 A;  3BU9 A;  3UEU A;  3MVF A;  3NAD A;  1HBP A;  3ZW1 B;  2JOZ A;  2GJ5 A;  3FEN A;  2A2U A;  5LJD A;  5FFH A;  2NP1 A;  2LFO A;  3WJF A;  1LF7 A;  4I9S A;  3STN A;  2BS6 A;  1A3Y A;  2WWP A;  2ANS A;  3VE1 A;  4Y0S A;  3U03 A;  3WBG A;  1DZM A;  3BDR A;  1KT7 A;  4HFO A;  1GM6 A;  3C78 X;  3P6G A;  1O1U A;  4ZJ0 A;  4YDA A;  1A2D A;  3BY0 A;  4U8U N;  1T0V A;  3BRN A;  2KTS A;  2W2A A;  1OEE A;  2MJI A;  4ORW A;  5DPQ A;  2QO4 A;  4ZH6 A;  4XMC A;  4LKT A;  2FT9 A;  4U8U O;  5IO7 A;  5EED A;  5H9N A;  4XMD A;  1TW4 A;  2FLJ A;  4COT A;  2WR6 A;  1BM5 A;  5HZ8 A;  4FBR A;  1SMP I;  4WHI A;  2E4J A;  2IFB A;  3B2I A;  2OFM X;  4L1N A;  2QM9 A;  5CE4 A;  4NNT A;  4DQ3 A;  4QGX A;  2FR3 A;  3WOV A;  2L9C A;  3CQR A;  4TKH A;  2DM5 A;  1HMR A;  1Z24 A;  3ELX A;  3VG3 A;  1LNM A;  1S7D A;  2WEX A;  2XST A;  4GET A;  2KT4 B;  1OBP A;  4PSQ A;  1QAB E;  5H9A A;  1B4M A;  1O8V A;  4IB7 A;  3UEV A;  5LKF A;  3FEP A;  3VG4 A;  2HZQ A;  3D95 A;  3FYF A;  1I04 A;  3Q6L A;  1E02 A;  3DTQ A;  1YWA A;  2CBR A;  3V8U A;  4YMY A;  1YP7 A;  4ORX A;  1JJJ A;  3U0D A;  5HTD A;  3VE2 A;  1OBQ A;  4AZQ A;  1GT5 A;  1OEK A;  2QO5 A;  2QMI A;  3BLG A;  4FQB B;  3SAO A;  4AZO A;  3HWE A;  3UEW A;  2FWV A;  3VG2 A;  3B2H A;  1MVG A;  4Y0P A;  4NLJ A;  4YKM A;  4GRJ A;  2X8F A;  2GTL N;  1B56 A;  3O19 A;  1I05 A;  2Q4N A;  3OD9 A;  5EZ2 A;  5LJH A;  3CBC A;  3GAQ A;  4YBP A;  3JS1 A;  4LKP A;  3ZUI A;  2LBA A;  5D8J A;  4ALB A;  4MIS A;  3GE2 A;  1HMT A;  3NR3 A;  1ICN A;  2KW1 A;  1T8V A;  3B2L A;  1VPR A;  3D96 A;  3EMM A;  5L8N A;  1I06 A;  2JMB A;  3DSZ A;  3PEC A;  4O4X A;  1SY3 A;  4GK9 A;  4ORR A;  1KQX A;  1JZU A;  4AZR A;  5BVQ A;  4ZHF A;  3LHN A;  2XKL A;  1Y9T A;  1EII A;  1LIF A;  3D97 A;  4GE1 A;  1P6P A;  1HQP A;  1KGL A;  2A13 A;  5FQ8 E;  1PM1 X;  2YG2 A;  4I3C A;  1KOI A;  2OVA A;  4QZU A;  3MBT A;  5BVT A;  5F6B A;  1OEJ A;  4WFU A;  4IB6 A;  4TLJ A;  5IO5 A;  1TVQ A;  1JYD A;  1AB0 A;  4YFQ A;  4ZHH A;  3EBK A;  2X8T A;  1TOW A;  2HNX A;  4IB9 A;  1XCA A;  1O1V A;  3HWD A;  1CBR A;  4O3Z A;  2ACP X;  1TXL A;  3P6C A;  3D4R A;  5D47 A;  1MX7 A;  2RA6 A;  3UAQ A;  2JU8 A;  1DC9 A;  3NX1 A;  1AEL A;  1FTP A;  1ERX A;  2X46 A;  1EPB A;  2OZQ A;  4YGG A;  1EIO A;  4NNS A;  1SXY A;  3KQ0 A;  2QOS C;  1ACD A;  1YWB A;  3APW A;  4K19 A;  4AYH A;  5HAE A;  3AKM A;  1LIB A;  4ZGF A;  1NP4 A;  3CR6 A;  5K06 A;  4UU3 A;  3HTY A;  5HWZ A;  5H9L A;  5CYB A;  4GNW A;  1BRP A;  4ALO A;  3PPT A;  4PJ2 A;  5AQ6 A;  2WEW A;  4LZV A;  4YBU A;  4YFP A;  2ALL X;  4ZFX A;  4ARH A;  5B27 A;  3ZWE A;  4IBA A;  1AVG I;  3HOE A;  3I0A A;  2CZU A;  1IFB A;  2Q9S A;  3WJC A;  3TGC A;  1E00 A;  1YUP A;  1ML7 A;  4YCE A;  4O3Y A;  3T1D A;  1EQD A;  1JYJ A;  2W2B A;  2CZT A;  4ORY A;  4EEJ A;  1ZNG A;  1X8N A;  4ZH9 A;  2AT3 X;  4HPB A;  1X89 A;  1QY2 A;  3FIQ A;  3WJD A;  4AZM A;  1ZRY A;  4N7C A;  4QQ1 A;  5AJB A;  4I95 A;  5BYP A;  1PMP A;  2Q2P A;  3VU1 A;  3FR5 A;  1RBP A;  4IAB A;  4QAE A;  3APU A;  3PQU A;  3OBL A;  3P6F A;  1X8O A;  1GX8 A;  2R73 A;  4ZGU A;  4JGL A;  1VYF A;  5FEN A;  2PY1 A;  1SXX A;  4GDZ A;  4YCH A;  2NNE A;  3O2Y A;  1GXA A;  4GZV A;  1CBS A;  5LJC A;  1JV4 A;  3ZW0 B;  3RKG A;  4ZCB A;  3FW5 A;  2NND A;  2AH7 X;  4TJZ A;  2OVE A;  2W2F A;  3NP1 A;  4I3B A;  1G85 A;  3TF6 A;  1KQW A;  1PBO A;  4IMO A;  4FBO A;  3QKG A;  4O4O A;  2AT5 X;  4MVE A;  4O3X B;  3FEL A;  3IA8 A;  4EQA C;  1EI5 A;  5HCD C;  4N7D A;  4BVM A;  1FEL A;  1URE A;  2K23 A;  3P24 A;  2GTF X;  4YKO A;  1IKE A;  1YWD A;  2LA7 A;  1SXW A;  5LJG A;  2AMM X;  4HWM A;  5D45 A;  3NQ3 A;  1RLB E;  1KT5 A;  2JN3 A;  5FAZ A;  1IIU A;  1T68 X;  1ZNL A;  4OMW A;  5EPQ A;  2KD2 A;  4NP1 A;  3S5V A;  3APX A;  3NBX X;  4NLI A;  1AQB A;  4MVL A;  4ZHD A;  3FA9 A;  5JR8 A;  1OBU A;  4QZT A;  3FMZ A;  1DZP A;  4AW8 A;  1LID A;  4O4S A;  4L3R A;  3KFH A;  2L67 A;  4QRL A;  5KID A;  4ODD A;  1GT3 A;  4MIR A;  3PP6 A;  1SA8 A;  2MM3 A;  3IFB A;  5L8I A;  5B29 A;  4FBV A;  3P6D A;  4KT5 A;  1ICM A;  4ID2 A;  5EEE A;  2BS5 A;  2JW1 A;  3WJG A;  1D3S A;  5BVS A;  1FDQ A;  1X8U A;  5HA1 A;  2AL0 X;  3FA7 A;  2QO6 A;  4EDE A;  1I4U A;  4XMF A;  5F7G A;  1FEN A;  5D4A A;  5F6Z A;  4D6B A;  3APV A;  1ADL A;  5H9K A;  1G5W A;  1KT6 A;  1EXS A;  3NX2 A;  2WQA E;  2Z4I A;  1IKJ A;  2F09 A;  1KZW A;  1S2P A;  1G74 A;  1U0X A;  2O62 A;  2Q39 A;  2FS7 A;  4Y0Q A;  2X8S A;  5F1E A;  3L4R A;  2RCT A;  1MX8 A;  4WFV A;  1ZNE A;  2BHV A;  3EM0 A;  4YGH A;  4OS3 A;  4NYR A;  4EXZ A;  1X8P A;  1SY2 A;  2AT8 X;  3E3C A;  3EYC A;  3WJB A;  3KZA A;  4GH7 A;  1GT4 A;  3UEX A;  5HZ9 A;  1QQS A;  5D48 A;  4GKC A;  3ZW2 A;  1JJX A;  2OVD A;  1GKA B;  1EAL A;  1IW2 A;  2AKQ A;  4AZN A;  4I9R A;  3STK A;  3CBS A;  3JSQ A;  1IFC A;  3BSZ E;  4KH8 A;  1KZX A;  1YWC A;  2Q2M A;  3BX7 A;  2ZAI A;  5EDB A;  3TZS A;  1LPJ A;  4OS8 A;  1E06 A;  1DF3 A;  2CM9 A;  4GU8 A;  4NW4 A;  1NGL A;  3PH6 A;  3CWK A;  3FR2 A;  1BSY A;  1EUO A;  1VYG A;  2NNQ A;  4ZR2 A;  3B2J A;  1S44 A;  4MVI A;  4I6S A;  5HCC C;  2RN4 A;  4QNI A;  1YIV A;  3HOL A;  3S5X A;  1BEB A;  1HN2 A;  1DZJ A;  3BU1 A;  1ERB A;  1BSQ A;  3AKN A;  2POA A;  5HZ6 A;  5HZQ A;  4CSB A;  4XME A;  4OMX A;  2WSJ A;  1GX9 A;  2N93 A;  5AJC A;  2RD7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...