1Z29A

Crystal structures of sult1a2 and sult1a1*3: implications in the bioactivation of n-hydroxy-2-acetylamino fluorine (oh-aaf)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
288
structure length
281
Chain Sequence
b'SRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenol-sulfating phenol sulfotransferase 2
publication title Crystal structures of SULT1A2 and SULT1A1 *3: insights into the substrate inhibition and the role of Tyr149 in SULT1A2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 87
structure length 281
sequence length 288
ec nomenclature ec 2.8.2.1: Aryl sulfotransferase.
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z29A00
3SBEA 5AWFC 3FPAA 2O8FB 2GEVA 1XPRA 1XX6A 4J0QA 2XXAA 3FMFA 3H1TA 4D6PA 3O47A 1AIPA 5C2JB 2DY1A 5F2EA 2IF2A 1HURA 1T5IA 3OHMA 4V02A 1L4UA 4JJZA 2X2EA 3FFBA 1SXJC 1QZXA 2OE2A 4IOMA 2HYIC 2LKCA 1NSFA 4BLQA 2YWGA 2ZUCA 2ZJ2A 3VU9A 1WMSA 3Q9LA 4B48A 3F3YA 2JLQA 4IVQA 5E7IA 3RWOA 1YZQA 3AF2A 1G7RA 2ZRKA 4QBIA 4DSOA 5A4JA 3FKSD 4TMZA 2ZS8A 1G6OA 4NP6A 2W6JA 4EPTA 1BKDR 3IEUA 3SYNA 2QBYA 4CEJA 3IUYA 221PA 3PEVA 2VA8A 1HY3A 1IOZA 3UG6A 5C4MA 1ZC3A 4JVMA 4QHYA 1CBUA 2GRJA 4IKEA 4ARZA 2CL7X 3QKRA 2I3BA 4G3XA 1CR1A 4UXJA 4XVRA 3SHWA 3LLMA 5JI3E 4IOLA 5JI2E 4H1VA 2NIPA 4LJ6A 5GJVC 5IK2A 5ANRB 1LFDB 3WNCA 2R8RA 4Q9KA 2ATXA 4QC2A 4C0BA 3Q5DA 1UEIA 4B74A 4LOAA 1ZU4A 2ANBA 5F9FA 4HB4A 2P6UA 2R44A 2ZTSA 4UNPA 5FPHA 2C2HA 3KQHA 2ORVA 4CYMA 1ZIPA 2HF9A 3BB1A 3T1QA 4YMTA 1KI2A 4OI0A 1OXUA 2AXNA 4L16A 4RZ3A 3WYAA 4ZPXA 2G3YA 3U61B 4Q02A 2QPTA 2WIBA 5L3VA 1OH6A 5KPJA 2OBNA 1HT2E 1Z0KA 2AK3A 3U44B 1G3IA 1F5NA 4NHOA 5J40A 3KXIA 3VAAA 4TT3A 4BECA 3O8BA 5TV2A 2CHVA 3SYKA 2O8BA 2J9RA 3HR7A 4HAWA 3ICEA 5UKDA 1TMKA 3A4LA 2Z5FA 3BIFA 2EW1A 2ZYVX 5J4HA 3LBNA 3FHCB 3MAAC 4YXWD 5J4KA 2JJ1A 3F5FA 4MGKR 5DO9A 5C4GB 1QHHA 4EPRA 2CBZA 1RRPA 4TLAA 5FI1B 4OHXA 1KJZA 2R9VA 4C9BA 2REOA 3GLFB 4BASA 3WP0A 2ZJYA 4AWXA 1E0SA 2NOAA 3TGPA 2OCBA 4JIMA 4PX9A 4B3CA 1G9XA 1CJUC 1X8LA 1ESNA 2J5XA 1FQJA 1QDEA 1R0YA 3B1XA 3QENA 4JLAA 4DC9A 3G0HA 4KITB 1SXJA 4BGDA 2O8EB 2GVDC 4KXFB 3U3JA 4V0MA 4BFXA 3AKCA 4DLXA 3OIVA 4AYTA 1SVOA 4GOXA 2GNOA 4A0FA 1CEEA 2VF8A 3FFAA 4WW0A 5GJBA 1WQ1R 1RZ3A 3LW8A 1E32A 2GCOB 4QJ5A 4JT4A 1L8QA 2VBCA 1FX0B 2F9LA 1QHGA 1LB1B 1NVWQ 2UZ3A 3B78A 4C4PA 4CZ2A 3OAAA 1E2NA 3I5XA 1G4AE 5EXSA 2AFHE 4FI3C 2F1IA 3OE7D 3VTKA 4AKEA 4JL5A 3CPHA 4B2IA 4OQNA 2XTZA 3IQXA 3BWDD 3BGWA 5DE3A 4MRRA 4LY6A 2VHJA 3PUVA 2WJIA 2ZIAA 4HDCA 2W58A 3RS0A 1XTJA 3DPUA 3PEWA 4PC2A 1JXOA 3GJXC 2GZDA 2BOVA 1UEJA 3B8HA 4JZKA 1EWQA 1D8TA 2NO6A 1XWIA 3MFYA 4DEYA 3DHWC 3IHWA 3M1IA 4Q1EA 2IXGA 3GLIA 2IHBA 1CIPA 3DEFA 4N1AA 2ZE8A 1RJ9B 2OFOA 1BOFA 1NIPA 2WBLC 4Z1MD 1NBMA 2VSXA 3A6PC 5AUPB 3VQTA 4IDQA 4C0AC 1RRFA 2RHDA 2VP4A 2ZRCA 5EE1A 2RGBA 1K5GA 1KSFX 2W2TA 4KI0A 4TL7A 5GJCA 3RS2A 2V55B 1WBBA 1MO4A 4NYIQ 3A1UA 3E2IA 2C77A 5CDFA 3IQWA 4A9AA 4HB0A 4KV9A 4C3ZA 4KODA 2A2ZA 2WZQA 6Q21A 1HH4A 4URYR 4QNRA 1IJFA 5FTLA 1IY0A 1JQLB 5CK4A 4PR0A 3C14C 4TLBA 3ZYCA 1TU3A 2IYSA 4V0KA 1Q3TA 5H1YA 2ZSBA 3LH5A 3VR5A 1NN1A 1G21E 4YONB 5IT5A 1LF5A 1RIFA 4LJAA 2WJJA 2P67A 4LWZA 4A0HA 4NZYA 1F48A 4IDHA 3L0SA 4BFZA 1IM2A 1Z06A 3LWNA 1KI6B 4KHZA 5EP1A 3UPUA 2O8FA 2GILA 2RAPA 3GFOA 4M53A 4QGAA 3QXHA 4XD7A 4TMKA 5B64A 4EFMA 5BYKA 5DLQC 2NQ2C 3AB3A 3WY9A 4HUTA 1UADA 1ZP6A 1TF2A 2O0JA 5SZKB 4B3BA 4EJSC 1VMAA 5IF9A 1AN0A 3GFPA 4GI7A 3ZZ0A 3NDBB 4PHGA 3ZVMA 2IS4A 4URZR 1T3HA 2ZITA 1Q3HA 3EXAA 3KKOA 3TVTA 1SHKA 1A82A 2O52A 4LBZA 4B3DA 1M7HA 2FV8A 4G1UC 4RJLA 3KB1A 2QL6A 3ZIAA 1KDRA 4M8NE 1N3BA 3IIMA 1G3RA 3PVSA 1P60A 2XOKD 721PA 1I2MA 1Q44A 1U98A 4E07A 2QMUA 2CJWB 1TF5A 2CK3A 1NMXA 2WMNB 1XB2A 3RSOA 3B1YA 4NCJA 1DAGA 2VLIA 2QUZA 1XTRA 1NL3A 2C03A 4BUJA 1ZYUA 4WZ6A 3TE6A 3AKDA 4PQYA 2QI9C 4TTRA 1W2HA 1P5ZB 2FZLA 3HR8A 4IFEA 2OM2A 3MUFA 4Y0VA 4HLUC 4XJXA 1NG1A 4FMBB 3SR0A 1S1CA 2LKDA 2NZJA 4D82A 4B44A 1E6CA 2IYLD 4KVAA 5F3WB 2ZSEA 4W7SA 1DAKA 1R5BA 1S96A 1CJVC 4R2HA 4ILEA 1E4YA 1YZGA 5DYIA 4DUGD 4Q03A 3RHFA 5FR2A 2ZI3A 5AUQA 2ZR7A 1BS1A 4DCSA 2AK2A 2EFEB 3NEYA 1XTKA 4GOJA 2XSZD 1XEXA 3EA0A 1TU4A 4LRWA 2VP5A 3OEED 1E2GA 3L82B 4DSNA 2ZM5A 3KJEA 1OLOA 1P9RA 4Q00A 3MWKA 2X77A 3U44A 1F60A 1QVRA 2BEKA 3QVUA 3M0EA 2G6BA 1YQTA 3NH6A 3P32A 2ZROA 1G7CA 3A37A 3C5HA 2NO0A 2ZRLA 2JLXA 1ZM2A 1TPZA 3VFDA 2ZJBA 4DT1A 2GVZC 4KBFA 4WXPA 3P4YA 4Q18A 4FWTA 1E1RA 1XRJA 4JS0A 5CLQA 5HTKA 4Q5IA 4UKDA 3Q3JB 5BW8A 4JVLA 1U94A 2YOGA 1DAEA 1XNJA 5SZJA 1YR9A 2ZI6A 3UWKA 3RYTC 4WVFA 2REXB 2IK8A 5KSYA 3GLFA 2IYZA 5CB8A 1GAJA 4L9SA 1FNMA 2CNWD 4WOPA 4YMVA 5SZIA 3HP1A 1QRAA 2J87A 1JR3E 3ASYA 1CJTC 2GZHA 4DLTA 4EJSA 1NY5A 4OK5A 2P5SA 2OLKA 5KU1A 2GXUA 1DTSA 1AZSC 1UKEA 2YWFA 1P2SA 2ZI4A 5BN5A 1YU9A 2DWQA 1HTWA 3TLXA 2OLJA 1G3UA 3TUZC 1Q1ZA 1Z6YA 2B8WA 4ZIRA 3I62A 3TNFA 3OFND 4TWZA 4EPWA 1QHNA 3TQCA 1BYIA 3PUXA 1MKYA 4XWOA 2QGZA 5FTNA 2BKUA 2R2AA 3MJHA 4QXAA 1XBTA 5JSZB 2QAGB 1T6NA 2C5LA 2DB3A 4A0RA 4UNSA 2C8VA 3P26A 4OQLA 4XWAA 2DHRA 2WOJA 2IT1A 2PCJA 5BYJA 1QG2A 3UG7A 1UAAA 2XX3A 2C99A 1MT0A 2J7PD 3TRFA 3WYGA 1G8PA 2V8OA 3PCRB 4EAQA 3KXKA 3LBIA 1P6XA 2WIAA 3FVQA 1AQYA 4AD8A 2ZRHA 1BH2A 1E9DA 2DFTA 2FJUA 4HLUA 2ZJ5A 1KK1A 2IEZA 4D81A 4F93B 1E0AA 1AKYA 2HXSA 4KYUA 1XXHA 4KFRA 3PUWA 1L7VC 4PO1A 4PHTA 3LA6A 3OF5A 2FSHA 1LV7A 1KSHA 2ECKA 3AF3A 2XXAB 2H17A 4P3YA 4KO8A 1E9RA 2OCAA 3PUZA 1ZNWA 3KKMA 4NYMR 3B1ZA 2B21A 3CH5A 4PSAA 1P9WA 4PFSA 3FKQA 5DIFA 3U4QA 1OH8A 1AA9A 4RCZA 2GF9A 2RKOA 3OIYA 1SZPA 3QY0A 3AVPA 1W4CA 1YHNA 1R8QA 3IPXA 4JL8A 4LJ9A 2ZRPA 2XITA 3VU9B 2A5JA 4TYNA 4QBGB 4O25A 4Q01A 3IGFA 2W6ID 5JEEA 1VG8A 1CP2A 4DLSA 2GF0A 1FUUA 3I1FA 1NN5A 4CEJB 4OQFA 3UIEA 3GEHA 3LVQE 2ZAMA 1ZBDA 2F43A 3P1JA 4JVNA 3NBZC 4ARZB 2YJTD 3EARA 4PANA 4AG6A 4TZ6A 1LF0A 4LX0A 4WA7A 3CZPA 3TR5A 1W36B 4C7OA 1KAOA 3QI2A 4I4LA 5KSOA 4F7WA 3AQ4A 4UQOA 5LB2A 4H1UA 2DR3A 3BB4A 1L4YA 4JBWA 4LYFA 4ASUD 2BMJA 2KBEA 1E9SA 2IEYA 5FUYA 3GJ7A 3BK7A 1JJVA 1G8YA 2H92A 2IYXA 1E94E 2IYWA 2WKQA 2IS6A 4M9SA 4C2UA 3KFXA 2JGNA 1FQKA 5L3SA 4PZZA 1BMFD 2RGDA 1N6NA 4IW3B 1U81A 1OIWA 2CVHA 2EWWA 5FL3A 1N2CE 2FX3A 2CHQA 2Q3FA 5BN3A 2QAGC 3PEUA 3UWOA 2N1BA 4OHWA 3I8XA 1G5PA 2CJWA 1P61B 1MV5A 4M1KA 3ZQ6A 1TTTA 2R6AA 1S9HA 3NC0C 1G19A 1NMYA 4ZDJA 2CDNA 2WJHA 2BBWA 3N2EA 2G88A 5K8IA 2XZLA 3QKTA 4BFTA 2O8BB 3A1SA 1E79D 4Q7KA 2XB4A 3AVWA 4MRNA 5KDOA 4FW9A 5KDLA 4IHQA 521PA 2JIZD 1YR7A 1KNQA 4MGIR 1ZD1A 1JXMA 2CE7A 1VCOA 3QBTA 1QF9A 1XTQA 3TK1A 2VP0A 5HKKD 1XJQA 2EVWX 4QG7A 1B0UA 5EP4A 1QHHB 4JL6A 4AKGA 5AJZA 4TYPA 4OYHA 4TMVA 3C16C 4PHFA 1KK2A 1N25A 3PENA 2HDNB 3UMFA 3SJZA 1Z3IX 1R5OA 3CIOA 4M1TA 1TAGA 3UMRA 4M9QA 4DSTA 5EE5B 4FD2A 3RANA 1KO4A 3QQ5A 1Z28A 4MYUA 1DE0A 1AQUA 4JKIA 1IQPA 2W83A 4MQBA 2BMFA 1SXJB 1NJFA 1KK0A 1IN5A 4ACBA 2QSZA 3D7MA 2ZI7A 3WHLA 4HB2A 2NO9A 5DN6A 2B8TA 2IYUA 5CJPA 4E09A 4G5GA 2FZ4A 5FUWA 3B85A 1SVLA 1X1RA 3SHFA 4CIDA 5FPKA 4C30A 4LC0A 4MGYR 3AVTA 1DG3A 4D0GA 4DLYA 2R62A 3SFZA 1VECA 3ZVNA 2PT5A 3MJRA 4HSEA 4MRVA 2VSOA 1N6KA 1IN7A 3W90A 1Z63A 4NCNA 2VSFA 3K9HA 4UJ5A 1XEFA 3FKSA 1WF3A 5DHAA 3SYLA 421PA 1E2EA 3PJRA 4CEIB 2GJSA 3RC3A 2WSMA 4U02A 2QAJA 3EC2A 1VG9B 3KUDA 4A0GA 2FF7A 4WAUA 2VP6A 1XEWX 3L0OA 3TBKA 4RD1A 4B6EA 4C0HA 4NPHA 3LXXA 5E7MA 5FI0B 4X8MA 3BERA 1XMJA 4DIDA 2V6JA 3GLIB 2OT3B 4KCGA 1IONA 2IL1A 2IHYA 3THYA 4HLCA 1ZNYA 2RGEA 1Y3AA 1JR6A 1KYIA 1E9AA 2W00A 1OXXK 1JJ7A 3LQQA 3CB4A 2FSIA 4PHHA 4X8OA 5JJKA 1IJEA 4FMCB 5CM8B 1M7GA 3HJNA 1CJKC 1MH1A 1AGPA 2KB0A 1XDBA 3QJYA 1SHZA 4RD2A 4A2PA 1EWRA 1XJCA 3Q72A 4IRUB 1W47A 2NG1A 2PCLA 4P4UA 3W8NA 2BC9A 2EYQA 2J0VA 2P0EA 3X1DA 2YZ2A 4A36A 1IY1A 3O8RA 3HU1A 3C5CA 2J7KA 1IN8A 1Z07A 2ZYUX 4Q4JA 4QRHA 4W5JA 2QGNA 821PA 3I5YA 3TIFA 1KI1A 1SKYB 4K46A 2RGGA 4DLWA 4B3FX 3LNCA 1RE0A 4DLUA 3WXMA 4RKEA 1YE8A 1G41A 4FMDF 2VTKA 5A0FA 2FPMA 3SZRA 5EE9A 3GLHE 2QU8A 4LUCA 1Q1QA 3QF7A 3FOZA 1RVDA 3LO5A 1FNNA 1VKJA 2AHOA 1Z2AA 2OG2A 2JDIA 3EZ9A 4B6FA 4TL6A 1DVRA 1ZJ6A 3QOFA 1YZNA 3DMNA 1E0KA 2GXSA 4IFBA 2ZUDA 5KSZA 4NYMQ 4MITA 3IKJA 5LB4A 3C7KA 2DFKB 1OKKA 2VHQA 1COWA 3T5GA 4MUAA 2PL3A 2QP9X 1Q21A 3DMDA 2Q0HA 3GQBA 5JJLA 1WA5A 2IYVA 4HEJA 3SE0A 3LQRA 1J90A 2FFHA 3BJIC 1J2JA 4ZCLA 5GJWC 4OK3A 3M4YA 2FSGA 3T5DA 1P2UA 4D0LB 3ZQJA 1W49A 1VIAA 5FOXA 1M2OB 1U2RA 3NVAA 4M1WA 4RVCA 1ZM7A 2A5GA 2ZPTX 3N70A 2QG6A 1ZUNB 4I81A 2F3TA 2BBSA 4DDVA 4TTQA 3Q8XB 1E96A 1CU1A 2ZI5A 1E2DA 1E69A 4EQ6A 1DADA 4N0DA 4LV8B 4XH9B 3A4NA 5K8LA 3DM9B 1W4RA 2E87A 2WWIA 4JYCA 4HB3A 2QA5A 2GETA 2W0MA 4FIDA 2KI5A 2XTNA 4C0LA 1T4GA 1ZNZA 3KX2A 4RSGA 1E9EA 1TUEA 2WTUA 1ZRHA 2IW3A 2FMXA 1A7JA 1ZUIA 4JLBA 5CLLA 5JBQA 4TTPA 3EPJA 4B71A 3OIWA 3OE7A 1EFRD 2X1VA 3MG9A 3VR4A 1OJLA 1ZM9A 5B58C 2ZR9A 4NONA 3HDTA 4EUNA 1KK3A 4POAA 4EDHA 4DDUA 2QT0A 2MSEB 3L8YA 5BXQC 3SN6A 2FH5B 1JBKA 2CCGA 3BH0A 1XF9A 3U2QA 3GP8A 5TB5A 1P3JA 3U3MA 1XEXB 1AS3A 3AGPA 1GNQA 3NIBA 3QG1A 5AJVB 4KLNA 4BFVA 1GL9B 2UKDA 1II8B 2A78A 3EPHA 5TMPA 1Z0AA 1GILA 2VRWA 4M2LA 1N6LA 2F1RA 4URWR 3QG5A 2FPKA 1NF3A 1J8YF 1XU4A 4Z1MA 2WKPA 1XCGB 1HEIA 2HEIA 4LC1A 3MLEA 3GLGA 1E2QA 4DT1B 4XVUA 1ONBA 4BLTA 4O2LA 1DARA 4DCVA 1U0JA 1TF7A 3RRZA 1UM8A 2ZANA 5L3QA 3D6TB 4IOJA 3SOPA 3GCGA 1KSGA 4EPVA 1SVMA 2O0HA 3K70D 1KDOA 4I1OA 4YDHB 3UXMA 3GEEA 3W5IA 2WSSD 5JWOA 2P2LA 1DAHA 2ZRNA 3IEVA 1FMJA 5HE9A 4ON9A 2HT1A 2ATVA 4PQFA 1I4TD 1QHSA 2WWGA 4F4JA 3QXJA 3U3RA 4W9MC 3H4MA 4TL8A 2QMEA 2QZ4A 2OCYC 2ZI9A 2FFQA 3B2EA 4BFSA 4TLEA 4XOIA 5BWMA 1ESMA 1UKYA 1DAIA 1J7KA 3FHOA 4DJTA 2OILA 5GVSA 4EJSB 1UBGA 1KDTA 4HAVA 2Z0MA 1P7CA 5LPNA 1AS2A 2QM8A 3PV0A 5D3MA 4AIIA 1G3MA 4TLDA 2J0QA 3KJIA 5H8WA 3RC8A 4LHXA 4CT4B 4RY2A 3E70C 2WAXA 5A5GA 4HAUA 2BWJA 1N5KA 5JFGA 2YINC 4JYBA 4ZIRB 4BLRA 1EX6A 2G0NA 2XTMA 5FOTA 4PAMA 4BFWA 1G291 1NLYA 1SULA 2O8CB 1OFUX 1Z6XA 2CVFA 3HU3A 4OHVA 1D6JA 3ZVRA 2A5DA 5HR5A 3GJ5A 1GP2A 2PEYA 3W5JA 3TSOA 4HLDA 4DKXA 3LVRE 3L0IB 5JWRA 4DB2A 4OI2A 4FCTA 4CEIA 1RPZA 1WBDA 2XOKA 4UJ3A 3VNVA 4M1MA 1CULC 2BBTA 4CW7A 1E98A 4ZI2A 3I8SA 1KZ7B 4QHTA 2D06A 3IBYA 3QF4A 3CO5A 3AP1A 3NBFA 4Q7LA 2AD1A 3KKPA 2FA9A 3SDZA 3VNUA 2F1HA 4KU4A 4GZLA 2XEXA 5J4LA 4Q9JA 1TQ2A 2PMDA 3H84A 1XXHB 2EWVA 2VHUA 1OH7A 1Z8FA 2IBMA 4NMMA 4FN5A 4P4TA 1FW6A 4TZ0A 3JVUA 2R6FA 2QENA 1N6IA 1QBKC 2DCUA 1PLLA 2NO1A 1GOTA 5IDVA 4WIAA 1KY3A 4MKFA 5E4FA 4ESHA 1OIXA 2HYDA 2XJ4A 2C9CA 3H86A 3B9QA 3U4QB 3I92A 4TMXA 5G3YA 3UANA 2G1JA 4DUGA 4XTCS 1R4AA 2CEAA 3AVXA 2OUKA 3DDCA 4E5UA 2ZRDA 3CX8A 4O2RA 1Q57A 2AKAB 2C96A 621PA 4MGZR 1N6OA 4ESVA 1FTSA 2XSZA 1I4LD 2A9KA 2X8AA 3LLUA 3OEEA 4JSTA 1KSJA 2EFGA 4HI0E 1W5TA 1YZLA 4PO9A 1PV4A 3AUYA 4DXAA 1R7RA 4JLDA 5AUNB 2QTVB 1D9ZA 1KKMA 1DS6A 4HLQB 2WWYA 1N6HA 2JASA 2REBA 1EX7A 4IDOA 2GK6A 1CJMA 3ZGXA 1SGWA 1PLKA 2F43B 2F1JA 2H1LA 2ZRIA 3A36A 2AWNA 4LBWA 1VPLA 4CGZA 1VYTA 2RHMA 4RD4A 1E1QD 3K0CC 3R9IA 1XMVA 3CW2A 4FCVA 1G64A 1W2GA 4G5OA 2ZSDA 3W6NA 4AURA 4MKGA 4C7OB 1II9A 4AY2A 2IF0A 3ZZUA 1GRNA 1U99A 3WRYC 3GJ6A 2P5TB 1GVNB 4JBYA 5AJYA 4NE2A 1YZUA 1Z0JA 4F38A 2QY9A 1K5DA 2CNWA 1SXJE 5L3SB 2G0TA 3OESA 1ETUA 1G7TA 4V0ME 3TW8B 2V7QA 1SVSA 2AFIE 1NG9A 1T8TA 1IN6A 4WZBE 3HU2A 3H0KA 1JNYA 3LD9A 1G1MA 1JPJA 1K6MA 3NG1A 2IS1A 2H5EA 3CRW1 4Z8XA 1VCIA 5FL7D 2QORA 3T34A 1TL7C 4OJQA 2J45A 4Q66C 1RYFA 3OFNA 1OF1A 5E3HA 4RZXA 5J4YA 4U7DA 4LJ4A 4PSKA 3DZDA 1IXZA 5BN4A 2ODBA 1VCNA 1HE1C 2Q9AA 4FINA 5CB6A 3MCAA 3U7GA 2HJVA 2IX3A 2JLUA 4US1R 5DI3A 4Y0AA 4UNQA 3U6BA 2CCKA 5DGXA 1CS4C 3ND9A 3K0FA 1OFHA 1II0A 2HT6A 2JJ2D 4DLRA 2J7PA 4CDGA 4DEXA 3DKPA 1KMHB 1O3YA 5FOUA 1GL7A 4AKHA 5DI9A 3K9LA 4TYQA 3U7EB 1S9DA 3EG5A 2PZFA 4JLJA 4Q1FA 4MRPA 2BVNA 3CR8A 4BZQA 3CZQA 4M4SA 1NBME 2ZRFA 1N5IA 3QIAA 4GRAA 3KL4A 1QG4A 5FPTA 4B47A 1II8A 3RRYA 3I3SR 2Q9BA 1T0HB 1Z47A 2IC5A 4NCKA 2AX4A 1P2VA 2V54A 4OL0A 2OCPA 1U90A 1ZIOA 3AV0B 4AK9A 1H8ED 4W5WA 1KI3A 2GZAA 2VP2A 3KB2A 3R9XA 1FTNA 2FDCA 3W3AA 4LGMA 1JEDA 1FL9A 5CDFE 2XNDD 3CLVA 3LV8A 3AP3A 4JSYA 3L2OB 2DWOA 1W48A 2W0SA 1MO6A 3KQKA 2Z43A 4V0NA 4KFTA 2XZPA 4XVQA 4LK2A 3QUSA 2WWXA 2ZE6A 4L15A 5EE0A 2GAOA 4LZZA 3HWSA 4BRWA 3ADCA 2PX3A 1YKSA 2NZ8A 5AJXA 2UZIR 3ZS8A 4R71A 2W6IA 3DKVA 3NWJA 4MYTA 4A6XA 2HUPA 1RW4A 5H70A 2WOOA 3MWJA 1M74A 1K8RA 3K0CA 3OZXA 1CTQA 1CXZA 4PC7A 2PMKA 1E2JA 3F8TA 2XZOA 5AR1A 1JR3D 4PPGA 4MKHA 1J8MF 1KI9A 1ZINA 4M1SA 1Q22A 2GESA 3BE4A 2B92A 2PEZA 3RRMA 2ORWA 2YNMA 4M22A 1KTVA 1MR3F 2J1LA 3CX6A 4JLNA 3R7WA 3QXCA 3SU8A 3THYB 1S3SA 2QP4A 4TMTA 2YC4C 4P33A 4R98A 5B2ZA 2DYKA 1ANKA 3V9PA 2IXFA 4ASUA 2YV5A 4LCBA 3AGQA 2EFDB 2IYYA 4JBXA 3WNDA 2A3RA 2ANCA 1VYUA 3A8TA 3ZIAD 2O8CA 3ICQB 2SHKA 2YVUA 3EASA 3B1VA 4M0LA 1E2FA 3QSYA 3EIEA 1Z0IA 3HYTA 1JALA 3AF0A 1JAHA 1U0HC 1C9KA 4U5XA 2IWHA 5FOVA 1NJGA 1EXMA 2D7CA 1AJEA 4OI1A 1FFHA 3VKHA 1KJWA 1EFTA 3LFUA 5FBWB 1B23P 1CRPA 1R0XA 2JLSA 4FWIB 1ZU5A 4Q4JB 1KKLA 1P62B 5LDDC 1OYWA 3AKEA 3K09C 3VR3A 1UKZA 1XTSA 2BM0A 3THOA 1G5RA 1XD2A 3FYHA 4E22A 2A30A 2VYFA 1R8SA 3ADKA 2YYZA 4HATA 3AF1A 2WHXA 1CR4A 1TQ6A 3K9NA 4GMXA 4GT1A 3QPUA 2GCNA 2AL7A 3AVQA 2QP3A 1QVAA 2NMVA 1IXSB 2JIZA 4IOKA 4C0KA 1DBSA 1OW3B 4QBFA 4US0R 4EFLA 3GPLA 4IEIA 1ZC4A 5EE3A 1BO6A 1MABB 3THXA 4JLPA 1TEVA 5HKKA 1A2BA 4JMPA 3IO5A 1UJ2A 3WBJA 1NNEA 4EPYA 4AG5A 1OPXA 1YJ5A 3W9YA 3I4LA 1D9XA 3ONWA 1E2LA 2FPLA 3TVDA 4EKDA 2I1VB 3ETLA 4QGHA 4NL4H 2BM1A 3IDQA 3JVVA 4QGGA 4D4LA 2D3WA 1TNDA 1P4SA 1FMLA 5M04A 3B60A 1SQ5A 4RD6A 1RFLA 3GEIA 2TMKA 4ZCIA 4DZZA 4NCHA 1VCMA 5KNBA 2YHSA 4LJ5A 4PXAA 3OEHD 2OO7A 4EQ6B 4F92B 2AN9A 2MMGA 1AZTA 5FBLB 1WE2A 1TADA 3EW9A 1OV4A 2ODEA 4WBSA 1E4VA 3PR1A 3TSWA 3VR6A 3ZDQA 4US2R 5JECA 3GLFE 1X1SA 1KY2A 2Z83A 3GD7A 1KO5A 1OFTA 4KJZA 3X1YA 2WPDD 3HPQA 1OHHD 3A1WA 4PC3A 1E2HA 5DISB 1J99A 1R0ZA 1GL6A 4ZV4A 3BFKA 1U8AA 4A4DA 4HYYA 4EPXA 1IBRA 1W46A 1UPTA 1GITA 1UDXA 1P75A 5KO2A 4FMDB 4LYJA 1Z6GA 3CM0A 2JLZA 3AVOA 2JA1A 1DPFA 1OYYA 2P65A 2BKEA 1G5TA 2WJVA 3CKLA 3KUCA 1F3OA 5CYOA 5GVRA 1MO3A 5FTMA 4AYWA 2AD5A 1PZNA 1H8HD 2V1XA 1WXQA 1T8UA 2FGJA 2H16A 2JEOA 4RKFA 5FFMA 2RGNC 3T1TA 3EPLA 3G82C 4JT2A 4OQMA 2OFXA 4GDFA 1NVVR 4H9GA 3L43A 1FOEB 4RZ2A 2CCJA 3CRRA 2D2FA 2GJ8A 4II7A 3QEOA 1XJ0A 1ODFA 3TAUA 4BLSA 1JB1A 1NIJA 1E2IA 1ZMXA 2J3EA 4AI6A 4JLVA 1VTKA 3GLGB 3O8CA 4DDTA 3PEYA 4R9UC 4RFSA 4LJ8A 3V4FA 4PTLA 3C41J 3AP2A 3KTAB 1KAGA 5FOWA 1X86B 4HAZA 1W0JD 4Q47A 2OHFA 1TUIA 1CF4A 3R8FA 3K09A 5L3QB 1Z08A 2QE7D 2C9YA 5J5CA 5B57C 2H8KA 4LHWA 3U6KA 1EGAA 4DCUA 1KMHA 5C1BA 4AYXA 4QM7A 2HF8A 1UBEA 1XXHE 4KVGA 2GKSA 5KYKA 2YC2C 4XIGS 2BMEA 4BFYA 3TMKA 2K5UA 3K70C 4Q1BA 1HYQA 4LPKA 1JI0A 2WWHA 1T91A 3QKSB 1FUKA 2JLRA 1W1WA 2GJKA 2W2XA 3N2IA 4BRUA 5J4VA 2ZJ8A 5D3MB 4B43A 4UNRA 4NYJR 4FCWA 3GJ3A 2QMOA 2PBRA 1W0KD 2E9SA 2XGJA 4K8OA 2KWIA 4LPSA 4E03A 4Q1CA 2JLVA 1O87A 2XB2A 2AWOA 1GDDA 4PPFA 4MDEA 4DSUA 2BEJA 5JHHB 1WRBA 4DDWA 1XPUA 3MSXA 3O8DA 2PX0A 5DSZA 2JLYA 2D7DA 3CONA 4RCYA 3C8UA 4P0TA 1G7SA 1XMIA 1S8FA 2FEMA 4A92A 4X8LA 5DHFA 2ONKA 1GTVA 2QPOA 3QPWA 4ZI3A 1SVIA 2W2VA 1IXRC 4URXR 3C4JA 4GPTA 1XCMA 3QF4B 1CLUA 4DB4A 4L8GA 2CXXA 3CH4B 2VH5R 3E1SA 4C2TA 3TQFA 2AXPA 2WMOB 4TQ9A 2ZRMA 1A5TA 3K0EA 2MSCB 1Z6AA 4M1OA 1U8ZA 4NDZA 1JPNA 2ZVQX 2GEUA 3PIRA 3A4MA 4IDNA 5EZ6B 4A15A 4AKIA 1EFRA 2NTYC 2IUTA 1WP9A 1E9BA 5JMTA 1G8GA 3P20A 4XSGA 3THWA 2RGNA 4GP7A 1R6BX 2FGKA 1R5NA 2OXRA 2OEPA 1VYVA 3CF0A 4MUBA 4CT5A 3CRQA 3IBGA 3LXRA 4TL9A 4ZKEA 4BEJA 3TR0A 1HV8A 1MOZA 3AKYA 4DCTA 2ASEA 5FUVA 1EFCA 1XFAA 3DL0A 3NDPA 3AVVA 1DELA 3B82A 3IPYA 4TYYA 1G8HA 2WJYA 3B1WA 2VPPA 2HLDD 3LX5A 1OSNA 1SVWA 3DOEA 3BH7A 3WNBA 1JQJC 2VP9A 5CK5A 4Z54A 2GDJA 3LBHA 4LHYA 2IWRA 2LCFA 4M1YA 1US8A 1XP8A 1ZD9A 2F9MA 5DYGA 4DBLC 2GJ9A 3PQCA 3NXSA 1PUJA 1PLJA 1MABA 1IHUA 4MRSA 4YXWA 3WMFA 4BZXA 5K8UA 4QOSA 5FTJA 2AKYA 4HUQB 2ZJOA 2GJAA 1QHIA 2ZS9A 2WSSA 4A6PA 1EG7A 3RSLA 2J0UA 1ZNXA 4I1UA 1WDTA 4OQXA 5HZHA 2FEOA 1RC8A 1ZD8A 2ZE5A 3BORA 1DO0A 1GZSA 1GSIA 3BOSA 3VMFA 4EFNA 4P32A 4Q9LA 4MA4A 2O8DA 4C0JA 2WJGA 1S3GA 1IAQA 2EQBA 3CX7A 5DN6D 4A8JC 1A4RA 3UATA 1NY6A 2IUUA 4D2IA 3V4RA 1VDZA 2YWEA 2NPFA 1U8YA 3LDAA 2GA8A 3JZMA 4OHZA 1DOAA 4L4UA 1KZGB 4XTRA 2C78A 5JRJA 5EUQB 3OIUA 1NKTA 1X6VA 4JVSB 3RNLA 1DEKA 1FZQA 3AUXA 4EIWA 4URUR 4QJ3A 2O0KA 4O3MA 5DNYB 3JZAA 3SNHA 1IY2A 2Z6VA 3EIQA 3MGCA 5EXPA 3CPEA 3EZFA 1NLFA 5F9HA 4LBVA 1M1YE 2WM9B 1EK0A 1KMQA 4LSGA 1ELOA 4PPNA 5C18A 3R9WA 2PLRA 2GWHA 5DI3B 4LYHA 4B75A 4GP6A 4ACAA 3K0FB 2WWFA 3U60B 4TSFD 4LHVA 2C04A 1CKEA 3PG5A 4QFMA 3I32A 1D2MA 2ZYWX 3BB3A 4QHSA 2ZUBA 1NLZA 1GKYA 1NP6A 3FDIA 1XTIA 4KYIB 1EFUA 2GAAA 5G3ZA 4NBSA 4TMWA 4V0LA 1NVVQ 3IIJA 4CEHA 121PA 1ZW6A 3QXSA 4B3GA 2ORIA 3VX4A 2QT1A 1G3QA 3K0SA 4UXHA 1J70A 1LNZA 2V6IA 4IXMA 3WRXC 3SI7A 1AGRA 4Q1AA 5FBRB 4KFUA 3PUYA 2OSBA 3QBVA 2VO1A 2RGAA 3KTAA 1FP6A 3FMPB 2GK7A 2FE4A 5EUMA 3W6OA 4F4CA 1D5CA 3D8BA 1V43A 5FPSA 1ZCAA 2ZYTX 5G53C 3T35A 4WXRA 3N5CA 4QGFA 1LS6A 3RLFA 2O5VA 4QJ4A 4HAXA 1NMZA 5G40A 4YMUA 4Q4HA 4G5RA 4PC6A 2QM7A 1X3SA 1MRNA 1BYUA 1S0UA 1Z22A 2DWPA 3VR1A 2JDID 1Y63A 3U3KA 3GMTA 3QKSA 4IXNA 3E5HA 2OXCA 5L3RA 3V00A 2PLFA 1ZUHA 2OFWA 5K8TA 4G5SA 2OBMA 1UDWA 1OKKD 1XZPA 3WHKA 1E1QA 1COWD 1RKBA 1KGDA 1X8KA 2D74A 3LW7A 1MO5A 2R6CA 4NYJQ 4O0MA 5FTKA 3B9PA 1S4QA 3R7WB 5KSPA 2F6RA 4P4SB 1I2DA 3BRWD 4FMCF 3KQUA 1GKIA 5KOYA 4PAQA 4MYHA 1ZM3A 2GTPA 1KOFA 3IHLA 3WBKA 1Z5ZA 4YDSA 3I61A 1F2UB 2CE2X 4A8JA 1KI4A 3RWMB 2QEQA 3B13B 2JLWA 4Q9IA 1D2EA 3ECCA 2W6JD 3LY5A 1MRSA 3QVVA 4B2LA 3Q7QA 3I72A 4G01B 3S1AB 4DCNA 3EPKA 5LD2B 5CYPA 4D80A 2ZRGA 2RGCA 3AM1A 2RH5A 1YRAA 3KQLA 4OBEA 2OESA 1ZM4A 3KXLA 1Q1BA 4D4KA 4GZMA 5TARA 1S2MA 4ERNA 3A1TA 4BEBA 2V4ZA 2X2FA 3AEZA 2ZEJA 2RMKA 5FL7A 1W36D 1XD2B 2ERXA 3VHXA 4Q19A 1T0JB 2AR7A 3GJ4A 1M34E 5EZ5A 5IK2D 5KPDA 3NBYC 1DAFA 2GXQA 2C95A 2GCPA 3L8ZA 4HZIA 4XWKA 4BLOA 5JJIA 1SVKA 3BXZA 2PZEA 4JJKA 3D3QA 1F2TA 3VHLB 3THXB 3RVBA 2VEDA 3TKLA 3CBQA 2JJ2A 3U5ZB 4BZPA 4BWYA 2D4HA 2BHRA 3ZH9B 1OE0A 3CNLA 4OJKA 1TQ4A 3P4XA 1W44A 2J46A 2ZJZA 1N6PA 3R8CA 3EAQA 3CRMA 1Q20A 1P72A 4GBMA 3CNNA 1LS1A 2Q9CA 1DO2A 4GNKA 4TT3D 1WCV1 1N0WA 3DOFA 3NTUA 3GLGE 1UKVY 2GBLC 2KE5A 3QE0A 4KLZA 1ZAKA 3CUEF 2F7SA 4LJYA 1W4AA 3GFTA 1P9NA 2EFCB 2KBFA 1H8EA 3AVUA 2ZQ5A 3IO3A 4CRWB 1OB5A 3ZD7A 2X19A 3K0AA 4LHZA 2XNDA 1UBCA 3K1JA 2NPIA 4GOKA 2WVJA 3W8RA 5JRZA 3NC1C 1ZVQA 3SJBA 3UKDA 4HZUA 1Z0DA 2BBOA 3J81k 5HPYB 4D26A 2JJ1D 2ONJA 2ZE7A 1NSTA 3EZ2A 3EA5A 2UVQA 4NTZA 3RABA 2CLCX 4DLVA 1G4UR 5CIWA 3WYFA 1KJYA 3K53A 3X1XA 5EJEA 4HUQA 1EESA 3EZ6A 2CMKA 4QKQA 2MSDB 3TAHA 2Q21A 1KHTA 1NN3A 3A1VA 3BFVA 4PZLA 1KIMA 4LBYA 3UMSA 2ZRAA 4Q21A 3PFIA 1SXJD 2FOLA 3Q5EA 2PT7A 4Q4AB 1E3MA 2QRNA 4B73A 2OAP1 3AH8A 5ELXA 1JR3A 3EWSA 4Z8YA 1VG1A 3I73A 4CVNA 3QKUA 2BCGY 3T1VA 4IJMA 2HJGA 5FPYA 2I1QA 2DPXA 2VF7A 3BS4A 3CNOA 1KNXA 5H68A 2C9OA 2FFAA 1YZKA 3BD9A 4D0NA 1GNRA 4FXPA 5E7JA 5LD2C 1TX4B 1GIAA 2CL6X 1E2PA 3OAAD 1GKUB 4TN1A 2YKGA 4DLZA 3EWAA 2NO7A 1XD9A 3SJCA 4ZDKA 5J47A 3FTQA 4RFSB 1ZCBA 1NKSA 1TEXA 4PSVA 1OH5A 3EX7C 1JECA 2IA5A 1JAIA 1E9FA 4LJ7A 4N0EA 3B5JA 3UK6A 3T06B 4D25A 2ZAOA 2VIIA 2CLSA 2A5FA 3D31A 5CIQA 4IVRA 2WV9A 3GLIE 2ZREA 4GFDA 1KO7A 1U9IC 2QQEA 3BAFA 3GJ8A 1KI7A 2CL0X 3ZLJA 4K81B 3VKGA 4JKYA 5AJWA 1XZQA 5JHGB 1NBMD 2B7BA 3SQXA 2YWHA 1HT1E 5KTYA 3RS3A 1KDPA 1W4BA 2IXEA 4OI4A 1M8PA 3W3ZB 3A58B 4CF7A 3GLHB 1N5LA 2G83A 4ZKDA 2QQ0A 4NKRA 4KSCA 3KJGA 2IYRA 1AKEA 2Z4RA 3T61A 2QMHA 5IRCD 3REGA 2QRZA 2WICA 1HA3A 4Q48A 2ZR0A 4ABYA 1GRRA 1G20E 4MYCA 4S35A 3SBDA 1IN4A 2OBLA 1LY1A 2GBLA 4JLOA 1SKYE 2F3RA 5KNDA 3U3OA 4B2PA 4KFSA 1N6RA 2YOFA 2V9PA 3SEAA 2EU8A 5FH9A 3RS5A 1C1YA 4B35A 4ZCMA 1HQCA 1GM5A 2VHTA 2PJRA 3AF4A 3WP1B 2PJZA 3NKVA 2IYTA 3T12A 4LV5B 4KAXA 1NVUQ 2XNSA 4XD7D 2B7CA 1Z0FA 1VHLA 4Q9HA 1M6NA 1KO8A 2IS2A 1GG2A 3FHTA 3OEHA 5KHOC 3MRSA 4A2QA 2BIFA 1HE8B 2DFLA 1I4DD 3KKQA 1T5LA 1Z29A 3FMIA 3X1WA 1VIYA 2WKRA 3FGNA 1OT3A 2H57A 4DWJA 2WPDA 4P4SA 1OHHA 5TVKA 1P2TA 4LV6A 1W5SA 1AK2A 1Q0UA 5L8VA 4QNMA 5JLJA 4LI0A 4Q7JB 2ZU0C 4BLPA 4UNNA 2Y8EA 3C15C 5BQ5A 1OB2A 2FNAA 2V7QD 3THWB 1LTQA 2GHIA 1F2UA 1UBFA 1YR8A 1GRQA 3SFVA 1FPMA 2ZETA 1RRGA 1BMFA 4Z51A 5EP2A 1LVGA 5JWHA 3S1AA 2O8EA 3KQNA 2CK3D 3RS4A 1H8HA 2P6RA 2R65A 1UFQA 3MWLA 5CM9C 4R2IA 2ZXUA 1AS0A 3LX8A 3TUIC 2G1KA 4D4MA 2QTHA 1Q12A 4JLKA 2BCJQ 4TQAA 4TYWA 3VX3A 2XAUA 2GCOA 3Q85A 4RFVA 1E2KA 5HCNA 1FX0A 1VHTA 4ZDIA 3TJZA 5IHPA 2HCJB 4Q4LA 3SJAA 5F98A 1KI8A 1VG0B 3IILA 3PITA 1N0VC 2L0XA 5JCPA 2ZSFA 2BJVA 1N0UA 3B7GA 1E79A 1LW7A 1T3SA 2R6GA 1U0LA 1W0JA 1OFIA 1US8B 4KBGA 5G41A 5TXGA 1PJRA 3QPVA 5FBQB 4Q1DA 4PPQA 1E0JA 4M21A 1U9IA 4I1VA 3KJHA 2D62A 1Z6TA 2QE7A 2WWWA 3H2YA 3P27A 2BDTA 4PC1A 2ZSAA 4B32A 3K70B 2LWIA 3R20A 4XSHA 1E2MA 4RD0A 4BQSA 4IDPA 5P21A 2J0UB 3ASZA 4YC7A 3K9GA 5CITA 2Z4SA 3KDSE 3DZ8A 1RJ9A 5FUXA 4PQRA 3BBPA 3T1OA 4PO8A 1YRBA 1CR2A 4G0NA 1SKQA 2JAQA 3CWQA 3DO6A 1R10A 1HUQA 2ZRBA 2Q3HA 2O8DB 4RZUA 2P6NA 2J59A 2JJ8A 4S2EA 2PH1A 2Q3MA 3MWYW 1E1RD 3DM5A 4JLMA 4NH0A 5JS7A 1KO1A 3KFVA 1NN0A 2HCBA 5JCZA 1W0KA 1Z83A 1A2KC 1R0WA 2H18A 3CWZA 2IUSA 3L0PA 2OV2A 5EP3A 5EXTA 4A2WA 4F4IA 5GADl 2BMDA 1M7BA 2EFHB 4BPBA 2CHGA 3QNUA 3PXGA 1C4OA 2I4IA 4PAOA 4MDFA 1RYHA 1BIFA 3F0TA 2IYQA 2QBYB 4DIEA 1KI6A 3X2SA 3FE2A 3X1ZA 4YMSA 4X8HA 4V03A 4Q4AA 3QKRB 4M9ZA 2WAYA 2D2EA 2P3SA 1GFIA 4OKSA 3B6EA 3LAWA 4URVR 2J0SA 3ZZTA 2ERYA 1XEWY 4V0OA 5JS8A 5HE8A 2A7QA 2HV8A 4C0QC 2F55A 2FFBA 2RGXA 3EIHA 4CEHB 2QSYA 3MD0A 3ZD6A 4YLGA 3QEJA 3RAPR 4L9WA 5D3QA 2RCNA 3EZ7A 4KSBA 4OK6A 4P31A 2ODWA 5FOSA 2ZS7A 4B76A 4MKIA 2VHCA 4QBHA 1QHXA 4UXIA 4B33A 1YR6A 3G5UA 4ZDWA 1P73A 4A82A 2N42A 4D4JA 5E95A 3AVYA 2KSQA 2N46A 3KKNA 4G5QA 2QTFA 4AC9A 4I1SA 4N3NA 3ADDA 4DRZA 1XPOA 3TSZA 2PZGA 3W6PA 2BV3A 1E9CA 2VL7A 3ZJYA 5KUTA 1RRCA 3M6AA 4Q4HB 1EFHA 5JZVA 1R2QA 2FWRA 3FMOB 5TY0A 1V5WA 1CRQA 4GL2A 2ZRJA 2DFNA 1G6HA 2HLDA 3NH9A 1AM4D 4PZYA 3TUJC 2G9NA 1OXVA 3GLHA 3GJ0A 4YMWA 2ODNA 2ZVPX 3ADBA 1W7AA 3KZ1E 5HZKA 2Q6TA 1DAMA 4M9XA 4ZO4A 4OHYA 3RS7A 3VR2A 1G17A 1QHYA 2FSFA 1XCPA 1GNPA 2J41A 2A5YB 1A1VA 1TQDA 3BFXA 1GWNA 4HAYA 3SS8A 1JEEA 3Q7PA 2H7VA 3HPRA 5JEDA 5FBVB 2NGRA 3IIKA 1FP7A 1OXTA 1Q1EA 2KJQA 1E99A 3WMGA 1UF9A 4I99A 4F91B 2YOHA 1YVDA 4LDJA 4A8JB 2FN4A 2JATA 3LRPA 5B30A 1WB9A 1Z2CA 3BH6A 3NHBA 4MH0R 4C0SA 1L2TA 3CPJB 2E1RA 3CF2A 5CJ2A 1XMSA 2RB4A 1D2NA 3FB4A 4NCIA 1DG1G 2QN6A 4DHEA 3NHAA 3FWYA 3EC1A 4Q7MB 1N5JA 3U7HB 1T9HA 2R6DA 2QROA 1OXSC 1PVOA 2JCSA 3BC1A 8OHMA 3K8YA 3U7FB 5KDDA 1F6BA 4IVPA 2V3CC 1S1MA 4R7ZA 4B34A 2BJWA 5AUOB 3ND8A 1NRJB 1OIVA 1W36C 4QM6A 4A1FA 3TW4A 4LYAA 3SC3A 2CLDX 2XJ9A 1CR0A 4GMDA 3NBXX 3HYRA 3W34A 1G8FA 5DH9A 5TDHA 1F2TB 4BFUA 5C46F 1NI3A 5LBIA 3VKWA 3CR7A 4TSFA 5HCIA 4NU0A 4HDQB 2G77B 1HQYE 2FU5C 5EQTA 1NVXQ 2GXAA 5SZHB 2ZU6A 4DVGA 4RD3A 2OZEA 3REFA 4WZAE 2ZJAA 3RRNA 2FG5A 4BE7B 4W5HA 4U00A 3CF6R 1PUIA 2VQSA 3NEJA 4L5BA 2MMCA 1H65A 4B3XA 4NYIR 3K0AB 5AK0A 4QL3A 2QNRA 5JSZA 2QAGA 4ITRC 5KNCA 1G16A 4TQUS 4IEEA 2C98A 2V1UA 1G18A 3ZS9A 1YZTA 2QPAA 3MMPA 4HZUB 4TLCA 3ZVLA 3WMEA 3TH5A 2HXYA 4GSYA 1XD8A 1GUAA 2GEDA 3CRVA 3SQWA 3DVLA 4HDOB 5EXXA 3RDPA 1X8JA 2OAQ1 2B6HA 5FR1A 3QXXA 2DBYA 2EYUA 3T15A 1T3LA 4YQFA
chains in the Genus database with same CATH superfamily
2GUWA 4PEVA 1BS9A 3ZNNA 1H2BA 3H18A 3I9OA 2P62A 1WEHA 2NX2A 2AFRA 4P3YA 4GC9A 5AWFC 5GAJA 3FPAA 1OR8A 3PFGA 4BNIA 3OQHA 4Y2JA 4YAJA 3PTLA 4DA7A 2VDNB 1AV6A 4E5SA 5HQTA 4TS4A 1V26A 3H1TA 4D6PA 4OHFA 3N87A 2AH5A 4EB8A 2DY1A 2PJUA 5F2EA 2P35A 2IF2A 4AJKA 3OHMA 1CZOA 2CLFB 3UQYS 4JJZA 4K9KA 3B51X 3JATB 3FFBA 3PPWA 3DWIA 3I45A 4D57A 5JANA 2OE2A 3G68A 4KQWA 1UP4A 4MVJD 4X6YA 5JY6A 2I62A 2YWGA 3DG9A 3DHYA 4QPJC 4CMJA 5KINB 4Q3AA 5AM0A 2Y67A 4BWGA 1BEZA 2OGUA 3F3YA 3UAVA 4H4EA 4NECA 4Y2XA 1ST2A 5E7IA 3AF2A 2ZB4A 5BSGA 4C89A 4MVJM 1Z7YA 4DSOA 3DR5A 3EVEA 4BKPA 3FNIA 2W6JA 4IJQA 1I30A 4NP6A 1C9EA 2WY2D 3B52X 1E4EA 3STTA 1WZ2A 2QBYA 1P45A 5TRTA 4PS1A 4CEJA 4FOSA 2P2DA 1RTTA 1U5AA 1PN3A 1JWBB 1PWHA 3DZGA 4MJLA 1ZC3A 1DDIA 3L41A 1WB5A 4NMXB 4IKEA 1QRTA 1NQTA 3ZR4B 2Y92A 4D7AA 5ARBA 4G3XA 3VO8A 1SBNE 4IZ6A 4JQOA 4XVRA 3WLLA 3N0TA 4YR7A 3IDFA 4I55B 3UFXA 3R0VA 5CB4A 5JI2E 1VJCA 1VLVA 3CIFA 2H00A 2GDZA 1YL7A 3WNCA 3FPGA 3ZJ5A 1I2BA 1ZSVA 1T36B 2R8RA 5I9MA 5KVSA 1WW2A 1Y1QA 1GSOA 2R4TA 3HYNA 2EJUA 4NAHA 2IH5A 2XTJA 1RLMA 3PNYA 5A5VA 5F9FA 1E5LA 3TLYA 1TK3A 3HS3A 5TQ2A 2QNIA 3O21A 1HNXB 2GARA 2P6UA 4DMLA 2QD1A 5FPHA 1JPVA 2C2HA 2V0GA 2AOTB 4BMDA 2I4RA 5GONF 5DTJA 4OI0A 1G38A 2ZQZA 3DVAB 2QNBA 1ISGA 3GFGA 3IE2A 3GAFA 5L3VA 2E49A 5EKTA 2J3HA 4ZHQB 1TO1E 4FKMA 2MHCA 4WMLA 3TE7A 3LC7O 3O8BA 4IP0A 4BECA 3FPCA 1IBCA 4MDHA 1OZAA 2IIQA 1VL5A 4ERXA 3UA4A 2IY7A 2YXEA 4QEKA 5EZSA 4EGFA 3ICEA 2LVBA 5UKDA 1PQWA 1YNOA 3E22B 3MJSA 1J5EB 1R0SA 3BIFA 2EW1A 2ZYVX 5ALVA 1EHIA 5J4HA 3FHCB 1G8KA 1DDOA 2XY4A 2G9VA 3MAAC 1CP3A 1MJFA 5AW7A 5J4KA 3F5FA 4MGKR 4DNXA 2BSQA 2JZNA 3PB3A 4K6KA 4OHXA 5FI1B 3THRA 2RGRA 4RZHA 3QJ5A 5HKOA 1N9GA 3EQ7A 2G9UA 3RSHA 4F1WA 3EGDA 2NOAA 1H23A 4PGMA 3ZDYB 3LUCA 4WPGA 1SN7A 4PX9A 3EGXB 3FYUB 2GLUA 3TTSA 1X8LA 2ZB2A 3RHSA 1FQJA 1GA1A 2EEPA 2JPDA 3ESZA 2ZIZA 3JAMA 4PQGA 3WQSB 3LBAA 1JR2A 1NONA 3G0HA 3T38A 4KITB 4BP9A 2YL2A 3U3JA 4CXMA 2NVWA 6YASA 5CVVA 2HRQA 2WFAA 1DLJA 3AKCA 3O8CA 1SVOA 4GOXA 4YYEA 4C29A 1Z4LA 3JD4A 2EGGA 1Y9DA 2ZRQA 3N0WA 2NVUB 5GJBA 4WZBA 1QZUA 3FCOA 1V45E 4JT4A 5B1DA 2ZTUA 3B78A 2F9LA 1P0MA 2HZBA 3MOGA 4N5MA 5KQMA 2CXOA 3DV2A 4EGQA 1JBQA 1Z8DA 3OKAA 4FQ7A 4EKYA 2R7KA 1TKAA 3CEPB 2DP4E 5EXSA 1DQSA 2AMFA 2F1IA 2X3UA 3MILA 4CCYA 5MN4A 1EUDB 3E2MA 2VA9A 3BWDD 3IQXA 4M88A 5JASA 1GL3A 2E37A 4LY6A 2I87A 1K27A 2RH9B 1R0LA 5CXUA 2WJIA 2ZIAA 4TSKA 3NHJA 3KZMA 4L85A 1XTJA 4D3ZA 1UZMA 1JXOA 5BR4A 2Z8XA 3R3SA 1DWUA 4MGEA 1UEJA 1ULAA 4ALLA 4A73A 3HGMA 4F56A 4MS3A 1SD1A 4DEYA 4DNFA 5KYXB 3L6CA 3DHWC 2J5KA 4Q1EA 4F9FA 4BB6A 3H2ZA 2AJCA 3GEDA 3ZV6A 2IHBA 1GZUA 3PGMA 2O6LA 3N76A 5JROA 3MINB 1WSBA 3TD6A 1NBMA 1H05A 4WCDA 5D1HA 2B9EA 4UBOA 3NRJA 1JBEA 3IP9A 4C0AC 3A6PC 2RHDA 3BMCA 1ZCZA 1K5GA 2NU7A 2VWHA 1EUCB 3UJHA 2YDYA 4BMOB 4QXOA 2ZT8A 1H0KA 2ZATA 4RKYA 3TN7A 5BXYA 1YJ8A 3QVWA 4NYIQ 4RJIA 3TOSA 4DR6B 4UE6A 2WD7B 2C77A 1D2AA 2VKTA 2E89A 3O3NB 2P4QA 1QV9A 1LK7A 4O4IB 4C3ZA 5L7TA 4YY3B 5DCWA 3V9AA 1JSLA 4N9WA 1KP3A 3GFFA 3ENZA 2QX9A 1BEUB 1JQLB 1RM5A 2V74B 5C0OE 1TU3A 2IYSA 1F1JA 2O4UX 5H1YA 4I3FA 2ZSBA 3AEKB 3LH5A 4DBLE 1BE8A 2I4MA 1RAFA 2II6A 3N6XA 5IT5A 4PLWA 4CCSA 4IX9A 4CTOA 2A1UB 3P0HA 3OMLA 3QFCA 3I42A 1MN6A 4ZQHA 2GO1A 3G2LA 4C08A 4IDHA 4RTLA 1IM2A 2CXNA 4BO3A 4F5EA 2Y1FA 2NU9A 1JE1A 4URFA 1TM2A 5DGTA 1E3JA 1SXGA 1ZI8A 4XD7A 2LE0A 3SPXA 3NPAA 1V8ZA 1WUYA 3IQEA 4TMKA 3ZV7A 5K6AC 2OCLA 1D5WA 1RJGA 3O8LA 1ISIA 4CMEA 1UCFA 2AW3A 2W93A 1T1GA 3LP6A 4B6OA 1Q0RA 4CQMA 2HJ9A 4B3BA 2Z09A 3A0UA 3QKWA 2J9XB 3AR4A 1AN0A 5DLPA 3GFPA 5DM0A 2YCBA 5CVDA 3NDBB 2PYDA 2H9YA 5KWJA 4P7JA 4PHGA 3Q88A 1V7QA 3JQFC 5A3RA 1ZH6A 2ZITA 4Q3NA 3NKLA 3FTEA 3KKOA 3TVTA 3RBZA 1U1EA 4UAJA 3W2GA 1KFBB 2P4EA 3KEFA 4A5OA 1NJ1A 2ZBFA 1NVFA 4MA5A 2GM4A 2O2DA 3ABRB 2POCA 1KS2A 3KB1A 1H22A 2W2KB 2QL6A 3GGPA 5HIMA 3ZIAA 4LRUA 1B15A 3UOGA 3IUSA 3AINA 5HDQA 1O6FA 1JI3A 3IIMA 4B84A 2QRVB 1DLIA 4MWOA 2BEVA 2AKEA 2Z1DA 1QUEA 3II6X 1KEWA 1U98A 1ZUNA 4E07A 4B3TB 3AY6A 3OE4A 1SCDA 4JQCA 3ROGA 4IHJF 3SQDA 2X41A 2WMNB 3E53A 5HRUA 3AXTA 1QOQB 3EA4A 1ZX1A 3ETNA 3DOOA 4NCJA 4BB5A 1AZLA 4E3WA 1A2OA 3ELYA 5CYGA 1H0SA 3TEJA 1ORWA 1V1MB 1ZYUA 1UBHS 1Z0ZA 2V45A 4QXQA 2BGGA 2OC4A 2QI9C 4TTRA 1P5ZB 4AJOA 2OM2A 3RCBA 3CEHA 3PDHA 4L0DA 4HLUC 2VJMA 4XJXA 4FMBB 1XMOB 4IO1A 4F72A 1S1CA 2LKDA 3H5WA 1WV0A 5DU2A 4C6TB 3P2MA 2FHPA 1SBZA 3N39C 5AKZA 3D43A 4LNUB 5EGSA 5TMBA 1DAKA 1R5BA 2DWUA 3IHKA 4N48A 1CJVC 3QV1A 4ILEA 4RTKA 1GZ6A 1KWKA 2DULA 4AY6A 1X7WA 4G0ZA 5FR2A 5AUQA 2O2HA 1BS1A 4DCSA 3WO0A 4EA7A 1K06A 3ED5A 2EFEB 1RAHA 2ZPUA 2IBSA 1U1DA 1XEXA 2G28A 2PKWA 1ZIYA 3FDZA 3UUGA 3MUNA 1NWHA 2WRZA 2PL9A 3BUSA 3L82B 4KE6A 2B4QA 1R4NB 3NALA 1OLOA 1PL6A 2D1SA 1LWOA 3JWJA 2X77A 3HJRA 4Q00A 5AOCA 3RB8A 3UW1A 2IEBA 3WGZA 3MBIA 4P86A 3IAXA 4BNUA 4EZIA 3NIWA 3M6LA 5B5SA 1IOLA 1Y8RA 3STYA 2IOFK 3ICCA 2ZRLA 3DTTA 3G7NA 4RPKA 1KH3A 1TCCA 2JLXA 1EINA 1V41E 2A14A 1ZM2A 2X42A 3N58A 4QASA 2GVZC 4QYSA 4DT1A 1Q0SA 2C54A 3IIIA 3QGMA 4LC9A 4LFBB 1JPUA 1IM5A 1QXSA 1LJLA 4CR7A 3TIIA 4JS0A 4L4XA 4W5QA 4K8RB 1C9MA 1GR1A 3BSFA 2C94A 4PYMA 3H9JA 4JI6B 3LSTA 1U5BA 1XNJA 1XXLA 3EVCA 3C5EA 3C3DA 2WFZA 2P90A 4B83A 1P1BA 2ZI6A 1K7FB 3RYTC 1RJEA 2CYBA 4PR3A 4XLZA 1SBCA 1PR6A 3F67A 3IT3A 4IQ4A 4L9SA 3MMNA 4P92A 1ETHA 3UW3A 4F86A 4TWIA 5JNVA 4RV9A 4WNYA 3K35A 3V4ZA 4YMVA 4M38A 5LDHA 4QG3A 2A86A 2JLCA 2VYQA 2J87A 3V2UA 3H2HA 2IOHA 4MPJA 2B1RA 5IN4A 5L40A 2GZMA 2E5LB 1ZGJA 4WOKA 2D5AA 4OLJA 4EJSA 1X1QA 3ZLBA 3PXAA 4FNOA 1ZN8A 3SQMA 2JFXA 4IMRA 4E1VA 2Q2WA 3VU3A 3EBLA 1P2SA 5DWDA 1L7QA 1LDYA 1UC5B 3ACCA 4CLOA 1YU9A 2DWQA 1HTWA 1LNQA 4TTJA 2EZ4A 1TAHA 4QOIA 3OZFA 4OLAA 1G3UA 1G42A 1EPUA 2O1XA 4RQBA 4R7GA 5EQJB 1YJXA 5IYZA 1A4XA 1JGTA 2B8WA 1GFZA 5HFJA 5IBRA 3TLJA 3FLBA 4ZIRA 1XRPA 4EYQA 1SJ9A 4TWZA 3KO8A 2CD7A 1QHNA 4GX5A 3ZHXA 1EXNA 3D6MA 3AW8A 3MPOA 4M0CA 2QGZA 4F0JA 2JGJA 5LP6B 2ZB8A 3G89A 4A0RA 1J9EA 4JP2A 1ZN9A 3P26A 3M1YA 3A06A 1NKVA 1HLGA 4JBGA 4XDYA 1YI1A 1UAAA 5DF1A 1PI3A 2WABA 4QUKA 3WYGA 1ONNA 5ENZA 4F8JA 3PCRB 3K71B 2RDMA 4UZEA 5NULA 4WCFB 4YJHB 1GZVA 1KVQA 1WLSA 3NIGB 2HD4A 2AI1A 4Q93A 5IAJA 3RYHB 1AQYA 4R2LA 4EVQA 1R1DA 2DFTA 2C5AA 5A2QA 3W5CA 2AMJA 3KSUA 2UYGA 2DPHA 3CVUA 4KQ9A 4PIMA 1NVEA 1UBRS 1RWPA 3USZA 5KNBA 5DM1A 4FS3A 1FYFA 4XFKA 3FSGA 4N76A 2O2CA 2WD9A 3NT2A 3PUWA 3CX4A 2I2AA 4MYSA 2OPHA 4IIJB 1KSHA 2ECKA 2H1HA 1RNLA 2GN0A 3OZVA 3BA6A 2IOQA 4WLNA 3PUZA 4EVRA 3B1ZA 4JOQA 3VRHA 4B79A 1EVJA 4COKA 3AM3A 3DQQA 4GSLA 1OH8A 5DIFA 2F1OA 1AA9A 2O2EA 3IAAA 2GF9A 1YWGO 1T6BY 3MAGA 3W5UA 3IPXA 3TZBA 2O5RA 1HR0B 2I6XA 1QZ3A 1A4UA 3GJQA 4R1NA 2EZUA 4BOYA 2OG1A 5BWBA 4TYNA 2QUHA 3BL8A 5JXIA 2AW5A 5BSMA 3ANLA 3ZQUA 4XR4A 2W6ID 5DVZA 1HRDA 4EM6A 1VG8A 4ADSG 1U6KA 2AC2A 1YCGA 3PYLA 4JR1A 4PXYA 2FG7C 3P2EA 2X9QA 1E4EB 2CNOA 2D8MA 5FNVB 5JS2A 4H1WA 4CEJB 2XADA 5BR1A 1YZ3A 4HVAA 4ZTZB 1ZBDA 3QV2A 1BCSA 2X15A 3IV6A 5GZ6A 3VHRA 2GLTA 2J9YB 4FC7A 1MX1A 4JNKA 4RADA 4HRXA 4PANA 1Z6ZA 5D7BA 2YNMD 3E27A 4LX0A 1C3XA 1RPTA 1TIBA 4NXMB 4CL2A 2J30A 1FDTA 4RXUA 4UBLA 3UFXB 1T34A 5A4AA 5B6JA 5C80A 1DUSA 5H9VA 4HS9A 4AZWA 5HBGA 5LB2A 3RIHA 4JBWA 1C0KA 3FR7A 4IGKA 5BMVA 2B4KA 5FUYA 2G4VA 3WLHA 2UYQA 1H2EA 2XWBF 3BK7A 4GR9A 3JWIA 2WKQA 2IYXA 4RYLA 1YVPA 1QE0A 4GI2A 4YAKA 1WY5A 4LZAA 4M9SA 4EUSA 3MWDA 3GRPA 2PWPA 2WINI 5TQ2B 1BMFD 1O54A 3AERB 3OFKA 2RGDA 4NR0A 5KSWB 1N1DA 4IW3B 3FOFC 1CUWA 1NFFA 4JUFA 3T41A 3EDCA 5DFAA 2VT3A 3MT9A 4MKRA 4X71A 3ZV3A 2FX3A 2Q3FA 3HJCA 2QAGC 2QT9A 4OHWA 3EQZA 3PZBA 3R0IA 1S9HA 1VKNA 3H5RA 3JQQA 3ZDXB 1NMYA 3RAJA 4MQUA 3WMRA 4OXRA 3ETDA 2YWXA 3BIJA 1DP4A 1Z17A 1XAJA 5K8IA 3AJEA 4I5EA 3HJGA 1NW3A 4EKEA 2W8BA 2XZLA 4P7FA 1H94A 4P7BA 3GZNA 4C07A 3M5CA 5JYDA 1M0TA 2P3OA 4MRNA 5CYFA 4QECA 3WWCA 5KDLA 2JIZD 1JJFA 1YR7A 2PV7A 3T3GA 3C7DB 3COYA 3IXMA 5LWHA 4FSXA 4OQYA 1XHLA 1KVTA 4DIOA 1MDFA 1U3CA 2GPNA 3KB8A 3G17A 4V1CB 4FFDA 5A6SA 1SG0A 3IVMA 4JL6A 2P8JA 1XRNA 5AJZA 2CHFA 2Z5VA 3KV3O 3ERCA 5GOZA 4TMVA 3C16C 1KK2A 3GYGA 1U7DA 5HMLA 1VA4A 3E7FA 1QJCA 1N9GB 4PIVA 3EGDB 1AT1A 2NXCA 3S29A 3UMFA 1Z3IX 4NJOA 1U0GA 3CIOA 3D8SA 4KQCA 1JG1A 2GS9A 1N2BA 5EJMA 3UMRA 3E5MA 4HQ6A 4XD2A 3WLKX 3OC0A 5IMBA 1Z5WA 2QVLA 1V3QE 1VM6A 4DWVA 1QX3A 2H9IA 1QGUA 3FYTA 1I9CA 2JRLA 2VYND 3LDFA 1AQUA 1DRKA 4HDKA 1KEEA 1IQPA 2W83A 2F62A 3N07A 2BMFA 3RHTA 1U9YA 2N1MA 4ACBA 5A02A 3D7MA 3O5AA 3G2MA 3G2PA 1YS9A 4J0FA 5K05A 4Z3KA 1ONPA 1X87A 1QH8B 5TPZD 2NO9A 2VCEA 4EUKA 3FAZA 4MLCA 5FUWA 3BK2A 3VR6D 3HSKA 3SHFA 5FPKA 4H7IA 4MGYR 4WV3A 3AVTA 4K40A 4JI7B 1IEWA 1CNEA 4PIPA 4AROA 1TJ3A 4HO1X 4TVBA 4ZYTA 1Z8NA 3ZWNA 3PF8A 2R62A 1JIXA 3VDRA 1LSUA 3ROQA 4ME6A 3NASA 5LU9A 2BGJA 4JOSA 1IZ8A 1YB4A 4RJKA 3SYLA 3AUFA 3K9HA 5DHAA 3B7PA 3FKSA 4UMFA 5JD5A 1HWYA 4TX1A 4GL2A 3FSJX 1B8UA 4N18A 2WSMA 2GHQA 1ZH2A 4Q3CA 1VG9B 2V7GA 4G9BA 4P2BA 1TDJA 3CVJA 4B46A 2FF7A 2JD1A 3OOJA 4RD1A 1YFJA 1OREA 1ZXXA 3H9UA 4AT1A 3MTBA 1FEZA 5FI0B 5BV0A 4DV3B 3BERA 3WIUA 1NBOA 4BV3A 2V6JA 4YV1A 1YQUA 2OT3B 3GBVA 4OH1A 2GAIA 1COZA 1D2RA 2W6NA 2RK4A 1CDDA 3NONA 4XKJA 1ZNYA 2RGEA 3THYA 4ISCA 1E9AA 4AZ3A 4GGOA 3DT9A 2H63A 1AB6A 3V34A 3PQFA 3CB4A 3BMCB 1JTVA 1IJEA 4WHMA 5CM8B 2L42A 4GUAA 1CJKC 1UXJA 2KB0A 1GQFA 4JEIA 4HFNA 5I5GA 4CLDA 4EUHA 5CFRA 5CLHA 1U11A 1Z3CA 4DA4A 1EWRA 2WTNA 3Q72A 4IRUB 4CNBA 3ZJUA 2OYSA 3FZNA 3U19A 4AMGA 3SM9A 2Z4TA 4F2DA 3PJEA 3HO6A 4NU8X 2VWGA 3NVDA 4TTVA 1JDUA 2YRWA 4W7HA 4ETWA 3HU1A 3P45A 2PMCA 1YBVA 2J7KA 1IN8A 1Z07A 2R1UA 1BE6A 2TYSB 1E8MA 2VCYA 2ZYUX 4TRRA 4WZZA 2ZTHA 4MAMA 3I5YA 1KI1A 4K46A 2MIIA 1JKMA 4Y8VA 4R2JA 4DLWA 4ED9A 2DETA 2HHCA 1XN4A 4R5MA 3CFYA 5K3FA 2FSUA 1MA0A 4RKEA 4YJ2F 3S2FA 3RSSA 2I7VA 3G5MA 4KRGA 1G41A 4ETNA 1RLOA 2VTKA 5AM1A 5GINE 4KK4A 4IIGA 5EE9A 3R7AA 2QU8A 4LUCA 3DC2A 3FOZA 4F84A 5TX7A 1RVDA 2O2JA 3SJ7A 5AVJA 3B89A 1Z2AA 2R00C 3FDJA 1XQYA 3RAFC 1DKQA 3HC7A 3ZCQA 3LG2A 2CVOA 2DFDA 4BXOA 1IQRA 3DMNA 4J4TA 1E0KA 1UWLA 2GXSA 4IFBA 1YB5A 4OAPA 1DKMA 4NYMQ 4D9FA 4ND6A 5A4MS 4PS0A 4UEQA 4JH0A 1RRVA 5IFLA 2FJPA 3ESYA 1M8JA 3DE0X 3I9FA 1YZHA 2PL3A 1CIVA 4OXQA 3T5GA 8LDHA 1NTRA 2Q0HA 1KRHA 3ROZA 1NSYA 3GQBA 4ONEA 1WA5A 5EGNA 5JJLA 3WGYA 1GPLA 1CNFA 1FTYA 2WTBA 3BJIC 4I50A 4LRYA 2ZJ7A 4TS9A 5GJWC 3RSGA 3QVKA 3MJFA 3T5DA 1P2UA 3HDJA 5BSUA 3T5BA 5IDWA 1W49A 5FOXA 5IT4A 1IZZA 1M2OB 1PFGA 4J9VA 4KV7A 1K6EA 2X40A 4QAJA 2BEVB 2I7TA 1RE1A 2WG0A 1RR6A 3VPAA 1ZUNB 3AUTA 3MOIA 1PVVA 3PWZA 4DDVA 2YH2A 4UHKA 4M8LA 3NWOA 1E96A 2ZI5A 3OPMA 4MP3A 4EQ6A 5LA6F 4ARCA 4N0DA 4QA9A 2VC2B 2PQ2A 4H6WA 4TS1A 5DNAA 4JKOA 4P7KA 5K8LA 1GZ3A 1X74A 3DM9B 2YWJA 3M2TA 4HB3A 4YQZA 4RGYA 2GETA 3HRKA 2Y4NA 4ZAVA 3PKIA 2KI5A 2WSLA 3KX2A 2FR8C 1E9EA 1TUEA 2WTUA 4KWIA 2O0LA 5CLLA 5EEHA 3V7YA 4TTPA 4R6XA 5BNWA 3EPJA 6REQA 2VJMB 1NMSA 4HNSA 4K6GA 3HN6A 4UOZA 5B12A 4INJA 3L4BC 4NONA 1EDOA 4OAQA 1T9DA 3FBWA 1C3OA 4OSOA 1EFLA 1H3FA 2QT0A 4OP3A 4DDUA 4AQ7A 4KMOA 3MK31 3SN6A 2FH5B 4EHJA 5A3JA 4I9GA 1BHO1 1X7WB 1PNRA 3GP8A 1HNWB 4IY1A 4J0HA 1DIGA 3MBOA 3PE3A 1RRMA 2CBXA 1PQ4A 4YALA 1PJ2A 1XEXB 4JR0A 5IVDA 5AJVB 3AGPA 1DNPA 2XKJE 2R84A 5HG0A 4KLNA 4Z1MD 3O4FA 2VJKA 4UD2A 5C8YB 3UB4A 3FBTA 1Y4SA 3NV9A 5TMPA 1W8IA 3P96A 4EX6A 1NV9A 1IVSA 1QSGA 1V3TA 2ROQA 1X42A 3QG5A 3R3UA 3HVKA 1XU4A 1J8YF 1WCYA 1Y8RB 4KPFC 3SWWA 2HEIA 1RWBA 2Y27A 3GMDA 2HWXA 2Z57A 1E1LA 1ULBA 1E2QA 5HX7A 4H0FA 4RDIA 4ZU1X 4DT1B 5A5FA 3A28A 2HIMA 2YWRA 3E7XA 4BLTA 1H69A 1U3VA 4MMZB 2JIPA 1DARA 1SXIA 1FU8A 2PZKA 2REQA 4DCVA 1YI0A 5CLJA 4O02B 1LI5A 4MW9A 4BY9E 4CR6A 1RPAA 2HRBA 3ZWYA 2DERA 1UXIA 2JVKA 4QUEA 1SVMA 5I4IA 5AKHA 1KDOA 2C9DA 3BGSA 4HJXA 1WLYA 2MYTA 4YDHB 3OCVA 3T0IA 3PL1A 4GPZA 5KU7A 4Y2RA 5FWYA 1FMJA 4PQFA 4CM6A 2A5LA 3RYIA 1I4TD 3H7AA 3ZBPA 4DIBA 2I2BA 4L57A 3HUTA 4AJPA 4K9MA 1RM4A 3HCAA 5KVVA 3CH6A 1R6XA 4TL8A 5CDUA 1RJFA 4U3JA 2ZI9A 3C7CB 2JHAA 3P94A 1V5FA 4GXNA 3CJTA 4ZOEA 1ESMA 1ZOIA 3JVEA 4DJTA 3FHOA 3AKZA 1XLWA 4EJSB 5FHRA 4FBLA 3F9CA 2G5GX 2G36A 1PSWA 1X7XA 2XF2A 3IBTA 1R0BA 3BTUA 2QM8A 1UBSB 3EQ9A 2IQIA 5KHAA 4AIIA 3BIXA 2J0QA 1YC5A 3FHJA 3CLTC 3TEFA 4WJLA 1A5ZA 2J4CA 4RY2A 3AEXA 4EYEA 2FLVA 3E70C 4BN0A 4EY8A 3FCAA 4TWBA 3Q3HA 4RE5A 5CHYA 4HAUA 4JQSA 5IYZB 2BCEA 1OVGA 1NI4B 2YINC 3GHYA 4JYBA 1YOVA 2HA3A 4AIRA 4ZIRB 2G0NA 3BXEA 3KYDA 3L93A 2DBRA 4LWPA 3PFWO 4EECA 4QOEA 1MGPA 2VG8A 4MARA 4II3A 1A9XB 2GASA 3DVRX 3GUUA 2PEYA 1C3VA 4ZV9A 3KR0A 3LVRE 3GPDG 3L0IB 5IAEA 5JWRA 4FCTA 3P9NA 4X1YA 1O7JA 1SUCA 2PQMA 4CIVA 2SKDA 4IM7A 1PK8A 1CULC 4OMFG 1EVYA 4TV8F 1D1PA 3NZEA 3CNHA 4CW7A 1KZ7B 4QHTA 2D06A 3CG0A 5CG2A 3EF0A 4PAWA 3IBYA 3R44A 4K7JA 1YQQA 3ABOB 4JLWA 3CO5A 3PNOA 4G8BA 1PUXA 5CNMA 3R23A 1ST3A 3G1WA 2D0PB 2AD1A 5JVDB 5CVEA 3SDZA 1STOA 3DE2X 3VNUA 3KT0A 4GMKA 5AVUA 3H84A 4XFDA 3VAZA 4PYJA 2IBMA 4NMMA 2OQIA 4P4TA 4PZ9A 3QVSA 3AY0A 3PC4A 4G1BA 2JHPA 4HNHA 2NO1A 4Q16A 3AFMA 2YIMA 4OB8A 4IQ8A 1XZGA 3CS3A 5E2IA 4ALMA 1OIXA 4WRRA 4RVOA 1C30A 2C9CA 3WAGA 2PVCA 5G4LA 1ADCA 3I92A 1H4VB 4DUGA 2G1JA 5KVAA 5CT8A 3UHOA 2CEAA 1E18A 4DLNA 3C7TA 4YJ3F 1PL8A 3DDCA 2YX1A 4G9EA 2ZRDA 3CX8A 4O2RA 1Q57A 1YL6A 1Z7EA 2AKAB 2JI8A 3JWEA 2I4TA 3O1IC 4MGZR 4N6OA 4G07A 4GYYA 2H31A 2QMYA 2I6GA 4S1OA 1TQ8A 1YA4A 3I01A 2X6TA 1ZEMA 1NT4A 4INOA 2CHUA 2FWAA 4K6MA 3V8NA 2VUUA 4PCUA 5FNZA 2X86A 2XYVA 2OWEA 2CVZA 3QP9A 4HLQB 1EDEA 4TZTA 4YO8A 4F6CA 1UAYA 4IDOA 2A35A 3U37A 5JSQA 1UZLA 2H1LA 2ID9A 3R8XA 3RSQA 1BCSB 2PMEA 3L7BA 4RLSA 4P5PA 3TQRA 3N2KA 2IP2A 3OY7A 4RD4A 4I55F 2CDAA 4S2UA 3OCYA 3R9IA 1G8MA 3DLAA 4KXVA 2XNHA 4G5OA 1RKUA 5AD1A 1JKIA 5AOBA 4MKGA 2VATA 4FNAA 1II9A 2YJ3A 1GRNA 5E9JA 2B83A 1CSEE 2P5TB 2AMLA 4Q39A 5AJYA 4QPCA 2CB0A 2XZDA 3YASA 3EGEA 3PT5A 1Z0JA 4G5HA 5B2FA 2VJAA 4KR9A 2QY9A 1K5DA 1O5OA 4DA6A 3MWDB 1SXJE 2HA5A 2O57A 1JDBC 1F4VA 3S0JA 3LX6A 4V0ME 1ETUA 4ZO8A 4YR9A 4QYTA 2V7QA 1O5IA 1FYVA 5A6VA 1N0IA 3HYLA 1NG9A 2ZSJA 2GSWA 2PK3A 1LDMA 2A9JA 3H0KA 1JNYA 3ILSA 9ABPA 3PC8C 1G1MA 3A3KA 3NG1A 4G6ZA 2AJLI 3ELUA 3FOBA 4F3TA 4L74A 1LSSA 1U2ZA 4FOTA 1O94D 3L9XA 3CRW1 3VDXA 4GM0A 5FL7D 4WUTA 1XGKA 2VAWA 2QORA 4RSRA 3R3JA 3T34A 4F2HA 2C9ZA 5L7WA 2IH2A 3A1EA 3ENKA 3MZ0A 4XJTA 3S5JA 1D07A 3O4VA 4WZAB 3ZOKA 1LUAA 3IPCA 3W79A 4F1JA 4BVLA 2NNLD 2ZBEA 3GZNB 1QK3A 2ZT7A 3ANXA 4HCJA 3FVVA 3MWEB 4FINA 4MR9A 5CB6A 4EQZA 2P69A 2HJVA 3JD3A 2QZPA 2YYSA 1OA1A 2C83A 3OIFA 5DI3A 1C8BA 4BP1A 1GNLA 1PVDA 5DGXA 1YZFA 3EXG2 1II0A 4GICA 3SKYA 1XKLA 4MUKA 5AVZA 4O4LA 4DEXA 1J0CA 3P9ZA 1KMHB 5EIOA 2E5WA 3VNSA 3VVMA 1LVUA 3N2YA 1ZAYA 4AKHA 1TZ2A 1QGED 3PFCA 4TOIA 4TYQA 2JVIA 1J56A 1T2DA 2H8GA 2XQIA 3IJPA 4JLJA 1IHXA 2ZIXB 3AC0A 4MRPA 5DX8A 2QUAA 3CBGA 2IE8A 3ANTA 4H0CA 4M4SA 4ZAWA 4LF4B 3QIAA 1QG4A 4DJFC 2FRDA 3GNQA 3L1UA 2AX4A 1P2VA 3O91A 1BFKA 2F67A 2OCPA 4PG5A 1QYIA 2VNSA 4ISBA 4S24A 3LCUA 3SP1A 4HDKB 2YDXA 3KB2A 1KEEB 5DP1A 1IH8A 2QTBA 5LLSA 4MQFA 3W3AA 4LGMA 1APBA 2VHEA 1FL9A 2FDCA 2ZIUB 3F3KA 5LQMA 4I1PA 3MF4A 2I54A 3W06A 3AP3A 3DAYA 3ANSA 3I01M 2ACEA 1MO6A 3W2EA 4UQLA 2F8TA 4WLFA 4Q12A 3ZY6A 3UV6A 1PAUA 2OAGA 5A1TA 3NWPA 1TB4A 1OXMA 3BL6A 1QYXA 4OIMA 2Q7XA 2BELA 1Y3DE 2V96A 1YULA 2G08A 2XRFA 5D3ZA 5T3YA 1Y81A 3OM1A 3I53A 2I66A 2CZGA 4YP0A 2ZSIA 4Y6RA 1YKSA 5AJXA 5B4VA 2JKZA 4ARVA 3INNA 3P2JA 5D00A 4KPUA 3SF8A 3HRIA 4LZWA 2HUPA 1JIIA 5IXSA 4NZNA 3QITA 1GU0A 3L6RA 3WK8A 2CMFA 4D6YA 1PX2A 2OL4A 5EYPA 3ZNOA 4FB5A 1IXYA 1JQEA 1GPWB 3K0CA 2PX2A 1A3CA 4PC7A 4OM8A 2Q5QA 2V7EA 4QREA 1E2JA 3ZHZA 4ENVA 4IJVA 4XDGA 4Y2YA 1JR3D 1BROA 1O2DA 4MKHA 4OB6A 1KI9A 2JC3A 3WRYA 1Q22A 3NEAA 3I28A 1JFLA 2J4FA 2B92A 2EW2A 1P0FA 2HSGA 1FFBA 2PEZA 3PQ8A 1KTVA 2YBDA 5KBYA 3COPA 4B4VA 5K99A 7REQA 4I66A 3QXCA 7AT1A 4YCJA 3THYB 3BEDA 3I0MA 1TPYA 4U7HA 5E6SB 2Z9BA 4TMTA 3WL8A 1P80A 1NYQA 4GECA 5FA5A 3IKMB 3MWFA 4AZ3B 4P33A 1Y0BA 4M87A 4FE4A 1U3FA 2IXFA 3V4OA 4ASUA 3JALA 2EBFX 2ANCA 5DT2A 4QATA 2B35A 3RWBA 2J32A 1DKUA 3K92A 2O8CA 1IRXA 1GKLA 1I5RA 2BFMA 1NRXA 2RGWA 2YVUA 5THXA 3HYTA 1Z0IA 3H5OA 3OZGA 4YWHA 3F47A 2OP0A 1U0HC 1C9KA 2OQRA 2CXPA 1DSSG 1EXMA 2D7CA 1Z13A 1FFHA 1AJEA 4OYRA 1QDUA 4BO7A 3DDZX 1EFTA 2C84A 1SKAA 1R0XA 4FWIB 1WETA 2NWQA 1QK4A 1MNQA 1P62B 1NYRA 5FUMA 5LDDC 3AKEA 1MP0A 1UKZA 2GEBA 4HNQA 1YRHA 4EO4A 1XD2A 5ALSA 3DBLA 5LQDA 2WUDA 4H6PA 1X13A 1F6WA 4BX3A 2YYZA 2DBQA 2BI8A 1L8LA 1OU0A 4XR9A 4GMXA 4X84A 2IZ0A 4WY8A 3KLOA 4HNRA 2AL7A 3JYQA 3TVYA 2QP3A 3ZGLA 2DLCX 1KDZA 3TPZA 4BXOB 1DBSA 1OW3B 5IC4A 3B3AA 2HL6A 2XCQA 1IB6A 2H4YA 2NYUA 1ZVKA 3D0QA 3IXQA 3K8ZA 4KDCA 5GPBA 5AI0A 3JXEA 3THXA 4ND1A 4A6DA 1UJ2A 2E4ZA 2DRIA 4EY3A 4AG5A 3ONFA 1OPXA 3G23A 4DR7B 1YJ5A 2VUHB 2YRXA 3D2BA 3I4LA 2FPLA 4YV7A 4UAGA 1J1IA 3GQBB 4EKDA 2HRDA 5HDBB 1HMPA 4L1KA 3W1EA 2IYPA 3ETLA 4A03A 5JZOA 2ZCJA 5FJJA 3G8YA 1J1ZA 2VTVA 2IEDA 3HCRA 2XGMA 3JVVA 1CC1S 3KDPA 3NBMA 3QHPA 4QSMA 2D3WA 2J3DA 4OQEA 3AYXB 2D5IA 5F77A 2PTHA 1P4SA 3LMKA 2PKYX 4L95C 3WLIA 1TVMA 4MCHA 2B3DA 3ROFA 1U2PA 1SVUA 4RD6A 4RMJA 1UZNA 4BQPA 4CMCA 3CMCO 3GEIA 4HV4A 2WAOA 4DZZA 2P9TA 2PO7A 4FB4A 2YHSA 4MQLA 4FFMA 4LJ5A 3R7DA 3OEHD 4EQ6B 1J1UA 3UGTA 2HSEA 3HH8A 5KTPA 3W2HA 4M99A 3ER9A 4DMFA 2ODEA 3I5XA 4NG5A 3PR1A 1NNUA 3ABSB 3K94A 4G8JA 5JECA 3WLAA 1IIBA 1DRUA 2FDXA 1FLNA 1QLHA 3C0KA 5EXDA 4E4RA 3GLFE 1OFTA 3MJ4A 1DB3A 3HPQA 2L19A 4J4BA 1QS0A 5IUKC 2RD2A 1SPBS 1DBWA 1J06A 1E2HA 4JZYA 2VK8A 4ND2A 3BMXA 3DVQX 2ZB7A 3DULA 4REQA 4ZV4A 1U63A 1MOQA 1XG5A 2C97A 5DB4A 3RUAA 4A4DA 2AFHB 2UAGA 4EPXA 1W46A 1K5PA 2ZTMA 4NENA 1PEDA 1GITA 3PXEA 1L0BA 1UDXA 1NURA 1U8XX 1VB5A 3LCRA 4LYJA 3R1IA 4KQKA 4N8DA 2J67A 3CM0A 5FBZA 2JA1A 1DPFA 1OYYA 2W4IA 1B00A 3A4TA 3H4TA 3KZCA 4HMQA 1F3OA 4WTOA 3IEPA 5CYOA 1T8PA 4E15A 1JW9B 1TFUA 1ULUA 2YS7A 621PA 1WXQA 1T8UA 1TO6A 3MCUA 4RGVA 3OVMA 3T1TA 3Q8MA 4JC0A 3DUFA 4MTLA 3VC7A 5D51S 1E1MA 1NVVR 1FOEB 4PGGA 3PJFA 2PNJA 3V7NA 4BO0A 4CKYA 1WUTA 2D2FA 1SCQA 2GJ8A 3OQ6A 3AZPA 1RS0A 2WP8J 1JWAB 4ZCPA 5AVSA 3DMFA 3ZDDA 4PYQA