1Z29A

Crystal structures of sult1a2 and sult1a1*3: implications in the bioactivation of n-hydroxy-2-acetylamino fluorine (oh-aaf)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
288
structure length
281
Chain Sequence
SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenol-sulfating phenol sulfotransferase 2
publication title Crystal structures of SULT1A2 and SULT1A1 *3: insights into the substrate inhibition and the role of Tyr149 in SULT1A2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 281
sequence length 288
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z29A00
1G5RA 3B1WA 1OIVA 2G1JA 1W5SA 2RCNA 2FOLA 4LWZA 1NVXQ 1II8B 1TEXA 3GLHA 3HP1A 2EQBA 3KQHA 1S0UA 1SHKA 3NDPA 1JQJC 1P2UA 5E7MA 2V7QA 2ZS9A 4FI3C 2JLXA 4GFDA 1P6XA 3I1FA 2QGZA 3EIHA 5EE3A 3K8YA 1A1VA 4LHZA 4EJSA 4RZ3A 1DO0A 1N5LA 1E1RD 4FCVA 2QTHA 3EZ2A 2BCGY 5AUPB 5J4HA 5JWOA 4HDOB 3O8DA 1QG4A 3K0SA 2A5FA 5FR1A 1J99A 1KI2A 4RD0A 5EQTA 2ZSEA 3C14C 3QXCA 4LV8B 3MWJA 3O8RA 4LJ5A 2PCJA 5HE8A 3HR7A 1QDEA 2VQSA 2QU8A 2WVJA 2NO9A 4PHGA 1BIFA 4UQOA 3GEHA 1R0WA 3GJ0A 1NBMD 1E79A 5DI3A 1P62B 1DG3A 4GP6A 2AXNA 3BGWA 3BOSA 4E22A 1RIFA 1P7CA 1ZC3A 4QJ5A 1GNPA 2Q3FA 3OFNA 5FBRB 4URXR 2O8EA 4TMXA 4KLZA 4FW9A 1CTQA 2PBRA 4TTRA 4B2LA 1CJMA 2BEJA 3E1SA 1GOTA 3FKSA 5TMPA 4X8MA 1ZU4A 4RZXA 2J0VA 4OI2A 1Z29A 2O0JA 4B33A 2R62A 3TVTA 4PXAA 1E9RA 1R8SA 2CLSA 1AA9A 5EXXA 1ELOA 4Z1MA 1G5PA 2ODEA 1SKQA 3KJEA 5DISB 5SZHB 2H18A 1KGDA 1XJCA 3W5IA 1MOZA 1MRNA 1UKZA 1P9WA 4MKGA 4IOMA 4BFVA 5C46F 5AJVB 4DZZA 1WBBA 1NKSA 4DLYA 1JEDA 4KODA 4HB3A 1L4YA 1VIYA 2GKSA 4QBHA 4X8OA 1S9DA 4LSGA 3UKDA 4XTRA 3UMFA 4DCTA 3N70A 1LVGA 1QVAA 3N5CA 4XVRA 1NRJB 2HEIA 3BIFA 2YJTD 3LQRA 4NHOA 4DEYA 2O8BA 2C9YA 3QG1A 4BFXA 3OE7A 2ZSDA 1XNJA 4QHTA 4C2UA 3Q5EA 1G3RA 1KI1A 4OK3A 4CZ2A 3QKRA 4MGZR 3TUIC 4HZUB 3GLFE 2J7PD 1DTSA 2ZI6A 4C7OB 4O3MA 1I4TD 3VR3A 1XJ0A 4BZXA 1I2DA 1E9EA 2ECKA 4WW0A 2ZSBA 1SQ5A 2QAGA 5FTJA 4Q9IA 3HWSA 4Q4LA 1IM2A 4OBEA 4DCSA 3SYKA 4GDFA 2JAQA 2B92A 2YWGA 4BFUA 3EX7C 1WDTA 1P2SA 1OV4A 2CCGA 4URYR 4Q00A 2ZJZA 1G3IA 2OESA 3EAQA 1T9HA 3JZAA 3RRYA 3BFXA 4ON9A 3RDPA 1YR9A 1OFHA 1GNQA 1PLJA 4FMBB 1S96A 5KOYA 3UPUA 1UF9A 1OXXK 1R6BX 2IYXA 3BRWD 1E2EA 1VCMA 3KQUA 2WV9A 1HA3A 1NY6A 2AHOA 1O3YA 1T5LA 3A4MA 1YZUA 3K53A 4Q1EA 1OIXA 5LD2C 1G7TA 3IHWA 4OJQA 1KY3A 2C98A 4ESVA 1EK0A 1COWA 4RZ2A 1IJEA 4Q1AA 5F98A 5IK2A 5TDHA 1OLOA 4BWYA 3L43A 1SHZA 5H8WA 1R10A 4Q4JB 3GPLA 5IF9A 1VMAA 2CL6X 1XB2A 5FFMA 3ZQJA 2JJ1A 3OHMA 3LX5A 4QM7A 1EFUA 5E3HA 3S1AB 2E1RA 1OJLA 4PHFA 1P72A 1VYTA 1LF5A 2VP0A 1FOEB 1T0JB 1N6PA 3CWQA 3CH4B 4JL5A 3QEOA 4S2EA 1GM5A 4M9ZA 2GJ9A 1QRAA 2LCFA 3UATA 4WBSA 2DWPA 2WICA 3ZD7A 4BZQA 1N0WA 2WIAA 4E5UA 4LPKA 3TR5A 5FPYA 1T8UA 2I1QA 4NCIA 1Z2CA 2IYZA 1G17A 4PC1A 4Q9LA 4DC9A 1KI6B 2WJIA 3AGPA 5LBIA 3IIMA 4I99A 2GVZC 1GITA 2XAUA 4F4IA 2NZ8A 2IT1A 3DKPA 2DCUA 1VKJA 2W83A 2ZE6A 5D3MB 3SEAA 5FL7D 2BDTA 4DWJA 1VHLA 1GKYA 5HCNA 1NN0A 2ZQ5A 1XTRA 3WP0A 1E6CA 2ZJYA 3ZVRA 4BFZA 1FQJA 2CJWA 3B82A 1TX4B 1YRBA 4WVFA 1IN5A 3QY0A 3SZRA 5TXGA 4I1OA 4RSGA 1M2OB 4D81A 3QIAA 1ZIOA 4ACAA 3K70C 1P9NA 1U0HC 1Z0IA 4OI0A 5E4FA 3NIBA 2W6IA 2WWXA 1CJTC 4KYIB 4GI7A 2CK3A 5KNDA 1K5DA 1XJQA 5BYKA 3TUJC 1T6NA 1XMIA 2A78A 2P5TB 5TVKA 2GVDC 4YMUA 2OBMA 2HCBA 4JLVA 4Q18A 4ZI2A 3LW8A 5C2JB 2QT0A 4CEIA 3LV8A 5JI3E 4M0LA 1XXHA 2HYDA 4ZPXA 1ZNZA 5B57C 4C0HA 4EQ6A 5CLLA 2I4IA 4HLUA 4MRVA 1UKEA 5J40A 4M9QA 4JVNA 3U4QA 1XD9A 1G64A 4KLNA 1E2GA 4CVNA 3VX4A 3DDCA 2OO7A 1ZBDA 4IDPA 1OE0A 4FWIB 1KZGB 3TSWA 3OEED 2AWNA 4JLJA 4B44A 1W0JD 2JDID 3EC1A 3FE2A 4D0GA 3W5JA 3TLXA 3GFOA 4IVPA 4Q4HA 4Z8YA 2IEZA 1E9FA 5JS7A 1W2HA 3BC1A 3IPXA 3SN6A 4XD7D 2CVFA 2GILA 2BMFA 3DM9B 2X2FA 4FWTA 3CZPA 3IUYA 2RGAA 1RFLA 2DFNA 2KB0A 3SE0A 1GRRA 3QG5A 2Z5FA 2DPXA 3A37A 2D06A 1GZSA 1CR1A 1ZJ6A 2QQEA 3IQWA 2CDNA 4XVUA 4TYNA 2ODNA 3I5YA 3B1ZA 1GFIA 4A8JB 2BCJQ 1NMYA 2CMKA 1E2DA 5CB8A 4UNNA 2ZUCA 1YZTA 2QRNA 2ATXA 2GK7A 2ZJ5A 2WWHA 1CJKC 1G7CA 3MWYW 3TR0A 2CLDX 2Y8EA 3KKPA 2NPIA 3AF3A 4M1KA 4Q7JB 5JI2E 3WMFA 4RD1A 2YV5A 4B48A 4WXRA 1OFUX 4GOKA 3U2QA 4OJKA 5AJZA 3AVTA 3VQTA 1II8A 1MO6A 1X1RA 4I1UA 1N25A 2EFGA 1D2NA 2P3SA 3DVLA 4WOPA 2E87A 2QMHA 4U5XA 1II9A 4JJZA 3P26A 1E2HA 1IXRC 1OB2A 2BJWA 1R7RA 1UFQA 3T61A 2JASA 3EC2A 4KAXA 4WA7A 4F7WA 3ONWA 5AR1A 2ZRAA 4JZKA 1Q3HA 1IHUA 2YWEA 3SFVA 1JQLB 3GLHB 5DLQC 3D7MA 1EFCA 2H16A 2BBWA 4N0EA 3ZZTA 2WWFA 1CULC 1KNQA 5GVRA 4CDGA 1H8EA 3THWA 4LUCA 1M1YE 3A4LA 3PXGA 3WXMA 1G7SA 3RS2A 3UMSA 3A6PC 1Q0UA 1TQ4A 2HJVA 2ORIA 2IHYA 1ZM2A 2ZRKA 2ZM5A 4DCVA 1UBGA 1QHNA 5CJPA 3WBJA 2ZR9A 2KBFA 4JVSB 2D2EA 4C30A 2J5XA 3EIEA 2AFHE 1ZM7A 2FFAA 1WBDA 1E2MA 3T1OA 1XP8A 1AKEA 3D31A 3H86A 1JXOA 5TARA 4M21A 4XVQA 4M1MA 3UANA 1EFRA 1FQKA 1KKLA 4KBGA 1RRCA 2PX3A 4KO8A 2QTVB 2P2LA 5UKDA 2R9VA 2E9SA 1S3SA 2ATVA 2CE7A 2C5LA 1NSTA 3BD9A 3AVYA 4OQMA 2C8VA 2IYWA 2IW3A 2YWFA 3B1YA 4EPYA 4LBZA 3W9YA 4B3XA 1AN0A 2O8EB 1HURA 3QEJA 4B3CA 1Z5ZA 1US8A 1Z0JA 3QXXA 3GJ3A 2QTFA 3U7HB 2ZSFA 1E3MA 1HQCA 3UMRA 3DEFA 2W2XA 1JJ7A 4DJTA 3LWNA 3H1TA 4TYYA 5FOVA 2ZREA 2ZRJA 4ZCMA 3NXSA 1P3JA 4ASUA 1EX7A 5EE1A 2JLUA 3U3RA 4KITB 3QPUA 4PZLA 1R8QA 2HT1A 3IEUA 3GLFA 4EFMA 5EE5B 5CYOA 2AL7A 2Q9AA 4F93B 3IQXA 2O8BB 1DAKA 4JIMA 2ZPTX 4WAUA 4BFTA 3IHLA 2XB2A 1P61B 521PA 3B78A 1UDWA 3QKRB 3OIUA 3H2YA 4C0BA 5JJLA 2QN6A 3QXHA 2GA8A 3SR0A 3LRPA 1ZCBA 5CM8B 1G8HA 2ZU0C 821PA 4US2R 3TGPA 1F6BA 2QAGB 2YZ2A 4M2LA 3WNCA 1T3LA 5EXSA 2H5EA 3RLFA 2A3RA 3THOA 2CEAA 2DBYA 5KPJA 3GCGA 3FHTA 4ZO4A 3PVSA 2XEXA 4B74A 3Q3JB 4B76A 1E9DA 3U3KA 2DYKA 2G88A 5FOWA 2A5JA 4ZV4A 2GZHA 4JT4A 4EPVA 2XGJA 5JLJA 4EKDA 1UEJA 2QP3A 4X8LA 4LV6A 1IXSB 3HU1A 2D4HA 4DSOA 5FL3A 3AF0A 2VA8A 4I4LA 3LDAA 4DVGA 2KE5A 4KSCA 1KMHA 2ERYA 3NVAA 4YLGA 4Q47A 4LY6A 3TBKA 1E69A 3ZIAD 4M22A 2BV3A 1E2QA 4K46A 1KOFA 1NLZA 3CX8A 1AQUA 1CR2A 1Q22A 1MV5A 5FOUA 1RC8A 4NYMQ 1AQYA 1YZKA 2WSSD 1NJGA 4LHVA 3LNCA 5AJWA 5BYJA 1CBUA 3ZS9A 1JBKA 2KBEA 3F0TA 1Z06A 3PUWA 2GESA 2O8CA 3EIQA 4US1R 2XOKA 4M4SA 3AM1A 2NQ2C 2PJZA 2WWYA 1G1MA 2FN4A 3HJNA 2OXCA 2ZVPX 2FNAA 4C0SA 4LHXA 1JAHA 3OEHD 4NTZA 3PEWA 3QBTA 1IQPA 1ZUNB 3GEEA 4QL3A 1Z63A 1DAIA 5FTNA 2V8OA 1DAEA 3I3SR 3MWLA 1X86B 3FTQA 1XX6A 2TMKA 5ANRB 3WBKA 2DFKB 4YQFA 1RRPA 5FL7A 1VTKA 3P32A 4AYXA 2JJ2D 2XTMA 2ZRLA 2IEYA 4FD2A 3B13B 1KI9A 1XD8A 4MRNA 1OFIA 1M7GA 4YMSA 3EPLA 4HLCA 4US0R 1FW6A 2ZTSA 4A8JC 5JWHA 3RWMB 3I92A 4JLDA 5FTMA 1ZCAA 3A1VA 2REBA 2P67A 4OHZA 1LS1A 1CEEA 2G77B 2QRZA 2ZS8A 1DBSA 3CX6A 5KDOA 2QROA 2ZYVX 1N0UA 2W0SA 3MAAC 3AUYA 2HV8A 2PH1A 1FNMA 5G3YA 4LCBA 1K8RA 3KUDA 4L8GA 3IEVA 5H70A 1M74A 3NBYC 4QGFA 4D4KA 3CRVA 2BHRA 5AUNB 3EA0A 4A0HA 2DFTA 5L3SB 1XZQA 1DPFA 1ZUHA 2CJWB 4B47A 2RB4A 1GG2A 1TL7C 4JBYA 5D3QA 2ZJ2A 3RVBA 4C0KA 1A5TA 2GHIA 5TV2A 3TQCA 1DAHA 1RVDA 1QG2A 3DOEA 2GDJA 4XIGS 3OEEA 3LFUA 1W0JA 2CLCX 4QGHA 5LD2B 1L7VC 5EUMA 1N2CE 2Q3HA 1M6NA 3NEYA 2QZ4A 1XBTA 1V5WA 4FMDF 4BGDA 1VYVA 4CEIB 4AG5A 5E7JA 4DRZA 4GPTA 5GADl 1U8AA 4PAOA 4OI4A 4DCUA 2F6RA 1Q57A 2NO1A 4HAVA 4EQ6B 4FMCB 1ETUA 1VG8A 1BMFD 4LYJA 3HPQA 1HV8A 2ZRBA 2DY1A 5DE3A 2IF0A 3BH6A 1GKUB 3FKQA 1U81A 4WIAA 5G53C 4DBLC 8OHMA 1E2IA 1RE0A 3R9IA 4BFSA 4I1SA 2VLIA 5DHFA 1W4RA 2RAPA 4PPFA 1ZNWA 2QPTA 4Q4HB 4DDTA 1P73A 1ONBA 3BE4A 1QHYA 1KDRA 1ZAKA 2HXSA 2WKPA 3LBIA 2ZVQX 4A2PA 5GVSA 4UNPA 1KSFX 2Z43A 2V3CC 3X1XA 1F60A 4B3FX 2RHDA 4A8JA 4OK6A 4CRWB 2H17A 2NO7A 1FMJA 2VSXA 3OAAA 1W46A 4JLAA 4DDVA 1KJZA 2OT3B 2R8RA 1KDOA 1OXSC 2DWQA 1W0KA 4JT2A 5GJBA 2AXPA 3U5ZB 3CX7A 2ZRPA 5F9HA 4EPRA 3KJIA 2REXB 4DCNA 3ZD6A 2HLDA 5JZVA 2QMEA 4FMDB 1ZYUA 2R6CA 2Z0MA 5JJKA 5FOTA 3AKCA 4G5RA 3QVVA 2OCBA 3PG5A 4RFVA 3N2IA 2BEKA 2GXSA 3T12A 4NYJQ 3KFVA 2VSOA 4RCYA 4Z54A 4ITRC 4KV9A 5FI1B 3QPWA 1QZXA 3FMPB 4C9BA 1UADA 3BORA 3AV0B 2XTNA 1E9BA 2GJ8A 2X77A 4KFUA 1D5CA 2IYVA 4A0RA 2IYSA 1SVKA 2BBSA 4TL8A 5KSOA 3KKNA 4NKRA 1F3OA 1AM4D 1OPXA 4AKHA 3C5CA 3AVOA 4WZBE 5AK0A 3T1QA 1XCMA 3C7KA 1MRSA 5JMTA 2P6NA 1K5GA 2P5SA 2H92A 4OI1A 3GMTA 2Z6VA 1UBEA 3ZZUA 4A36A 4LBWA 5EP4A 3BBPA 3RHFA 5HE9A 5B64A 3LXRA 2QAGC 3IKJA 1MT0A 1ZD8A 5C4GB 3THWB 2NO6A 3LD9A 1P2TA 3CONA 3M6AA 1BYUA 1OHHA 1NBME 2YHSA 2ZEJA 2FEOA 3AP3A 2OFOA 3K9GA 3Q72A 4OQXA 3A1UA 3SYNA 3ECCA 2GZDA 2PT7A 3NDBB 1NVVR 4A0GA 4QXAA 2JLVA 1S2MA 5JEDA 3R9XA 1E2PA 2C95A 2IC5A 1VCIA 4Q9KA 3TJZA 4V02A 2FPLA 2ASEA 2YWHA 2MSDB 2ZRMA 4TLAA 4XSHA 1OH7A 3D6TB 4H9GA 1Z3IX 1OXUA 1UEIA 3UG6A 2B8TA 1M8PA 2HXYA 1IY0A 2EWWA 1G3MA 2H7VA 4P3YA 1W36C 5J4VA 3KQNA 3CPJB 4MRPA 1U0JA 5KSPA 2YINC 1N0VC 2BWJA 4FN5A 1BOFA 3GQBA 4JKYA 3RS7A 1WXQA 1JPJA 2V6IA 4OK5A 1US8B 4HATA 4PPNA 3VHXA 2RGEA 5HR5A 4B32A 3AF1A 1E1QA 2CE2X 4B6FA 1N5KA 2IXGA 3HPRA 1KK0A 1ZD1A 1EX6A 2XSZA 3B1VA 2C9OA 1U8ZA 5FPTA 1E9CA 3L0PA 2G9NA 3BJIC 2IUSA 2QE7A 2YVUA 4BEBA 2RGNC 5BWMA 3AB3A 4O2RA 3B60A 3CRMA 3ADCA 2OM2A 1XPRA 2BJVA 1FZQA 3C8UA 4C0LA 4QNRA 4R7ZA 5IRCD 4MGYR 1U90A 2IWHA 4D26A 3SJBA 1KI7A 2ZS7A 1F2TA 4TL6A 3GLFB 4OQNA 4R2HA 2OCAA 2CHQA 4KSBA 3SU8A 5G3ZA 1UPTA 3V9PA 1DG1G 4IDHA 2FFBA 1EWRA 1YKSA 4I1VA 3HU3A 4QBGB 4RJLA 3WMEA 2F1IA 5FH9A 3P20A 2G3YA 3OIWA 2B8WA 4JLNA 4A6PA 3CB4A 1NLFA 2ZE7A 1J7KA 4JLKA 3TW4A 3TNFA 1S4QA 2XJ4A 1CIPA 1DAGA 4DXAA 1JB1A 3ZS8A 1T3HA 5IHPA 4HUQA 1O87A 1XEXA 4Q9HA 4OHXA 4A9AA 3CPEA 2V55B 1NVWQ 4MYCA 4QNMA 2ZRIA 4CGZA 3EXAA 2B6HA 4A2QA 4QBIA 2V6JA 3RSOA 2QG6A 2VHTA 3NBZC 4FCWA 2C96A 3CUEF 2A2ZA 5DHAA 1A7JA 3PCRB 1ZU5A 1SZPA 3ZVLA 5BQ5A 1P2VA 2J7KA 3RANA 1AS2A 4QM6A 2YYZA 4LYAA 4PO9A 2BM0A 1DVRA 2IYRA 1VHTA 2YC2C 3CF2A 3I73A 2CL7X 3PV0A 3IBGA 2IUUA 2Z4RA 1KMHB 2ZRCA 4TMVA 4YMVA 2OBLA 4MYUA 4DDUA 1QHHA 4DLTA 1JPNA 3TAHA 1TQ6A 4KYUA 5L8VA 1TADA 4HLUC 4LOAA 4AWXA 4QGGA 1TMKA 2FMXA 5EP3A 5LDDC 4YONB 4PZZA 2IX3A 4MDFA 1E4VA 1TF7A 1FX0A 2P6UA 3PR1A 1A2BA 1V43A 4C0JA 2O8CB 4KCGA 3ZVMA 2QMUA 2RGNA 3FPAA 2CBZA 3X1YA 2QA5A 4B3GA 2DHRA 4HAZA 4HB0A 3PUZA 2VP9A 1ZP6A 1YZQA 1OT3A 1TPZA 1KK2A 2LKCA 3KFXA 4Z51A 3O47A 2EVWX 2QM7A 1XMVA 1KK3A 1P75A 1Y63A 4KBFA 4NONA 1E2LA 3NBXX 1GRNA 2D3WA 3KJGA 3TW8B 3RS0A 4D0NA 4PPQA 1LV7A 3ZYCA 3CWZA 2ZAOA 3GLIE 4ZKEA 5C1BA 3QOFA 2YNMA 2AX4A 4EDHA 2WPDD 4GP7A 2HF9A 3W6PA 3A4NA 3ICEA 5H68A 1EGAA 2YOGA 3EPKA 3JZMA 5CYPA 2W58A 2D2FA 2ZRDA 4XTCS 4DSTA 3SI7A 5L3SA 1NP6A 3W3ZB 1BYIA 3QE0A 3ADDA 3B9QA 3AGQA 2D7DA 1LF0A 4YXWD 3WMGA 1KMQA 3AQ4A 5GJVC 1FFHA 3CRRA 2ZJOA 3IILA 3U60B 3WHKA 4BLQA 5F2EA 3B9PA 1H8HA 3CR7A 3EZFA 4DLZA 1NSFA 4M9XA 1GDDA 5EE0A 1G6HA 5J4YA 5EP2A 4JSTA 1J70A 2CNWA 4E07A 3K09A 1XTKA 5B2ZA 2WSMA 2GJSA 3MMPA 2IYYA 4LDJA 5C4MA 4P33A 3R8CA 3T35A 2I3BA 2IYUA 2VHUA 2P0EA 1XF9A 1RW4A 4CEHA 1YVDA 3REFA 1CP2A 4K81B 4AK9A 5EZ6B 3J81k 3PIRA 4I81A 4JBXA 4LJ9A 3GEIA 3LX8A 1BS1A 1N6OA 4JLBA 3ZLJA 4B3BA 4A6XA 4XWKA 3VNUA 1UKVY 4LRWA 3WP1B 2DFLA 4Q7MB 2JIZD 2JGNA 1E0JA 2A7QA 3QENA 3ZQ6A 2QL6A 4IFEA 1B23P 1FTNA 3KTAA 4HAUA 4EPTA 1GKIA 2PEZA 1KYIA 2WWWA 5FUXA 3W8NA 2GJAA 1GSIA 3LW7A 5EJEA 1QHIA 1CS4C 2R6DA 3RC8A 2IS4A 1DEKA 4AYTA 3I62A 4Q21A 1R0ZA 4M1WA 4B75A 2EWVA 5EXPA 3KDSE 4BE7B 1E2NA 4BFYA 1GL9B 1G8PA 4NP6A 1QBKC 4IDQA 4F92B 4MKIA 3LY5A 3DZ8A 3VX3A 3K1JA 3CRQA 5DYGA 2XB4A 3FHCB 4UXJA 1L8QA 2ODBA 1N6IA 4QFMA 2IF2A 1GL6A 3RRMA 4NBSA 4JL8A 3CF6R 1G9XA 3WNDA 1E99A 5KO2A 4QGAA 4JL6A 1A82A 4CIDA 3R9WA 3KQKA 4V0ME 3CH5A 3T15A 4CYMA 4MGKR 5CJ2A 3T5DA 1ZMXA 2GXQA 5C18A 2AKAB 4OKSA 3B85A 2G0TA 1E2FA 3BB1A 3UWKA 3VKGA 3GJXC 3OIYA 1R5BA 2PCLA 1S8FA 4ACBA 4A2WA 2FH5B 4ZCIA 1D9XA 1E1RA 1RYHA 1OH6A 1JR6A 4DUGD 4DB4A 1IBRA 3K0CA 1RRFA 4FCTA 2IYQA 2ODWA 2IUTA 2SHKA 2N1BA 1ZNYA 3P27A 4TZ6A 4Q1CA 1KO1A 4G5OA 1JECA 3WRYC 4XOIA 3WYFA 4KVGA 4QRHA 4C0QC 4ZI3A 3EA5A 3PENA 3Q9LA 2OE2A 1HY3A 3AVXA 3IIJA 3LLMA 2D74A 1RRGA 3ASZA 5DI9A 1OIWA 5G40A 4Q02A 1A4RA 1Z22A 2VHCA 3F5FA 4KJZA 4TYPA 1NBMA 2JLRA 3CM0A 3I8XA 4W5WA 5LB2A 2J9RA 4X8HA 2NG1A 4E03A 1Q3TA 1HT2E 4V0LA 1GILA 3X1DA 3H0KA 4EAQA 1YZNA 4G1UC 2W0MA 1OYWA 3QPVA 3K0FA 4EIWA 4FIDA 1EG7A 2F1RA 1FL9A 5DN6D 1G21E 3DKVA 2VPPA 4RZUA 1LW7A 2XNDD 5CLQA 3HYRA 4JLOA 3CNLA 4LYHA 4DSNA 3RRZA 1TUEA 3TK1A 1MABA 1NVVQ 3D3QA 1E4YA 5A4JA 1N6LA 1FPMA 1MKYA 1XD2A 4TTPA 4PANA 3I61A 1GAJA 1KI3A 3MSXA 4L5BA 1I4DD 1WE2A 4Q48A 1MO4A 5F3WB 1PV4A 2IXEA 3T1TA 4TL7A 2A5DA 2NO0A 2ZR0A 3GFTA 1Q1ZA 4NE2A 2ZYTX 1GNRA 2WJHA 3R20A 3RC3A 3T34A 3KXKA 3SOPA 5J4KA 2J1LA 1Z83A 4F4JA 4Q01A 2ZSAA 4G3XA 2J7PA 2ZJBA 4IOKA 1E0SA 2O8DA 4N1AA 2L0XA 4NZYA 3DO6A 3QNUA 3NH6A 1R4AA 3BFVA 2CHVA 4POAA 2VP5A 4JJKA 1KK1A 4HUTA 2RGBA 4LC0A 3UXMA 1E79D 4P4UA 2IHBA 3G0HA 3B2EA 2WAXA 1ZM9A 3TAUA 2IWRA 1HE1C 4QC2A 3EW9A 3V00A 1E0AA 2Z83A 3QF4A 3OFND 4RVCA 2Q9BA 5KU1A 1PJRA 2IYLD 4D0LB 3LLUA 1QF9A 4H1VA 1IAQA 4D4JA 3ICQB 3CNNA 2CHGA 1F2TB 2FZLA 5K8UA 3F8TA 3ZGXA 3FKSD 1YZGA 3P1JA 1R0YA 4PTLA 1Z47A 2O5VA 3MCAA 1SXJE 4AG6A 5HPYB 3LVRE 3H84A 3KB1A 2QP9X 1FUUA 3FHOA 4M1SA 2J3EA 3SBDA 5DO9A 1R0XA 3GFPA 1ZIPA 2PMKA 1AS0A 3E2IA 3IBYA 3OF5A 1E2JA 1XFAA 121PA 1SXJD 3ND9A 5B30A 3QBVA 1W49A 4IXNA 1E94E 4G5GA 4GT1A 2ZE8A 1A2KC 2ZRFA 4EFNA 3ND8A 1N6RA 4TL9A 2B7BA 1ZVQA 1WQ1R 4HUQB 2P65A 1XEXB 1N5IA 3MGCA 2VYFA 3MRSA 1GP2A 3NC1C 2J45A 4WXPA 2JLQA 3OE7D 4MUAA 3PEUA 3K9NA 4AKIA 5JFGA 2KSQA 4IKEA 3RABA 3MFYA 4TQAA 2PZFA 3KXLA 4MYTA 2NIPA 4Y0VA 1ZINA 1MH1A 2DWOA 3AUXA 1Q20A 3LXXA 4R71A 1W36B 1FP6A 3QXJA 4KVAA 4MITA 1BKDR 3A1SA 4HAYA 5K8TA 3EWSA 4EFLA 2QUZA 2WKRA 4IDNA 2Q21A 1QHHB 1XWIA 2VIIA 1KI4A 3Q7QA 4B35A 4MKHA 2V1UA 4W7SA 2C04A 5JBQA 1EFHA 1NMZA 2WPDA 4AY2A 1FX0B 4NH0A 4O0MA 3LVQE 1KO7A 3TUZC 3NHAA 1Q21A 2WOJA 1ANKA 3GJ5A 5CB6A 3GLIA 1NMXA 4UJ5A 2NZJA 4BLOA 4Q03A 4GBMA 3CZQA 2XZOA 2A5YB 2ONKA 1FMLA 3RWOA 1PUIA 4PO8A 2N42A 3RAPR 2VTKA 2ZU6A 5EXTA 3SNHA 6Q21A 1COWD 3HYTA 2XXAB 1FUKA 2ZRGA 2ZRNA 1JEEA 5IK2D 1M7BA 1N6NA 3QQ5A 3UIEA 4BECA 5FOSA 1J8YF 1LS6A 1P9RA 2ANCA 1AZTA 2VHQA 4BASA 5CITA 5LPNA 3PEYA 2AD5A 5BN4A 3ZJYA 2BMJA 1KDTA 2FFHA 2JJ1D 3FVQA 1ZM3A 4XWOA 5FBVB 3TSZA 4Q9JA 5L3QA 3LAWA 5EZ5A 1DARA 1G8FA 4PQRA 4HLDA 5JWRA 2AKYA 3IDQA 4W5JA 1UDXA 2QBYA 1U0LA 2HJGA 5DIFA 1JI0A 1JR3E 2FE4A 3VR4A 1W4BA 2HCJB 2IS6A 1N6KA 4KHZA 3ZDQA 3T5GA 2MSCB 1W4CA 2JLZA 3GLGE 4BZPA 4G01B 2PT5A 2WM9B 3RSLA 4UKDA 2V1XA 1CJUC 1JR3D 1VG9B 2BM1A 4HAXA 4QKQA 4HYYA 4PSAA 5HKKD 2JDIA 1Z8FA 3A1WA 1RKBA 2PX0A 3W6OA 2R44A 1X1SA 2B7CA 4XD7A 2FDCA 1SVLA 2GEVA 4HI0E 3TE6A 2WKQA 4Z8XA 1SGWA 1X8KA 2ZJAA 3ASYA 4G5QA 5K8IA 3FFAA 2JA1A 3Q85A 4MQBA 2O8FA 5ELXA 4CEHB 1Z6GA 1DOAA 4TWZA 1VIAA 2HUPA 5JCPA 2CCJA 4DIDA 1Z6YA 1Q12A 4JYBA 2ZAMA 4AKEA 3CR8A 3QJYA 1QHGA 5FPSA 4B3DA 3RS5A 2NTYC 1NN3A 1DAMA 3EPHA 2D7CA 2PLFA 3RS4A 3K9HA 1CU1A 2GK6A 4F91B 1SVWA 4PSKA 4CEJA 3KTAB 2CK3D 3SJZA 4DLRA 5CDFE 1UBCA 1WP9A 4DLVA 1XXHE 2J0SA 3ZZ0A 1Z2AA 1D6JA 2MMGA 3SC3A 5DH9A 4Q7KA 2D62A 2REOA 3QVUA 4U02A 4AYWA 2JLSA 1IY1A 1DO2A 4PAMA 4V0MA 4D82A 1PUJA 3BAFA 2VF7A 3Q8XB 2ORVA 4D4MA 5JS8A 3DM5A 4ILEA 4KFSA 1QVRA 2J41A 1SKYE 5JSZB 3EZ9A 3O8CA 1G8YA 2F7SA 1Z07A 2R65A 3D8BA 3W90A 1G291 3GP8A 2EW1A 1XEFA 5FUWA 1W48A 4BRWA 4IVRA 3AVWA 2C9CA 2QORA 2B21A 4P4SA 2OCPA 2QENA 4LJYA 3BERA 5HZKA 1HH4A 2YKGA 1Z6TA 3KKOA 5AWFC 1CKEA 4JMPA 5JJIA 1AK2A 1NG1A 4TTQA 4UNRA 2X19A 2QQ0A 3ADBA 2W6JD 3DHWC 3LBHA 4Q4AB 2GEDA 1BO6A 2BKEA 1TF2A 3CPHA 3DMDA 1YR7A 2VSFA 2OILA 1EXMA 1XZPA 4PO1A 1F48A 2ERXA 2RGDA 4LHYA 4MA4A 2F3RA 3VU9A 2G0NA 1I2MA 2A5GA 3U7EB 3QSYA 1KO5A 1S3GA 2RGCA 4DLUA 3SHFA 5FR2A 3THYB 1RZ3A 3IPYA 4UNQA 2OSBA 3AEZA 1Z0KA 3I4LA 1G7RA 4U00A 1XMJA 2F1JA 3K70D 4RFSA 1GWNA 3PFIA 4LBVA 4NYIR 5E95A 2C03A 2PEYA 4FXPA 1NLYA 3U3OA 4TMTA 4LJ7A 4TMZA 5FUVA 5GJCA 4Q1BA 5FTKA 5AJXA 2GETA 1TTTA 1YJ5A 2PLRA 5SZKB 2HYIC 4OL0A 3K0FB 3EZ7A 5BN5A 1XTQA 4ESHA 1II0A 2OG2A 4S35A 2J0UA 1E98A 3EPJA 3A1TA 4FINA 1C1YA 3NTUA 1TUIA 4QOSA 2QNRA 2FG5A 2QT1A 3VAAA 3BK7A 3FDIA 4A4DA 1W5TA 3KKQA 1DADA 1HTWA 4JYCA 3X2SA 1EESA 4C2TA 3THXA 1MABB 4TYWA 1U8YA 4HZIA 1J2JA 4JKIA 1XD2B 2FZ4A 1RPZA 1G5TA 2XX3A 3NH9A 2DB3A 1H8ED 2IL1A 3DOFA 3DL0A 5P21A 4DLSA 1TAGA 2OHFA 2R6GA 2QEQA 2W2TA 5HZHA 1LB1B 3ADKA 2F9MA 2NMVA 2FWRA 2PMDA 3PUVA 4GOXA 3T1VA 2A30A 2EU8A 2QP4A 4L9WA 1F2UA 5A5GA 1E2KA 1KO8A 1KHTA 1U99A 5F9FA 2BKUA 3EWAA 4CT5A 1G18A 2R2AA 3AP2A 1XRJA 3ETLA 1GTVA 4Q1FA 4EUNA 1GL7A 1NI3A 4LHWA 4PC6A 4NMMA 2BBOA 1EFRD 2O8DB 4A92A 3P4YA 1KO4A 2OLJA 4MUBA 4QHYA 3TKLA 4HAWA 2LWIA 1S1MA 4XJXA 2QMOA 1NIJA 1SXJA 1Z0FA 4DIEA 3FMFA 1D8TA 1GUAA 4PC7A 5KNBA 3CLVA 4MYHA 3QF4B 1NJFA 1JXMA 2DR3A 3QKSA 4P4TA 5FUYA 2WJGA 3NHBA 4HLQB 1NY5A 1IONA 1DS6A 3REGA 3L0SA 1OFTA 1NL3A 3WYAA 4TT3D 4R98A 4AI6A 4NCKA 2JLYA 4PHTA 4Q1DA 5KYKA 3ZIAA 2BBTA 2F9LA 4TLCA 3N2EA 4RD2A 1Z6XA 2X2EA 4ASUD 2EFEB 3MWKA 3KKMA 2WSSA 4JVLA 3SHWA 3KJHA 4TLBA 3JVUA 3BFKA 1YU9A 3CKLA 2ZE5A 4K8OA 1SVMA 1E9AA 1G20E 5IT5A 2FPKA 1XMSA 3GJ4A 5KSYA 3SDZA 1IN7A 2Q6TA 3MD0A 3E5HA 3OEHA 5FOXA 2OEPA 3K09C 3FFBA 3CBQA 4URUR 1WMSA 4EPWA 1Z0AA 1ZW6A 4TSFD 2PZEA 3FMOB 1WF3A 2NGRA 2Z4SA 4ZIRA 3IO3A 1G19A 1XTIA 2JJ2A 1VG0B 2KI5A 4W9MC 3R8FA 4B43A 3G82C 4ZDKA 4DT1A 3TMKA 1UJ2A 1JAIA 4NYMR 1HYQA 5CK4A 1ZM4A 1PVOA 2VP6A 3EARA 1ZRHA 3FMIA 4BUJA 1XTSA 1D9ZA 1KJYA 1W4AA 2G1KA 4OYHA 2RHMA 4PX9A 2CVHA 2NPFA 2GNOA 3AKYA 4MRSA 1QHSA 4KXFB 1P60A 2FGKA 2VP2A 3T06B 4QJ3A 5FPKA 5FI0B 4M9SA 1CJVC 4N0DA 5BW8A 1C4OA 2OCYC 3GLIB 2QAJA 3MUFA 2XXAA 5KSZA 3OZXA 4YMWA 3MJHA 3VR5A 3KL4A 4DHEA 1LTQA 1WA5A 3NG1A 3W6NA 3PJRA 2ZI3A 2ZANA 2C77A 4IW3B 1YHNA 4UJ3A 2ONJA 3KZ1E 621PA 1NNEA 1HE8B 1C9KA 4HEJA 2ZI5A 1TNDA 2BMDA 1VG1A 2MMCA 4LYFA 1UM8A 4NDZA 4RD4A 4AC9A 3U61B 3K0EA 2R6FA 3R7WA 4DEXA 1JR3A 2XOKD 4BLSA 2X8AA 1AGRA 3X1ZA 1NG9A 1IJFA 2KWIA 1KTVA 5HKKA 3AVPA 4JBWA 3NKVA 1U2RA 4GZLA 1Q1BA 1W44A 1OB5A 2YOHA 3GLGA 1W7AA 1AKYA 2GXAA 1FNNA 3PEVA 3KQLA 1D2MA 2A9KA 4PC3A 3TIFA 5BXQC 5L3QB 4A15A 5B58C 1XCPA 1XEWX 1XU4A 3U7GA 1Q1EA 2F3TA 1G6OA 1E32A 2QBYB 4TQ9A 3K0AA 5EP1A 5DNYB 2F1HA 1KJWA 3RNLA 5TB5A 1BMFA 4UXIA 2ZI4A 2HDNB 4NL4H 4JS0A 4V0NA 4U7DA 2UKDA 1IN4A 1G4UR 4TMKA 5M04A 3K0CC 4W5HA 3M4YA 3L0OA 3KB2A 3RS3A 1XPUA 3L0IB 4KFTA 2CXXA 5G41A 5FBWB 3UWOA 1CRQA 4LJ6A 2QPOA 4GMDA 5FBQB 2ZR7A 3TVDA 1NF3A 2J0QA 3AF4A 4PR0A 5JRZA 4PSVA 2QM8A 1ESNA 1G41A 2VHJA 3HDTA 2PJRA 4C0AC 1FTSA 1UKYA 1LFDB 2IBMA 2WWGA 3NEJA 3WRXC 2WAYA 5DGXA 2O8FB 5FTLA 4AKGA 2ZI9A 5CDFA 2FJUA 1FP7A 3C5HA 5AUOB 2WJJA 3SQWA 4ZDIA 4LI0A 2EYQA 1Z6AA 5E7IA 4BFWA 3AKDA 5K8LA 5LB4A 1KNXA 3B6EA 2UZ3A 2EFCB 3VR1A 4ARZA 4CEJB 2W2VA 1TU4A 1IN8A 2FGJA 2H57A 2BVNA 4M1YA 4V0OA 3GJ7A 3M1IA 4MRRA 5SZJA 3SYLA 1ZNXA 2J59A 3BH7A 1ZC4A 1N5JA 5CM9C 4CW7A 4WZ6A 2OV2A 2GCNA 1MR3F 1S9HA 4IHQA 4IDOA 3U44A 2QGNA 2RH5A 4ZDJA 3VKHA 1T4GA 2V9PA 5JSZA 3B8HA 4LV5B 3LQQA 3NBFA 1OKKD 3WHLA 2PZGA 2RGGA 3L8YA 3ZH9B 3MLEA 4A1FA 3W3AA 3WNBA 4ZCLA 2VEDA 2W6JA 1KSGA 4MGIR 1PLKA 1TQDA 4KU4A 3L8ZA 5FBLB 4OQFA 4BPBA 5L3VA 1UBFA 4HDQB 1P5ZB 2XTZA 2HF8A 3LA6A 1CRPA 4MH0R 4TQUS 1HQYE 2GF9A 3F3YA 3TQFA 3RRNA 1T0HB 3VHLB 1L2TA 1U98A 4Q4AA 2PL3A 1XCGB 4J0QA 3TRFA 1RJ9A 4F38A 4P4SB 3U7FB 4GNKA 1TU3A 2F43A 3NWJA 1RYFA 2GCPA 1GVNB 3Q7PA 4NU0A 4LBYA 1KI8A 2IK8A 2FU5C 4JLPA 4O25A 1KSJA 2N46A 2GCOB 3OAAD 4UNSA 3MJRA 4NYJR 1AZSC 4JVMA 1LNZA 5EUQB 3THYA 3WY9A 4A0FA 3VNVA 3SQXA 2BC9A 3CNOA 2BOVA 2WMOB 1W0KD 3TSOA 2XZPA 1NN5A 2ZETA 3VU9B 1KKMA 4NCHA 4A82A 2JLWA 4GL2A 4NCJA 2Q3MA 4D80A 3CIOA 3SBEA 3DMNA 2FSIA 4TLEA 2NOAA 2HLDD 4IFBA 2AN9A 2V54A 3VKWA 1SVOA 3K9LA 4LJAA 2Q9CA 4GMXA 2XNSA 1T5IA 1YRAA 3EASA 5KTYA 2ZXUA 1MO5A 3GLHE 4RFSB 4YMTA 1M7HA 4NYIQ 3E70C 5KHOC 3VFDA 3DPUA 1IXZA 2ZROA 2RMKA 2OAP1 2WJYA 2VP4A 2ZRHA 3LBNA 5KUTA 2CCKA 3BWDD 1WCV1 4EJSB 3A36A 2J0UB 3B1XA 2V7QD 3C41J 4DLXA 1NVUQ 2VO1A 2XJ9A 2FSGA 4L16A 2IYTA 1JNYA 4D25A 1U9IC 4ZDWA 1G8GA 1VCOA 3QUSA 3LH5A 3THXB 3L82B 3G5UA 1CF4A 4HB2A 2ZJ8A 3IIKA 4B73A 2WTUA 3VTKA 4B34A 1R5OA 3MG9A 4V0KA 1YR8A 2ZI7A 4EPXA 4OQLA 2FFQA 2FSFA 5BN3A 4F4CA 3M0EA 3QF7A 2GAAA 3AP1A 1SULA 5DI3B 3I5XA 1WB9A 1OHHD 4XWAA 4B2IA 2WBLC 3WYGA 2EFDB 2VBCA 3A58B 3OIVA 4B2PA 2VL7A 1BH2A 1F2UB 4M8NE 4PHHA 4XH9B 2X1VA 1XDBA 1Z28A 4DLWA 4TZ0A 4BLTA 4DDWA 3BH0A 1IOZA 4RY2A 4KFRA 4TMWA 2XZLA 4TT3A 4LJ8A 1MO3A 3CF0A 4O2LA 2IXFA 3IGFA 4WZAE 1X8JA 2OLKA 4GZMA 4RD6A 4M1TA 2QSYA 4L4UA 1LY1A 1R2QA 1SXJB 3BB3A 3V4FA 4AURA 1R5NA 1X6VA 1CR4A 4LPSA 4BRUA 2EFHB 4B6EA 2GF0A 2OZEA 5CK5A 1NIPA 1ZUIA 1VCNA 1JALA 1T3SA 3EZ6A 4HZUA 3QKSB 2J46A 4PAQA 2FEMA 2YOFA 4Z1MD 2P6RA 4MDEA 4IEEA 3SFZA 4C7OA 1K6MA 4PC2A 4PFSA 5KNCA 1W47A 2GEUA 3PUYA 1E1QD 1SVIA 5GJWC 5DSZA 2IS2A 2ZYUX 1AGPA 2GBLC 2O52A 2XSZD 1YQTA 1G3UA 1CXZA 5JHGB 2QE7D 1CR0A 3UG7A 1D2EA 4TSFA 2GZAA 2JATA 3RYTC 4R2IA 5KDDA 2AK3A 1X8LA 3A8TA 1T91A 1YR6A 1U94A 3EG5A 2O0HA 3HU2A 1KAGA 4V03A 4CT4B 2OFWA 3LO5A 1U9IA 2KJQA 4JLMA 4URVR 2WJVA 2OBNA 2HT6A 3DZDA 1G16A 1F5NA 3AKEA 2UVQA 5JECA 3AF2A 1DAFA 1IY2A 1WRBA 4TYQA 1TQ2A 1KSHA 2VF8A 1XEWY 1XTJA 3AVVA 4QBFA 2J87A 4UXHA 1AIPA 2JEOA 4RD3A 3KUCA 4B71A 3Q5DA 1VPLA 4GSYA 4ZIRB 3U3JA 3FYHA 4GOJA 1EWQA 2VH5R 3U6BA 2CL0X 2FX3A 2WIBA 2ZYWX 4DSUA 4IJMA 4C4PA 4DT1B 2MSEB 2FV8A 2AFIE 4Q4JA 4BEJA 1GRQA 1M34E 2RGXA 4IXMA 2QPAA 1KDPA 4CF7A 5JRJA 2AR7A 1H65A 1B0UA 2G83A 1J8MF 3GD7A 4R9UC 5CIQA 421PA 5JHHB 3S1AA 2GXUA 1KAOA 1YZLA 721PA 4ERNA 2GTPA 3KX2A 4H1UA 1W36D 2Q0HA 1QHXA 2QSZA 4IOLA 4YXWA 1HEIA 4LGMA 3TH5A 5FPHA 1Q44A 4D2IA 1ESMA 3C4JA 2VRWA 1JJVA 3I72A 2OXRA 1J90A 1CLUA 2ANBA 5SZIA 3GJ8A 2FSHA 2JCSA 1OYYA 2ZITA 5A0FA 1KI6A 3PUXA 3JVVA 1KIMA 2GBLA 1S1CA 1E96A 2XITA 4NCNA 3AVUA 4BLPA 2V4ZA 2K5UA 4HDCA 1OH8A 5KDLA 3C15C 3VR2A 1T8TA 2IA5A 2AD1A 1TF5A 3B5JA 2GWHA 1E9SA 4IOJA 5AJYA 3R7WB 5TY0A 4ZKDA 4FMCF 1G4AE 5D3MA 221PA 4HSEA 5L3RA 3FOZA 4XSGA 4LX0A 2H1LA 3BS4A 3W34A 2FPMA 1YE8A 3I8SA 5JEEA 3PITA 4OHVA 3GLGB 1Z0DA 3ZVNA 2F55A 3W8RA 1KY2A 4DKXA 2FF7A 1AJEA 4LC1A 1VDZA 2UZIR 1N3BA 4M1OA 4AD8A 4QG7A 1SVSA 3CRW1 3UK6A 1OH5A 1NKTA 2JIZA 3VMFA 4G5SA 1NN1A 3K0AB 2C99A 4C3ZA 1I4LD 2ZUBA 1IN6A 4L9SA 4PQYA 4IEIA 3QXSA 2QY9A 2O0KA 4LK2A 4P0TA 1W2GA 2C78A 5J5CA 3AH8A 2EYUA 4LZZA 2RKOA 2C2HA 3H4MA 5AUQA 4QJ4A 4DB2A 4Q7LA 2WMNB 4Y0AA 4JSYA 4MKFA 2IS1A 1PZNA 3QKUA 5HCIA 4BQSA 2QI9C 3P4XA 4QHSA 2R6AA 5JCZA 3HR8A 2OFXA 2WWIA 4Q19A 3NC0C 1Z08A 2W6ID 3KXIA 1OKKA 4RCZA 2GAOA 4NPHA 3I32A 1DELA 1XXHB 3SS8A 5CIWA 1E0KA 1H8HD 4PZYA 4ABYA 4AIIA 4E09A 3SJAA 2LKDA 1N6HA 2ORWA 2OUKA 4PQFA 3CW2A 4YC7A 5DYIA 5KPDA 1L4UA 4P31A 4G0NA 4EJSC 2CNWD 2I1VB 3OESA 3U3MA 3U4QB 1OXTA 4ARZB 4P32A 2JJ8A 4YDSA 4RKFA 4URZR 1ODFA 2GRJA 3SJCA 3VR6A 4TLDA 1SKYB 3IO5A 3X1WA 3U44B 4Q66C 1EFTA 5J4LA 4DUGA 1VECA 1OXVA 2YC4C 2GJKA 3GJ6A 4N3NA 1OSNA 5IDVA 2G6BA 1X3SA 3BB4A 4YDHB 2AK2A 1VYUA 1UAAA 1P4SA 3FWYA 1XPOA 3QKTA 2ZUDA 2BMEA 3PQCA 3V4RA 4RKEA 4OHWA 4GRAA 3L2OB 4Q5IA 1AS3A 3AVQA 3C16C 3QI2A 2ZIAA 3FGNA 4L15A 4D6PA 2FA9A 1ZD9A 2W00A 1G3QA 3CO5A 4OHYA 4TN1A 1HUQA 2AWOA 2GCOA 2BIFA 3BXZA 2WHXA 4M53A 4II7A 1Q1QA 5EE9A 1RJ9B 2H8KA 4URWR 3U6KA 3B7GA 2OAQ1 1HT1E 5J47A 2F43B 1Y3AA 1GIAA 4IRUB 1OW3B 4PPGA 4BLRA 1W1WA 5DN6A 1PLLA 4IVQA 4KI0A 1KZ7B 4D4LA 3K70B 5H1YA 5HTKA 1SXJC 3O8BA 1DE0A 4HB4A 2WZQA 2WOOA 1TEVA 3FB4A 4LJ4A 2XNDA 1OF1A
chains in the Genus database with same CATH superfamily
2C8JA 1SZDA 2EFJA 3LP5A 4LWZA 1WDKA 4FZ5A 3HP1A 3RFXA 3ELUA 2EQBA 4O59O 3NDPA 2QL7A 4E94A 1RWMA 1VHQA 5KREA 5KZMB 1I5OA 2AH5A 4QOJA 1UBUS 1TVMA 4YHHB 4LYYA 3OG9A 4WI1A 1Q1GA 1VZ3A 3TWOA 3SK0A 1P6XA 2Y1WA 3EIHA 5EE3A 1M5RA 5LN1A 4OQZA 3TXXA 4GDMA 4MV9A 1A1VA 2WA2A 1OBFO 3MT7A 3VI3B 3DBOB 2RHCA 4BV3A 1JFLA 3NCHA 3NTQA 4FCVA 5AUPB 5JWOA 4LE2A 2QLJA 4LXUA 1Y34E 1U63A 3ZGZA 4JITA 1YXMA 2VXOA 1XCLA 3K0SA 4DMKA 3SSMA 4ZQGA 2A5FA 1FNCA 2C07A 2OM6A 4CMBA 3ICVA 3FD8A 1KI2A 4RD0A 4ND4A 3QXCA 4YV7A 3HBNA 3KQPA 3OQVA 4LV8B 3D02A 4QSHA 4JR1A 1MIHA 4HH4A 5CVTA 3DFIA 3L7CA 3A0UA 3N74A 5C37A 2QU8A 4Z4IA 2LP4Y 2WVJA 2VCEA 4UQOA 4CMAA 2ZYRA 3KSUA 1TAUA 1BCSA 3IL2A 1EFVA 2POQX 4NCXA 1NBMD 1PJ8A 3M6IA 3TCKA 3UJBA 4WJLA 4GX5A 3ZXXA 1Z34A 2FLWA 2QL9A 5A03A 3VOTA 2AXNA 2FMHA 4KUHA 1K75A 3ZU6A 5ADUS 2J30A 3HZHA 1GGEA 1O0SA 1TCAA 2R96A 2H4YA 2Y2UA 2WLSA 3FNIA 1PD0A 1CZOA 3K9BA 3IT0A 3KSRA 1VL2A 2VK8A 1PGOA 3WL5A 4DR1B 1YZFA 2BRUA 1EBFA 3RT1A 3OX1A 4BMPB 2IPMA 3HO6A 3E1SA 5TMPA 1E7MA 1XGKA 3T38A 3GOHA 5SYAA 1BHO1 1Z29A 2W2OA 5IAEA 4LF9B 4WZAA 3PRHA 2ET6A 3Q2OA 4M9RA 2PUWA 3UV3A 4DQDA 3NZEA 2G07A 1P3DA 1CRWG 4UBOA 4RA6B 1E9VA 5LXTB 1CCWA 1M2VB 3DEJA 5JNVA 1XJCA 1SPXA 1KMIY 1MOZA 2QQ5A 4PWZA 5DTMA 4DLBA 1OX6A 5C46F 1WBBA 5AJVB 2XWBF 1ZONA 1JEDA 3I9OA 4KODA 3WTBA 1BQ3A 1XVAA 4CQMB 2GKSA 4X8OA 4KDFA 2JCXA 4XTRA 3T5MA 3N70A 3N5CA 3CZ4A 4IXWA 1T9CA 2JJYA 3KOMA 4L3WA 1A9ZA 3WKBA 2BFCB 4DEYA 4NHOA 4X1YA 3L84A 2C9YA 3I9NA 3QG1A 5AI5A 2X42A 1M6YA 2V7GA 2G04A 2W11A 1DINA 2RGUA 4HAIA 1CETA 1KI1A 3RHZA 1EUDB 1Q19A 4DXDA 4EFKA 4Q7QA 4UTRA 5K3EA 3BK1A 4MGZR 3UFXB 4HZUB 5FV7A 2J7PD 2ZI6A 2O59A 4MV0A 5LKAA 3DZCA 1O03A 3VR3A 4HT3B 3MA0A 4ARCA 1I2DA 4R51A 4X63A 2QUIA 4F5WA 1ZHOA 4W5QA 2QAGA 4ZOEA 4F6CA 4XIFA 4QODA 1WETA 1G20B 5KIAA 1VQ1A 1CNEA 1YJBA 4FYXA 3N05A 3WYCA 3SYKA 2WR8A 2Q2VA 2YWGA 3QUTA 4GM4A 3CZAA 3W2HA 2PUCA 1OV4A 1CDEA 1Y1LA 2W22A 2ZJZA 1TMGE 5D86A 3DLCA 4HBGA 3RRYA 2DUWA 4ON9A 1QCZA 1YR9A 3QWAA 4RLQA 2J4CA 3U26A 1H4VB 4JEMA 4RF5A 1MFPA 3G85A 3JAKA 3PSAA 1PLJA 1GPH1 1N3IA 4UBJA 3GT7A 3CF4A 1GUFA 2IXAA 2WV9A 2XODA 2JBAB 5J63A 1M34A 1M0SA 1L6IA 1HORA 3GRAA 4WH0A 5TX7A 1T5LA 4Q1EA 1ML4A 4KLCA 4XUGB 4AZ0A 4WN9B 4YPFA 5EERA 2C98A 1L4GA 1UQTA 2VZLA 1V11B 2HKIA 1COWA 5SY9A 5JC1A 2B8JA 4RZ2A 2PAAA 3BD8A 5IK2A 5TDHA 4BWYA 3U19A 3VYRB 3RASA 3C3WA 2A58A 4K88A 3ND6A 1R88A 1RWNA 5IF9A 5E9JA 1VMAA 4KIFA 4LRTB 1KVTA 1A8UA 3ZQJA 4F2DA 1YUNA 3OHMA 5EKUA 3FM9A 1CUUA 4GMHA 2DQZA 2E1RA 4I9HA 4JELA 5EGNA 3VGPA 2EC5A 3EVNA 1VYTA 3Q6NA 3CWQA 4JL5A 4UBNA 3VUEA 3W4JA 4EUHA 3CH4B 2HEGA 1GM5A 4YUYA 3D5TA 5JVDF 2GJ9A 2LCFA 3UATA 5J23A 2AI2A 1ENPA 1FTWA 1JPUA 2DWPA 5LP6A 2QXYA 4GOMD 2WICA 3ISTA 4QE3A 4E5PA 4H4DA 3UAVA 6LDHA 1DCTA 1FJXA 5BNZA 4IINA 1AG9A 1QKIA 1A9SA 1T8UA 2CZGA 5IN5A 4C4TA 4EA7A 4F3NA 5FNVF 4NCIA 1W19A 5K03A 3QQPA 1DXHA 1G17A 1RI2A 4I6GA 2P9YA 4PC1A 5GV8A 3BPSA 1A1SA 4D99A 3D1VA 4MLDA 4WASA 4N5DA 3EZNA 4CF4A 2BFBA 1EAYA 1IL0A 1MA0A 4U7FA 3V8VA 4KWTA 3WGZA 3TG8A 4F4IA 3IUNA 2P91A 5FUMA 5LD2B 2P79A 2O4UX 3MTEA 3NGXA 2W83A 1M0TA 3SEAA 1KR2A 3NDRA 5FL7D 3ZCRA 3DTYA 2DJ5A 3AHEA 4KRXA 1H9CA 1JG6A 1NN0A 2O0LA 4LN1A 5HNKA 4K9SA 4C4SA 1E6CA 2ZJYA 4JI3B 1OASA 1QPBA 2CJWA 3GOQA 4E2YA 4MXDA 3FYTA 4WVFA 2C7QA 4RVOA 4JYAB 5DTJA 2ZVJA 3C7DB 3GC6A 3FNGA 4IJ5A 5DDIP 4FFBA 2VHVA 1CJSA 4IILA 3O2QB 4LRXA 3QIAA 3DF9A 1SC3A 1ZIOA 4HHEA 1KJ9A 1Y42X 4B4DA 5JH7A 1U0HC 2HQBA 1FIUA 2IJGX 1LLFA 1ODTC 1QB7A 3RFCA 4I9FA 1CJTC 4KYIB 3ZWXA 5KNDA 2E4XA 2X41A 1K5DA 3T3MB 1XJQA 5DM1A 5G4KB 2YHAA 4MRAA 4DF3A 1T6NA 4YAKA 2OHOA 5TVKA 5L53A 4ALMA 5EJ8A 4ZT5A 2HCBA 5BYAA 1IOWA 4HNRA 1K06A 4CKBB 4CLXA 3DR5A 3LV8A 2XWSA 3ENKA 3JWIA 3O92A 1NT2A 2W93A 4LE0A 4BB0A 4O1MA 1W96A 3LX6A 2HYDA 1ULTA 4HGPA 1YV9A 2QX7A 1R6VA 2PKQO 3HEAA 5B57C 1FFCA 3IXMA 2D4AA 4O1HA 1WDMA 1DBPA 1UKEA 3ICPA 4L07A 4F0JA 1MOQA 2C4MA 1K6EA 4JP2A 2FQQA 3GB9A 4BBPA 4BHTA 4CVNA 4OX9Y 3CUYA 1ZBDA 1NJ6A 2XKAA 1OWMA 4JP5A 4FWIB 1ZUD1 3WK5A 2UUCB 1JAYA 2AWNA 2I2FA 3OEED 4GD3Q 1W0JD 4TUYF 3D1LA 3FE2A 1I2BA 1RNLA 2PDAA 1U1FA 2WU1A 1KXJA 1MC4A 1JSXA 2ZDGA 4OFBA 4D0GA 2WSIA 1C7RA 1SY7A 1RTTA 3GFOA 4Z8YA 4EUKA 3VC7A 4BMVA 3OPQA 1GADO 3KZMA 1W2HA 4U8GA 3OWHA 3AZQA 4BVKA 1S8OA 2P8JA 1GA6A 1NQWA 1ZHFA 2GRAA 4OREX 1E2UA 3PR2B 3IP6A 3EJ6A 5LCXA 2N1MA 1RFLA 4NWIA 2DFNA 3LFTA 1L5QA 1GRRA 3LKBA 3QG5A 2X2PA 4KPEC 2XD9A 4OMFG 4Y98A 3KEOA 2BFFB 4J6EA 1CR1A 1DKNA 1FDTA 1ZJ6A 4INAA 2CDNA 2QTAA 1VJ1A 1H9AA 5I7HA 1JBQA 2FZ5A 2ODNA 4J90A 3LOQA 3GVCA 1H05A 3B1ZA 3NTRA 1V8OA 2XMDA 1GFIA 4YJHB 1JHDA 3FZGA 3FLAA 4JCOA 1EH5A 1NMYA 5ENVA 3TLAA 4MVWA 2WG0A 2IIPA 3IDZA 4GX0A 2JAUA 4W1SA 5EIBD 4BP3A 1TPYA 1WXWA 4YAFA 3ZWNA 1RMYA 5EVCA 1DDIA 2GK7A 2JZCA 4DUZB 1CJKC 2I6FA 1UOQA 4YT2A 5TS3A 1RWQA 3AF3A 3EGDA 3N7TA 4M1KA 4S1PA 3CT6A 2YV5A 1A9TA 2NXNA 3BRQA 1KBZA 4B48A 4CKXA 2BN4A 3CLSD 4PR3A 4G36A 5KVSA 5EJ5A 1I7PA 2BR5A 4OJKA 3IQHX 1R0CA 1T15A 1UJMA 1JLRA 3M4NA 5AJZA 1QX4A 3C1OA 2JFNA 2F3SA 3L1UA 5IPFA 4BQPA 2O19A 2JI7A 2GCEA 1NXWA 2KM1A 4NH4A 4RSRA 3NFRA 4AUNA 4ZJPA 1XVLA 3HKEB 4MEJA 5A2QA 2W2LA 5DIZA 4N65A 2BJWA 1OYVA 3VTFA 4AZSA 2JASA 4Q6BA 4KAXA 4F7WA 5ES4B 5AR1A 3HXOA 1EDEA 1VE7A 2ODQA 5TVGA 3OCJA 1Q3HA 5KTPA 3F5DA 1Q84A 2YWEA 5D2CA 1XMQB 5IUJC 1JQLB 2ADFA 5A5VA 1EFCA 2OBFA 2O2XA 1KP2A 1BWRA 1SCIA 4P4GA 5C8ZA 4INZA 4BPRA 1YVPA 4D43A 4B45A 3TDNA 1ESEA 3LLVA 3BWYA 4QFCA 3UUWA 4F46A 4CDGA 1PO7A 1H8EA 3HU5A 3V4ZA 1NBOA 1ENYA 3A4LA 4EEKA 3UMSA 4DJ5X 1LBQA 2IHYA 4EHNA 5E0OA 2G36A 1QHNA 1O96A 4WFQA 1S3IA 4YY3B 1KMMA 3R3ZA 4C30A 1ORVA 4AJ9A 1NR1A 1ZM7A 2AFHE 4MEBA 1WHSB 5DTIA 5FF9A 2J3LA 3R8XA 2IBSA 1NDHA 3MBOA 3ZJUA 4FM9A 1HX7A 1AKEA 2DY0A 4OGFA 4YP6A 4E1VA 3OOSA 1KQ3A 1FQKA 1U0BB 1GSHA 2PX3A 4DJFC 1Y33E 1V0JA 2QTVB 1P2BA 3BZWA 4ZWNA 5UKDA 1IOVA 4Z3KA 3R5HA 2H1CA 3RBAA 3RYCB 3IT1A 3F8SA 3LLCA 3VPBA 2B5OA 2CE7A 1IHYA 3CR3C 4L2IA 4YCAA 1JEOA 2H4JA 4OQMA 3WDKA 4CM9A 1SNYA 2IW3A 3ZHCA 4X84A 5AHWA 4AJPA 4EPYA 4YAUA 2XDWA 2D0IA 1Z5ZA 1SWVA 1US8A 1QP4A 3H0CA 4R40A 2IV7A 3QXXA 2XTAA 4O6VA 5LXTA 4FILA 1H6DA 4CT0A 1E3MA 3PRJA 1E6WA 1HQCA 2WZBA 3PC3A 1GTZA 3LYUA 5SY6A 1SXIA 3ABSB 4POOA 4BEWA 4CQMA 4WXEA 3LUHA 3UHAA 1PT6A 1KZ9A 4FDLA 3H1TA 4I4TF 1CT9A 3R09A 4TYYA 2VG8A 1SCAA 5DCWA 1G6Q1 4ZCMA 2J07A 1LBSA 2G9VA 1USWA 4IHJA 2B37A 3DDWA 4HDMA 4PZLA 4WSOA 4XFJA 5E38A 3LHSA 5JXGA 2CZCA 2IY9A 4LMRA 1MV8A 1QAQA 2DH5A 3K2EA 3WRYA 5GZ1A 2NLOA 4RHUA 2Q9AA 3R3JA 4F93B 5G1NA 2HWYA 1P1HA 2C00A 3CKYA 5F33A 2ISCA 2PWPA 2H2AA 2ZPTX 5IAOA 4BFTA 2CBGA 5I3ZA 3VDRA 1F38A 2QZZA 4Y18A 3L1KA 4J2OA 3B78A 521PA 4X24A 1O8CA 4E3WA 2AJDA 3OX4A 2E82A 1U5BA 3IVMA 1M3SA 5JJLA 2GA8A 2VXYA 3SR0A 3O95A 1ZRSA 2GHTA 4WLEA 3TL6A 1QG0A 4UD2A 3M8KA 1WXXA 821PA 2VPYA 1TK3A 3KHTA 5CAEA 4US2R 4G67A 1W5EA 4G1FA 4CLRB 1HRKA 4QXPA 3ZW9A 4TM8A 1TT5B 1H23A 4DJDC 1DZ3A 3LIIA 3O7WA 4NATA 4O63O 2OPHA 5B4UA 3N5KA 3FOEC 1PR4A 2CEAA 1TCBA 5KPJA 1AXRA 3KVVA 3HMKA 3L06A 3PICA 4AZTA 1U1EA 4XARA 5K0NA 1HZZA 3QEBZ 4KO1S 3EGVA 4CKCB 3FYSA 3Q3JB 5JD4A 4JYZA 3HK2A 4M0CA 3JQGB 4EBBA 4GPD1 4EL5A 3OM1A 2ZUTA 1T6XA 4ZV4A 1ZJYA 2GZHA 4JT4A 2VUUA 2XGJA 5JLJA 1UEJA 3C6QA 5KOIA 4DSOA 1V3VA 2EL7A 1RM3A 4BNHA 1OB2A 4I4LA 3IVCA 1RHKA 3ANLA 2O7NA 2KE5A 2VUIB 1KMHA 1KYXA 3NVAA 4DVGA 4LY6A 5DW0A 1ZCFA 1E69A 1ISHA 5A4KA 5BY2A 1AZWA 2BV3A 2E4AA 2GN0A 2FWAA 2HGSA 1NLZA 1D09A 1PBTA 2IY7A 2EBUA 3AHHA 1HDYA 4DYHA 1Q22A 3GT0A 2N75A 2PS3A 1BDBA 1NMEA 5FOUA 2Q7OE 4FHEA 3M83A 4NYMQ 2O2EA 4OJNA 1N92A 4HQLA 1RC8A 3P9CA 1WKCA 5AJWA 1RXYA 3E0QA 3FETA 5B7GA 1Z06A 4WXHA 2GESA 4N7RA 5SICE 3EIQA 2QTZA 2VJKA 3GNLA 3PXEA 4BKPA 2IPXA 2IV3A 2DPMA 2JGIA 2V6MA 5SY4A 2Q4EA 3UW1A 2I0FA 2LE0A 4MVXA 2EP8A 1V26A 3N8IA 4D9NA 2ZVPX 3G9XA 4C0SA 1G6KA 1JSCA 1JAHA 2FRDA 4NTZA 3NAZA 2VJMB 1Z63A 1GQFA 1DAIA 1U2PA 4P7BA 1PS9A 2GWRA 2ZVDA 3RSSA 5ANRB 3QUCA 5FL7A 4EK9A 2ZBQA 1SG0A 4D41A 2XTMA 3AK4A 2IEYA 4L0QA 3GA5A 1PQYA 1UXJA 3VPAA 2HMUA 3F7OA 1SO8A 1OFIA 3KKZA 4YMSA 4R1PA 2V5AA 4IGFA 3PTZA 4HLCA 4FIZA 5KC8A 8LDHA 2QTTA 4PRLA 3V2IA 1NA5A 4CTKA 4FYKA 4C2BA 3RWMB 5DLDA 1QMPA 3I92A 3HY6A 2R4QA 2WZCA 3B7PA 2H51A 3B51X 3JYOA 2FUCA 2HNBA 1AO3A 1LS1A 2YRFA 4MR7B 4AWBA 4BEVA 1UBRS 3TF5A 1NJ5A 4MSUA 5M34A 1VSVA 1JJIA 2BGJA 2QRZA 1K86A 2VHEA 3FAZA 1L6RA 4KXMA 4Y6OA 5G0WA 5L7YA 3R7FA 4B40A 1QQ7A 2ZYVX 4IJQA 2W0SA 3RF7A 5MDHA 3L4KA 4PG5A 3AUYA 2VSQA 1SQ0A 4MS3B 1HQDA 3GGGA 1BC5A 4LEIA 3GDFA 3NVKI 4XUEA 4NZ9A 4CCSA 2OMKA 4QGFA 4KQGA 1Z62A 3CRVA 4D4KA 1LUAA 1RPJA 4P6VF 4B47A 4F2PA 1A69A 3Q3GE 1TL7C 4LKOA 1PKEA 5L7WA 2ZJ2A 3RVBA 4HYQA 4XX1A 1UCFA 5CEFA 1A5TA 2GHIA 3DZGA 2O3JA 4CM4B 3UWSA 1RPAA 3WWZA 3K20A 3UJ3X 1CDZA 2BTOA 3G2OA 3UT0A 2ZUSA 1RJDA 4M1EA 2V8BA 3OEEA 1NUHA 2HU8A 1W0JA 3PQFA 4B17A 1ZVVA 3OF2A 4IQ8A 5HTOA 1RM4A 1Y98A 1U3UA 1L7VC 3ZHTA 1T26A 2AVNA 3T9EA 1J2YA 1D2CA 1DJPA 2CUTA 3FUWA 4FMDF 4NNPA 3TOXA 2K6GA 5JNLA 5E7JA 4DRZA 3L4JA 1QGED 1MVLA 2EZ8A 3A6GA 2F6RA 2JZNA 3GH1A 3GNTA 4PG6A 4DCUA 3I9MA 2NTVA 3ZWAA 1MGOA 1NLUA 1PAUA 1BMFD 2FFJA 3ESQA 3HPQA 5BSUA 2ZRBA 5JC8A 3ACDA 1OU4A 4UZFA 2BFPA 1WNTA 3SKVA 2DY1A 3AWIA 4X85A 1EP3B 3ACCA 4BJ6A 1V8DA 3N7UA 3BH6A 3C3AA 3FKQA 4PPYA 2FJPA 5G53C 4DBLC 1E2IA 1EMDA 2P41A 4I1SA 2VLIA 3H4TA 1CLEA 1X1BA 4UD6A 4XJSA 4BJ5A 4DILA 3BE4A 2HA3A 1NZJA 3LBIA 4ICIA 1XWWA 2WKPA 3E53A 2ZVQX 1ISFA 1OJ7A 3F74A 4UNPA 3S40A 4A2PA 5GVSA 2V3CC 5CNKA 1Q16A 3VO1A 4B3FX 1AUPA 4DQ0A 4LZLA 4XJVA 3E7PA 1SQGA 2NO7A 3K4PA 3OOYA 3U0BA 1XTUA 1NVKA 1YT5A 2QUKA 4JR0A 3ZKWB 3X1MA 2X8WA 3Q3EA 3G02A 4B4KA 2O50A 1PL7A 1RADA 1AC5A 1O95A 1S3FA 1ZS9A 2YL2A 3CX7A 2IIQA 4KYVA 3RVDA 2B2NA 2WWRA 4RMIA 1FYDA 3KJIA 2FSUA 2IZ1A 5BR7A 5IC4A 3FROA 1RDFA 4EI9A 2HQOA 1GFSA 4EMTA 2DUUA 4RK1A 1DIRA 2C2ZA 1ZYUA 2NUBA 2JIRA 3JPYA 1AKUA 4H7DA 4CIYA 4GVLA 2Z0MA 1P4JA 3AKCA 3E8SA 2E55A 5CB0A 3PX7A 1T0PA 5D7NA 2MOKA 4RHYA 4DLLA 2Q3EA 3UGQA 1LX7A 1TAHA 2OCBA 3L6DA 2ENWA 3PG5A 2A4MA 3N2IA 4LNUB 4XX0A 4Z4QA 3T12A 3ZCQA 5EQJB 1XMPA 1JQEA 2CZQA 5B3JC 1D7AA 2CUNA 4JXKA 4OB7A 2EERA 4C21A 1QZXA 1HT0A 3W3AD 1I3CA 2FUNB 1TZBA 2OHHA 3ZE2B 2AJBA 2NV2B 2ZUFA 5KJ1A 1UT6A 3JWHA 5HKLA 4D4IA 4EG6A 4WESB 1ECCA 4X45A 1X94A 4DTIA 1E3TA 1Q6ZA 2IYVA 4KBYA 1F7UA 3JX9A 3LBAA 1QRDA 1VYHA 4JUAA 2CJYA 4OYYA 3KKNA 3EXHC 4NKRA 1RQ7A 5DNAA 3C5CA 2XR1A 3GLSA 4XDZA 5AK0A 4KV7A 3ZDDA 1YZVA 2O7VA 5E4JA 3C7KA 1EDBA 2P6NA 4XQEA 1MF7A 3P7MA 2PMCA 3KJZA 2NT3A 1VKHA 1SUWA 1BGWA 4MQ6A 4RNDB 4A36A 4XUDA 1SC9A 3BBPA 5B64A 4N6NA 1CRLA 3S2EA 3E6AA 3L40A 4AN4A 1ZD8A 2HFJA 2XCUA 4J6FA 5CDUA 2NO6A 3LD9A 1EGMB 4MKXA 2GEJA 3VJMA 4MVJE 4YMHA 5B36A 3M6AA 2QZ9A 3W3AH 4B3TB 1Z12A 2YHSA 1FPQA 1RHQA 3OM0A 2OK8A 5D00A 2HIHA 2JAPA 4KMRA 4Z4GA 1Q1NA 2IYPA 1QUFA 3EOBI 1C4KA 3BWVA 3VOSA 4OQXA 1TI7A 3A1UA 1USGA 3I04A 1ZJZA 4WKBA 1NVVR 1IRXA 1ZFNA 3NDBB 2FPSA 1MNAA 1N2IA 4EY5A 3K3PA 3V7YA 5DGDA 3E22B 3QXGA 2ACKA 1R0KA 1E2PA 5ALGA 1Y9EA 3MS7A 2IC5A 4V02A 3AEQB 3URKA 1L1FA 2ZRMA 5T6BA 1OH7A 3D6TB 3N6RA 2QN1A 3H5VA 4H9GA 4V3BA 1FFWA 3BMCB 3A26A 3H9JA 3I6BA 3KKLA 3UT6A 4D9CA 2D8AA 2JGKA 4FJ1A 2EWWA 5FO0A 4QOEA 3TEJA 4CQLA 2OBBA 5J4VA 1X92A 1GPBA 3BIJA 5FLXA 2IVZA 4CG2A 4NE9A 1DRUA 1N0VC 2I1WA 4FN5A 1C30B 3BXOA 1K5PA 1NPDA 3RS7A 2IH4A 2CDAA 3B70A 3BMQA 4FDVA 3H2GA 3OU7A 1AXEA 3TJRA 1J6UA 1SIWA 1Q2UA 4NJEA 2PK3A 1E1QA 1NTOA 2CE2X 2FR8C 2UYYA 4B6FA 4BO5A 3SWWA 1MEOA 4ETMA 1J20A 1JA1A 1NNLA 4J0IA 1NVBA 4R4JA 2DF8A 2FN7A 2JJQA 3OKFA 3RVPA 3L0PA 1RAAA 2IUSA 4JOBA 2R8BA 1MX9A 1JT2A 2RGNC 3VO9A 3LUPA 4O2RA 1AUVA 1M6VA 1JQBA 2BJVA 3C8UA 3RC9A 3A9WA 3CUWA 4QNRA 2VUHB 5EC8A 4HQ0A 2FPGA 4C0LA 2B25A 5G2OA 3SJBA 1KRWA 1KI7A 5CVUA 3LPAA 3E5RA 4IRMA 2I62A 1KVSA 2CHQA 2FWJA 4R2HA 4BWFB 3ESDA 3V9PA 5ERGB 3DL4A 1KEEB 4RJLA 2FFBA 5EUCA 4QBGB 3WLAA 3HU3A 1BX1A 3WMEA 3ELBA 2F1IA 3CVOA 3ETCA 3PHBE 3PUKA 3VV2A 4BX2A 4CLEA 1D2HA 3UK1A 5JTUA 1MD9A 4QQKA 2QN9A 2B8WA 1VMKA 4C4ZA 2ZSKA 2XJ4A 5CTJA 3TNFA 1NDQA 4MS4A 1JB1A 1NWCA 1Y4DE 4QDXA 4CKCA 5IHPA 4OP3A 1XEXA 5IX8A 1ZK4A 5L51A 2XVMA 3TZ6A 2VRBA 3WLFA 4P92A 1C1DB 2ILTA 1FDVA 1PU2A 1UM9A 2FI1A 4FGZA 4MYCA 5IKEA 3B1FA 3EXAA 2B6HA 2YFYA 3DBLA 3GDGA 2YHBA 1YWGO 3VPDA 1Z4PX 1D0IA 4RDHA 4FTWA 1V2GA 5I7WA 4NOJA 4XI9A 3AETA 4U0KA 3QWHA 3EMKA 2NXEA 3AM5A 3LUAA 4Y30A 3RANA 4DA0A 2HX1A 4KPFC 1UJBA 4M8IA 2GPNA 1DJMA 3RYHB 3C24A 1R4NA 3Q3HA 1LRJA 3A05A 1ZSVA 3FNBA 3W7AA 5HF6A 2FSPA 5DLEA 4UHCA 3IBGA 2VPZA 5AW2A 2ZRCA 5CVJA 4TMVA 5L4LA 3KAKA 1KWKA 4R9VA 5A6SA 1JWBB 3GF4A 5AQ1A 4EYSA 2I3ZA 4P35A 1JPNA 1SQSA 2C4NA 4UTNA 3T0GA 5L8VA 2R3SA 4HLUC 1E1KA 3GPDG 4IX1A 1TMKA 5BSEA 3V6LA 2FMXA 2Z2ZA 5LDDC 4YONB 2VJMA 2VYND 4PZZA 4MDFA 1FX0A 3PR1A 5FHQA 1I4EB 1CE8B 3O9MA 3LFHA 2ADMA 2QMUA 4KPUB 5LMUB 3FPAA 2CBZA 3X1YA 1QRSA 1N1DA 3IEKA 2FPIB 4HAZA 4ANFA 4YJDA 5MN6A 3PUZA 2VZ8A 1YZQA 4HK4A 1FRVA 5ED0A 4YV1A 2PV0A 2B3DA 3BAZA 4Q4DA 1KK2A 4X1OA 2LKCA 4AY3A 3KFXA 3RHSA 4Z51A 2ZK7A 3KLMX 4QUIA 1P75A 2GVNA 4Q37A 3WADA 4C5BA 4CDMA 1VHDA 3IEMA 4F21A 2O5EA 4WNCA 5DNWA 4R8RA 1F4LA 1ZIYA 2YY6A 5CIYA 2AUNA 3ESBA 5FHRA 5HEKA 5L9AA 4ND3A 4KPYA 2WTXA 1XQ1A 3KQQA 4PPQA 1M33A 1LV7A 1P4RA 4GE0A 4C4XA 2R60A 3OF3A 2ZAOA 1T2UA 4KR7A 1YMVA 1FMCA 3GRCA 3QOFA 2WPDD 3UMJA 4EDHA 5JD5A 4M0PA 3ICEA 3D6HA 3EPKA 3AUSA 3JZMA 3L6BA 3KD2A 1SXPA 4G4SO 5CYPA 1EP1B 3NYRA 5B1HA 5G0SA 3AI7A 3NIGB 5ECDA 4W8GA 2JIBA 2ZRDA 4XTCS 2VYCA 2ZUVA 3SI7A 5IULC 5JY1A 2W9XA 5TIIA 2O54A 5T6MA 1BAPA 1GCUA 1M5UA 3AGQA 3I9V1 5HILA 1HYGA 3UQZA 3VAZA 4B4WA 4GAEA 5K7SA 1L8OA 5C9ZA 4A1OA 3AQ4A 3DP9A 3TZKA 3DT6A 1K27A 3CRRA 1M2FA 2LV8A 3GMSA 1B3BA 3PPWA 4QDJA 3TRDA 3WHKA 2GBIA 2I2WA 4LGYA 4J1TA 3LUJA 1MC1A 1T8WA 4FBGA 3JYPA 1N2CA 1O77A 2LRHA 3EEQA 4AXXA 4Y9UA 1FYEA 1VBNA 2CNWA 2PRJA 3B5IA 4EOGA 2QDXA 3EAGA 2A1UB 3DPSA 1NW4A 4IJUA 1KQGA 1Z18A 3WAGA 3UT5B 3VH3A 1WPGA 2IYYA 1VOTA 2Q62A 4LDJA 4LMBA 3DV0A 4P33A 5DLPA 3R8CA 2VHUA 1TK9A 2GA9A 4FZVA 3MM4A 1MJ5A 3BDAA 5FNVB 5HS4A 1C7FA 4YRCA 1YVDA 2UYCA 4NMXB 1CP2A 2C2OA 3TTWA 3J81k 3PTAA 2DTEA 1A95A 1M67A 4LJ9A 3IBTA 4X3CA 1V4BA 3TEFA 1BS1A 1N6OA 1W0CA 1ZOOA 3EXIA 3ZDCA 3UF0A 3ZLJA 3OIDA 3COZA 3KQMA 4XWKA 1I3NA 2BFEB 3NETA 1KMCA 2AUMA 1QNFA 2EKDA 2QN7A 4Q7MB 4Z2AA 1UKAA 2V4UA 3OUZA 5KQPA 2DP4E 4QNNA 3ZQ6A 2JKVA 3H2IA 2QL6A 3PGVA 1P4GA 1FTNA 4NU5A 4TTSA 2GBPA 4ML3A 4I55F 3R0JA 1NVGA 4AXBA 1GKIA 1LLUA 1KYIA 2EKBA 2WWWA 3G17A 3IRVA 1RZUA 3NEPX 3PXUA 3Q98A 4QX6A 1GSIA 3ZK8A 2VKTA 1QHIA 1CS4C 2II6A 4FR2A 4B8ZA 1SRRA 4QUEA 4M1WA 4Z9FA 5FXMA 2EWVA 5EXPA 3ZDRA 3NNNA 4B75A 5U9CA 4H17A 1E3IA 1X7ZA 1GL9B 1MVNA 2Z3ZA 3KS9A 5C8YA 1QBKC 4IDQA 4XM0A 3S99A 3ANXA 3A1CA 3AF6A 3EPRA 2XT0A 2HMAA 1SC6A 3I37X 1AMUA 3OQ6A 5C7OO 2PS9A 3ZTTA 5C51B 1TQ8A 4RO0A 4UXJA 3ESRA 4QFMA 3W5AA 1TA9A 1V8FA 4ZZ2A 3BIXA 4BRSA 1FXUA 2QVBA 3A6KA 1TTQB 1Z6ZA 3PE4A 2CSUA 4M6WB 4MINA 4GF5A 1W76A 4OQYA 5I7FA 3KP1A 3KEGA 1LW6E 2NPOA 1MB9A 3FCYA 5TGTA 1EM8A 3HEMA 3UMGA 4DMUB 3LUBA 3R9WA 4ENVA 2QI9F 3T15A 4CYMA 4EGCB 3CXRA 4PAWA 2ZYIA 1V96A 2XH8A 1JV2B 3JD0A 4MPRA 3T5DA 1QE5A 1EVJA 3BTUA 4FVTA 4LNUA 3TLGB 3UK2A 2AKAB 4PYJA 4WLVA 3M81A 3N9IA 3VYVA 5A0TA 4AW9A 3WIEA 2JLBA 1XU7A 1CZHA 4MVJG 4MP3A 5JALA 2JC3A 3UWKA 4Y1RA 4IIJF 4TUYB 5J1SB 1S8FA 2JCYA 1PL0A 3HI6A 4TROA 5CRIA 1WQ4A 4IYRA 1E59A 3KHSA 3UJNA 1RYHA 5BW6B 4BDTA 3GAMA 1QU3A 1M72A 3OP4A 2OXIA 4DB4A 1PVVA 1RRFA 2B0CA 3I2FA 1PJSA 1BJRE 3FDZB 4BXOA 2MYNA 4TZ6A 1J1IA 5BRJA 3EUAA 1CUXA 1GPAA 3JQQA 4FOOA 2RGRA 5M5BA 5HF9A 3IIJA 3AQIA 3ZN2A 4DV3B 1R18A 3HB9A 2BEUB 4RSHA 1M1YB 1OIWA 5G40A 4ZGWA 3T5PA 3LWBA 1A4RA 2JFVA 4DVJA 3G2KA 4L4SA 4U39A 4OAQA 4X8HA 5B4TA 1Y8AA 3O3MB 4NENA 1BJTA 4TKUB 4HEQA 4IUBS 5DW3A 3X1DA 4EAQA 5C8DA 1YZNA 1RCUA 1Q50A 1OYWA 4AZWA 4QZVA 3FLMA 5CCBA 1TD9A 4NU6A 1EE9A 5EJGA 2OV3A 1Y5NA 2WF5A 2F1RA 2QYOA 1V7PC 1MMFB 3FJYA 3E23A 3GARA 1G21E 4PCUA 4F9EA 2WFLA 3ANMA 2Q5CA 3D2AA 5KJ6A 4OM8A 5LYJF 1JS1X 3BF7A 1FSSA 1LW7A 1CUHA 2OGZA 2MINA 2WF8A 1Y3HA 5CLQA 4AO8A 1GJRA 5HJEA 2JRLA 3I76A 4LYHA 2A1TS 2SKDA 3BMCA 4KP7A 2NSHA 2VOEA 3C74A 1SA0B 4RORA 1NVVQ 3GDHA 4PLYA 2GBCA 1N6LA 1G0OA 3HH8A 3OE5A 1EQUA 1FPMA 1VJGA 3R2JA 4HFRA 4J1SA 4YACA 3B53X 3R9XB 1B73A 1GAJA 1PYOA 2E5FA 4TRMA 4CMCA 1UMCB 1D0SA 3MSXA 1SCNE 1T9KA 1XL1A 2C4HA 2DPYA 3LT1A 4EF4A 1WE2A 1MO4A 2BE7A 3N8DA 3HKCB 4IQGA 2A5DA 4E5YA 2ZR0A 1NONA 1QYIA 3ETEA 3GFTA 1HDCA 2ZYTX 3L7AA 4EHHA 1HNZB 1PJ2A 3R20A 4NFSA 2GAFA 4KLRA 5ESXA 3U3ZA 3EFOA 2QRKA 4CMEC 4ND7A 3SOPA 1E5DA 1K4MA 4FGJA 4E21A 4LS3A 2ETXA 3W5UA 1N9ZA 4Q01A 2QMQA 1EFKA 4IOKA 4LAFA 4KGZA 1E1CB 1C8LA 2PS0A 2XQJA 3TTSA 3UJHA 1EUQA 2J5RA 1TTHA 3MWGA 5IKOA 4IMJB 2VP5A 2RGBA 2AJ8A 3LCVB 3GY0A 1USKA 4YR7A 1W6UA 3OP1A 2JKZA 3B2EA 1A8HA 3AJAA 3QMPA 3M9XA 1GTMA 1O4WA 1FSGA 1ZM9A 4GYYA 5HA5A 2OOKA 2IWRA 3ZNOA 1SHUX 1TYDE 5GM1A 5E2BA 3V00A 1UANA 2Q9BA 5KU1A 1PJRA 3LLUA 1O97C 3W5BA 1IAQA 4Z3OA 3CNNA 2CHGA 2NM0A 3BX1A 2FN9A 1H5QA 1YBMA 4F56A 1N2OA 3P0RA 4QASA 3KJXA 2DR0A 1GR0A 1J5XA 1YZGA 3D0OA 1L4LA 1U9JA 4HD8A 1R0YA 1SBCA 1W87A 3DWGA 4GLFA 1X7XB 3MCAA 4M8KA 1H22A 3INRA 5ARCA 1FUUA 3UMMA 4M1SA 3WDMA 2ACVA 3PQ4A 1T36B 4RMNA 1GQSA 2R8ZA 1BD3A 2PMKA 1C1DA 2VPXA 1W1UA 1H0KA 3KVNA 2FUEA 3OF5A 1OYOA 4M86A 2R1VA 1XFAA 1JFSA 3KWMA 121PA 1NYRA 4MNTA 1R12A 5TMBA 3L6CA 2ONCA 2PD6A 4RETA 4IXNA 2WJ3A 1UODA 2ZJ7A 3JATB 3ND8A 4MUJA 4TL9A 5G0UA 5CDGA 3FG9A 5HHTA 1LPSA 3OZBA 1XZDA 2WSBA 2ZT7A 5HJ2A 1C7EA 4I4TB 3NC1C 2XLCA 2R25B 1E3WB 1MH9A 3UYLA 3OE7D 4XM2A 3R7SA 2XCQA 4A26A 4AKIA 1Y5LA 1MPXA 4UUPA 4EB6B 4ILKA 4XPZA 3RABA 4H6WA 1A5ZA 2G76A 3SAJA 3OIFA 4TQAA 1IZ0A 1JP7A 1ZINA 5ALJA 5C8XA 2X0DA 1KEVA 5LQRA 3AUXA 4R9RA 5J2UB 2YYYA 3K05A 3A6HA 3B38A 1NOJA 1W36B 1CQJA 3HEBA 2Q49A 2FE1A 2Y6UA 4KVAA 4OGGA 4IIFA 4ZVNA 3RJTA 1BKDR 3SSOA 5JCOC 3NJRA 1NUAA 1GSOA 3Q7EA 3UWMA 3OZCA 4PCLA 5K8TA 1CE8A 2X0NA 1ONOA 4TS3A 4TMYA 4EYQA 2I7TA 3EPPA 1KI4A 2FPIA 3DMPA 4B0OA 4PRYA 2WHRA 4BNDB 4LSWA 1QQBA 2PMWB 1RAHA 4EI8A 4XRRA 2WA1A