1Z2AA

Gdp-bound rab23 gtpase crystallized in p2(1)2(1)2(1) space group
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
164
structure length
164
Chain Sequence
VAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAISSWREKVVAEVGDIPTALVQNKIDLLDDSCIKNEEAEGLAKRLKLRFYRTSVKEDLNVSEVFKYLAEKHLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of family-wide Rab GTPase recognition by rabenosyn-5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords Ras-related protein Rab-23
total genus 51
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2005-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z2aA00
4O3MA 2MSCB 5TV2A 2CHVA 2VIIA 2XTZA 3L0SA 4GT1A 2A5GA 4GP6A 5EQTA 1Z3IX 3ZIAA 5JJLA 4QRHA 3KJHA 4HAVA 4M53A 4QNRA 1OXUA 1KOFA 3R20A 2QROA 1QHHB 4IHQA 3IILA 1KZ7B 2ZTSA 3W3AA 5DGXA 2GKSA 4YQFA 4TLBA 1KY3A 3Q85A 2JDIA 4G5RA 4M1KA 1YR6A 1OW3B 2W2VA 2A5YB 1F6BA 1M1YE 5FOTA 2G0TA 1A5TA 2EVWX 5F9HA 2YKGA 3LBHA 4GNKA 3GLGE 5KSYA 3DO6A 121PA 5A0FA 1V5WA 3OIVA 2IYUA 2A2ZA 4P4TA 4B74A 1GVNB 2WKPA 1CXZA 1SVWA 3FB4A 1GZSA 2AK2A 3CIOA 3QXCA 4LHXA 2QQEA 3AH8A 5DHAA 4QBIA 2V8OA 2D7DA 3R9IA 4KSBA 5AK0A 4OJQA 4A0FA 1JR3E 2AX4A 5FR2A 2R9VA 1P2UA 1OFTA 1MRSA 2F1JA 3SE0A 2VHCA 4TSFA 3E5HA 3BE4A 2OILA 1U8ZA 4JVNA 1TQ4A 3IO5A 4IOLA 1SXJC 3U3OA 5DIFA 3OFNA 3OIWA 5FUVA 1JQLB 4JIMA 4S35A 3AF1A 2BDTA 3TIFA 4TQ9A 2ZS9A 5JRJA 1BO6A 2OE2A 4KYUA 3B9QA 4Q9KA 1CRQA 4MYCA 1YZQA 1TU4A 1W0JA 1WXQA 4HDOB 1G8GA 3VTKA 3NVAA 4XD7D 3L0PA 3G82C 1FP6A 1ZIPA 2QAGC 2ZAOA 4MGKR 2V6IA 5A5GA 1ZD8A 2QPAA 3G5UA 5E95A 2P65A 1HT2E 5CDFA 3WHLA 4AIIA 1GKUB 2ZQ5A 4EQ6A 2CEAA 1OH6A 2B8TA 2Z4SA 5FOWA 2HJVA 1E2PA 3K9LA 3CZQA 5CJPA 2W6JD 4C0SA 2YWGA 4EPYA 3TAUA 4QJ3A 1II8B 2VF7A 3V4FA 5AUPB 2GILA 3CNOA 4V0MA 4AKIA 2ZROA 4B6FA 2CHQA 3AKCA 4A9AA 4CEIB 4LPSA 2ZRJA 4PC7A 2QM8A 1KKLA 4POAA 1R5OA 2JGNA 5JHHB 1KO1A 1G5PA 1AGPA 1L7VC 4FXPA 3DDCA 2DFLA 4MGYR 3B5JA 3EZFA 1NLZA 4OHVA 5JZVA 2G3YA 2OUKA 2R6CA 2V3CC 1WP9A 3TE6A 1RC8A 4C9BA 3FE2A 2ZM5A 5HKKA 4LCBA 2ZXUA 4Q4AB 1ZC4A 2XZLA 1Z6XA 4C0QC 1KYIA 5G41A 2R6DA 1T3LA 2OCPA 2W6ID 4ARZB 2H7VA 3EIHA 1CKEA 1E1QA 4QL3A 4IDNA 5JWRA 3EZ9A 1E96A 4M2LA 3J81k 5JRZA 1Z47A 3T1TA 5FBLB 4QHYA 1O87A 2IBMA 2C9OA 4MYTA 1KNQA 2ZSEA 3GJ7A 3BK7A 3A4NA 5E4FA 1D5CA 1T4GA 4JBXA 1CJKC 1VCNA 3DZDA 3RNLA 4EJSC 3DMNA 1RJ9A 1DG3A 1ZUHA 1DAEA 3KXLA 1OHHA 2GXUA 1AJEA 2VSFA 3LLMA 2W00A 2XTNA 3WYGA 4PQRA 4OHYA 3LDAA 4V0LA 2O0JA 3P4YA 4NE2A 3S1AA 4DEXA 3THWA 1G3QA 1QHNA 2GA8A 2XTMA 2FOLA 3BB1A 3ZGXA 4DT1B 1DS6A 2WWXA 3EG5A 1XWIA 3GJ0A 1X8LA 2YOGA 1FQJA 1SVMA 4QJ4A 4WIAA 5K8TA 1NLFA 1GWNA 4QG7A 4KSCA 1DO0A 4YDHB 4C0AC 4CIDA 2XEXA 1G8PA 3EARA 4B73A 1NG9A 1JALA 3MWJA 2AL7A 4MITA 1ZVQA 4PZYA 1NMZA 3FTQA 3VKGA 2H5EA 4OHWA 5DISB 1ZD9A 6Q21A 3AVQA 1TTTA 1IBRA 4XOIA 3EZ2A 4JT2A 4D80A 4BASA 5EJEA 3W5JA 4GMXA 4X8MA 4KVAA 3B9PA 3RAPR 4B3FX 3SYKA 3RRNA 3L8ZA 1K5DA 3D3QA 1N6RA 1Y3AA 3SJAA 3HU1A 4NYMQ 2J0QA 2ANCA 4ZI2A 1FQKA 1NG1A 2KE5A 3CRMA 5FTJA 3JZAA 1NP6A 1RPZA 4AYTA 3LLUA 1E9SA 2ZR0A 3BWDD 5B58C 4O0MA 4M1MA 5JMTA 2G77B 2PX3A 3VFDA 2OV2A 4FMDB 3C16C 4DSUA 5LDDC 2REBA 1HA3A 3QI2A 4YDSA 4B32A 4P4UA 4TMTA 2HT1A 3GJ6A 5FBQB 5HR5A 2OLKA 3BFXA 5FPYA 3UG7A 3CH5A 1KSJA 1S0UA 3M0EA 1L4YA 4JLVA 1NIJA 4KAXA 2Q9BA 3O47A 3U3JA 2F3RA 4KLZA 1FOEB 1G5TA 4MKGA 4BFXA 1ZBDA 2Z5FA 3CWQA 5A4JA 3R8FA 2FF7A 2I1QA 3K1JA 2NPIA 1MT0A 4A2PA 4AKGA 1NRJB 4NHOA 2NO9A 4UJ5A 1KI6B 1UBGA 1Z6YA 1CJVC 2JATA 2IXGA 4RCYA 5KPJA 2DHRA 3PCRB 4Q4LA 4AK9A 4M1WA 2REOA 1EFRA 1TUIA 4F91B 2CNWA 4URWR 5SZKB 2ZS7A 5F9FA 2QE7D 2ONKA 2WZQA 2BCGY 2J0UA 1CULC 1NBMA 1T8TA 4HB4A 1W5TA 4IXNA 4ITRC 4URZR 3B1YA 3G0HA 1OF1A 1Q1BA 1KK0A 1OV4A 3BB3A 4V0NA 2QT1A 3LRPA 4TQUS 4CDGA 1KY2A 3HU2A 2UVQA 3REFA 2ZE7A 3W9YA 2CMKA 1ZNYA 1RKBA 5FOXA 3VNVA 4KFSA 3DKPA 4PSAA 1SQ5A 4RZ2A 2WKQA 4DCVA 5L3SB 1BIFA 1OIVA 4JLOA 1N6PA 1N2CE 3T06B 2PCLA 3CM0A 2H18A 2ZJYA 3ZVLA 4Q21A 1IXSB 4D26A 1HURA 1I2MA 1ZUNB 4KBFA 4Q4HB 3IIKA 3ND8A 4DLSA 4II7A 1N0WA 3RS4A 3I61A 2AD5A 3VX4A 3UANA 1GSIA 1U81A 3SR0A 1P5ZB 2L0XA 3OEED 4C0HA 1BMFD 3T35A 3UIEA 4C0LA 1US8A 4N0EA 4OHZA 1RIFA 1FPMA 2ZREA 4C0KA 3QXHA 1NY6A 1VG1A 3CR8A 5J5CA 4XSHA 2CK3D 2ZRGA 1QVAA 2OSBA 2QPOA 3TUZC 4JLPA 1SVLA 4RFSB 4URUR 2GBLC 4CEIA 3NBXX 4LBWA 1Z07A 2IEYA 2LWIA 1QZXA 4V0OA 4WXPA 2CE7A 1ETUA 5EP2A 3T1VA 1VCMA 1ZU5A 1NKTA 1G291 3QY0A 4Q4HA 4ZO4A 2EFHB 4HUTA 1YVDA 4B2PA 2CLDX 1XEFA 2OBLA 2QUZA 3FFBA 1GP2A 4NYMR 5GJWC 1XEWX 1E79A 1XMSA 1EWRA 4Q48A 3AGQA 4HATA 4KFUA 5DI3A 3LNCA 3O8BA 2NPFA 2ZJ2A 1K6MA 3GJ3A 4TT3D 3GLFE 1Q1EA 3LQRA 3VR4A 5CDFE 1MOZA 1XD8A 4PX9A 2C98A 4DCNA 2ZYUX 1A4RA 2ZR7A 3L0IB 4OK3A 4Q9LA 3GEIA 1M7BA 2C04A 2JLWA 2GWHA 4PPGA 4TTPA 2WMOB 3ADKA 3PEWA 1UBEA 2IS1A 4QM6A 1IONA 4HYYA 3SYNA 3CRW1 3GLGB 4Q1EA 3ADDA 1G19A 1TQ6A 2VSOA 2XB2A 2IEZA 2QI9C 2H92A 2XJ4A 2E9SA 1KDTA 4B33A 3KB2A 2FA9A 4PQYA 4TMKA 1D6JA 2ZRBA 1XD2B 2QP3A 2WAYA 1YZLA 3DVLA 1LVGA 2O0KA 3KTAB 5SZHB 1U8YA 1E0AA 4LYJA 1KK2A 1AQYA 1KI1A 4HSEA 4C7OB 4LJAA 2A5DA 1NMYA 4Q1AA 4LJ9A 2FSFA 521PA 1KI4A 3U7FB 2V7QD 1G3RA 1NN5A 1ZNZA 1QBKC 4YMTA 2G1JA 4MA4A 2YZ2A 3VHXA 1Z6TA 4L8GA 1YJ5A 2WICA 1JBKA 2IYRA 4G01B 3ND9A 5HPYB 3TAHA 4A6PA 3R7WB 4B48A 2RGAA 4IVPA 1XDBA 4D4KA 1AK2A 2ZSDA 4RD4A 1UKEA 2QSZA 2IS4A 3QVUA 2CE2X 1KMHB 4G5GA 4B43A 2R44A 4A6XA 1MABB 2ZRPA 3Q7PA 1P60A 1SKYE 3WMEA 4HLUA 1HE1C 1RRGA 3AVPA 4DUGA 2LKDA 1IY2A 4FD2A 2O0HA 1UJ2A 5JI3E 3EIEA 3K09C 4KI0A 3ICEA 4NYIQ 4US1R 1IN6A 2A5FA 3OE7A 4DDTA 2B7CA 1OKKD 3KKOA 4OI4A 1F3OA 4B3BA 1L4UA 4Y0VA 1LY1A 3QENA 4Q1FA 3VR2A 3TR5A 1IJFA 2R2AA 4GSYA 3NH9A 3VR3A 2ZI3A 2GXSA 2WWIA 4KBGA 1LS6A 2FMXA 3LWNA 1RYHA 4B47A 1CS4C 4Q7JB 3LXRA 4R7ZA 4TYWA 4GI7A 4JLAA 4ESVA 1G9XA 4OQLA 1N5KA 3VMFA 3TQCA 4JSYA 1E9DA 3CONA 1VKJA 3THYA 3NTUA 1AZSC 2HLDA 1XJQA 1ZJ6A 3R8CA 1NVXQ 4QHTA 1U98A 3L8YA 3RWOA 1PV4A 2CL7X 3SJZA 4ASUA 1IXZA 4DRZA 5G40A 5AJVB 3F3YA 1M74A 3QG1A 1PZNA 3IEUA 4G0NA 2FU5C 2WWWA 4PO1A 4M9QA 3CF2A 1WBBA 2PT7A 1BOFA 1CEEA 3NXSA 2B92A 2DFTA 5KDLA 2ZU0C 5GJCA 3I5YA 2IS6A 3HWSA 3KJIA 4R9UC 3IQWA 4EPRA 5HZKA 2BHRA 4B3DA 4C2TA 4M21A 3U6KA 3AM1A 2WJHA 1XEXB 4M1SA 2JJ1A 3WYFA 3AKDA 1UDXA 2EFEB 3QKSA 1D9ZA 2N1BA 4UXIA 1CR4A 4Z51A 1ZW6A 1TMKA 4A2QA 1UKZA 1P9WA 5DSZA 4DZZA 1E2IA 3X2SA 4E5UA 4RFVA 3U7EB 1B0UA 4FW9A 2O8BA 2GNOA 1GRRA 4UXHA 3L0OA 4X8OA 4BFSA 4BQSA 2HF8A 4RZXA 4ERNA 1GG2A 2HLDD 4DCSA 5HCNA 1ZM4A 4BEBA 1DOAA 1KIMA 1OXVA 1GNQA 3HR7A 2PLFA 1OH8A 4MQBA 2BEJA 1X8KA 4OQXA 3WNDA 1MR3F 4W9MC 3QF4A 2GJSA 4DLWA 2FFHA 4V03A 4AURA 3I4LA 1VCOA 2A7QA 2PZFA 3C5HA 3N2EA 2JLVA 3IPYA 3OAAA 1GNPA 3GD7A 1Q3TA 2G88A 4P33A 3AP2A 4DWJA 2ZANA 1NBME 4PANA 1W4CA 1CU1A 1XD2A 4NONA 3U3KA 2ERYA 1U0JA 2D4HA 2PLRA 4TWZA 4D6PA 4LI0A 4A8JC 4LX0A 5FPHA 5M04A 2FWRA 3CF0A 1E4VA 1E0SA 1T6NA 1ZMXA 1H8ED 3ASYA 4YMUA 3UMFA 2ZRLA 1NVWQ 2Z6VA 4M1YA 4EAQA 1ANKA 4D4MA 3PEVA 3KJEA 5H68A 3VQTA 1KSFX 2PMKA 1Z0JA 2LCFA 3QPWA 4Y0AA 4EFLA 5KPDA 3THWB 3ECCA 3I1FA 1QHXA 1W49A 2FZLA 3QUSA 2O8DA 4BLPA 2FN4A 2RGGA 4TTRA 4UJ3A 2AKYA 1YHNA 4BRWA 1ESNA 3W6OA 3IDQA 1G7TA 2HT6A 1T5IA 1OH5A 1N0VC 3W8NA 2YV5A 5EXTA 2EFDB 4KV9A 1HV8A 1VG9B 2LKCA 3CWZA 1T5LA 4QNMA 4WOPA 5LB2A 2QT0A 1JB1A 3CPEA 1Z0KA 2GXAA 1S9DA 1C1YA 1QG4A 1I2DA 2CXXA 3W3ZB 2YVUA 4W7SA 1YQTA 1E98A 4PAMA 4DLTA 421PA 2OXRA 2O52A 2J3EA 3B60A 4OI2A 3T5GA 4CEHA 1CF4A 3UPUA 1CLUA 3KUCA 2ZEJA 3FDIA 2GZAA 4KFRA 3NH6A 4ZCIA 4HAUA 1AIPA 4TTQA 3TMKA 2PH1A 1DTSA 1S4QA 4QKQA 3SQWA 3OFND 4F38A 1P2VA 2J0VA 4PC6A 3SHFA 1XP8A 4BLTA 5GVRA 3QJYA 4JL6A 4XSGA 2P6NA 5EE1A 4A36A 1YZGA 3AVOA 2OO7A 5JS8A 4Q7LA 3CZPA 1G1MA 1DAMA 3LVQE 2DB3A 3ZDQA 1FTNA 2FDCA 4F93B 2DCUA 1HYQA 4A92A 4OQFA 4XVRA 2R65A 2QA5A 2QAGB 2Y8EA 4M9ZA 4JBWA 4AKEA 4FI3C 1X8JA 2JCSA 1LFDB 2IYQA 4ZV4A 2IYWA 1NJFA 2GCNA 1WBDA 2XAUA 3QXJA 3ZD6A 2A9KA 5DO9A 3QNUA 3U2QA 3N2IA 2BBWA 5IF9A 2JJ8A 1K8RA 1JPNA 5P21A 4KXFB 1JEEA 1NN0A 5J4LA 1FX0B 4O2RA 1IQPA 3SFZA 2HJGA 3EAQA 4JLJA 3Q9LA 1QDEA 5E7MA 5BYKA 2ZE6A 4A15A 4FINA 3F8TA 2ZRKA 3ZVNA 4D0NA 3AF4A 2B8WA 1E2HA 4IEIA 1L8QA 1EG7A 2YNMA 4PXAA 4YXWA 3QQ5A 2C9CA 1E99A 1E0KA 2BWJA 1AA9A 5EXSA 4DVGA 1WDTA 4WZBE 3NBZC 4LPKA 5DHFA 1U9IA 4OI0A 3WYAA 3GFTA 1CTQA 2P6UA 3GFOA 4N3NA 4GZLA 4TL9A 2CLCX 4NH0A 4GOKA 2VSXA 4EIWA 2BEKA 4LUCA 1P6XA 2F43A 2ZSBA 4ILEA 3PQCA 4L16A 2Q0HA 1G41A 3KKNA 2REXB 4KO8A 3W6PA 4Q4JB 1W36C 3CLVA 4NCJA 1IY1A 2ZRHA 5SZJA 4DDUA 1SKQA 2DPXA 2XXAA 1N6OA 2ZIAA 1G18A 4OK5A 2CCGA 5AUNB 1N6LA 3FGNA 1OT3A 2ZI4A 1OYWA 3OF5A 1YE8A 1PLJA 3K0FB 1MKYA 1N5LA 3EIQA 1E2EA 2ZI7A 1F60A 3HYRA 1GIAA 4H1VA 1O3YA 3T61A 1DE0A 3B78A 4BPBA 1XCMA 1TX4B 3BXZA 2IUSA 1A82A 3AB3A 1A2KC 4UNPA 2YJTD 1IY0A 1KK3A 3MRSA 4QGHA 4Q4JA 1T91A 2BMDA 2ZR9A 3PUXA 1W5SA 1D9XA 2ZJBA 2WMNB 5CYPA 2F1RA 3X1WA 3EX7C 4RD1A 4I4LA 3V9PA 4O2LA 3RSLA 3C14C 3NHAA 3T1QA 3WNBA 4QC2A 3RS3A 3QPVA 4Q9JA 1ZYUA 5FUYA 1KO4A 1FNNA 3HP1A 3RRYA 3KQLA 2J45A 3QF7A 1UPTA 3FMFA 4P4SB 1X1SA 5L3QA 4A8JA 2VA8A 4PFSA 4D0LB 4R71A 4BEJA 1SZPA 4HAWA 1IJEA 1FW6A 4IVQA 1JR6A 3EA0A 4MDFA 2XZPA 1JAIA 2H17A 2XOKD 2QQ0A 3SBEA 2C95A 3TNFA 5EP4A 1KKMA 2HDNB 3MAAC 2J87A 2IUUA 3TW4A 1GKIA 1Z6GA 4LHWA 4CW7A 4I81A 1Q57A 2IL1A 721PA 5DI9A 1G3IA 2HF9A 1PLLA 1LS1A 1JI0A 2P2LA 1XTRA 4IVRA 3DM5A 1E2JA 4U7DA 1FFHA 1F5NA 1SXJA 3QXXA 4LY6A 3SJCA 2IS2A 4BFTA 4NL4H 1R8QA 2HXYA 2BBTA 1YR7A 2ZE8A 3RC8A 2BKUA 1G4AE 4EPVA 1UEIA 4DIDA 1OH7A 1E1QD 5H1YA 4HDQB 3UMRA 3RC3A 2NZJA 3ETLA 4JL8A 1E9BA 3B85A 1IHUA 1SGWA 5H8WA 1J70A 4DC9A 1EX7A 2QN6A 4PHGA 4FWTA 1NL3A 2GDJA 3DZ8A 2QMUA 1P2SA 3Q72A 4LOAA 4GOXA 2IYXA 4E07A 4MUAA 2F6RA 1FP7A 2YOHA 3NC0C 2MSDB 2QTFA 1OXTA 5C4MA 1IAQA 3ZQ6A 4KLNA 4TT3A 3OIUA 3THOA 5BWMA 1W36D 3I32A 3IIJA 2QEQA 1E9FA 2NO0A 3FWYA 3BRWD 3HU3A 2I4IA 3PXGA 1VYUA 3TJZA 5KU1A 1P62B 3I73A 1T9HA 1ONBA 2DFKB 4EDHA 2JJ2A 1ZINA 3RS7A 1AKEA 3SN6A 1NMXA 4IRUB 4NYJR 3QKRB 5KSPA 4JLDA 1VYTA 2ZUCA 3FOZA 3FMIA 4M4SA 1Q21A 1C9KA 5FBWB 2ZJZA 1KJZA 3OHMA 4BE7B 1XTSA 1ZM9A 2E1RA 2ODWA 3AUXA 4JYCA 1YZNA 1II8A 1G5RA 1FUKA 2CL0X 1JJ7A 3BH6A 5DLQC 4AKHA 3HR8A 5L3VA 3KFXA 4RVCA 5JWHA 1J8YF 4CRWB 1K5GA 4NTZA 2VEDA 4P31A 2R62A 2ZRAA 3HJNA 4IW3B 4U00A 4OI1A 2G9NA 5FPKA 5KDOA 3NDPA 2G1KA 3BH7A 1CR1A 2ZSAA 3AVUA 1BYUA 1QHYA 1ZIOA 2ORIA 1E1RD 1XEXA 4JJKA 5HE8A 3P27A 2RMKA 1T3HA 1G17A 4HLUC 4P32A 2IT1A 5DYGA 4BZQA 4Z1MD 3ADCA 1C4OA 2ZRDA 3KXKA 3WBJA 4TZ0A 3RHFA 2J9RA 3T34A 4E03A 3C4JA 4XWAA 2OAP1 2UZ3A 3BFKA 5DN6D 2EYUA 4F92B 3K0AB 2GEDA 2Q9CA 3QXSA 5AUOB 1GKYA 2JLXA 2JLQA 4XWKA 2GZHA 1R0WA 2OFXA 3B1XA 2F1HA 3AKYA 2Q3MA 3K8YA 1Q22A 3RDPA 3WXMA 1XTQA 4TN1A 2UZIR 5LD2C 2ZE5A 1P72A 4MGZR 1KMQA 2IYSA 4TL6A 5B64A 1NY5A 5EP1A 3ZZUA 4RD0A 3ZS8A 4LJ7A 3BGWA 2AN9A 1GAJA 3JZMA 2W0MA 2YWEA 3LA6A 1GNRA 1XXHA 2XX3A 4HAXA 5CIQA 2D74A 1M7HA 1GRNA 4TYYA 5F98A 1N0UA 2ODEA 2WWFA 3DOEA 3V4RA 3A58B 2CDNA 4G5QA 2NTYC 1NSTA 2GESA 2HXSA 3A4MA 3H4MA 3QE0A 1KSGA 5K8UA 2HCBA 1OB5A 1QVRA 4HZUA 2VL7A 2DR3A 3IIMA 4LGMA 1OLOA 3WMGA 3CUEF 4BGDA 4G1UC 5JJIA 3A4LA 2C96A 3IO3A 4DXAA 3VAAA 2C5LA 4DBLC 3U5ZB 5TY0A 4GDFA 4OYHA 4Q7MB 2WPDD 3ZS9A 1UEJA 4D4JA 1SVSA 2ANBA 4QJ5A 2ZJOA 8OHMA 1MV5A 4GFDA 4BFVA 3WMFA 1SVIA 2IC5A 2EFGA 3REGA 2KB0A 1E2NA 4M0LA 2JJ2D 1TQDA 3KUDA 4TZ6A 1RRPA 3X1XA 1JR3D 2FJUA 1T8UA 2EFCB 1E2FA 4OBEA 1EX6A 3AEZA 4KITB 2ZYVX 1G3UA 2DWPA 2ZYTX 4ACAA 2OHFA 4NYJQ 2GXQA 2OFWA 5FTMA 4US0R 1DAHA 4C30A 4AWXA 4HZIA 4RD3A 2RGEA 2PT5A 4AD8A 2NO1A 2AFIE 3ZVMA 3SC3A 5FUWA 3K0CC 3QOFA 5JWOA 1UADA 4U5XA 1ZUIA 3FHCB 3SOPA 4B2IA 3FMPB 1Z63A 3K0SA 1WMSA 4DT1A 4BUJA 1XEWY 2VH5R 3QIAA 2BVNA 1XMIA 3U3RA 2VTKA 2FZ4A 4NBSA 2IYYA 5FOUA 4DB2A 3KX2A 1D2MA 2IF0A 4F4CA 1B23P 2XSZD 2XJ9A 3N5CA 1F48A 1OXSC 4TLCA 2QAJA 3IHWA 4M22A 4EJSB 1SXJD 4LRWA 4DCUA 3QKUA 1KI6A 2KWIA 3RANA 2OZEA 2VF8A 4YONB 3I8XA 1ZM3A 2F1IA 1N6NA 1NVVR 4RKFA 1VIYA 4BRUA 1NN1A 3FHOA 3B1ZA 1NF3A 1DADA 3MCAA 1P2TA 3U4QB 3Q7QA 4M1TA 5HZHA 5JCZA 4PO9A 1E1RA 3AP1A 4LV6A 3GPLA 5UKDA 4JLMA 2ECKA 2MSEB 2TMKA 4MRSA 1OSNA 3ZYCA 4Z8YA 4RZ3A 4CYMA 3SYLA 1E2QA 2YHSA 2WWYA 2VHTA 2P5SA 2QMEA 2XNDA 4JVMA 4TL7A 1KNXA 1P73A 2WWGA 3LQQA 3NHBA 5JEEA 4WXRA 1GL7A 1Z2AA 4CEJA 4CGZA 3B8HA 1U8AA 3UKDA 1Q3HA 1H8HA 1Z0IA 2W2XA 3GLHE 2FGKA 1LW7A 1OFIA 1KI3A 1OFUX 3AF2A 2F3TA 3AVYA 1LF5A 3LBIA 3WBKA 2Q21A 3P1JA 2PZEA 1H8HD 5EXPA 4HUQB 5KTYA 4GRAA 3SS8A 3ZVRA 4HLDA 4MKIA 2ZI5A 1Q1ZA 2JIZA 3X1YA 2WBLC 4URYR 4EPXA 2N46A 4DLYA 5BXQC 2O8CB 4DIEA 1GM5A 4FMCB 4BZXA 3ICQB 1Z0FA 5KSOA 1H65A 4LJ4A 1W44A 2ZVQX 4BFYA 1XU4A 2UKDA 4BLQA 3MJRA 4QHSA 2SHKA 1WCV1 2FGJA 2PJZA 3VR5A 3K70B 3NBFA 2H16A 2GJKA 2OEPA 4EFMA 5JECA 3LD9A 4KFTA 4RCZA 1FNMA 3RS5A 1DVRA 1COWA 3A1UA 5ANRB 4QBGB 2ODNA 2WKRA 4KCGA 3KQHA 1VHTA 4PAQA 3U60B 1DO2A 1AZTA 3GLHA 4C0BA 3AVXA 2BIFA 4DLUA 2NQ2C 5J4HA 2P6RA 2NO7A 2GF9A 1DARA 3LXXA 3D8BA 3VKWA 2XXAB 3B1VA 3VHLB 3VNUA 4Q47A 5DI3B 4DSTA 3F0TA 3D6TB 3NIBA 1F2TB 1I4DD 1S8FA 5AR1A 3GJXC 3ZH9B 5F3WB 3K9GA 1A7JA 5FL7D 1T0HB 2KBFA 4AI6A 4HAYA 5FL3A 4MRPA 4AYWA 1E4YA 2BJWA 4BFZA 2VQSA 4GOJA 2O8FA 4EFNA 1P9RA 2GEUA 3E1SA 4IEEA 3GJ8A 4JMPA 4YXWD 2F9LA 4AG5A 1JAHA 3CRRA 3Q3JB 3PR1A 4DUGD 4HLCA 4OHXA 3NBYC 3P26A 2WWHA 3OEHA 2WIBA 1DPFA 2OLJA 3UMSA 3K53A 1KDRA 3AKEA 1ZU4A 4US2R 2BJVA 1D2EA 3A1SA 4JLBA 2CJWB 2FH5B 2V55B 2Q6TA 1W1WA 4RSGA 3K0CA 5TDHA 3TSZA 3EXAA 5JLJA 4FMCF 4IFBA 3TK1A 3MWLA 2JEOA 4I1UA 5CJ2A 5FL7A 5AJXA 1OXXK 4Q1BA 2C9YA 1ODFA 3QSYA 1D2NA 1GL6A 4JKYA 3U61B 4DSOA 1W2HA 1WA5A 3EZ6A 4HB2A 2IW3A 4MGIR 2MMCA 5JFGA 2PJRA 1N3BA 1OYYA 1DELA 1WE2A 4OKSA 621PA 1XZQA 3RS2A 1Z22A 2AKAB 2E87A 4JBYA 4FMBB 1TF7A 3LH5A 3OE7D 3PV0A 4DLRA 4V0ME 2KSQA 4MYHA 4JKIA 1U94A 4HDCA 4R2HA 5BQ5A 3KKQA 1P7CA 3TKLA 4ABYA 5FTKA 1CP2A 4BWYA 2RHMA 2VRWA 2ZI9A 4LSGA 2P67A 2O8EA 4B6EA 1KMHA 2D62A 3MSXA 1N6HA 4AYXA 5K8IA 5CLLA 1DG1G 4FIDA 1DAIA 1KTVA 1DBSA 3K09A 2WJIA 2JASA 2BMJA 2RAPA 4WVFA 4ZDKA 1M2OB 5GJVC 3PEYA 1NVVQ 1U0HC 4X8HA 3ZLJA 5C1BA 3CRQA 2QMOA 1QF9A 1IXRC 1CJUC 1KJYA 1U2RA 1Z08A 1ZP6A 4MKFA 2QRZA 1JECA 1HTWA 3KQUA 1YZKA 5DN6A 3EPJA 1YZTA 1QHIA 3K9HA 2ZJ8A 1US8B 1XTJA 2AXPA 4PC3A 4UKDA 4FCVA 3PENA 4XD7A 3OAAD 2WTUA 3FHTA 4NZYA 2I1VB 1ZNXA 2XSZA 1HQCA 5G3YA 2O8EB 2EQBA 2FE4A 4ZI3A 4EPWA 3SI7A 1TQ2A 4A4DA 3QVVA 3RLFA 2WAXA 1S2MA 4OJKA 2RGNC 2ZVPX 1ESMA 4GP7A 3H2YA 1CBUA 1RJ9B 1W47A 3C5CA 1M8PA 2ZRNA 1XPRA 1Z2CA 2JLRA 1CRPA 3AF0A 1NIPA 5ELXA 2NZ8A 2ZJAA 3JVVA 3LV8A 4O25A 4Q19A 1T3SA 1SXJB 5EXXA 4D2IA 1UKYA 3U44A 1FTSA 2FPMA 3FYHA 4LYFA 2GBLA 4QFMA 1QHGA 1VYVA 4ZIRB 4HLQB 3QEJA 1P75A 1KO7A 4M8NE 4DKXA 4P0TA 4L9SA 2A78A 4MYUA 2B7BA 2GRJA 2DBYA 2DYKA 2FV8A 5DH9A 1TEVA 821PA 1BYIA 1G6HA 4MRNA 2HUPA 3QKRA 5E7IA 2A5JA 4I99A 3A37A 4TYNA 4P3YA 2JAQA 3BC1A 3I92A 2GAOA 4OL0A 3MJHA 2V4ZA 4ZDJA 1EFTA 5JEDA 3VU9A 2F9MA 4TLDA 4B3GA 4PAOA 3L2OB 4Q18A 1HE8B 3EA5A 1E2GA 3PUWA 3FFAA 1BH2A 2EU8A 3PUYA 4ON9A 4PHHA 4LHYA 2FNAA 2J5XA 4IJMA 1RFLA 3A36A 3PG5A 4IOMA 3TR0A 4HB3A 5G53C 3KQKA 1HUQA 3H0KA 4PQFA 5CYOA 1KDPA 2K5UA 3AV0B 3MGCA 4ZCLA 2JLUA 2J46A 2VHJA 3MG9A 2XB4A 3RRZA 5L8VA 1R0YA 1YU9A 3O8RA 1OFHA 1XZPA 2D3WA 2G0NA 4RJLA 5JHGB 1OB2A 4TMXA 1G7RA 2ZETA 3AVVA 2PL3A 1UAAA 2JLZA 2NG1A 5J47A 1XD9A 2RGCA 4YMWA 3A6PC 5LD2B 3FMOB 2QSYA 3WRYC 1TADA 5HTKA 3GLIE 5CK4A 2WOJA 1XXHB 2JDID 3IQXA 5JI2E 5HE9A 2W6IA 4PPQA 1R0ZA 1UBFA 2G6BA 1S9HA 4GPTA 1MABA 3KB1A 1ZCBA 5FBVB 3AVTA 3T5DA 4Z1MA 4KU4A 1J2JA 1YKSA 2IX3A 3K70D 5J4VA 2OXCA 3MD0A 4A0HA 4HI0E 1Q12A 3LY5A 2IYLD 4BLRA 1E0JA 1KAGA 3LBNA 5L3RA 3ASZA 2AFHE 2QAGA 2VO1A 1NN3A 4G5OA 3I72A 3Q8XB 1XJCA 1VG8A 4NCNA 4JVLA 2WVJA 3IGFA 4U02A 2D06A 2IWRA 3E2IA 3RS0A 1DAGA 4C7OA 1LF0A 1R5NA 4C3ZA 3PEUA 1IM2A 1JXMA 2ASEA 3HYTA 2J0SA 4EQ6B 1UFQA 2FPLA 3V00A 2X2FA 1KI9A 1GITA 2B6HA 3U6BA 3QKTA 4TLAA 4RKEA 1NSFA 1G6OA 1TPZA 3CPJB 4JT4A 5BN3A 2XGJA 3OZXA 2H1LA 5DE3A 4DCTA 2HV8A 3GLIB 4UNNA 2WHXA 2CCJA 1S3SA 4TL8A 1Q20A 2GCOA 5EUMA 1P4SA 4Q9IA 2EW1A 2ZS8A 5KNCA 2CCKA 2ZRCA 1XMVA 1E9EA 2NO6A 3BOSA 3CBQA 2CVHA 4EPTA 1X86B 3QBVA 1JNYA 1U0LA 2FG5A 3QG5A 2IXEA 1BKDR 2X19A 3KKMA 2FFBA 1PUJA 3GCGA 2EWWA 2J41A 1SHZA 2P3SA 2D2EA 4CT5A 1OPXA 4JLKA 1IN7A 3OEHD 1RRCA 1SHKA 4WAUA 3GEEA 3GLIA 4JJZA 4Q1CA 3THXB 1R5BA 3PUVA 3K9NA 4LWZA 4Q66C 4LBYA 3KDSE 4OQMA 4D25A 4F4IA 3ADBA 3IBYA 1X6VA 4LV8B 4QGAA 2Z4RA 4PPFA 2BCJQ 4PHTA 2DWQA 4EKDA 4IOKA 4M9SA 3GP8A 5KNDA 2QBYA 4D4LA 3GMTA 2ONJA 5DNYB 1U90A 5EE0A 3I5XA 4EJSA 1GRQA 4XIGS 1QRAA 5J4YA 2MMGA 4CT4B 3CH4B 4B44A 2IYVA 2JA1A 3AP3A 1GTVA 1EGAA 4XH9B 2C77A 5FOVA 2J1LA 3M4YA 1MO5A 3P32A 4JVSB 2RGBA 2NIPA 3ZJYA 4I1OA 1VG0B 1XX6A 2GETA 3B82A 2N42A 1RZ3A 2VHUA 5CLQA 2VP6A 3P4XA 1QHSA 2OESA 3I62A 1OIWA 2QPTA 1MO4A 4H1UA 4IDOA 4H9GA 2C8VA 1E69A 4CEJB 1E6CA 1F2UB 1KI8A 4Q01A 3M1IA 3PIRA 3WNCA 2EYQA 4BFWA 4C0JA 3EPLA 4OK6A 3A1VA 4QBFA 2W6JA 4TMZA 2JLYA 3QBTA 1BS1A 1CJMA 3H86A 1LB1B 3KL4A 2XOKA 3B13B 4ZKEA 2F43B 3TBKA 2BC9A 4LHZA 2CL6X 4Q03A 2J0UB 2IYZA 4QXAA 1KAOA 3LAWA 2NOAA 2IUTA 4MUBA 1MRNA 1W46A 4ZDIA 1PUIA 1PLKA 2A3RA 3AQ4A 1NJGA 1IN4A 4JS0A 2V54A 3GLFA 3VR1A 2IF2A 1E2DA 4BZPA 2W58A 5IHPA 3BERA 2PCJA 3CPHA 3RWMB 3EZ7A 3WRXC 2C2HA 4TMWA 1A1VA 2RKOA 3K0FA 1W7AA 3CX6A 5GADl 4EUNA 4DB4A 2VP5A 2W0SA 1N6KA 1VECA 1VIAA 4XTCS 1Q0UA 3TVTA 4MRRA 4TSFD 4URXR 2BMFA 1JEDA 3NEYA 5J40A 2NMVA 3E70C 3MUFA 4UNSA 2H8KA 3TSOA 2QG6A 2QTVB 3GLHB 1RW4A 1KZGB 2O8CA 5HKKD 2QBYB 3T12A 1Z6AA 2C78A 4LYAA 4D82A 3GLFB 3L82B 1A2BA 1EFHA 2XZOA 4S2EA 1FMLA 2G83A 1HQYE 1XMJA 2R6AA 1F2TA 1LTQA 1V43A 1KJWA 3KZ1E 4NP6A 5KUTA 4D0GA 2JJ1D 1WF3A 3BH0A 2XNSA 3IHLA 3K0EA 2QENA 4JYBA 2B21A 4V0KA 2CBZA 1P9NA 2O8DB 3OESA 5IK2A 1VDZA 5DYIA 4HB0A 2GTPA 1E2LA 2O5VA 3CNLA 1G7SA 2ZITA 4KODA 2ZYWX 4IDQA 2OCYC 5TVKA 3FKSD 1E9RA 4RD6A 2F7SA 3EASA 1XB2A 3VKHA 4B34A 5EE9A 3PFIA 3TW8B 1PJRA 2RGDA 1SVOA 1UF9A 1EESA 1Y63A 3UWKA 3CW2A 4LJ6A 5CIWA 5L3SA 1W0KD 3W5IA 3R7WA 1I4LD 3LW7A 1W48A 4PZLA 3ZQJA 5BN4A 3DEFA 5AJYA 3B1WA 2J7PD 2BKEA 2WIAA 4NCKA 1E3MA 2Q3FA 3MWYW 1XNJA 3RSOA 4AG6A 4XTRA 4B35A 2P0EA 3UWOA 2GJAA 2J7PA 3KJGA 1CR0A 4NKRA 1XCGB 5JJKA 4A82A 2VHQA 2X1VA 3SDZA 1DAFA 4YC7A 1R2QA 1Z29A 4AY2A 3ZIAD 2ZAMA 4UXJA 4HAZA 1P61B 4FMDF 4TLEA 4BFUA 2IHBA 1G16A 1AS2A 1XTIA 3UXMA 1E9CA 4ZDWA 4DJTA 4CF7A 1M7GA 1XRJA 3CF6R 3PITA 4FCTA 4UQOA 2CJWA 2HYIC 1AN0A 2C03A 3CX8A 4HEJA 4YMSA 4B76A 4ZCMA 4ACBA 5B30A 3L43A 1LV7A 2IXFA 3RYTC 1VPLA 4L9WA 3DL0A 1XXHE 4ASUD 1SULA 2QL6A 5IRCD 5KNBA 2PX0A 1TNDA 2GAAA 1TF2A 3U7HB 5KHOC 2P5TB 4LK2A 1W2GA 1JXOA 5G3ZA 3W90A 2BM0A 4NU0A 4B75A 1G7CA 3W8RA 2QZ4A 1G8YA 3EPHA 2OT3B 4IDHA 4MDEA 5FPSA 5EUQB 3BS4A 5FFMA 3U7GA 2OM2A 1OIXA 1S96A 2QRNA 1OKKA 3W34A 2GF0A 3PVSA 4JZKA 3B7GA 3TQFA 1FL9A 4MH0R 2PEZA 1YRBA 4A2WA 4G3XA 4W5WA 4BECA 2V1UA 3FVQA 4K46A 2BM1A 2XNDD 4D81A 1LNZA 4L15A 2FSGA 3WP0A 5LB4A 4BLOA 2V1XA 4KHZA 5EP3A 5AUQA 5FTNA 2XITA 2QE7A 4JSTA 1J90A 2CNWD 4W5JA 1AKYA 4IFEA 2FEMA 3C15C 2QNRA 3EC1A 2FFQA 3B6EA 3TSWA 1E2KA 4QM7A 2AXNA 3KTAA 2YC4C 2IK8A 3RRMA 5C18A 3EWSA 3MFYA 2GCPA 2FSIA 3Q5DA 4PZZA 2R6FA 5FBRB 1AGRA 1X3SA 2QGZA 5H70A 5GVSA 3X1DA 2RGNA 4DEYA 1COWD 1KO5A 3MMPA 221PA 5EE5B 1DEKA 2WSSA 3A1TA 2QU8A 1G3MA 1WB9A 4L4UA 4YLGA 4PHFA 4B3CA 5D3MA 1G8HA 4BLSA 3NEJA 2WJYA 2AR7A 1RE0A 1GOTA 2Z83A 1UKVY 1EK0A 2VP9A 2ZRMA 1H8EA 3HDTA 3SFVA 4C4PA 1NVUQ 4Q4AA 2OCAA 3UG6A 1XJ0A 3NDBB 1XCPA 3BFVA 4LC1A 5CM9C 3U3MA 1N5JA 1XF9A 3CX7A 3A1WA 4PR0A 2QGNA 3FKQA 1GUAA 3Q5EA 3BJIC 1JJVA 1T0JB 5E3HA 1NI3A 1II9A 1X1RA 4GMDA 5EZ5A 4LDJA 3QPUA 2QTHA 3EW9A 5F2EA 1ZC3A 3AVWA 2VLIA 4B3XA 3UATA 3SU8A 3QKSB 4FCWA 5TB5A 2ZUBA 3CRVA 4IKEA 4M9XA 1GILA 4OQNA 4QGGA 5C46F 2VP2A 3DPUA 3NKVA 3ZD7A 2BBSA 3NWJA 2GZDA 2RHDA 2WSMA 4NCHA 1I4TD 3VU9B 1YRAA 2FFAA 3CKLA 3TUJC 2CVFA 5E7JA 3X1ZA 3EPKA 4NCIA 3U4QA 5D3QA 2H57A 1ZNWA 5FI0B 4C2UA 3KXIA 3H84A 5BW8A 3I8SA 2FEOA 1HT1E 1J7KA 2C99A 3ZZ0A 2CK3A 4IXMA 5CITA 4WA7A 3KKPA 2GJ8A 4AC9A 1N6IA 4MRVA 2D7CA 3QF4B 2NGRA 2Z43A 4CEHB 3OEEA 3SJBA 3VR6A 3KQNA 1NNEA 4A0GA 3FPAA 5TXGA 3M6AA 2PZGA 1MO6A 1U9IC 4LZZA 3ZZTA 4DLZA 4HUQA 1Z8FA 1FMJA 1MH1A 5J4KA 4RY2A 4MKHA 1ZAKA 1NBMD 2I3BA 3T1OA 1ZM7A 4LJ5A 4PSKA 1WQ1R 4PTLA 2V9PA 3JVUA 5IT5A 4R98A 1M6NA 4GZMA 1EFRD 1R8SA 5KOYA 1KDOA 3SZRA 2ZUDA 5D3MB 1D8TA 1MO3A 5K8LA 3THYB 4DDVA 5TMPA 4DSNA 2ZPTX 1KO8A 5KYKA 2ORWA 3DMDA 4FN5A 4LJ8A 1JQJC 3ONWA 3IKJA 2VBCA 3TGPA 1VHLA 4ARZA 3K70C 5CK5A 2YINC 2GK6A 2ZRIA 3H1TA 3RVBA 4LC0A 1JR3A 1J8MF 3CO5A 1W4RA 1ZCAA 3C41J 4QGFA 1W4AA 2BV3A 1YR9A 2HYDA 4N1AA 2O8BB 1HH4A 1R7RA 3IBGA 3SQXA 3IUYA 1IN5A 3HPRA 1AM4D 1EXMA 1IN8A 4DHEA 3O8CA 3PJRA 5SZIA 2GEVA 2ATXA 2WPDA 3BB4A 4B2LA 1ELOA 3WHKA 4ZPXA 4QBHA 4XVUA 1E32A 1G20E 2QP9X 1KGDA 4IOJA 2RCNA 2ODBA 4CVNA 3MWKA 5FPTA 5JSZB 5FTLA 3SEAA 2AD1A 2X77A 4E09A 1TL7C 1ZM2A 1KHTA 1SVKA 4F4JA 2WJVA 2O8FB 2BBOA 4J0QA 1W0KA 1Z0AA 2GCOB 2QMHA 3BORA 5IDVA 2DFNA 2OBMA 2IWHA 3PUZA 5CM8B 1SXJE 3C7KA 2QY9A 4Q02A 3GQBA 5BN5A 1XPUA 2IYTA 2ATVA 4JLNA 1TU3A 2RGXA 1XFAA 3LX8A 3SHWA 4ESHA 4F7WA 3B2EA 3DHWC 4Q5IA 1Q1QA 3A8TA 5EZ6B 5JCPA 4LV5B 4K81B 3TH5A 5JSZA 1IOZA 5L3QB 2WJJA 1E2MA 4A8JB 1YZUA 1Z5ZA 2W2TA 3AGPA 2FPKA 3S1AB 1W36B 3THXA 2OBNA 1M34E 2GJ9A 2ZJ5A 1N5IA 3IPXA 5JBQA 2HCJB 2KJQA 3N70A 2GK7A 2X2EA 2V7QA 3EC2A 1XPOA 3DKVA 1N25A 5BYJA 4UNRA 2RB4A 1TUEA 1R10A 2QM7A 1GL9B 1YR8A 4LYHA 2CHGA 4LJYA 1KSHA 1II0A 1W4BA 1FX0A 1VTKA 3GEHA 2RH5A 3IEVA 4RD2A 4G5SA 4LBZA 3VX3A 1VCIA 2X8AA 2HEIA 4XJXA 1OJLA 3LFUA 5FR1A 1HY3A 1FUUA 5KDDA 3SBDA 4RFSA 3TUIC 2KBEA 2YOFA 5B57C 4IDPA 2R8RA 3BIFA 1R0XA 2OG2A 4XVQA 4DLVA 1EFCA 5B2ZA 2PBRA 4HZUB 1Z28A 5GJBA 2YYZA 1RRFA 4KJZA 2IA5A 3EWAA 4R2IA 5CB8A 2VPPA 1QG2A 4M1OA 2Z0MA 4WW0A 1GFIA 1OHHD 1E79D 4W5HA 5IK2D 1L2TA 5JS7A 5FI1B 4A0RA 1BMFA 4I1SA 5EE3A 3O8DA 2WOOA 4NDZA 1E9AA 1FZQA 3LX5A 4K8OA 4XWOA 3TRFA 2A30A 1UM8A 5KO2A 5FOSA 2AHOA 3AF3A 2JIZD 3DM9B 3LW8A 2BOVA 4DLXA 2WM9B 3R9WA 4Z8XA 3CR7A 4QOSA 4WBSA 1KK1A 1EWQA 4L5BA 4RZUA 4WZ6A 3CB4A 1P3JA 3WP1B 2V6JA 5KSZA 2Q9AA 3C8UA 2WSSD 2AK3A 1WRBA 3GFPA 3HPQA 1VMAA 3T15A 2GHIA 1UDWA 1DAKA 1F2UA 1J99A 4LBVA 1XTKA 4UNQA 5AJZA 5LBIA 4URVR 4TYQA 4GBMA 3DOFA 1NLYA 3FKSA 4I1VA 2J59A 2DWOA 5C4GB 1R4AA 2OCBA 2GVDC 4Q1DA 4CZ2A 2ZRFA 3BBPA 3OIYA 2YWHA 2J7KA 1S1CA 2VP4A 5CB6A 1ZRHA 3RABA 2WJGA 4B71A 1HEIA 3BD9A 3TLXA 1CR2A 3LO5A 4LHVA 1KI2A 1Q44A 4NMMA 1U99A 1Z0DA 1ZD1A 4PC2A 1G21E 3TVDA 3WY9A 1QHHA 4DDWA 2R6GA 2IHYA 1PVOA 4Q00A 4JL5A 4E22A 1CJTC 1EFUA 2ZU6A 3I3SR 4TYPA 5TARA 4NPHA 3AUYA 4PSVA 1W0JD 2PMDA 3D31A 2CLSA 3SNHA 1G4UR 4PC1A 1AS0A 1TF5A 4V02A 3NG1A 3NC1C 2YWFA 2VYFA 4GL2A 2W83A 1E94E 1NKSA 5AWFC 2ORVA 4Q9HA 1G8FA 3W6NA 1JPJA 2AWOA 2F55A 4TMVA 3CNNA 2QP4A 2FSHA 4Z54A 2JLSA 2PEYA 3P20A 4NYIR 2VP0A 3D7MA 4FWIB 4TQAA 3GJ5A 5LPNA 2D2FA 4Q7KA 4KYIB 3GJ4A 2FX3A 4X8LA 2DY1A 1G64A 2AWNA 4ZIRA 2ERXA 2YC2C 3KFVA 1TAGA 4YMVA 3UK6A 1RVDA 1AS3A 2OAQ1 3U44B 1TEXA 1CIPA 3F5FA 1RYFA 2ZSFA 1S1MA 2WV9A 3R9XA 1Z83A 1SKYB 4N0DA 2KI5A 2Q3HA 5AJWA 1KI7A 1UBCA 4A1FA 2GVZC 4KVGA 3QEOA 1OE0A 3GLGA 1R6BX 1XBTA 3MLEA 4WZAE 4PPNA 2EWVA 1Z06A 4P4SA 5HCIA 3BAFA 5C2JB 4ZKDA 2OFOA 2BMEA 1GDDA 2QORA 4PO8A 1AQUA 3K0AA 5FUXA 5FH9A 2ZI6A 3LVRE 1S3GA
chains in the Genus database with same CATH superfamily
5TS2A 2MSCB 2RDMA 3WLTA 1R0LA 2O9JA 2VHZA 4MEBA 5EQTA 1GPAA 3RTBA 5BQ3A 3HDQA 3ZIAA 1D0SA 1F0YA 3KE8A 3F5DA 3FPGA 3Q2IA 2BTOA 3GNLA 1NUSA 3T4UA 4CM4A 1O1YA 5CM2Z 2JHAA 3CNBA 3VC3A 4IHQA 3ZE6A 1JTFA 4BTEA 1USWA 3TEFA 2Q27A 1KZ7B 4DIOA 2ZTSA 3JAWA 3HJHA 4YQFA 1WW8A 2I4RA 1B8UA 2JDIA 2YIMA 2VXBA 4R83A 3GDHA 4ALNA 3B48A 3H42B 1F6BA 1HT3A 1ZJZA 3OI7A 2H1FA 4EVSA 2G0TA 1KZ1A 4F71A 4JP8A 2WG0A 3EVFA 3NWPA 1H6AA 3LBHA 2IH4A 2HPVA 2N1MA 1V5IA 121PA 3MZ0A 2P9HA 4RDIA 4FP9A 3PNKA 4EBBA 5JMPA 2GZ2A 1S02A 1QQ7A 3STTA 3AHFA 4C5CA 1SVWA 1FVXA 3CIOA 1Q91A 1Y81A 4JB2A 2Q5JA 2JG3A 5A5DA 4QBIA 4Y6SA 2WWRA 3AI3A 2GHQA 4DOMA 5AK0A 1OLSB 3IQEA 3QFSA 5JYDA 4MR7A 3TTTA 2IKQA 4GLBA 4BO2A 5IFKA 2F1JA 3NXKA 3IVGA 4TSFA 2HI0A 3UBTA 2HLPA 3W8EA 4G8JA 4KOEC 3T9DA 1Z4QA 1W4LA 3RV3A 4CM7A 3OLWA 2V8BA 4JVNA 3ROKA 3TKAA 1CUCA 2BHLA 4KQ2A 4LI3X 4CFZA 1FDOA 1SXJC 4O1MA 1I6MA 2WTNA 3OFNA 5DNEA 3LUKA 1JQLB 1E5LA 3BXPA 4ENUA 4TKVA 3TIFA 5K05A 4TQ9A 2PX4A 1BO6A 3PCTA 3B9QA 5ITVA 1CRQA 3KKLA 3H5RA 1TU4A 1WXQA 2C3PA 1G8GA 3VTKA 5JNLA 3L0PA 3M81A 4WA8A 5BT9A 1EH5A 1QFJA 2HO4A 4OJNA 4KH0A 2V6IA 1ZD8A 4TTAA 2XUFA 3Q3CA 3TQTA 4AIIA 5D6NA 3SGLA 1VJCA 4MTCA 5KYXA 3WLRA 5ES4B 5LQRA 4L8LA 2PT9A 3C3YA 3CZQA 5CJPA 1Y3BE 5DM0A 4P6VF 2YWGA 2QVCA 5ALTA 4QJ3A 1JPVA 1II8B 2P62A 4LN1A 1NW7A 5BV1A 4LMPA 3QTLA 3QU5A 5C32A 3GJZA 2R4QA 3HVUA 2IDZA 3WI7A 1ORRA 5KZMB 3UJNA 4B6FA 2CHQA 4NZPA 4MJLA 3RUAA 4TKZA 3UC5A 2JGNA 4JV5B 2JGRA 1KO1A 1L7VC 1I5RA 5F3DA 1G5FA 1I9GA 4JUIA 2XUAA 3JWPA 3EZFA 3M3DA 3SZUA 5JZVA 4NG4A 1J42A 5DBFA 3KSDO 1MIHA 3MRTA 4TS1A 3A6JA 4ARVA 4RE6A 2V3CC 1MOQA 4Y1RA 3VH3A 4L02A 4B4WA 3X2FA 4C9BA 4E46A 1RC8A 4YAUA 3QX7A 2ZM5A 1GGJA 3T0GA 1OMOA 1RQLA 1X92A 2R2GA 3IAS1 4G1EB 1ZC4A 4H3HB 4Q4AB 4QU0A 4XQEA 3ROTA 4ZJZA 4RHUA 3RYFB 2W6ID 1H69A 3KCNA 3N0WA 4M8IA 4Y7DA 3P9XA 4J29A 2CXHA 2H7VA 4O29A 1NW8A 2L2QA 3D6UA 1QZTA 3TD2A 3F90A 3SQLA 3LQFA 4HWOA 1Q14A 4RH1A 5JRZA 2ZBFA 1XZNA 3FI9A 5B53A 3UAYA 4IJKA 4QHYA 4OQQA 3KKKA 2IBMA 4G97A 5BSUA 3VSDA 1NE2A 1DP4A 3U7QB 1KNQA 2CJPA 2JHCA 4PQGA 3BK7A 3TFWA 4A27A 4BGIA 1GYQA 1D5CA 5E4FA 4V2IA 3CVWA 1LKZA 1ZIXA 2B5VA 2GEBA 1AMUA 4EJSC 1QKKA 3FI0A 1PE0A 2YS7A 1OHHA 1OAAA 1Y4AE 3SJ7A 4WWHA 1YACA 2VSFA 1AJEA 1W9HA 2QV7A 1BXRB 2W00A 2XTNA 4IJQA 1BKYA 1L4GA 4PQRA 3LDAA 3CMCO 2WMYA 1RPAA 1XRLA 3FWHA 3OE1A 4JYMA 4V0LA 3ORYA 3OZIA 5LOVF 3KAKA 1LTHR 2GA8A 1GTL1 2FOLA 3HHEA 4J07A 3BB1A 3Q6MA 4EG7A 1J5PA 5JANA 4X7MA 1P1CA 2RHCA 4IFIA 5IT9A 3Q8LA 3GJ0A 4U2EA 3SKXA 2PNJA 4J75A 2PWPA 5COQA 3DZBA 3REQA 2V6GA 5JARA 1DO0A 1DQPA 2BFFA 5JU6A 3TTWA 1DQSA 3MWJA 4M88A 4MITA 1ZVQA 1JX6A 4PWZA 4PZYA 4WXYB 1NMZA 4ECEA 1J8QA 3HYLA 4O63O 1NXSA 5GOTA 4ABTA 3O9VA 3FOAA 2FAXA 1HQDA 3ZGOA 4NBWA 1MJGA 1YMVA 3ZLUA 1JU9A 1YVRA 2FJPA 1IBRA 2IOQA 3AVQA 3PDIA 4IV8A 2B1IA 2JGMA 2XVMA 3F4LA 4S2UA 3RJTA 1XQ9A 4V0QA 1IYZA 4GMXA 4KVAA 3B9PA 5HIIA 5LQNA 4XUGB 1JU4A 3PUKA 4ZVTA 3SYKA 3L8ZA 5HSGA 3VKHA 3T5CA 2ODPA 1ODLA 3D3QA 3R3ZA 1N6RA 1Y3AA 4OO3A 2L42A 3R40A 4NYMQ 3DMTC 3NGMA 2G80A 2KE5A 1E5DA 1EDDA 2PGNA 4KXMA 3JQPA 3E9NA 2C31A 3CBGA 1KYTA 3H17A 4LOHA 4OLFA 1Y6QA 1NP6A 1IZ8A 2WM2A 5AVVA 3OQOA 4TXMA 1C4XA 4B81A 1LCIA 4O0MA 4I9FA 4A16A 3TPFA 5JVDA 4IUDS 2PKXA 4RZIA 1E3WA 5HFNA 4FDMA 1Y1RA 2VDQB 1M33A 4P4UA 4TMTA 1EHIA 2HGZA 3DTNA 4NU8X 2B6NA 1VKRA 1LRKA 1UZMA 2R00C 3GJSA 1V71A 2JGIA 4KTVE 4D9HA 1D1PA 3KLOA 3M0EA 4JU8A 4GZ6A 1LZLA 4JLVA 2Y77A 4KAXA 2Q9BA 4YT5A 2F3RA 2DLCX 4BFXA 5E2IA 3RUDA 3KRTA 2APJA 3R8FA 2FF7A 3QOYA 4FCCA 5JXGA 4F85A 1LQUA 1MT0A 4A2PA 4C3UA 4J03A 1U2DC 2CKDA 1X7DA 5IS2A 4NHOA 2XBLA 1KHHA 1YHZA 3HEBA 4OCZA 2VK2A 4LYEA 3UFXB 3W5VA 1KI6B 1UBGA 2B3TA 1CJVC 1ZK4A 2F3UA 2GA9A 3RVSA 1TECE 4PPYA 4ND6A 3ELYA 4RCYA 3WJAA 3D7RA 5DASA 2VNSA 5ERGB 3V2UA 4GLJA 4RF4A 1L4LA 4AK9A 1EFRA 2AG0A 1OASA 4C43A 4URWR 3SQDA 5F9FA 4DC1A 4L73A 2IELA 1I6LA 4JJEA 2QE7D 2ONKA 2WZQA 4ZT5A 4S1NA 4DDKA 3A4YA 4EL5A 1CULC 1UOQA 3DEJA 4IXNA 3TQRA 2FW0A 3B1YA 3I23A 3OZEA 1Y1PA 4AUMA 4CTMA 1OF1A 3SP1A 3R6GA 3L1UA 1OV4A 4YT8A 2ZULA 3RKRA 3BSYA 5HJ2A 2PD4A 2QT1A 3JQEA 3M6IA 1YCGA 3JYNA 3MJ4A 2GASA 1A04A 2R66A 3HU2A 1N2CB 3PR2B 4E70A 5U9CA 5DWQA 1TVMA 4BV9A 2QX6A 3LHFA 1QG6A 1F0PA 2ZE7A 4OGLA 3REFA 2QN3A 2ZAIA 1DLJA 3AJDA 2JLYA 3VNVA 3HSYA 3DKPA 4KFSA 3WZLA 1H0RA 4DCVA 2VJOA 1BIFA 1HLFA 2CXSA 4I1RA 4JLOA 3UA3A 3P2MA 1JSLA 2JVKA 1AG9A 2PCLA 3CM0A 1R8XA 2H18A 3FPCA 2ZJYA 3OVMA 3R7FA 2HD4A 3RVPA 4KDCA 3ZVLA 5HQ3B 3WLMA 3O92A 4D26A 2INGX 1HURA 2TRSB 3OUZA 1DC4A 3GXOA 1D2HA 1CF9A 1EUCA 2XMCA 3RG2A 1H93A 2GK4A 2C58A 1F20A 2W6QA 2YHBA 1FDIA 2NVWA 3I61A 4CL0A 1X7ZB 3NBKA 3L84A 4ETWA 1B1AA 1J5XA 1V2GA 5LIPA 4GM4A 1BMFD 3O4RA 3T35A 4BBAA 3UIEA 1YZYA 1VL6A 1X1AA 1EE9A 3VYSB 1X9HA 4IYJA 5BMOA 2Q1WA 4LOJA 5DU2A 4Q7QA 2FWBA 3QUBA 1JG7A 1EM8A 2XQKA 3QXHA 1C9NA 3V32A 1WZCA 1ZGJA 3IEMA 1IB6A 5E6RA 4E13A 2PYDA 5CG1A 1YR1A 4HTFB 1M5UA 1ZMOA 4HH3C 4P5PA 3JYLA 3WK8A 1QZXA 4V0OA 2JFBA 4UCWA 4UMVA 3JRWA 2WFMA 3DULA 1RHQA 3N2YA 2W70A 3ZWXA 1EDOA 1VCMA 4FLEA 4NU5A 2C9ZA 3FOWA 2EFHB 4PYMA 1ISFA 3D3EA 3G6WA 4B2PA 5DHTA 2CLDX 1G9TA 2ZJ1A 3GEPA 3VO8A 1ZH8A 1GKKA 4B6RA 4FD3A 4ILKA 4NYMR 2QVGA 5GJWC 1XEWX 3ZDRA 3PTAA 5K3DA 3LNCA 4RESA 1A4XA 4JT8A 2CBGA 2BELA 3GJ3A 3GPIA 3IP9A 4TT3D 1Q1EA 3CLUD 3QWBA 4ADSG 4KIGA 1NUQA 2BI8A 3A6ZA 5AI5A 1JQAA 3T3IA 4FZ5A 1MOZA 3EZYA 4DCNA 3JWHA 1WXXA 2ZYUX 2X6RA 4LVCA 2QD1A 3L0IB 4IJWA 1Y3DE 2Y1LA 5IVIA 3GEIA 1M7BA 2QVYX 4YAJA 5D87A 4C07A 1CLEA 1JQEA 1RQPA 3NTOA 4FVTA 4HGOA 2WTXA 5K0JA 2LV8A 3ADKA 3M70A 4R40A 1T4CB 2YDYA 1BU8A 2R3SA 2NYUA 3UYLA 2QTNA 1UBEA 5A71A 3WK7A 3C6YA 3FOFC 1O57A 4MA5A 3SYNA 4Q1EA 3T3OA 1G19A 1OOEA 5AKHA 2XB2A 4RDHA 2VQDA 2H92A 3B20A 1KDTA 1Y82A 4B33A 4IJ6A 2ZBGA 4XARA 1VJ0A 2JLBA 1ADJA 4BJ1A 1D6JA 3PC2A 2G82A 4GD3Q 1E89A 5JD6A 3MILA 1TZKA 4N0MA 2HDHA 3ZQKA 1T1JA 3MOIA 4UARA 2H48A 5C34B 2KPOA 4IF4A 4OEHA 3R7NA 3SYRA 1R0KA 4TLMB 4X66B 2H1RA 1JR2A 3LA8A 3WRXA 4HSEA 1KE1A 4CTJA 2XHEA 4P0QB 1D2RA 1HT0A 1RSZA 3T9EA 2V6MA 4LJ9A 5A6VA 4RMIA 2ZBEA 3KETA 3U7FB 3I64A 2JHPA 2V7QD 4X7PA 3UZUA 3FOCA 1QH8A 3IJPA 4WKCA 2VJAA 3ZHXA 2G1JA 4MVJI 1UIMA 3UJDA 3EC7A 2C7BA 1GPLA 4LXYA 5IJAA 3S4YA 1JNXX 2O1XA 4GYWA 1RLMA 3HO6A 4WVLA 2I87A 3ND9A 4DWVA 5DYWA 3KVNA 3BWYA 1L8LA 3R7WB 2FFRA 2OV3A 4XDZA 1X7WA 4KX3A 4IVPA 4N5LA 5F2OA 5M3BA 5BN4B 2C1EA 4UUNA 1UKEA 2QSZA 4O4LA 4CI9A 4MP6A 1U9JA 2EW8A 4P7FA 5JTUA 2PO7A 1MABB 1P60A 1NJ8A 1Z82A 2HGSA 1JIVA 2IPNA 1RRGA 1WW2A 3OCYA 1DXOA 1UBNA 3JSAA 4HJXA 4OJTA 3UWPA 1IY2A 1ESCA 3ACBA 1ACLA 1EVIA 4M37A 1FRQA 3K09C 4CG1A 5JI3E 4ESOA 3ICEA 3B3GA 3PD0A 3VAYA 1IN6A 2XBMA 3M9LA 1D03A 4TSKA 2B7CA 1DV2A 1Y4UA 3KKOA 3PGKA 4LNUA 1F3OA 1TE2A 2MYTA 4G63A 4Q1VA 1ZHFA 3DOHA 1L4UA 4Y0VA 4QGSA 3C74A 2PVCA 4BNVA 1JV2B 4U3JB 2R2AA 4GSYA 4EYKA 3NH9A 1DDGA 2ZI3A 5HFJA 1K1EA 3MTGA 4Y2PA 2P9YA 5EZYB 3VR3A 5B55A 3GAZA 1GZHB 2FMKA 4TM8A 1I13A 1RYHA 4B47A 1CS4C 4LVUA 5EJ5A 3WWDA 4W8GA 5AKKA 3OCCA 1DJOA 4Y2SA 1B6TA 1M6VB 3ST7A 4HNVA 1N5KA 3M1AA 3VMFA 5A0VA 4BUCA 4JSYA 2G9ZA 2COUA 5I3CA 1BA2A 3IDZA 1VE6A 1AZSC 1BGVA 2YRWA 1XJQA 1ZJ6A 3GFBA 1EGHA 1K5HA 1LVUA 3LCVB 3R8CA 1VJGA 3ACDA 4EKIA 2XE8A 5C8ZA 3CYFA 3RWOA 3L8YA 3ILYA 4GX1A 3PGXA 2QRUA 2KLBA 3SJZA 4MYDA 1S6YA 1L4HA 4QELA 3FBTA 1ADFA 3F3YA 3TIIA 2F00A 4AWBA 2VPIA 4I19A 1HKHA 1M74A 1W94A 4BXOB 1TIPA 4DKJA 4V3CA 3I5AA 4G0NA 2FU5C 3LRTA 5CT4A 5B2EA 4WD3A 3B6ZA 3UN1A 2FN9A 4M9QA 5DCLA 2NUAA 2W2KB 3RFTA 3MB8A 1DGQA 1MPTA 1BOFA 3GHHA 2FN3A 3VJRA 4BDSA 2X5KO 3KD3A 4X20A 2B82A 3GRFA 3WIOA 3I5YA 3G2HA 4HXGA 5A3VA 3HWSA 3KJIA 1OROA 4O33A 5DDIP 5I7AA 3KHSA 4EPRA 5CPFA 4M21A 3L1KA 1P4GA 4QYSA 3U6KA 1H3EA 1UQTA 2H0AA 2JJ1A 2PQ2A 1NUPA 3AKDA 1GFSA 1C4WA 1UDXA 4P98A 4UU7A 2EFEB 1JEQB 5GZ6A 4ANFA 1OC2A 1N2GA 4TV8A 1KP2A 1UAYA 3HUTA 4Z51A 4QRIA 4ZVOA 5FWNA 3ODPA 3L7MA 1X1QA 2IODA 3A6KA 4PYLA 1E2IA 3EIXA 3PX3A 4E5UA 1X7YA 2ODTX 4RFVA 1G38A 2GNOA 1GRRA 4UXHA 1TXGA 2PIAA 3TNYA 3TQQA 1QYXA 3AR8A 4RZXA 2VBFA 3CS3A 1L5RA 1RI1A 4FHGA 2DKOA 4PFQA 3AEXA 4YPOA 4FFVA 5GQSA 5FX2A 1GNQA 3HR7A 4R54A 1OH8A 1RYBA 1P1FA 4BN5A 4F8EA 5KNCD 1C41A 4YCSA 1QE3A 1DG9A 3LPLA 3OZGA 4DWWA 1WULS 1Q1GA 3QF4A 3IE1A 1SQFA 1HLPA 4X64B 4DLWA 2FFHA 2JAUA 3K1AB 3QPDA 1Q6ZA 3I4LA 3MELA 4J7AA 3N2EA 4QLAA 3ABQB 1NUHA 1YZVA 2IOHA 1I7DA 2D5LA 1OLUA 3H2JA 1W19A 3IULA 3FTFA 5AVQA 5TT1A 2PUTA 3OZDA 3VPCA 1NBME 4LYYA 1HLGA 2P78A 1XD2A 2C57A 2XH8A 2ERYA 1U0JA 3HR4A 3OT4A 2PLRA 4KYTA 4HKTA 4TWZA 5AHRA 3LQ4A 1PK8A 3EWIA 4LX0A 3DVRX 3SE7A 1ZMXA 3ASYA 1ES9A 4EY6A 1PNRA 3TGLA 3UMFA 3CUUA 2ILVA 4CQJA 1Z2PX 1ANKA 3QW4B 3HJFA 5G4KB 2AOVA 3W2HA 1GLGA 2C4UA 1HNZB 3NFRA 4EZEA 3BXGA 3OZBA 1Z0JA 3C8DA 5C8YF 1T1SA 3EVTA 1JJBA 2QIOA 3QFRA 1VRVA 3I1FA 3MJCA 4AN4A 4YX9A 1JFRA 1R4NA 4BX3A 1CY2A 1E6MA 1HE5A 3LS2A 4XYBA 3W6OA 4EHNA 4Z6KA 4OP1A 5KNLA 4B3JA 1OH5A 1T5IA 1VLLA 4BNHA 4IHJF 2YV5A 2EFDB 4QNMA 1VG9B 2LKCA 1JZTA 3LYUA 5TMDA 3WGZA 2A0YA 4XRGA 1NMEA 3ZCQA 4R1TA 2CFTA 4TV9A 5A5EA 2YICA 4B6PA 1U7DA 4JQSA 5LA6B 1JFLA 3CKMA 2O59A 2GCGA 421PA 3O3OB 5CCEA 2NXWA 4KQHA 3IERA 1NI4A 4Y2TA 1R6TA 2VRNA 1CLUA 1U5BA 2ZVDA 3G0CA 3IDFA 3OOYA 2ZBRA 3UPUA 4K0KB 4J9VA 4NATA 4B40A 4KFRA 5T3YA 2QTBA 3CT6A 4F3YA 1FP1D 2XVYA 1LK7A 4J0IA 2ZSIA 4DCCA 3ZQ4A 2PVPA 3PWTA 1LPAB 2YDXA 3OPQA 4F06A 4F38A 4GI1A 2DMRA 3GGGA 2QD2A 3PYXA 1VPEA 1VYHA 3CRZA 5HBGA 4C89A 2I2AA 4BLTA 3C8MA 1CUUA 2BFFB 4JL6A 4QAQA 1RWNA 2HSDA 2P6NA 1YZGA 5EE1A 5HX7A 4B3IA 4CCSA 5JS8A 1C7ZA 3KR0A 2NTEA 2YWJA 2BFMA 1G4HA 2WZCA 1LNSA 2FPIA 4FFRA 4GYKA 2HWYA 3DDOA 4IMJB 5G0TA 1R3DA 3G2PA 1JIIA 5LWHA 2GTIA 2O7SA 1UJBA 5HKLA 3U37A 4E5DA 4ARCA 3ZG6A 3N2KB 2C4HA 2DCUA 5KQRA 5KTPA 4XVRA 2CXPA 2R65A 2Y8EA 2YMLA 2Z04A 3BQMB 3HJCA 1VOTA 2PZKA 4RGVA 4UBIA 4Q82A 3RADC 1J1UA 4AKEA 4YJ3A 1Z4OA 3DFFA 3RODA 1X8JA 3EUFA 3I6BA 2IYQA 3GG9A 2X3YA 4KWCA 4O1IA 5AVTA 4DJEC 1NJFA 5AYVA 1CB0A 3S5JA 4YMHA 3QXJA 3MK31 1T2FA 5DGCA 5CCXA 4KK3A 4Y30A 2ZWIA 1B2RA 3N2IA 4A73A 2FZ5A 2HQBA 3DWEX 2BBWA 4PSDA 5IF9A 4GOOD 4FGSA 3VPAA 1JPNA 3W2TA 4DV1B 5HXAA 1YUMA 2EW2A 4G4SP 2EKBA 3TLGB 4JUDX 5J4LA 1PGOA 3UT5B 4O2RA 3C8ZA 4LE1A 2P2NA 3AR7A 4NMHA 5E7MA 2IBTA 1ORTA 4RQTA 2PSJA 1DHRA 1T34A 3DB2A 3SS9X 1FP2A 1QRTA 4E2XA 3CV3A 3NBAA 3VU0A 3FROA 1O8BA 4PXAA 4NCXA 4YXWA 2RJOA 2JIOA 5B5SA 1W5FA 5B3KA 4LF8B 2C9CA 1L5HA 1RWOA 5LKAA 3BJMA 5HIKA 1DKRA 2AR9A 2XD9A 4AXXA 5EXSA 5K0SA 1U7TA 1RAFA 4E2FA 2NTNA 2ZGVA 3WYAA 3GFTA 1KVUA 3GFOA 4N3NA 3KZMA 4GZLA 4RA6A 3PWZA 2CLCX 4NH0A 4TL9A 4AMYA 3T5MA 3WWOA 5K1ZA 3IMEA 5KIAA 3C3JA 3FRIA 4LUCA 2KW5A 2AV6A 3B9BA 4QOIA 3N07A 2OAEA 3ONFA 3TZQA 5C7LO 3CKKA 4PTZA 4HADA 5FJIA 3PQCA 4IHJB 2XNHA 1G41A 1B26A 4FOPA 4M98A 4ENPA 4HRXA 1QP7A 2AUTA 1UC8A 2MSKA 1ISJA 1PK7A 4DCJA 4TZTA 3ELBA 3I52A 1XTBA 1KJQA 2ZRHA 3VDNB 3FPHA 4DDUA 1QE5A 1IUPA 3F98A 2EP5A 3JQBA 1S2OA 2X8WA 4XIIA 3FGNA 1OT3A 3AW8A 5DBGA 5C8YB 1WQ4A 2Q8PA 1YE8A 1T13A 3G49A 3WLHA 4UTNA 2GPSA 5BURA 3HYRA 1GIAA 3G9ZA 3T61A 4AZ3A 1DE0A 3JVEA 4CQMB 4BPBA 4B3MB 5H4HA 2HK9A 5IBRA 2HCRA 3BXZA 1QCCA 1GTG1 2IUSA 2OYSA 2WMDA 5GGYA 4NAHA 1YS4A 3IXMA 3F6YA 4YJ3B 5KJ6A 4NENA 1PFWA 1V5GA 1Y4DE 2GD0A 2OQIA 3DTVB 5D6OA 4Q4JA 1T91A 5FXMA 4EY5A 2Q46A 2W8BA 1D9XA 4TVBA 2ZJBA 2F1RA 1BRTA 3CXUA 4ISBA 3V80A 2J4FA 3UV3A 4HVCA 1CETA 4LZAA 5HOEA 1PJAA 3AJEA 5F33A 1KEEA 2FOXA 3C14C 3AJ8A 2HNAA 2WB4A 3WNBA 1RM0A 3RS3A 2QUBA 5GOZA 3QPVA 4WSOA 5FUYA 3RV4A 5JVDF 3HB1A 4LDNA 4RX1A 4B17A 5K3OA 1QH1B 1RQGA 3L7JA 3C7CB 3OQ1A 1ZX1A 3L92A 4L6CA 2VA8A 1SU4A 2OGUA 4PFSA 4D0LB 5D5QA 2FPGA 5DX1A 4BEJA 1XZKA 4FNMA 4DDMA 4DG9A 1IJEA 3CR3C 1O5OA 4IG9A 2O14A 3D81A 3ZE1B 4MDFA 3DBHA 1YR2A 1L5NA 2QY6A 3RAEC 2A5LA 2AYYA 2XOKD 2XQFA 3FYDA 3C3WA 4NS1A 4CGYA 3TNFA 3TW4A 1Q7EA 3MAAC 4B87A 4DNPA 1Y7PA 3NANA 1Z6GA 2GOYA 1M5TA 2HSZA 2IL1A 721PA 5E6UA 4H31A 5CH3A 2ACEA 5MN4A 3KWJA 1G3IA 4UULA 2IU4A 2X5NA 3LUPA 2JI8A 3A3YA 5BSWA 1JS1X 1J1ZA 3FHJA 4U7DA 1IVSA 2FR0A 4KHPB 3HGMA 2Q1SA 1RJEA 1UPFA 3EYAA 4LY6A 4IGIA 5KVVA 3ICWA 1BTOA 3W4JA 3W6UA 4BNFA 2B1RA 2IX9A 3BE5A 4REOA 4PRYA 5SYMA 2JCYA 3NASA 2P6OA 3RC8A 4C0WA 3NOOA 1T8SA 3O7MA 4EHBA 2I8CA 4ZOQI 4HDQB 4P3NA 1PBTA 3CEMA 3GOHA 1SMKA 2P0YA 3VZQA 2WF8A 4CMIB 2AH5A 4AJJA 2QN6A 4PHGA 2GFHA 3AR3A 4FWTA 2OV1A 1L5SA 5G4LA 3DZ8A 3J7AC 2QMUA 4K9MA 5C7YA 1YL5A 2QN2A 2F6RA 3G8CA 1CT9A 3N53A 3VR4D 1FP7A 5CA0F 3AEUB 2NXJA 4LW8A 3N7TA 3OTHA 4WERA 4KLNA 3OIUA 3T54A 2XIJA 3P0RA 1R5JA 5BWMA 1T0IA 3LTEA 1ZMTA 1Y48E 2FEWB 1IDOA 2XMZA 4CMGA 1YCFA 3SF0A 4DWOA 2VXYA 3BRWD 2VNAA 2OV4A 2WSLA 3PDUA 4JVOA 4UVHA 1B42A 4LRTB 1ONBA 3ZY4A 3QUAA 1K4KA 4B7UA 1IPHA 1IVYA 3GBSA 1NF8A 3RS7A 3SN6A 4CDMA 1I9CA 4HMQA 3TD6A 1XYGA 3ANMA 3N8KA 1U4SA 4DNOA 4MRMA 3T7AA 3ER9A 5FBWB 2P35A 4LOIA 6REQB 1UAGA 1QYRA 2ZJZA 4WFKA 2V7PA 5T8KA 3AUXA 3DOIA 2ODWA 3RYFA 4E51A 1GPBA 1YZNA 3AFHA 5DW3A 4IDGA 3J80A 3V2GA 2OXEA 3F5MA 1ZKMA 4DMUB 5JISA 2BGJA 5DLQC 4JI8B 1RPNA 4AKHA 3HR8A 4HQ0A 3I2GA 3JQAA 2GDZA 2B30A 2JW5A 4CNQA 3H04A 3KE9A 1P31A 2D0PB 4Z4HA 3L1HA 3KQWA 3LLVA 2PZJA 4K1LA 4MWGA 4PCLA 1K5GA 4NTZA 3JD1A 4WOKA 3WS7A 4C1NA 2R62A 5ALGA 4OI1A 2Q45A 1I01A 3DFKA 2G1KA 4AAYA 4EY4A 3E2PA 1CR1A 2ZIUB 3R3UA 4X41A 3AVUA 3GNTA 2ORIA 5JZOA 1H1TA 5LZ7A 3FUVA 1UK8A 4D8YA 3LSYA 1A8HA 2X41A 3P27A 3U17A 4HLUC 4N8SA 1T4MA 3G2KA 1ZQ9A 3ADCA 4TZ0A 2H2WA 2Q50A 3GLTA 1CW2B 3T34A 1P1KA 4UOZA 1W8DA 1YMUA 3F9IA 2EYUA 5FUMA 2H4FA 3K0AB 1I7NA 3A9SA 1SFRA 4YGXB 4YDQA 4J2HA 3EPPA 2JZOA 4CIVA 2XGSA 4RKYA 2UU9B 3H87A 2WAMA 5AUOB 3A04A 5JAQA 4DILA 3CCCA 4UFOA 4K40A 5L4NA 2JLXA 3G0OA 4ZCQA 3E3OA 1MT3A 4JLSA 5C53B 3MMSA 2ZTHA 4E88A 1TT5A 3AKYA 3ZZMA 2V7WA 3DS8A 3O94A 5T4HA 3WDKA 1GYRA 4FX2A 3UMGA 1P39A 3ANYB 5LD2C 2ZE5A 1PZHA 1P72A 3QVXA 2HH9A 2OXIA 4YR7A 2ZYAA 2ZTVA 3BA1A 4NSNA 3ZZUA 2GYWA 4RD0A 1NLMA 5U1PA 3H9BA 4X60A 1E59A 1QNLA 4OJMX 1NNSA 2W0MA 2YWEA 1N8TA 5C5CA 1XXHA 1YFKA 4HAXA 3HXTA 5IDWA 5J2TA 1JDNA 1ETHA 4WN3A 3P0HA 1N0UA 5T57A 2ODEA 3TOXA 1M2GA 2CDNA 2IEAA 1NSTA 2IYNA 1FK8A 1AKMA 1JW9B 3D43A 3EZLA 3H4MA 4FQ8A 2OBFA 2XUDA 1X7HA 2HNBA 4FYXA 4FWBA 1B43A 1TW3A 3K0HA 3DMPA 2I0FA 1DWUA 4X54A 3ED5A 4P7KA 3EODA 1XAJA 5JJIA 1WP4A 5H5JA 1B74A 4IKPA 1GZUA 1W85A 2AE1A 4RMHA 4OV6B 2C5LA 2NPOA 4QUIA 1P81A 2BZ1A 5TY0A 3ZBQA 4GDFA 4OYHA 1RLJA 4Q7MB 3MMNA 1UEJA 2XGOA 2JBAB 4D4JA 4GX5A 4YACA 3IKLA 3G0GA 2XUKA 1EUDA 1NW4A 3OMWA 8OHMA 3IODA 1J7JA 3V1UA 4BTLA 2EFGA 4D4HA 4P4NA 2O0LA 5CDYA 3HFRA 1TQDA 2E4UA 2QTZA 5B1HA 1T15A 5AHKA 2CL5A 1E2FA 2WJPA 2IV7A 3EDMA 6YASA 5CDGA 3BCRA 4WBNB 4KITB 1G21A 1F06A 1G3UA 4ACAA 2GXQA 3BIXA 3O1HB 4IIUA 3OJXA 2CXRA 3WL8A 4L4ZA 2G71A 3WL4A 5IP5A 2HMTA 2ETXA 2YFKA 2MYUA 4RD3A 1A50B 1UWVA 2BSAA 2NO1A 5DYYA 4ZA2A 5KREA 1SIBE 3B8EA 1I1QB 3AFNA 1T1IA 4Y2YA 4C0XA 3GRCA 3K0CC 2ROQA 5JWOA 3D3KA 3MCUA 4D5GA 3E6AA 1ZUIA 3SOPA 3H4VA 4F6RA 4DT1A 2DQSA 3EXIA 4MV8A 2VH5R 3QIAA 1SUAA 3C6KA 3U3RA 2FZ4A 1Z5NA 3W7AA 1U4OA 3KX2A 2Q3JA 2IF0A 2YYSA 1GG8A 1RABA 3H8JA 3L7YA 2XJ9A 4TROA 2DPYA 2R8YA 3IR5A 3PXXA 1BQ3A 5BW4A 3CFYA 1NPYA 2WFZA 3BCSA 3MAGA 4P9NA 3VAZA 4CMEA 3C3CA 4MCJA 4LRWA 2X0KA 1G63A 5B1DA 4DCUA 3RANA 4B31A 4D9CA 3K8OE 1U5AA 2G06A 3NM6B 3DNPA 1SA0A 1DLIA 1V4BA 2OB2A 4FDTA 1YIDA 3H8VA 3PGJA 4QTZA 1VIYA 4A8HA 1DADA 4RMGA 1XOIA 4TXJA 5B4VA 1CY8A 2WYUA 1S2NA 5KVAA 3U4QB 5KTRA 4M1TA 1QIGA 1RS0A 5HZHA 5JCZA 1AHNA 1E1RA 3PQFA 2GBFA 5FNVF 4NVRA 4XYMA 5AVXA 2GTHA 4AS3A 2TMKA 3Q2KA 3UXYA 4LVNA 1EE2A 3QNWA 4Z8YA 3QJ5A 4OOFA 4ARUA 3ITNA 3SYLA 1MJ5A 2YHSA 4CIYA 2AFHB 2B4TO 2Q6IA 3ESZA 5AKEA 3MWFA 4JP2A 1YB1A 2PN1A 3NBMA 1Z2AA 4MK4A 4CEJA 1EM8B 3EVBA 4JY7A 2J3LA 1U8AA 2NWQA 1VSTA 2NZUG 4I1YA 2W2XA 3BUSA 1G98A 4REMA 2VWHA 1YCDA 1KI3A 1W93A 4OYLA 2F3TA 1NBOA 2OXFA 4IR7A 1SCKA 1H3NA 2Q21A 3LFHA 3BWVA 3FYUC 3ESYA 3QE3A 3BXXA 2J5BA 4GRAA 1UJ5A 4RJ2A 3DV0A 4F60A 4YRFA 2Q7OE 4R1MA 3IESA 5GMOA 1SUDA 4MWTA 5BXQC 4TGLA 2R96A 3A2NA 3RU3A 1G55A 1UP7A 3CH6A 3RYIB 1E2UA 4AP9A 4DIEA 1X13A 1RWBA 3BN3A 2C97A 3LOUA 4KMRA 4BMDA 1XN4A 4RSHA 4CXMA 3P9NA 2NO4A 3OY7A 4ZMBA 3AETB 5JBNA 5T7BA 4E08A 3FPFA 4UTPA 1XU4A 2FPSA 2UKDA 1N1MA 5BWCA 3OA0A 1Z4IA 3K70B 1MO2A 1HDZA 2X7JA 1M0TA 1REQA 4LTDA 3RS9A 3C24A 4UTVA 1PVOA 4COKA 2WKWA 4I6EA 2PS3A 3RE1A 4WBNF 4Y6OA 2I6XA 5K3AA 3IH5A 3X3HA 1FFXA 6GPBA 3DZKA 2ODNA 1RM3A 2WKRA 5F1YA 3K4QA 3W7VA 1HETA 4RY9A 4JJ6A 5AI0A 2XYQA 1KRHA 3WL7A 1AK1A 2QTVA 4DLPA 5IJ0A 4DLUA 2HA4A 4MGHA 2PLWA 1SOUA 3TQIA 2P1ZA 2P6RA 5C51B 3KUUA 3D8BA 1R15A 3VNUA 4XDYA 2NU9A 4Q47A 1WUIS 3AC0A 1M1UA 3F0TA 3JR7A 3TYXA 2AXQA 1C7FA 1F2TB 3MRVA 3R3VA 1MAUA 3HRHA 5AR1A 2W7TA 2XDWA 1HWYA 3DEKA 4MV9A 3TLGA 3TOCA 4CKEA 3L7NA 3MW8A 1T0HB 3M4XA 4AI6A 1TK9A 4NE9A 2E4VA 1TFUA 2OD2A 1E4YA 3GP3A 1KPIA 1TK3A 2BJWA 2QX8A 1DBRA 3A6GA 2W2QA 2XCLA 3AHDA 4GOJA 4BNMA 1PZGA 3H7IA 1NI5A 3E1SA 3HP4A 2ZIZA 2J5RA 4CMJA 3D6AA 3Q9SA 2F9LA 2CVPA 4AG5A 4MYRA 3CRRA 4Y9RA 3JWIA 3UWMA 2QXUA 3PJEA 1YDGA 3PR1A 3S68A 4E30A 3V1NA 5BOSA 1YA8A 3NB0A 2AFHA 5LOVB 2VAXA 4BE9A 3OEHA 1JH8A 2OFPA 2WIBA 2UV8A 5IYZA 1OLSA 1KDRA 9LDTA 2P6PA 5GP1A 1WOMA 2NU7B 4MA0A 5C4IA 2O3TA 3A1SA 5TDHA 2Q6TA 1W1WA 2GPYA 3FUCA 3EXAA 4GEGA 1T2NA 3BSSA 3TIVA 1LGYA 2JEOA 3MWLA 4BWVA 1GUDA 5CFQA 5LP1A 4UBOA 4CKCB 2RHJA 4ZTBA 1OXXK 3A14A 4P5EA 3ZLTA 4ETIA 3HWRA 2COEA 4LRYA 4BC0A 4ZALA 2O54A 1X70A 4LDPA 1TT7A 1GL6A 4JKYA 3VJMA 1ZOIA 4TN5A 4MQMA 4DSOA 4F2WA 3JAKA 3EZ6A 1TIBA 1EBUA 4MGIR 3RSHA 5D01A 3WKDA 5IC4A 4UAUA 4EB8A 4R01A 4L4RA 3LGAA 4HWGA 1HYHA 4QOHA 4AJOA 3NBQA 1ESDA 4HF7A 4M8LA 1TTHA 4L27A 1OFGA 3VZBA 3BHMA 3NATA 5JZSA 1CHDA 4V0ME 5IABA 3H9CA 3RUIA 1WWKA 3AIOA 2QRQA 4UFPA 1MDFA 1AF4A 3OLXA 4Q16A 5FIUA 1TFRA 2C2BA 2KHZA 3GVXA 2C29D 3IUQA 1CP2A 3VU1A 4DQLA 4BWYA 5HA5A 4MJ7A 4C4SA 4LZJA 5HRAA 1U0EA 3EXHC 3PHJA 1KMHA 3MS7A 2X7HA 1UXOA 4OY3A 1N6HA 1RT9A 3HXPA 3M9WA 4CODB 1Q3KA 3ABSB 1DG1G 4FIDA 2O2ZA 3QYJA 1TJ5A 5ARBA 5ADUS 5THQA 4ZI7B 1OI4A 2RAPA 3E9CA 3QMWA 4WVFA 2A1UB 4WECA 1A3CA 4ZDKA 3LHKA 1YJCA 2ZKIA 3ZLJA