1Z2EA

Solution structure of bacillus subtilis arsc in oxidized state
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
b'MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate reductase
publication title Solution Structures and Backbone Dynamics of Arsenate Reductase from Bacillus subtilis: REVERSIBLE CONFORMATIONAL SWITCH ASSOCIATED WITH ARSENATE REDUCTION
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 52
structure length 139
sequence length 139
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z2eA00
3OMWA 3UKJA 1DCFA 2JVIA 3MYYA 4YCSA 4MR9A 4KK4A 1LK0A 1U0SY 3LUAA 3HO1A 5GOTA 3C6QA 1MB0A 4EY3A 3CRNA 3HEBA 5HKOA 1ZH4A 1OXKB 3HCWA 3LUKA 2XDYA 1QO0D 3K9CA 4L4UA 2PL1A 2PJUA 3HDGA 3KHTA 1M2FA 3CG4A 4RU1A 3HZHA 3HVRA 4MR8A 3CS3A 4N0QA 4D6XA 1QQAA 1ZVVA 1A04A 1CEYA 1KRWA 3A0RB 3DGEC 2IPLA 3CZCA 4JP1A 4KVFA 3RVNA 4NV3A 1VKRA 4RS3A 4F11A 1LBIA 4MS4B 4PZ0A 5DLEA 1JF8A 5EWMB 3RVPA 4LRQA 2I6FA 5TE9A 2QU7A 5ED4A 2L17A 4XFKA 4PEVA 3OO0A 3N0WA 5TPZA 3M6MD 3BRSA 3KKEA 3Q7TA 4KNYA 1SXGA 6ABPA 4G0ZA 1WETA 3HJFA 4UHKA 2JBAA 3G85A 1QP0A 3NBMA 1BDJA 4EYKA 1ZY2A 4Z4FA 4G0PA 2FTKE 3KSMA 1SXIA 2IPNA 2FVYA 1JDPA 2PUGA 5TPWA 1Z12A 4G0QA 4MYRA 4YO7A 1D1QA 2R25B 5I4CA 2TMYA 3H75A 4CBVA 3ROTA 4OTZA 2PUBA 3IP5A 3Q7RA 1GUBA 1NXVA 5BRAA 5KQLA 2WY2D 3EULA 2CHFA 1P6UA 1W25A 1NXSA 4Q6WA 3FGZA 3K4HA 3QLUA 1Z15A 4Z4CA 1ZHHA 1S8NA 2M1ZA 2FQXA 2JK1A 3N6VA 1Z26A 2LP4Y 1K68A 3O75A 1TVMA 4KQ9A 4OBBA 5JS2A 3H1EA 3EDCA 4IRXA 4N76A 1GUDA 2PKXA 3QEMB 4XARA 1H9CA 5KQPA 1Z13A 2M98A 1DG9A 1EHCA 1LJLA 1JYFA 3A0UA 1A2OA 4WT7A 2VUHB 2FLWA 3QELB 3F6PA 3FMVA 3SG0A 3QX8A 3NHMA 2B1JA 3KS9A 4LDZA 2R4QA 1MVOA 1Z2DA 3F73A 1YK0A 2VUIB 6CHYA 4LE2A 5IBQA 3SNKA 5FWYA 3H6GA 2NUBA 4S04A 4MR9B 3BRQA 2IYNA 1RPJA 2MSWA 3O2JA 3RH0A 2P4UA 4E7OA 1GCAA 1P8AA 2CD7A 1VPWA 2H3HA 5CNKA 2LIVA 1QKKA 2FMKA 4RKRA 4MRMA 5KI6A 2ID9A 1FFWA 3SM9A 3GRCA 4HYEA 4UHJA 4ETIA 3H5TA 5JNTA 3Q41A 3I09A 5DKFA 3OMXA 2ZAYA 4RK1A 1Y1LA 4HNQA 4Z4GA 3F7NA 2WB4A 3IDOA 3O1IC 1ZGGA 5KC9A 3C3KA 2QVCA 2VYCA 3JVDA 4RXTA 5EWJA 3KCNA 2FN8A 3MIZA 5IUKC 1JFSA 4YLEA 4EYOA 1M5UA 4JB0A 3A10A 3LFTA 3CKMA 1RZRA 2E4VA 4XAQA 3T38A 3TD9A 4P98A 2X7XA 3GBPA 4YWHA 5EWLA 5TQ0A 3ILYA 3O1JC 4GPAA 3T95A 2B4AA 5IUJC 2FKAA 2MSKA 3RVJA 2HQOA 1PEAA 8ABPA 2JBAB 5JNVA 4G0YA 3FDFA 4MR7A 4KMRA 4WZZA 1DRJA 3FFWA 3OLZA 5IX8A 1JFTA 3GT7A 3CTPA 3RVLA 2FQWA 3N8IA 3TX6A 4G86A 4W5OA 3SQNA 2LUOA 1DBQA 1URPA 2L18A 3CHYA 3HUUA 3LUJA 4P1ZA 1YS7A 3CNBA 5GQSA 4H3HB 4YV7A 5IC5A 4LX8A 1NXPA 4WWHA 2JB9A 4W5QA 2FMIA 3KJXA 1JYEA 4XXHA 4JAVC 3H1FA 4FE4A 2Q5CA 4KV7A 2PUAA 3OLYA 3SAJA 5FBKA 3N0RA 2MSLA 3H5LA 4H3KB 3HUTA 4IMJB 2OQRA 5FWXB 4NQRA 1JLKA 5T3YA 3EQZA 3FFTA 1USIA 2FEKA 1U04A 4MQEB 5T7BA 1HEYA 1U2PA 2O20A 4QICA 2L2QA 2GI4A 3HSYA 4G0MA 4PE5B 1E2BA 3EODA 3KLOA 4YGXB 4RY9A 4KFCA 4NCBA 3L6UA 1TM2A 3QLVC 4G97A 1QO0A 2PAFA 4EUKA 2GWRA 1YVUA 1J56A 2E4YA 1ISSA 3CU5A 4TMYA 3TO5A 2MYUA 2A9PA 1DJMA 2FQYA 3C3MA 3G1WA 1MB3A 3QLTA 5E3JA 4PYRA 3QK7A 4FE7A 1XHEA 4RWEA 2HJ9A 2QVGA 1LJUA 4MQFA 4W5TA 1KRXA 4B09A 3DBIA 3KYIB 4EYGA 1A0OA 2HSGA 1DRKA 1QPZA 1JWLA 4YP9A 2MYNA 4ML3A 1JHZA 3VNAA 4WXEA 5DCLA 2PE5A 3Q9SA 1M2EA 4MS3B 4RK4A 3LKBA 3LMKA 3H5IA 3IP9A 4YR7A 2IPAB 3H1GA 3RVMA 1DBWA 1RXEA 5PNTA 3OQMA 4DQDA 4MS1B 1NXOA 3H5WA 4RK5A 4KZKA 1PUXA 4IF4A 1U2QA 3Q15C 4G0XA 3LUCA 3MQ4A 2PLNA 3O2SB 1BDIA 5EWJB 1DZ3A 5BRJA 3GL9A 3O1HB 4YS6A 2IPMA 1GLGA 5JNWA 1YS6A 2JCGA 1F4VA 3EQ2A 3JPWA 2PUDA 1USGA 2ID7A 2NZUG 4EGSA 1AB5A 1YK1A 5CNJA 2E4UA 1ISRA 3LUDA 2RDMA 4MS4A 5CNIA 3BBLA 2IOYA 5C5EA 2H0AA 1QMPA 4TLMB 5EWMA 5B3JC 1YTUA 1ZDMA 3HDVA 4MLCA 3RVKA 1PEYA 1CHNA 2JVJA 4TLLB 3IP7A 4HNSA 4DN6A 1TJYA 1SRRA 4Z9AA 5IEJA 1JDNA 1F51E 1NTRA 4KREA 1C4WA 2ZWMA 1NXTA 4O1HA 4RK6A 4N47A 4N03A 4KRFA 2NT3A 1TLFA 5IUNC 1E6MA 4L85A 5KQGA 4MR8B 4YRZA 4NCAA 1R8JA 1FSPA 2IDMA 5FBHA 4QYWA 3Q7SA 3GV0A 4JASB 1ZESA 3OLXA 4KPYA 3LTEA 5C5CA 1QP4A 4EVRA 1DCMA 2FN9A 3RVSA 1QQBA 3DZDA 4MLDA 2PUEA 3FFXA 3L49A 4D6YA 2F8SA 3CZ5A 5IEBA 4F12A 2N9UA 2FSPA 3CG0A 3KG2A 1LBHA 3VNBA 5KC8A 4N41A 4RSMA 5TQ2A 3HV2A 1DC7A 3NHZA 1BA2A 1ZAYA 2J48A 1KGSA 3N53A 4FB4A 3W9SA 3O2QB 2YHBA 3LUGA 4QYMA 1JH9A 1SD5A 4QPJC 5BQ3A 3QEMA 4OG2A 3EGCA 3KTOA 5JS1A 1D4ZA 3IPAA 5TQJA 4Z4HA 5TPWB 1M5TA 2PMCA 4RK0A 5JNSA 4OATA 1BDHA 3EAFA 3P9YA 2E4XA 3QELA 4LDAA 4MQFB 5BR1A 1AB6A 3OM0A 3KLNA 2QV0A 4XLTA 4ETMA 1VRVA 2LBPA 2W42A 3IP6A 3I5AA 3C97A 2E4WA 3OO1A 4O5AA 3HS3A 4ZPJA 4Z9BA 3T6KA 4ZMRA 4ZMSA 1BVHA 3OLWA 2RGYA 1KMIY 1UDRA 2FXIA 4Z0NA 1APBA 3NNSA 3UK0A 2GX6A 2WRZA 3GYBA 1FFSA 3JS5A 1NXWA 5DGCA 3M9WA 3E61A 1MAVA 2R48A 1IIBA 4DADA 1EAYA 1Z18A 1C0EA 3A3KA 1CYEA 3DLBA 3OQOA 5TPZD 3IPCA 1ZN2A 4Q6BA 2YHAA 1B00A 3F6CA 3B2NA 4RDCA 3RVRA 2LPMA 5F64A 2R47A 4TN5A 2IKSA 2RJOA 2BGGA 2FEPA 3GWGA 3I42A 4ZJPA 4EVSA 1EFAA 1QNLA 3ILHA 3O74A 3GA5A 3SY8A 4F06A 2A9OA 4Z99A 5IULC 4RZSA 4F3TA 2AYZA 2PUFA 3H5VA 2KYRA 4MPTA 3RVQA 3LUFA 4LE1A 2FLKA 1NATA 4MAAA 2JVKA 5FWYB 1DBPA 1YIOA 2OENG 1EWVA 3MM4A 1D2AA 4W5NA 2WJWA 7ABPA 2FEWB 4RY8A 1ZGZA 1U8TA 4PICA 1JFVA 3TB6A 4EYQA 4IILA 3QLUC 4MRMB 2NZVG 3LKVA 3QLVA 4RY0A 1T34A 3LOPA 4WUTA 1USKA 2CHEA 4JA2A 3QX9A 4EVQA 1JX6A 2QXYA 2PUCA 4H60A 1RNLA 4RKQA 1K66A 2HPHA 5HSGA 1RXIA 2HQRA 4RXMA 2JRLA 2WMYA 2PL9A 1Z17A 1Z25A 4RK7A 4Q7EA 3C3WA 3CLKA 1DC8A 4LZLA 1NXXA 3MF4A 2FW0A 3GBVA 3MMNA 3N0XA 3CFYA 5HM6A 2NT4A 5D2CA 3DLHA 4F8JA 4WXMA 2V0NA 5HQJA 3UUGA 5EWLB 5TQ0B 2F8TA 5FWXA 3N75A 1P2FA 1L5YA 5TQ2B 3O21A 1P6QA 1PNTA 4MQEA 3S99A 3E3MA 2A9RA 4M88A 5ABPA 3KYJB 4NICA 3NNNA 2L19A 2QSJA 3BILA 3D8UA 3HK2A 1EWTA 1JBEA 4E7PA 1E6LA 4MR7B 4MGEA 3BREA 5KWSA 4O1IA 4S05A 2QW1A 3QEKA 4Z4EA 4IMIB 1VLZA 3D02A 4KQCA 1E6KA 1ZITA 2FMHA 1PNRA 1EWKA 1YMVA 1BAPA 3OQNA 5CNMA 1TMYA 2WJAA 3OM1A 1ABFA 4LE0A 4OLBA 2RJNA 3DGFC 2CWDA 3LUHA 4ETNA 5JNRA 4W5RA 2P9HA 5DTEA 5B3JA 1RZRD 5CHYA 1GCGA 3RQIA 3H5OA 3M9XA 1QP7A 3NNDA 1FFGA 1D5WA 2GKGA 2WWVD 9ABPA 3JTEA 5JNUA 2AYXA 3HM9A 2VK2A 3T8YA 3TMYA 1I3CA 1Z2EA 1D1PA 4MS3A 3ROFA 4KK3A 2GBPA 4JB2A 1NY5A 1YMUA 2MYTA 1DCKA 4OLAA 3RVOA 1MIHA 4RXUA 3OLVA 1DP4A 4N0PA 4RV5A 2QR3A 4D74A 3MA0A 3EJWA 4MS1A 3JPYA 3R0JA 2A9QA 2QZJA 3JY6A 1ABEA 1W9HA 4Y9TA 1Z16A 4Z4IA 1ZH2A 3URMA 1L5ZA 4GNRA 2MYPA 4HNRA 4ZYLA 3I45A 2HQBA 4G0OA 1FQWA 1XHFA 4IGAA 2E4ZA 1XWWA 5KQMA 4XASA 4JOQA 1SXHA 1JL3A 3JVIA 1OXBB 3H6HA 2FMFA 3HXMA 1PHRA 2DRIA
chains in the Genus database with same CATH superfamily
4EHDA 3GRYA 4MYHA 3HB4X 3ZDAA 1G9TA 4LJRA 4QPZA 2IIPA 3C6KA 3UMCA 1RVV1 4JCCA 4NU5A 1UAGA 4IJKA 4FDTA 1WHSB 5CXXA 4B4DA 4D41A 3EMKA 4IOLA 1RZ3A 3H2YA 5JVDB 1UBMS 2IJGX 3H1PA 2W37A 3DT9A 5A04A 5BUSA 621PA 2ZIUB 3W3AA 1GCOA 3CB4A 1Y81A 3K53A 1DAGA 2P0AA 1NY6A 4NPCA 3AY3A 1UK8A 1JQ5A 1KXZA 1JLRA 3QTBA 4TTPA 1C1DA 3COPA 4HDOB 2VZ0A 2PMEA 1BMDA 4DA9A 4DNFA 5IN4A 5JJCA 1ESNA 3FTDA 3GLVA 3U3KA 1D0VA 4RW0A 5K6TA 4E11A 3NG1A 4TXJA 3DFFA 1Z5UA 4ZZ3A 3CUWA 5BURA 1U7XA 1CS0B 4C30A 3C98A 1MLDA 4ZIRB 1ML4A 5C7LO 3DEYX 2Q3FA 2AI1A 1WZUA 1NJ5A 2JLUA 1UKBA 1UKZA 3MWKA 3HCCA 3NGMA 5IAGA 4F11A 3IEKA 5JC1A 1B2RA 1UUFA 1XRSB 5AKEA 3SPXA 5EE5B 3T41A 3HY4A 1KR2A 5KNBA 4GM0A 2BTOA 5T6BA 2DULA 4MPRA 2VPIA 3JD0A 1CVRA 1F2UA 4JS0A 2WM9B 5DNCA 4Y30A 3J7AC 1E4VA 1Y1PA 3N0WA 1PJCA 4WA7A 4ZCQA 5C8VA 2P6RA 3M3DA 3I5MA 3ONFA 5HW0A 4WJZA 1CR2A 1AX9A 2Q3HA 2UZ1A 1WABA 3OZRA 2D8MA 1NJ6A 3EWAA 2QK4A 4OHMA 1ZU4A 3OFKA 2POQX 3F1LA 2GNOA 4EYKA 4PF1A 5AVVA 2V3WA 3IIJA 3QA9A 1T9KA 3BG5A 2GZ1A 5A62A 4H7IA 3W5IA 3PF8A 4KBFA 4XDYA 4G0QA 3TR5A 3WIDA 1ZS9A 1WTCA 3EMVA 3R74A 2IL1A 4A5SA 3MW8A 4D46A 1DADA 4ZVQA 3RSQA 4Y2RA 4K9RA 2Q4BA 5G1PA 3D64A 1XFAA 3TLKA 1JMKC 2H17A 2TMDA 4HJRA 1P6UA 1HE2A 1NMQA 2FZEA 1HLDA 2PH7A 4L73A 4NENB 4ARBA 4JP8A 2A0UA 2I33A 4Q24A 3S2YA 2QTAA 3RJZA 3GA7A 3KJHA 3K70D 3HVKA 1LLDA 1Q3KA 4BWFB 2OHHA 4LV8B 3U56A 3WWYA 1CY1A 4H08A 4UVGA 2QN9A 1PG0A 5ADHA 3NOOA 1KJWA 4A82A 3KOYA 3M6UA 1QYDA 3EVAA 1VFNA 1B0UA 3G0BA 2GRUA 5ILOA 4GMGA 2ZYGA 4CKBA 2C7QA 3L77A 2BF7A 1ZEMA 1ZMBA 1DU4A 4QBHA 4WKOA 4P35A 4TVBA 1FYFA 1L7EA 1LJLA 3QZUA 3LPNA 4V0SA 3QELB 3VTKA 4GO1A 2OYCA 5JXIA 1IHUA 1DHTA 3DFMA 5EIOA 3NEYA 5L4LA 1J39A 1UH5A 4ZVMA 2QRUA 4FBMA 3R9KA 2CXTA 1IDN1 4NJMB 3B2EA 4NWIA 3EEIA 3IIIA 3PWKA 3P5SA 4R1TA 2VUIB 3OA0A 4YRIA 5IBQA 1NT4A 2H4WA 3SNKA 3H6GA 2CLFB 3BN3A 4QTUB 3WGNA 1RPJA 2QTCA 1TUEA 1JBKA 4ER6A 1L5FA 1U8YA 2ERXA 3VV2A 5CCXA 4JKYA 3B3GA 4B17A 4F7DA 1JKXA 2YW2A 4JITA 2PPLA 1I6MA 4D9CA 4OH1A 3R9IA 3SE0A 4ZHQB 2ZE6A 4LJ9A 5G40A 2XQJA 2JJ2D 3LIPA 4JBYA 3VA7A 3KKLA 4YNBA 2FJ0A 2AOXA 4F2PA 3BMOB 4FK8A 4ZAFA 4ALLA 4B44A 4PGFA 4Z7QB 5IABA 3COSA 4HSEA 5JD4A 1Y7HA 4QG7A 4ZRMA 3RREA 4E03A 2QW0X 2ZXUA 1BEZA 1ZK3A 4X97A 3OJFA 1TQ2A 4H1VA 1AXRA 1N33B 4Q34A 1QSGA 5LZ8A 3VX4A 1BHSA 3EPRA 4NS1A 1U6KA 4IH9A 5B3AA 4L22A 2D2EA 4P7JA 1YS1X 2C58A 2YN4A 5TARA 1HE3A 4YHHB 2DFNA 1NF3A 2D5CA 1W46A 1ICIA 3PPXA 4JELA 4WESB 2WUGA 3VHRA 2YJTD 4DUGA 4Q4LA 1P2VA 4GOND 3ZGXA 1MX1A 4CIYA 4UHHA 1USWA 3KYCB 4WCFB 4LJSA 2HQOA 4WOBA 2Q4TA 3DMHA 3F2IA 5CG1A 1SPXA 2FPSA 3FDFA 3CISA 3QVLA 1LX6A 2XQFA 3AUKA 4JLMA 4PSVA 2WHEA 1KBZA 1YJBA 2HWWA 1RRFA 2IOFA 2YIMA 3PQ2A 3LXUX 4PVDA 5EZYF 1I14A 2J5XA 4Z4QA 5K3FB 1RQNA 2LUOA 1JMVA 4E3WA 1YZYA 3G8DA 1GDHA 1LSOA 4DV7B 1ZH8A 1U1DA 4XX0B 3ZY5A 3QF4B 5AI6A 3A4NA 4TWIA 4X45A 4ND7A 2RE8A 4AY6A 2QRVB 2Q5CA 3ZDRA 3SYTA 3KHSA 3KZ1E 5FBKA 5IAEA 3I76A 4RPIA 2O2SA 3L4BA 1N6NA 3C5EA 4GX2A 1PFVA 1Y7LA 2DBQA 1KS9A 2BGUA 5TB5A 3GAFA 2DC1A 4CW7A 1FFAA 1N1MA 1NQUA 4YRNA 2J1LA 5FFFA 2R2AA 1OOEA 1U2PA 2O20A 4D0LB 4AZWA 5LOVB 3BOSA 2QP4A 1TZKA 3E9CA 4RJIA 4DLNA 1SUAA 3GMSA 4P92A 1O94C 1NLYA 4UBKA 4XD2A 3HEAA 2G40A 5AJZA 1G63A 2YXEA 5EJ7A 4K0KB 2C4HA 3NO4A 5ESRA 3GLGA 1Y98A 1KYYA 3OEWA 4KXFB 2EQAA 5HZGA 1GZ3A 2MYUA 2YXDA 2ZRMA 1ODKA 1X86B 5DMHA 4POOA 1PK8A 2JH8A 4E6PA 4RULA 4EDFA 4DR6B 1MVNA 4QXOA 3NC0C 3FZGA 4ARUA 5EMKA 2XVMA 5TJ9A 1I9CA 3AEKB 3GRZA 1O3YA 5E7QA 1X80A 1E2NA 3DNFA 3SEFA 4LCEA 4YRMA 4J1QA 4DEXA 2W2TA 4KSBA 5FOVA 4D96A 2QE7A 1DUIA 4ML3A 3ENKA 3W06A 4YIHA 3IMKA 4QG3A 5K05A 1EA7A 4NTZA 3TLGA 1M2EA 1WHSA 4A6XA 5E4YA 4C5CA 4YR7A 2BN4A 5JVDA 1ZMOA 3EZNA 2DY0A 4H16A 5AJYA 3WWOA 3VOSA 1UWVA 5GTDA 7AT1A 4AZVA 1QS0B 1IVSA 1Z4KA 4EZBA 4E2XA 3DDCA 1PU2A 5LSAA 3K09A 3JQ7B 4MKXA 4G1EB 5HFAA 1R64A 1UPTA 2LGJA 4BZXA 1XPOA 3MCTA 5B30A 3W2TA 2KI5A 1CS0A 2V7XA 4N5NA 3ORRA 3SKVA 4DSOA 3KT8A 1ID8A 4P81A 3G5TA 1DWOA 3I5UA 3DA8A 3MXOA 4LWOA 1WEKA 1A8IA 2QB5A 1SBIA 2G28A 3QTTA 2GN4A 5FJIA 1BEUB 1HXHA 4Q9KA 3JD3A 3DUFB 1EFUA 2CY0A 4FFWA 1YS9A 4BVGA 4E94A 3S27A 3B2QA 4EUFA 5K0FA 2HRCA 4TUYF 4PC3A 2QD5A 1SRRA 3QU4A 3ZNQA 1XDZA 3EZ2A 3SJBA 1OH7A 1FFHA 1V45E 4IRUB 1KAOA 3O8CA 4IV5A 3RLIA 1L4EA 4PC1A 1E3IA 2X5OA 3VAAA 2ICAA 3SZ3A 5JXHA 4DUZB 1GQSA 3VSCA 1U99A 1VL0A 1CJUC 1MT3A 2QDXA 5KSOA 5CGQB 1IZ9A 2RHJA 1ZESA 3H2KA 2DLCX 4XYBA 3S2FA 1E1RA 2ADOA 3R09A 4CKWB 4X65B 2CBZA 3PR2B 5CLFA 1Z0IA 4MVJH 1US8B 2ECFA 3F7OA 4AXBA 3K31A 1QQBA 4PO8A 4ZOBA 4I9HA 5TSDA 2M1XA 1X87A 2C5GA 2N9UA 2J7PA 1M5RA 4O02B 1V41E 1X7XB 1E6UA 4O3FA 1CQZA 4MB0A 2DQZA 2FWIA 3VNBA 1U3VA 4DG5A 5JJIA 2P65A 1T2EA 2OV8A 3LKZA 1ZK1A 5B2ZA 3PEVA 4IHAA 5EUQB 3VPAA 1XA4A 4PG8A 3VAZA 1RKQA 1VCHA 3O2QB 3NRBA 5C8XA 3DBLA 5A3JA 2CMHA 3LAWA 1J1UA 3D7MA 3M49A 4CEHB 4DNOA 2FPLA 2VS1A 5DI9A 3SIRA 3L7YA 3IR7A 4HS9A 1BSVA 3QBJA 3WLSA 3PPWA 4TWRA 3R9XB 3NWBA 5KZMB 3QELA 4E5MA 3HRIA 2VNJA 4DSZA 3D3NA 3RTGA 1VLJA 2G8NA 1Z0AA 2CJXA 1NF8A 3AIMA 4GXNA 2PYIA 4J43A 4JNCA 2VHXA 4NJMA 5DN6D 3AXSA 3DKRA 1E1CB 1WSDA 4ZMRA 5CG2A 2JPDA 4KACA 5P8WA 4UHFA 2EEPA 3OOYA 1NXWA 3ZI0A 2V7VA 4OQ4A 1PZFA 1JA9A 2ONCA 4WRRA 1KAHA 4MWTA 2AFIE 3EUFA 3RFVA 2CUNA 2WUVA 3A3KA 4ONEA 1FSSA 1SKYE 2KWIA 1Z68A 1S3SA 3GVPA 2XA9A 3PIDA 5ECGC 4ZHQA 5FO0A 2ST1A 1GG9A 2R7KA 3RUCA 2OLEA 4RDCA 3DZCA 3O4RA 4MWBA 4TYQA 3KB2A 4TN5A 2OCKA 3T1HB 4AY3A 3S29A 3I42A 3BMOA 3QYFA 4MWDA 4N3NA 4EY6A 3GA5A 4DTIA 5KTPA 5GJBA 3BK1A 1UBKS 1JDUA 4V0MA 4U2KA 1NFFA 1WNFA 2NTYC 2O3JA 3FSEA 3PF9A 1MOPA 4F5YA 4XJTA 3HP7A 1YQTA 3SEZA 2FRDA 4Z7JA 3BMXA 3CE6A 1U31A 3S68A 1Z7GA 5I7AA 4TTJA 5I7EA 1KJJA 1YCGA 1U9ZA 1GKLA 1KJNA 2DEUA 5KTRA 1DBPA 2J08A 4NHOA 4DQXA 1W4BA 5ER9A 2ZBFA 3KTDA 3USZA 5F1KA 2PSEA 4MV1A 4TL9A 4OI0A 4H7FA 3MCAA 3EGEA 3NV9A 4WESA 4OAQA 3WHPA 4L07A 1ZGZA 2EWVA 2DWCA 2J59A 2IYFA 1CC1S 2B0JA 3CURA 1ZAKA 3KYCA 3VDXA 1TEXA 3B5JA 4RVDA 4WCFA 1RRKA 3W9BA 2EX1A 1TKBA 3T4UA 5B4VA 1GAXA 4BKOA 2PRJA 1S1MA 1Z08A 2O2YA 2WF5A 1Y1SA 2XQIA 5DP1A 3K9WA 1T8SA 1K8RA 2JHGA 2B6NA 2DH5A 1UBOS 3NTLA 4N39A 4URUR 4NK5A 5KB3A 3JQCA 4ZI3A 3BMQB 5K3FA 2HDWA 4NRDA 1FIUA 3C5CA 1V8OA 1VE7A 1ZL2A 2GZ2A 3P4XA 4B43A 2HPZA 1B6TA 1Y1RA 4LZLA 4WI1A 3QF4A 1W6UA 1FTGA 3GT3A 4NYJQ 3TFWA 1GNQA 2CNKA 3ECCA 3HWSA 2FWNA 2HO4A 3PXBA 4TT8A 5ALJA 4Y8VA 2NT4A 2QRVA 3VH3A 2H7YA 3DMPA 2A14A 2OP0A 2CDBA 2BI4A 2FSVA 2OGSA 4HAIA 2F8TA 1MO4A 4JA0A 4NBKA 3SQDA 4H7PA 3DZ8A 1E32A 2RAUA 2IYQA 4IZHA 2VBFA 5DHSA 3LWBA 1MKYA 1UBSB 1YQ9A 3QX3A 3WXBA 5LOVA 2VL7A 3D31A 1A9QA 2IZ0A 2ZI7A 2CN1A 4RKEA 4RKYA 3ZNOA 1NKVA 1NP6A 2AUMA 3A8TA 4V0KA 1TPZA 4RIGA 2HUPA 2FF7A 2ZYSA 1CRPA 4J07A 5AW9A 4RHEA 1DQZA 4RVHA 1JHPA 3TKYA 4LJAA 1Y5NA 4B8YA 1KFCB 2Q7OE 2H1OA 1TDJA 3KO8A 3I39X 4FBGA 5AHXA 3UAVA 1XRJA 2NUTA 1ZC4A 3D7NA 4PC7A 3D4NA 1UDWA 1JQ3A 3RYTC 1ZIYA 1MQAA 5K0SA 1XTVA 4WE3A 4CHTA 1A27A 1XXHE 3DYVA 4RNDB 1J33A 2VA8A 1OXMA 2ZW9A 4ZEVA 1YO6A 3C7TA 3RS4A 4WINA 3JTEA 1XAIA 3E18A 2BFAA 4YCLA 4WLOA 3QEAZ 4IDNA 3PC3A 4GYJA 1UPCA 3B8EA 4BB6A 5JAUA 4CLOB 4FINA 1GA1A 1TF2A 2KW5A 2C3OA 4KK3A 4B82A 5AUQA 3OCWA 1XAJA 5BN5B 4YUVA 4UAUA 1DP4A 4K1XA 3GRPA 4MUEA 4CTJA 4D5EA 4RIIA 1OBOA 4JJKA 4KXUA 4A2QA 1VJRA 4DMMA 1AXGA 1OD6A 1QS0A 1DMSA 3A6ZA 3HYSA 1P5HA 3HR7A 5AW2A 4II3A 4BKUA 3JQ7A 1YIAA 2LCFA 2YQ4A 3IAAA 4M87A 4QT0A 1L5ZA 1UT5A 2MYPA 4FFNA 3NKFA 1RHKA 3URMA 2ZRKA 2BBOA 4QEZA 4JKOA 1YJ5A 3ZGLA 3PA6A 4AICA 3RW9A 4DA7A 1E1MA 3HTXA 1XRNA 3UJNA 1WHTB 3KU1A 4ZQHA 4ZYWA 4OJYA 4XWYA 1NF9A 5G53C 3UEOA 1IHPA 4B7AA 3NTRA 3HXMA 2JK0A 1G16A 4MWOA 3ETDA 3HHPA 2C8KA 1MC4A 2PBZA 4MWGA 1G6HA 1M6VB 2Z56A 4RH0A 3ZW7A 2ZUCA 3M9LA 5EQDA 1JR6A 4ES6A 1ZGAA 1J42A 2UZ3A 4RTMA 8OHMA 1W9MA 5I9MA 2PS3A 3DUFA 1A2KC 3PUIA 3NBXX 2FP3A 5DHAA 1SHJA 2D5LA 1MW8X 2NQ2C 1W1WA 3C6QA 1N5MA 3QUSA 1J9EA 4FKZA 1E96A 5JSUA 5EMJA 1UPUA 5DOZA 2KMLA 4JIGA 1E9EA 1UFOA 5CH5A 3DNPA 2YMMA 5JY1A 1OWLA 5DTJA 4RAQA 1PYGA 1NVTA 3HA3A 4TN1A 2HNKA 3DMRA 1K86A 2A9VA 1IJFA 2H1WA 1IOWA 3WJ2A 2QKYA 1CJSA 2ON6A 4OKIA 4A7PA 1HBJA 3UJHA 4R83A 1ZCJA 5BVHB 4CKWA 1P0QA 2VDPB 3OTQA 4KW7A 1US8A 4V0RA 3UA4A 3WP0A 2H51A 1GRNA 1CUBA 3CT4A 4DLKA 1LI7A 3OZTA 4G36A 4KFSA 3GP3A 3D8SA 3NRJA 2P6PA 1C9KA 3OQPA 4AY4A 1X7XA 1JU3A 3PRJA 1W30A 4FEGA 1U8ZA 2B25A 3BRSA 3CV3A 4MIKA 4XIJA 1XZFA 3S2UA 5KSPA 2VAMA 3VKGA 4LZWA 4G0ZA 1THZA 5IRCD 4IRMA 3B6ZA 3IJ5A 1ZJJA 4OMUA 1C1HA 4S3MA 1VA4A 1L6RA 4KTTE 1NFRA 1CUFA 1U2ZA 1QAQA 2BKAA 4NCKA 5BSRA 3X3HA 1NJ1A 4CEHA 1ZW6A 1ZNXA 2ADMA 2GS9A 4JR1A 4YIKA 2FVYA 3UCEA 2XQKA 1IB0A 1ODTC 4K03A 1ZUNB 1RYZA 1GN9A 3S2SA 3R9XA 2NZWA 1XPUA 4PPQA 3LFHA 3SR4A 3TSAA 4F2GA 1II9A 1PJQA 3PXEA 2HCRA 4URZR 3ZWYA 5HK9A 3B9RA 4JXXA 2TMYA 2JIBA 4UTXA 2J3DA 4NFYA 1RRMA 1ZXLA 2RI1A 4KQ1A 5LA6A 4C78A 1GUBA 1Q1BA 3WMGA 1KFKB 2PLFA 3PQ7A 1E1CA 4JJ6A 4JT2A 4PZYA 4IIGA 2CHFA 3ZCSA 4R0NA 2RB5A 4RD2A 3TI7A 2GHQA 4FYHA 1Z15A 3CLVA 5ARCA 1T9GS 4JBXA 3CIFA 4EAAA 3K70C 4BVBA 2PUVA 1NMYA 2JK1A 1I0ZA 1AK9A 3L2OB 3N2ZB 2QTGA 3N6VA 5C1PA 2HU8A 2A94A 2CFRA 4WFKA 3U3OA 5IKEA 3FYCA 1P3DA 3FMGA 3L1UA 10MHA 2JIQA 1UXOA 3K2QA 3LY5A 3PNOA 3ROMA 3WLHA 4LN1A 1X38A 3QEMB 1WCWA 2IBTA 4BFCA 1KP9A 2PMBA 3AR6A 1FYEA 3P9KA 4JR2A 3PKIA 3A0UA 4DJJA 3HB5X 1NOIA 2HYIC 1B41A 1T8RA 4A91A 4CFZA 4P3NA 4D8XA 3NYWA 1J00A 2WF9A 5LL6P 3PENA 2R8ZA 4JI5B 1QBKC 1KMNA 3LKDA 2R4QA 5TEWA 1MVOA 4QODA 3U5TA 3ZHOA 1LXCA 2JFBA 1PWHA 4ZMBA 3IB3A 3KHUA 3I1FA 3I34X 2CDRA 3ORHA 2RBEA 3GQVA 2O5RA 1I3KA 1F14A 2V8BA 4NV0A 1GCAA 4DR1B 3LO5A 1CZOA 1IHXA 5B1IA 4HQFA 2FQ1A 1XL1A 1IMJA 2E49A 2X1MA 3AQ4A 1SKUA 2I71A 4MKHA 5HOQA 1CZNA 2CZGA 4QOEA 3VPGA 4FILA 4WNYA 4ZRNA 5I6DA 2E37A 4JSRA 1NVXQ 1Q1GA 3D0RA 4KYTA 3C7DB 3T0GA 1O58A 3OE4A 2FZLA 3HFJA 4EY4A 1FU8A 2AXQA 3BMQA 3HPRA 5IANA 2P62A 1H2YA 1F1JA 2BEKA 1NUSA 1VM6A 2BHRA 2VYCA 3FNGA 2FN8A 1XHLA 2HF7A 2WILA 4BEBA 4KHPB 3QQPA 3RGGA 1GRRA 4JLAA 4TRNA 5H82A 4ASUD 1Q77A 5AI0A 2IUUA 3ICPA 2QOEA 2I76A 2R87A 2VXOA 5BP7A 1VHWA 4QQKA 3BKWA 5G2OA 1NN5A 2LV8A 3CRVA 4HUQB 3U61B 2KLBA 3P97A 4HSGA 4U2FA 4G23A 5AXAA 2HZBA 2DPGA 4BDSA 4JBGA 1D9ZA 2AA3A 2BSXA 4HX2A 4RZUA 4WV3A 4QTYA 3ZH9B 3V8VA 2XWQA 3NRCA 2VLBA 1M33A 5AHWA 1QH9A 3SWWA 3VJMA 4KODA 2ATCA 2WYHA 3FZNA 3NTQA 2GO1A 4IDFA 1KETA 2JIOA 3VOAA 4F4UA 1ND6A 4PX3A 2NU8B 2ZJ2A 3PXCX 2JI9A 4UOQA 1FYWA 5T4EA 3QSGA 1Q1AA 3DO6A 3I9MA 4G86A 1DBQA 4MQUA 5EUBA 1JE1A 1I3OA 1NUQA 3LT4A 3LUJA 3F5QA 4XB1A 3G0DA 5T57A 3CNBA 5LQDA 1N32B 3C74A 4X1OA 4H3HB 3QF7A 5EPOA 2GXAA 4WWHA 5DM4A 1NVGA 1W49A 2WAYA 1HL7A 3ZIAA 1XT6A 3DJYA 4S1VA 4XXHA 4DMCA 3H1FA 4PGMA 4YHBA 3KLBA 1EESA 5E4TA 3BXZA 1GLNA 1XB2A 2FMXA 1UBJS 1ZZEA 2VDMB 3IUEA 3QVWA 3UWSA 5I47A 3GGOA 2VZ8A 4GMDA 4YFVA 1V37A 2G67A 4XRRA 1Q0RA 5ERGB 3C8DA 4X1YB 2ACWA 4E2WA 4CLOA 5ICSA 2YC4C 3BSYA 5EHQA 1I5RA 1HPLA 3BK2A 1I7NA 5BN5A 4GT1A 2WC1A 4UOEA 3PDIB 4G97A 2ZUDA 3LBAA 3OFNA 1ZKMA 3JW8A 2DKNA 5HMMA 3TTSA 1P8JA 3B78A 3FPFA 5ECYA 3GVIA 3RHZA 4C7XA 4HAWA 4DS3A 5EJMA 1YVUA 3BZBA 1BEEA 3O38A 2PKCA 5H9VA 1OWMA 4YPVA 4TMTA 2O1EA 1MB3A 1RBMA 3K1ZA 1T6YA 3A6KA 1L1RA 1IK4A 3DXZA 3HBAA 3NIWA 4INZA 1WHTA 2BY4A 1J0XO 1Y9DA 3PUWA 2KBEA 3K96A 3QTLA 2WA1A 4WOJA 4YRPA 3RCBA 1A0OA 1KU0A 4D1YA 2F00A 2YCBA 5F5NA 5L6MB 4WNAB 1ELOA 2ORED 3CVUA 1Z8NA 1M6VA 3FNQA 4BO9A 3OPXA 3G5MA 3HLKA 2OY0A 5IKXA 1OLXB 1FRFS 2HF9A 4KQ6A 2BM1A 3WV5A 3L05A 1ORTA 1L7PA 4A23A 5L9AA 1KDOA 1SC4A 5DCYA 4GOXA 4BZWA 5EESA 4JI4B 1AHHA 4IGKA 5KREA 1HNZB 1XU4A 2MSEB 1Y4ZA 3H5WA 3TB4A 1NRWA 2JFFA 3KCQA 1V6AA 1DQSA 4HWPA 5K3EA 1BDIA 1NURA 4BFSA 3GL9A 1T5LA 2F3QA 2ODAA 2PTHA 2WD8A 2ZI4A 2J3IA 4W82A 1KH1A 1SXJE 3QVUA 1EWRA 1NHGA 3E23A 3Q0IA 3JPWA 1R15A 4TVKA 3WK5A 2PUDA 5F98A 4IVQA 4LYHA 3UJDA 4QJ5A 3HB1A 5BVHA 4JZKA 2G8LA 2EQBA 1K4KA 3AF2A 3GHHA 4IIEA 1P4SA 2GTHA 1ZIPA 2XYQA 3Q3GE 4M0PA 3U3XA 3ZD8A 4AZTA 2F3UA 1HOXA 1ZDMA 4HH0A 3HDVA 1ZX1A 4K81B 4M22A 3UC9A 3KAJA 3IUNA 1P72A 1DAKA 3JVUA 4ZVOA 5H0IA 2DB3A 5G0WA 3HBJA 4RZ2A 2AD1A 3IP7A 1YBVA 2ZB8A 3UXMA 3VNUA 2LR0A 4LJ4A 3W5UA 2JI6A 5K0GA 1KI2A 2PX5A 3RJMA 1XTSA 1M0WA 3DB2A 1B14A 5M2QA 1NTRA 2DTDA 1JNXX 1NJ2A 2HH9A 4BYMA 1WRBA 4G63A 1NKSA 4AX4A 1T36B 5EJEA 3IALA 4IIVA 4N03A 4JGBA 1EQ2A 1NVDA 3HBLA 4I2VA 3ETJA 3Q7PA 4RVGA 2BISA 1NVEA 1G3UA 2H2HA 3J80A 5E8JA 1ZUNA 1DHRA 1BWRA 2YXNA 2GXSA 4OM8A 4ND2A 1AS0A 3R3YA 4JT4A 1MOZA 4KIGA 4PLVA 2GCGA 2OXEA 4KXLA 3AG6A 5A0FA 3RV4A 3B6IA 3ZYCA 3FPAA 4Y2QA 1NYLA 3RS7A 1FDRA 1J8VA 2FN9A 3JRWA 1QP4A 1KK3A 3CX4A 2YZMA 1GO2A 4QYSA 3DZDA 4UVDA 1OVMA 3C6ZA 1BS9A 2AJCA 16PKA 4KE9A 3CUEF 5ALYA 3HUEA 3BKXA 4ZQCB 5G0TA 4BNHA 4JDUA 5J4HA 3DM5A 4IXDA 2UV8A 1WZ2A 1JILA 3BICA 2P77A 3RU2A 3VZBA 4B8WA 3IUQA 3UZUA 1P6XA 2EBFX 5TQ2A 2QYOA 3CA8A 2D4HA 2J48A 1KGSA 1CJVC 1K6MA 1V4NA 3N53A 4J1SA 3SGLA 3IQFA 1EE1A 2R8BA 1SD5A 5CXQA 1WXIA 1JR3E 3QEMA 4RMJA 2HU2A 5T8KC 4CF4A 1SUIA 3NHJA 4JL6A 1NPTO 2C2XA 3DWIA 3SS7X 4XI9A 4AURA 4WFIA 2BR4A 3X44A 2XCUA 4F93B 2IZ1A 4RVCA 5ALMA 3N0VA 4XJSA 2C4TA 1QDLB 1EGQA 2R5NA 4JJIA 3RYFB 1RAIA 1K27A 4MZDA 3D6TB 1GNPA 3IQEA 1K9VF 1UDRA 2IFTA 2NWQA 4NG5A 1NXQA 3U44B 3WC4A 3DO8A 1UMKA 1MO3A 3RYCA 4QFMA 3AILA 5DGCA 3QEOA 5C5DA 2V45A 3E61A 1E5QA 3FI0A 4ZALA 3AF5A 4G81A 2JGMA 3FMIA 3TLYA 2GEUA 4BLVA 4M7OA 3ITEA 3QHAA 5CK5A 5D00A 3Q4GA 4M0UA 3T3NA 3D3EA 1W8IA 5F33A 5AXCA 2EF0A 4GAEA 2Q0QA 4D9IA 5IAOA 2R8YA 5SZJA 4V24A 3HRKA 3UOWA 1G5FA 3LVRE 1R4NB 3FCSB 4MXDA 2QT9A 3FBWA 3KZNA 3MUFA 1T3HA 2H7XA 2RGBA 4KU4A 2HK8A 1XZGA 4FWIB 4LMRA 4UVIA 4JXZA 1HG1A 5DBFA 3X2SA 4YH1A 1O6GA 2HGZA 3NIFB 4Q4DA 4DQKA 1ZINA 3OJ0A 4JR0A 5L4NA 1MIOB 3T7TA 4RZSA 2AYZA 4WDQA 5J9FA 3MMPA 1EXMA 2OVFA 2XADA 2QD3A 3KU4A 2YJZA 3ICOA 4PNPA 5EKXA 3PDHA 4LY9A 4LNAA 1DIGA 2X0NA 1D4AA 3BIXA 3G8CA 2Y9MB 2C78A 3HL0A 4HUQA 3SZGA 4DQLA 1TD1A 4FNGA 1JE0A 1XTBA 3HCRA 2LDBA 5IAAA 2JI8A 4DV4B 3O83A 1M6WA 1JDBC 2EFGA 3PQ4A 1XA0A 4JBWA 3INYA 5FPPA 4MB6A 4S2EA 3ST7A 3E5RA 5KVAA 2R7AA 2I3ZA 3EGVA 2CV1A 2VDJA 3QX7A 4MUMA 1R6AA 4MV8A 5CB6A 4YN3A 4DIEA 2ZSJA 1O5TA 3V2IA 4IXMA 2HPAA 4S12A 1SB8A 2G1UA 3AR7A 4XWAA 4DWOA 4PPNA 4PYOA 1ISMA 3I83A 3A6GA 3ZZUA 3BCUA 2ZB4A 4HWTA 1ACJA 4J1TA 3NFRA 4XRGA 2FJUA 4RK7A 4E1AA 3AP2A 2GASA 3B53X 4L74A 4R7GA 4N5MA 2GK6A 4OXKA 4JUAA 4PFJA 5AW7A 5ICMA 3KAKA 3LO8A 1H42A 2OORA 4GVXA 1W94A 3IOYA 3NT4A 4BLUA 4DJDC 2VDVE 4F8JA 5I9LA 5A6SB 4MTCA 1KI7A 2XUGA 3NV7A 3USCS 3FDIA 1EHYA 3NIBA 4LOJA 4TSKA 5LWHA 1AKWA 2XIJA 3I0NA 3FI9A 4B79A 1BXGB 2R8EA 4WUVA 1VDZA 3MJHA 3IBSA 3E3MA 4X1YA 1FXUA 1GUAA 1HETA 4YAOA 3BILA 4HWSA 1NUUA 1FZTA 2RHMA 5B2FA 5GIOE 1Y7PA 1ZM9A 2FZ5A 3OX1A 4ZKEA 4B2IA 4GZ5A 3IOEA 3PDIA 3IOCA 4RHFA 4GQAA 4PCAA 1KZYC 4Y6SA 5EAIA 4C5BA 2WB2A 4U2BA 3GPDG 3IHLA 5AK4A 4D25A 2X41A 2PZMA 3QOWA 1E3MA 2I54A 2BD0A 5HRUA 2BBSA 4PAGA 5CNMA 3RHTA 4S1WA 1XKQA 4QOGA 4YONB 4X3PA 1QFXA 3AVTA 1MTOA 4S0XA 2CLKB 4JT9A 4FJ2A 4GOKA 4XR9A 1Z22A 4QUHA 1DXOA 3EGOA 4UMFA 4D3XA 1X70A 2NZXA 1RZRD 1YMQA 3B8HA 2AXEA 1J1ZA 3O8DA 3UAOA 1HZZA 5AUOB 4NCXA 1WB9A 1PR1A 4V39A 4WNAA 3AFHA 3RS8A 3EDOA 1W4CA 4RACA 1E89A 2C7BA 3P0EA 3G88A 1OLXA 4FN5A 5LP6C 3AQIA 3NGXA 2EWMA 5JAIA 1SIUA 2FLVA 3MGKA 4DCGA 1F2DA 3L8GA 4R41A 4HMQA 2IEIA 2EP7A 3TKLA 1GYRA 3JY6A 3R75A 2C5HA 1NNLA 1KO5A 4H4EA 2EATA 5KHLB 1QF6A 4RVUA 4DT1B 1YB2A 2QPTA 4G8CA 3C1TA 5TNXA 1B8UA 4TROA 2EG5A 3S4YA 5JROA 2XA1A 3VYUB 3H83A 5F9MA 4LDRA 3Q72A 1SXHA 3AV3A 3JVIA 3NONA 3CX3A 3QJYA 4OO3A 1PHRA 1D7OA 1DCFA 1HRKA 1KGDA 4HLQB 3L4SO 3OFJA 1J5PA 2Q5IA 3NANA 1ATIA 4NATA 4HFNA 5DCWA 3V42A 4C7KA 2PKWA 2CHUA 4HAVA 2UVPB 1LLCA 4WDRA 1LSSA 2DHCA 2KSQA 2EFHB 1SVOA 4DQVA 1F6DA 2VRCD 3F6EX 1TO1E 2PNJA 3C3CA 3MQFA 3PNPA 3MPOA 3K9CA 3DQQA 4ZT6A 3MXTA 5HZKA 4MVJI 3HDGA 1PAUA 2Y66A 2PRYA 3MB8A 4QREA 3SIXA 4G4JA 1HFJA 2XWJI 3ASVA 3CS3A 2G36A 1Q11A 2C3UA 5DK6A 3BJIC 3TRKA 4F7WA 4YCNA 3EPHA 3OE5A 2C1ZA 1KJ8A 3H9CA 4YJKA 2A5DA 4KVFA 1YDMA 5CGZA 3T9EA 3PG5A 3GEMA 4U3JB 3R8CA 1FFBA 3JQGB 4L5YA 2QEQA 1QLHA 3A31A 3CX6A 3ZIUA 1EB8A 2DCUA 2EBHX 5EXPA 2CVOA 4CDNA 4CU5A 4R2WA 5AVWA 5JSQA 5ELXA 2XNCA 4F38A 5FCDA 3DD1A 2L17A 5I7RA 5JJLA 1QANA 2ZFUA 4YP0A 4OFBA 3BCRA 4AM8A 5LMNB 3M4JA 4O4LB 4WXRA 4YMWA 2VPQA 1I2DA 4ENTA 3C7KA 3LLCA 2ZBDA 2PR2A 2PUWA 4Z51A 1IOVA 1QZTA 3VO9A 1Y3IA 4P2BA 4BVJA 1P5FA 4GNKA 4WVLA 3KSMA 4FKMA 2GYUA 4WXHA 5KMGA 4B84A 3FR8A 1L5VA 3AOEC 3F5SA 3WRYC 1G5RA 2ZBPA 4LCJA 4UQPA 3L6RA 4KQIA 1GAQA 2VPWA 2XHZA 3LZDA 5CUQA 1GKYA 5J1TB 3D8HA 3IP5A 4C76A 3RYFA 4K0RA 4CLEA 3U44A 2C29D 2D00A 4F3KA 3E6AA 1E77A 2WHPB 1PTJA 1ZEJA 2QSZA 4KB5A 5EFOA 3VZPA 4GRAA 4HWOA 5LYJA 5LNK6 1OZFA 2JCYA 3C6YA 4DIMA 4L4XA 5LZ7A 3HNPA 5L6LB 4R0MA 2GK3A 2LP4Y 4N6GA 2X9QA 5GPBA 2P6UA 4IS3A 5GY7A 1M66A 1TVMA 4JUBA 1KY2A 3ZVRA 4YXWD 4RTQA 3GDFA 5IDWA 5JRDS 1SKYB 2J3MA 3AR5A 4D8UA 5F23A 4WJLA 1R4NA 4XB2A 4CLRB 2VUSA 1XTUA 1VC2A 4D9JA 4F71A 4YRSA 3W05A 1Z4IA 3ZEIA 3EVGA 4MCIA 1IXSB 3WX0A 4WZBA 3ER8A 3FHLA 4FNMA 4MRPA 2DXIA 3QUBA 1L4BA 1MIOA 4QSMA 4RTNA 2AT1A 2ZWPA 4N6OA 1MA3A 3HJBA 3WYEA 5KSWB 4BPBA 1NM5A 3HCNA 3EOZA 4OXYA 1A72A 5TJHA 1Y5LA 4WMLA 3KTAB 3JQAB 1ZUD1 2ZJ1A 3IMCA 1PUJA 2VTDA 4KXMA 4S04A 5AK5A 3I28A 2CT8A 4FXOA 1TPYA 1GTZA 1SUPA 4G37A 2J9GA 4BO8A 4Q3OA 3D8RA 3IX7A 1E9RA 5M3BA 2YUTA 3HV0A 4I3FA 1R6DA 3KP1A 1H9AA 3QMWA 4K9LA 5A3QA 5CW2A 5BQFA 1SXPA 2X5KO 2WZQA 2IS4A 2QN2A 1N0HA 3LBFA 2G9VA 2AOWA 1GAWA 1F0PA 1SZJG 1ZWLA 4Q5IA 9MHTA 1TMOA 1WEHA 4KO1S 4ZANA 4LBZA 5FV7A 1E7RA 2G5GX 3FVQA 3N5KA 1G3IA 2RAVA 3JARB 5REQB 4QARA 3DFKA 1RAFA 3GJQA 1TZCA 1Y1LA 4PWZA 1U2DA 4QUDA 3V6MA 3WZ2A 5JCXA 4MVJD 4OD0A 1G55A 1PT8A 3PQ5A 3D59A 1M7HA 4G5GA 1XTPA 3LA6A 3P2OA 1Q3HA 5EWJA 1BX3A 1NVFA 4HV4A 5IG2A 2GA8A 5AM3A 2XF2A 2G08A 5KVCA 1Z56C 2NM0A 2C4KA 1BKSB 1EX9A 1MG5A 3LFTA 1QIGA 3M4NA 3IR5A 3PC8A 3VC3A 1SC1A 5JV5A 5F5LA 3S70A 4CMHA 1YACA 3FM9A 4FZ5A 4TT3D 3QPUA 5A6SA 3RADC 1E4YA 4LY3A 1KFEB 4I9UA 1O89A 1QH8A 3DVRX 5T5QA 2BFDA 4GPAA 3EZ6A 3A3PA 3WLMA 5ITVA 2ACVA 4YUAA 1NW9B 2IU6A 2IDZA 1BXGA 4YJGB 2AFVA 1S6YA 1M34E 4N5DA 3IBFA 3R9WA 1LPMA 3NOVA 4GMKA 3DLPX 2JBAB 2ZAGA 3UCXA 3KR1A 4EF6A 3UJ3X 1EFCA 3Q3JB 4FS3A 4PO1A 2OA0A 1NNI1 3R7NA 4OHZA 4LVOA 4KMRA 5T3UA 5LLSA 3FVTA 4R71A 3RAFC 5J2UF 2FVXA 4JP3A 3T1YB 2AK3A 4BB9A 4Z1MA 3R5FA 5FWDA 3JAWA 3PGKA 5DJ5A 2GYWA 4AY2A 1UINA 2Z8XA 3JQ9C 2C88A 1W0JD 2OZLB 4U00A 4DCPA 1D6SA 3EF0A 1FYDA 3V8EA 2QTMA 4LISA 7REQB 4JFRA 4N8SA 3AFOA 3EJ6A 4D8TA 2OO5A 2C98A 1ETUA 1BE8A 1Z4MA 2CE7A 2NQTA 4KV7A 1ZM3A 3BH6A 5LD2B 2J9FB 4GOMD 3KALA 3N0RA 4WBSA 1G4HA 1GVNB 4LHYA 4Y2XA 3VYTB 1HT3A 1WBBA 1U8XX 3MTIA 1KC1A 3JR3A 4ALIA 2Q2WA 2R8XA 1X8LA 2GK4A 5T3YA 2I7VA 4B32A 1XXHB 3HSKA 3UK6A 4F4FA 1UBHS 3N87A 3W77A 1GGFA 2NUPB 3VSDA 1I6KA 1Y8AA 4HFJA 1P4AA 2VH1A 4H15A 3HCAA 2ZSBA 3PHGA 4C6SA 1GY8A 1NI4B 1YQDA 3STUA 1VE3A 2I6SA 1X3SA 4E22A 5JWHA 1QUEA 1DJNA 3A26A 5EZ6B 2OZVA 4NYJR 4QYIB 1A5ZA 5GONB 4DT1A 3BFPA 4EG7A 1F8YA 1RW4A 3U7QB 5JZVA 3IXQA 3KYBA 2Q3MA 2QRLA 4P8RA 3RKRA 4EKNB 1L4NA 3W4KA 3AM4A 4O3MA 1A4RA 4ZO6A 1JU9A 2FOIA 2R6CA 3LFUA 5IFKA 1UPBA 3W34A 1WW2A 4X6XA 1GEGA 3BXGA 4JYCA 4BQOA 5A1JA 4WXEA 1G5PA 2Y9PB 1HEIA 3TRHA 4RK4A 2UVPA 2VPZA 1SQGA 3VTFA 3ZY6A 4BNUA 5SICE 2XRFA 1Q12A 4ZN6A 1YL6A 3DD5A 3FYTA 4ZJYA 2FCAA 2CLEB 3DOUA 5PNTA 4JYBA 1GNSA 3ABQB 3IPRA 4GP7A 4MEBA 1KMQA 1FE8A 1L8XA 2JAPA 2OCGA 3JWIA 2QJWA 4NABA 4ESEA 2BHLA 4HAXA 4PZDA 1OT3A 1GP2A 3ETLA 1GLGA 2HEGA 1YXMA 4QUIA 3EQ2A 1FLVA 1CQIB 3ORYA 4B6QA 3D2AA 4G85A 4EUHA 4EG5A 1IPHA 2BL4A 4QBFA 2HHCA 4A1FA 4C20A 3LUDA 4U3JA 2BONA 2AMFA 1BE6A 1NBAA 4FGKA 3HWX1 2JCVA 2OYSA 4LNHA 3BWXA 1PX0A 2ZSDA 5F2NA 1BW9B 2I4NA 2Z4RA 1F2VA 4NZYA 5FA8A 1RWWA 2W11A 1L5SA 3HCPA 2FK7A 4UQLA 3AFGA 3BZWA 2PT5A 2L69A 3HJUA 4KQXA 3ELWA 3QVGB 4LKRA 4Z9AA 3DCJA 4J16C 3RAJA 1YZQA 1FU7A 2ZRQA 1ZOOA 4Q37A 3F0TA 2GYVA 4RVNA 1TJ3A 2ZB2A 1C4WA 3I1JA 4KQJA 5IYZB 5JCOC 1DDGA 4GI3A 4WOKA 4X44A 1HO3A 1XIVA 3FJOA 2RHOA 4NCHA 1K08A 1XWFA 4YRZA 1X1RA 1LB1B 3FBTA 3THXB 3CR7A 3BSWA 2WJJA 5EJ2A 3V4ZA 2TECE 1LPBB 3UYKA 5A5VA 4FZVA 3KWJA 1TC2A 4GXRA 3K92A 4U7GA 4V3CA 3WRXC 1NBMD 2F7SA 2ZRNA 1MOSA 4HWKA 2AX3A 1GL7A 3K0BA 4ZQFA 4D6YA 2XE6A 1E9DA 4KE7A 2F8SA 3O1LA 2WHPA 3M82A 4FSDA 1SD1A 2WHQA 4TWAA 3FRHA 3VVBA 4ZYVA 5JBNA 1MB4A 1YVDA 4OGFA 4QXPA 4ALJA 3KG2A 3PPYA 4LDNA 4AG3A 4D9MA 5BXQC 1GT91 1UJ4A 1W35A 1Q5PA 2AB0A 3P0HA 5DHQA 3DL4A 4J1NA 4BNZA 2YZ2A 5H3LA 2PRZA 3Q8WA 4EP1A 3ZJTA 4RETA 3E9ZA 4BGUA 2W6PA 2OVBA 3QVMA 3GGGA 2GDJA 4RM2A 2GESA 2JLAA 4CMEA 1VDMA 3C3JA 5EIHA 4DC0A 5L40A 3WMEA 1N34B 1BO6A 2GXUA 4B3DA 3DWGA 4CLRA 5NLLA 2RMKA 1N2OA 1R7RA 3IQXA 5JMWA 5KVSA 2AN4A 1DGQA 2DFVA 1P0MA 3H2IA 4QATA 4YRAA 5DP2A 5B37A 1SHUX 1J2EA 4GEKA 4RHTA 5AJHA 2E4WA 4O5AA 1PGNA 4A8JC 1D8AA 1HKUA 2QX6A 2H2DA 4OMFG 3VZQA 4E46A 3KTAA 3JQAA 2P9JA 2R6AA 2W6NA 4ZCPA 4E5DA 1UWLA 2VT7A 1V6CA 3QENA 4S1PA 2XUDA 4HC4A 4DADA 2Z3VA 1CF9A 4QO7A 4LHSA 1K8YB 1RLJA 3E9YA 3ILXA 2IE0A 5DSZA 4P33A 3OZIA 2CXPA 4XQ0A 2N46A 4G9EA 2FFBA 2G07A 2W8ZA 2IEYA 1KH3A 1IEXA 4WCFC 3GWGA 5IBPA 2GN9A 2N1BA 3JARA 5REQA 1E3DA 1IN7A 2RGCA 2W6IA 4OLHA 1Q1EA 3TXYA 1F5NA 1G5TA 2QNRA 1N8SA 3A7DA 2XDQB 4HEHA 1KQFA 4BVAA 3C2QA 2YHIB 1C7JA 1VOTA 2PX2A 2WBLC 3NHLA 3FVWA 1JWAB 3CKYA 2R7MA 3BFVA 3NHAA 5FO1A 1J2TA 1PT5A 5HRAA 1YS2X 3P2JA 3CVJA 2DOKA 4AMZA 1ATZA 1KP3A 4A6EA 1GSOA 5IK2D 7ABPA 1PI3A 4X62B 2JLVA 1FVFA 2FEWB 1K5GA 1U8TA 2DLNA 3TB6A 3W5DA 1SB9A 1KI3A 4YJGA 1P9OA 1PD0A 1YZLA 2PFGA 4ZDJA 2B8JA 3QLVA 1JVSA 1HYHA 3RUEA 2C2HA 1WR8A 3QKRB 3GLIB 1E2UA 3TTUA 3ZLUA 4E4YA 2O2DA 3FJ1A 4NH4A 4NSNA 3QX9A 3HABA 1NA5A 4AG5A 1NX9A 2V59A 3FWPA 4Q02A 1ANKA 1L4LA 4HFRA 4HDAA 1B8VA 2HQRA 4RDXA 3AHFA 2QL5A 2QUJA 3OZUA 2A30A 2JRLA 2FEMA 1SPBS 1HT1E 2XCIA 2OZLA 2UYQA 2YZNA 3C3WA 3VKFA 2V9ZA 2WNHA 2H1SA 3E9QA 3IV9A 3PLRA 1XLUA 5KVQA 7REQA 3MMNA 4UUPA 3VU1A 5JRZA 4EMTA 4H17A 2R6R1 1PR5A 3CFYA 2VZ9A 3DL2A 3MNFA 4RGBA 3MILA 5D2CA 1VZ3A 1VP9A 5DIZA 2J9FA 5C8YB 4WXMA 3M8KA 4KYVA 1Y34E 1P2FA 1QIIA 3DHYA 5DNAA 3ACCA 4K9OA 1P1FA 2PA3A 4YQEA 3O21A 1JSLA 3I30X 4ARCA 2W6JA 3ZV7A 1U3DA 3EY4A 4RYLA 1FXSA 2L19A 1SWWA 2NUPA 1WXDA 4CKXA 2JLCA 3QNMA 4OX9Y 1JBEA 1QIKA 5KWSA 4FS8A 1NI4A 1YQUA 2EFJA 2YCLA 2FR0A 2WTNA 1OXUA 2FSIA 3ZTYA 3B38A 2INGX 2ORVA 5KAPA 3X1DA 1WG8A 4KQCA 2XTJA 5CVJA 1MAWA 2FMHA 4DGSA 5FP0A 2IH2A 1YMVA 4CLXA 4IFTA 3I23A 1GR0A 1QU3A 4QYIA 5GONA 4U7JA 3GPLA 1J8FA 2R8OA 3U7QA 3OPQA 1C30B 2P2ZA 3PNYA 4R9SA 3EUWA 4WX2B 5A0TA 1X8XA 1T1JA 2WSSA 3FWNA 2X76A 2RD2A 1LLUA 4MUIA 1KPHA 1VGRA 1C8KA 4JEMA 5BT8A 2ZJ7A 3FOZA 1YZUA 1IUNA 2DHDA 3DMGA 4AECA 5F21A 1C3EA 2A88A 1PBNA 3KWFA 5ALDA 3NOQA 1W2WB 4L16A 1WKVA 2H1CA 2ZRDA 3A9RA 3ZLJA 2B9VA 3GRFA 3N8GA 2J3KA 1SWVA 3F96A 1XPRA 3DO5A 2IGBA 2ETXA 3EDYA 4XPZA 2O5CA 4ZI5A 3IV6A 1ZN9A 3AVUA 1D0IA 1J06A 1YDEA 3O03A 3TVYA 1NBOA 1IUKA 4JGGA 5J59A 5EXXA 3WLNA 2JKYA 2MMGA 4Y9TA 2V55B 4NS4A 4RTOA 3OSUA 3DZBA 5F73A 1YBFA 2HJSA 2HUNA 4M9CA 4RL4A 4FX2A 2HQBA 3MJFA 4LZOA 1L7RA 2WIGA 4IGAA 1CQIA 4Y6GB 1HKHA 1XWWA 2QW8A 4PWYA 5KYVA 3ANTA 2XUHA 2Q5HA 1CVIA 3H6HA 2GEDA 1E2FA 2OILA 3IHWA 1UL1X 2O0LA 3TEFA 4TMKA 1JYSA 2G5CA 1QPGA 1RRVA 4EJFA 1BWQA 2JVIA 3C85A 4GVLA 2Y4OA 2MOKA 1BW9A 2P3OA 2E18A 1OREA 2BDUA 4JYMA 2MCFA 5MN5A 3FE2A 3IFSA 3M6WA 1LVUA 4WECA 3E58A 2R5FA 1ADCA 1U7ZA 4O2LA 4X8HA 4AS2A 4LMAA 3PDWA 1R50A 2AEJA 2D4AA 2JA2A 2Q29A 2W5UA 4EAQA 2XUPA 3TRDA 5IDXA 3LUKA 2DFDA 5E8RA 5IYZA 2PVSA 3GGPA 3IILA 4N65A 2I66A 4RORA 2HRBA 2IDJA 3TL6A 1TEVA 2VR1A 3FPCA 4MKZA 4J29A 4YJ2B 3S1SA 3THXA 2ZLBA 3AX6A 2CF6A 1M6EX 1H85A 4UNQA 3U6KA 5ENVA 3KDAA 1TKRA 2V4UA 4M46A 1S89A 1AN9A 3ICVA 1XD9A 4F8YA 4IDPA 4Q3KA 3KEOA 4FLEA 1Z4NA 2MJLA 5C8DA 3IL2A 2V4ZA 1VRCA 2ZR7A 3N8DA 3RVPA 5A7FA 3GUVA 3SIWA 1XR3A 4AN1A 2B92A 4LJLA 4Y2GA 4M37A 2A7XA 4QASA 3EVTA 3GEEA 1PHPA 2DPLA 2M32A 2Z95A 3PFFA 3SOZA 4KOAA 1TFRA 4DIFA 2C7RA 1GZ4A 1O4VA 1TYBE 2IF2A 3ANNA 4G0WA 2DVMA 2HV8A 1SY7A 1YHZA 3AB7A 3G85A 4R81A 1CVLA 4Y3UA 1TT7A 5BR8B 1Q0PA 2Q62A 3LC7O 4ZXFA 3HUDA 1M1XB 3L0SA 3TRFA 4D57A 4IDCA 5HBRA 2WIFA 1Z37A 4WK4B 1IZ8A 3RF7A 2BM9A 2FWJA 3ANSA 1O9BA 3O73A 4K5QA 5I4CA 2CCJA 1H1LA 3Q7RA 1V8FA 2OKCA 5JSZB 1GPH1 3ROEA 4AJKA 2YV2A 1ZL0A 1LK5A 2JI7A 4WZAE 4W7IA 5B7GA 2Z5LA 1T3SA 1W4AA 1D6MA 3A9TA 4W6ZA 1ORDA 4RMGA 4YRGA 5IZCC 4NDNE 4YYZA 3HR4A 1VHDA 3M5PA 1Z0SA 1T5IA 3U49A 4BTEA 3I9JA 4HZUB 4QKQA 4EKEA 3FTCA 3PL1A 5CAEB 4MITA 1QBGA 4HT3B 3PWSA 4EKYA 1Y5MA 3H13A 4P2GA 4LTDA 4N76A 1Q7RA 4IZIA 1Z13A 2EFCB 1FFXB 2ZS9A 3JV7A 1QIDA 4TZKA 1DG9A 3P5BA 4MI6A 4PCUA 1EHCA 1ZA1A 4HYTA 4BIMA 2JJ1A 2YHSA 3K0CA 1G5HA 3ADCA 2Q2OA 1OYOA 2VG8A 1SGWA 2XDQA 3KOWA 3FPJA 3UW3A 2QTZA 3EC2A 2YHIA 3GCXA 3ECSA 3GQBB 3TK1A 4HD8A 1GZ5A 3SLKA 1UQRA 3UHFA 4MGHA 3SSAA 3F73A 2QZ4A 4XTRA 4E13A 4BRSA 2WF7A 2OCAA 1U0BB 3ZUPA 4X66B 3BRQA 3JWPA 3FCCA 3TXXA 1Q0TA 1P2UA 3DMTC 3MPUA 4KX5A 1VPWA 4FI3C 5HG0A 4BAUA 1BE0A 3UB4A 3VPBA 1I2AA 1FNBA 5AJUA 1GU7A 3RFUA 2AWOA 1JTFA 3NAGA 2PMKA 3QKRA 4I55B 3GLIA 4JBLA 1F2TB 4Q9AA 3S8MA 2ZYAA 2HA0A 1IVYA 1OAOA 4F5ZA 3DP7A 1XNRB 3QEJA 1HORA 1OYYA 5K0LA 2J0EA 5I4KA 2VNAA 4Z4GA 4BQNA 1UOQA 1RYMA 5KC9A 3BHNA 5CA0F 3S8YA 4XWKA 2PMFA 2XLBA 1JJFA 3N07A 2HMYB 4F46A 1LY1A 4DEYA 3P1JA 4RTPA 2FG5A 3CNOA 4G6ZA 3ZZNA 2NXJA 4DCJA 1YZNA 5C8YA 1EPUA 5HK8A 5LNK1 4TZ0A 4JSTA 2FPRA 5EP3A 5HR5A 4L3OA 3TJZA 2B5WA 3QBTA 4BN5A 3UTCA 1K2VN 3NHWA 5KNDH 3AF0A 2QUAA 4JJ4A 5EN4A 3NVKI 1YONA 1YC5A 3RVJA 2G72A 2V03A 2YZ7A 3AI2A 3CWCA 3E7XA 2J32A 1G8PA 3BH0A 3ZOZA 5HPYB 3GLHE 2AJTA 1OW3B 1JAXA 2QROA 3HJTA 1AU9A 4ZVVA 3SXPA 4KAAA 2BRUA 1URPA 3ZJ4A 1QOQB 3WV4A 1P2DA 1UM8A 1W8DA 1TYAE 5GQSA 1Y6FA 1KRHA 2O8VA 2JL1A 3GOQA 3SM3A 1V6SA 3R3JA 1NVAA 2P1RA 3FWHA 1X1TA 1C30A 5IT0A 1BRTA 2A0WA 3UJBA 1EKXA 3A37A 2MSLA 5EP4A 3SVTA 1XMIA 2O2JA 2WTEA 3DT6A 4U0JA 4HH1A 1NN1A 1AQJA 1BOFA 1DARA 1WQ3A 2GN1A 3IV7A 3QLJA 4HJXA 4M1EA 3T52A 3U3DA 5K8IA 1OAKA 5KJFA 1PR4A 2ZBVA 4QICA 4JLUA 3ESDA 4ENWA 4IJMA 4PE5B 4QFCA 1P1BA 3TFQA 4DCVA 2EZTA 1AF7A 2C42A 3EODA 4AJNA 2AEEA 4R1LA 4B6JA 1NZFA 1RRCA 1FJXA 5EP1A 3Q2KA 3HYCA 2QY6A 1FBTA 4OHXA 1NYTA 1NBIA 1Z5VA 2G9QA 4HDCA 2OPHA 3ZQ4A 2V7WA 4EUKA 5FAKA 3GRRA 2GWRA 1UEIA 2DSTA 3DZFA 1ISSA 1PZEA 3G1UA 3SZMA 5TY0A 2QP3A 3NHPA 4JK3A 1UK6A 1U0JA 2QL7A 4TKMA 2FQYA 2MDTA 4JXJA 4DBLC 1NI3A 2CMFA 4AX8A 2PUTA 1K7CA 2NV6A 4D44A 2ZIXB 1KRXA 1C0LA 1L3CA 1TRHA 1D1SA 2D0PB 3PDCA 2FSUA 3VSBA 1THMA 2G88A 1RYYA 4C5AA 1DRKA 5FUBA 1T8PA 2X1LA 3UPUA 1GQYA 2O4UX 1A1VA 5EG5A 3E7DA 3OOEA 1JHZA 4F1JA 5KS2A 4E33A 2VTKA 3BVPA 1XBTA 1KE1A 4HATA 3GEDA 3PGA1 1EFVB 1ML3A 2FR8A 4P5PA 3AUYA 3NPMA 2ZIVB 2BMDA 5HVNA 5HFNA 3O8RA 1IK6A 2KLHA 2E48A 3TZCA 1PEDA 1GDTA 2Z57A 3DKPA 4PPFA 4KZKA 2ZIZA 1ILEA 1GPUA 2Y1KA 2D7JA 1BOOA 2CFSA 1PJZA 2PLNA 3IP3A 3KQMA 3O2SB 1ZJWA 4QQFA 3QWIA 4NKRA 4PHFA 4Z8XA 1DLJA 1GNLA 4RKFA 4YJ2A 4M8LA 2G7ZA 3R3WA 1GYPA 3M6IA 2O3RA 3FPBA 5HKBA 2BH2A 2IITA 1ECJA 1JIXA 2E4UA 4K46A 4X54A 1Z0FA 3OCZA 3W8DA 4P6VF 4W5HA 2BEJA 2WYOA 1UJMA 3COYA 3VDMA 4YAIA 2RGUA 3P2MA 1OF1A 4NE7A 3WICA 5B3JC 3WGIA 1RI4A 4ZOLF 3NM5A 2EEZA 2RH5A 3OPYI 3HCFA 8LDHA 4WGFA 3C3AA 4ZOEA 1N6LA 3AM1A 4RIFA 3F97A 1SG0A 1NKTA 3HJHA 3BQNB 1T1GA 5DMXA 3RD5A 1KEVA 4RNCA 3FOAA 4BO7A 2BHSA 4FSHA 2HOQA 1V43A 1WE2A 1JTVA 4Q9LA 3ZDBA 4ER5A 1WBDA 5K9ZA 3VPCA 5KCMA 4ZYUA 4N01A 2EL9A 2ZROA 4NEGA 2XBLA 3RJ5A 5FBWB 1FUKA 2IDMA 2YIDA 4MEJA 4NBWA 4PX9A 3U6BA 4LMPA 1M10A 4KAJA 4BCDA 4Q7QA 2KHZA 3ENWA 3O82A 4ECAA 3OLXA 1JG7A 2X19A 3LTEA 3TAUA 4ABTA 3VR6H 4EVRA 1WXWA 5B4TA 1DCMA 3KL4A 4AP5A 1KZ6A 3D8BA 3KT6A 5JSZA 4X60A 3KQLA 1JIVA 3R0QA 2R00A 3FHTA 4KR6A 2PUEA 2YJ5A 1KBOA 5DB4A 3NORA 3FUCA 3RB8A 5K8LA 2VUUA 3TNYA 1Y8ZA 2XVXA 2CNWD 4JLWA 1GPWB 1OMOA 2X1HA 2RHGB 3GMTA 1FOEB 5JALA 5H80A 4F1KA 2FSPA 5FT9A 1M7GA 1WY5A 1GXSB 2HJVA 2VFAA 3TSWA 3GH3A 1ESMA 1Y3FE 1SVNA 3AJAA 3UB2A 1ODJA 5EINA 1L4FA 1R5NA 2D2IA 4U8GA 3STTA 5IBCA 1OX6A 3EXFB 5CAEA 4CV1A 1U65A 3KD3A 4I9FA 1OASA 3EQ8A 2FYTA 4HPJB 1GFWA 1G8YA 2FFAA 1ZBQA 4HBZA 4INPA 4XCXA 1M7BA 1PT6A 5DYWA 1TQ6A 1WL8A 3H7IA 2B4TO 1D4ZA 1FFXA 2FUCA 4JHXA 1AJEA 1KZ7B 5H68A 2PBRA 3EAFA 4KNVA 3H8VA 2QT0A 2C5AA 2GF2A 4ILKA 1P7ZA 4IP0A 4H6WA 4D02A 1RFGE 1U7PA 1DC6A 1V9SA 3C0KA 5I45A 1WXFA 2OBXA 5KWEA 3HVUA 1P19A 3ELBA 4HEJA 1VPVA 3C97A 3HKCB 1ST3A 1WV1A 3RSCA 3OG9A 3V1KA 2GRJA 2A7QA 3JAKB 4HUJA 4ZMSA 1OBHA 2VWPA 5IVHA 2M9MA 1AM4D 5ILQA 2WUWE 3JWHA 5CMLA 4EZIA 1SVIA 3A6LA 1N5JA 4D3YA 4XEHA 2P7IA 4L5AA 2ZZNA 4XFJA 1CYEA 3LDHA 1EFPB 3QNUA 4PCVA 1A9RA 2HMWA 4L5IA 1WMFA 2WM8A 1W4LA 4X63A 4C6HA 3FYSA 2FN3A 4I55A 1EUQA 3ZQ6A 3PFWO 5F35A 4FNAA 5A3SA 5IASA 1MUUA 1L5LA 3V32A 4HGQA 4MVWA 1PNQA 4MULA 1U90A 2IXEA 1Z4JA 2QIPA 4KZPA 5EZSA 1EFAA 4M89A 3AIOA 1M67A 4JWKA 2A9OA 1VXRA 3C8ZA 2R65A 3UANA 4F56A 2C95A 5JPDA 4MUXA 5TMDA 3H5VA 3UG7A 3K0SA 3U62A 3I32A 1L5MA 3TH5A 5JI3E 5LDHA 1LK7A 3WSTA 2QPAA 3WLJA 1R10A 1TUIA 2P27A 2IUSA 3M4YA 1EWVA 4F97A 1HC7A 5D3MB 3BF8A 2JEYA 5JFTA 3ZHRA 2G0AA 3VR4A 1GPMA 3AB8A 2PRIA 2RKWA 4HHEA 4XQGA 2IEBA 2WVAA 1M1YB 1BVRA 4IIYA 2XPCA 4WKBA 4OYRA 2H1FA 1HYEA 1DV2A 3KEFA 1A5BB 1QV9A 2YW9A 4WKNA 1M34B 1BMQA 5EXDA 4WBNB 2V97A 4HQ0A 1I13A 3N76A 4JIMA 5ALNA 3TQIA 5K3BA 4LC9A 4I4NA 4MRSA 1LFDB 4C7JA 2FW6A 4N3AA 1D2MA 2DZDA 3EGIA 1Z17A 3VYVA 1JB1A 3R7WB 2CKDA 4LF6B 2O8EB 1F7UA 2R6FA 2SECE 3EVBA 1FFYA 1CE8B 3ULKA 5I3ZA 2FPXA 2J3LA 5I8PA 3V1UA 3KWMA 4Y6OA 2C5SA 1F3LA 3L8EA 1RTTA 1ZKDA 2OZEA 2PQ0A 3B7GA 3KV3O 1F06A 1GTVA 3DDHA 3HU3A 4MV0A 3SBDA 2ZDHA 1ECGA 1X15A 3RIYA 4BCCA 5JISA 1G7RA 1P6QA 1PNTA 2GAOA 4L75A 4DZTA 4IIFA 2CXRA 5EJIA 3KYJB 3WJAA 2PXHA 3RPEA 4BV2A 2SHKA 1MVLA 4FQ5A 4MQMA 4G1UC 4V2UA 5JZOA 3V8MA 2CL0X 5CLGA 3IVXA 3SZOA 3DFIA 1EZ4A 5FHRA 1KQOA 2PLRA 4E6EA 2RCYA 1A2QA 4BGVA 5F4ZA 1DTSA 4LRTB 4ZAWA 2OQVA 1DOZA 2VCHA 1VGQA 2QLBA 1OT5A 2VT3A 3PC6A 4R84A 3VVMA 1Y82A 3HYLA 5BR7A 1G20E 3HZZA 1DJPA 1GPYA 2ZVQX 1NL3A 1RQLA 1N6HA 1Q84A 3OEED 1QVRA 4LRYA 4LSWA 4PLTA 1OV6A 2BMWA 2ZIXA 5KTNA 1ZICA 3ZGVA 3HJAA 2QMYA 2YBDA 4OAOA 5D3KA 5A4MS 2X0DA 1HDOA 4DDTA 4J6EA 2GGSA 3SVZA 3KELA 2J5RA 2AX4A 4IPTA 2O52A 5ISMA 4GKKB 1XZ8A 4L72A 3HG7A 1G59A 3GAAA 4MIOA 4MQ5A 4RY2A 1ACMA 4J8PA 2ZSKA 4ZDWA 1W7AA 4OLAA 1O95A 4PXSA 2PUJA 2DP4E 3W90A 1EFVA 3W78A 4RXUA 2GF9A 1O7JA 3K6KA 2QG6A 4RV5A 1MAUA 4CQMA 1QQ6A 3JPYA 2YIJA 1QFZA 2B83A 2Y2UA 4MEAA 1ONSA 2P2NA 3HA7A 3WB9A 3VUEA 2CNNA 5JQGA 2JLSA 3HDYA 4CMJA 3WA7A 4XDZA 3W8FA 1L7AA 1Z16A 3AYZB 3IQHX 3QY0A 2C92A 4PX5A 1KKMA 4HNRA 4Q01A 1BMFA 1PW5A 4TL8A 4Y0NA 4MAMA 1FQWA 1S2LA 1XTQA 4NOKA 3ZG6A 4B3TB 1ZG3A 2X2FA 1JZSA 1NLUA 4RA9B 4N7MA 4X91A 1GZHB 3SYRA 1OXBB 2CJPA 5H4HA 4REMA 1L4UA 2GEBA 2HLNA 3QOXA 1COWA 1HFKA 4JUCA 1OGIA 1QG2A 3HYRA 4L78A 4GGMX 4EO9A 1UZLA 4R1UA 5ICEA 4A92A 4K9KA 3HP1A 1JW9B 3K0FB 3LQFA 1RHMA 2IV7A 2C7PA 2OCYC 4PYLA 1XZEA 3IT0A 1U2EA 1P1HA 4LF8B 1G8GA 4Y1GA 5IMSA 1QU2A 4XH9B 5DBHX 1J2RA 3UQZA 4GD3Q 3ZIDA 2AEMA 1II0A 1QRTA 1SUSA 5HS6A 4FYYA 4EHJA 2R8RA 2VCEA 2Y93A 1HDEA 1RRGA 3ABOB 3MLAA 3OE7A 3WWDA 5FL7D 1PR9A 2E7ZA 4FHZA 2K7FA 1FJHA 4KDCA 3G2MA 1YR9A 3BHJA 4RHUA 1MENA 4RPJA 4PR3A 2WIJA 5FYDA 1YRQA 4ERXA 4KOEC 4BGEA 4CCWA 2ZJ3A 3ND6A 1XMSA 3TTWA 4GOJA 4JP1A 1OXSC 3HFRA 2J33A 5LYJB 4EPTA 4QGGA 1NAIA 1JQKA 2IH5A 1LVGA 1Q7CA 1LBIA 3DEJA 4YCDA 4CCAA 4Q00A 3CMMA 5EWMB 2YWGA 3UM9A 4Z2YA 4A6PA 1U98A 3ESAA 2FFHA 4GBJA 1A5TA 5T4HA 5TE9A 5MFZA 3T5BA 4BFXA 4X8LA 1Q1QA 1CFZA 4GGPA 1T13A 4HAOA 4JXKA 1DIHA 3OEYA 1GXSA 1T5DX 1RWXA 3VMFA 3OCJA 2VF5X 4PG5A 4XJVA 3TSYA 8AT1A 4XD7A 2NSHA 2I4RA 2OUKA 2B2XA 5E2AA 3T7CA 3TMAA 1IWOA 3EXFA 3O93A 1CWUA 3H2HA 2C04A 2GO7A 3AIKA 4M0LA 4RFVA 4DA4A 4K3VA 3AM5A 1SXIA 2X8BA 3EAQA 4B3SB 5IFLA 4Q9NA 4R40A 4HB4A 4FKBA 5HZHA 2BGWA 5A0VA 2P9GA 1NZDA 2DLDA 5E9WA 3E9EA 2CJWB 1ZSNA 1QHXA 1XD2B 3PJFA 1OFTA 2XR1A 4MJXA 3QKSB 4TS3A 2BLLA 2PCJA 3HYNA 4YRRA 4A0QA 4CBVA 5JJBA 3ROTA 3HKCA 5BY2A 1ZNWA 1XDDA 1XELA 4CNBA 2BCEA 3WY9A 2ASEA 2G4LA 1VPDA 2X9VA 3G17A 1OXTA 1FDVA 4M36A 4JLOA 1JIUA 3RSHA 4GYWA 2IYZA 2Y76A 5EOVA 4Q4HA 1E79A 1EVZA 4BMPB 4LJ8A 2ACKA 3LUBA 2XE8A 1EFPA 1Z26A 3L7NA 5EFZA 3AY0A 1AMUA 3ENNA 1KC3A 2YY5A 2F17A 1L7NA 3GIDA 3LCUA 1G2PA 1JLLB 4UNIA 4QE3A 2OBMA 2WM2A 2EBWA 3HZRA 4XARA 2HQSA 1D5CA 1GA4A 1PJ8A 1ZMTA 1UJ5A 3Q3IA 5DVZA 4CMCA 3ICEA 1ZGHA 2G25A 3LHSA 2JLYA 4Z1OA 5MHTA 1U2GA 3ASZA 3KVNA 1E92A 1XX6A 2IHTA 2XYVA 4RVOA 1IZZA 3P8ZA 1DEKA 2ZRJA 4R98A 5EEHA 1N2EA 4L15A 4DC9A 1QIMA 2NVOA 3HHEA 2ZSUA 3O84A 4HQNA 4L7QA 2GAAA 2PH3A 3B48A 5EJFA 2ZGVA 4FMCB 5D5PA 4PXYA 1H3FA 2I4IA 1YHYA 1QE0A 2CNDA 4NARA 5D01A 3SHTA 3ZDYB 3Q1KA 3RH0A 1JDVA 2VYVD 1RWOA 2Z3ZA 2FQQA 3RYIA 4FT2A 5C4MA 1FDSA 1Z7WA 2CFCA 4B87A 4Z2AA 3GO4A 5AKIA 4IDAA 5GGYA 1ZLXA 2M6SA 3RRNA 1M1YA 4BO5A 3LXMA 2I4LA 3OAAD 2I91A 5HF6A 3R5XA 1G8AA 1JEYA 3B20A 3TW0A 3A1SA 1S0UA 1PP4A 1W581 1U4SA 2QX8A 3A1WA 4HTFB 1XDBA 4I08A 4WBNA 1Z63A 4JB3A 3BFJA 3CUKA 5H59A 2QN6A 4QTTB 2YVLA 4R16A 4L51A 1PQUA 4JI1B 3RTCA 2O8EA 5L53A 4R1QA 1HEUA 4OQMA 4ND8B 2XXJA 1T0BA 1Y3DE 1CE8A 2HBRA 3OX2A 2ZVJA 2XZTA 3OFVA 3ML1A 1K7XB 2E4VA 2EKBA 5JVDF 1K63A 3ETNA 1DTWB 3UHPA 2R751 1RXCA 5KTKA 3ZLBA 4G07A 1NHWA 2NNWB 2JANA 4LYFA 2B4AA 3W2EA 5LB2A 4AKGA 4EATA 5FPYA 3CE9A 3ZE6A 1ZONA 3OZVA 2QTTA 2A5LA 2BSQA 1MG0A 3ZQKA 3OSZA 5E9QA 2F8MA 4EO4A 4DR3B 3MHTA 4B40A 4RO0A 4ZXPA 4C87A 3MN1A 2NTVA 4DJAA 3G02A 1SCAA 3CTPA 3BXEA 1CERA 2ZATA 5G1OA 3PEUA 4GPTA 1C1YA 1U1EA 2WQ6A 2GILA 2D2XA 4OBXA 4BASA 5BPFA 5HKOA 5E6UB 3FHJA 5HF9A 1UBCA 4FFRA 4OBEA 2PFSA 5SY6A 1S5PA 2Q4EA 4JODA 1G8JA 1K3TA 4FE4A 4OGGA 1CUVA 3OLYA 1FBNA 1SAYA 3KKNA 3LHFA 3LPCA 3M89A 4J49A 1UXHA 4XVRA 1CDZA 1PD1A 5AVQA 1SXJD 2OFWA 2WOOA 4CKEB 3PHCA 5CP8A 2E9SA 2C61A 1LD3A 1Y48E 2OP1A 2W8BB 3QGMA 4YAWA 3WP1B 1S8OA 1V35A 4FNOA 3KUDA 3I52A 2R6HA 1N8KA 1DQPA 2HKIA 3PX3A 1IY2A 3NYIA 1EUDB 3BM5A 1R00A 3AHGA 4OJMX 2Y68A 4FGJA 4O4HB 2X58A 1TM2A 4QXRA 4RY9A 1QO0A 4KXWA 3WGGA 1ULAA 4U6SA 4UARA 2D5AA 2FV8A 1AH2A 1JXQA 1QK4A 3AUJB 2ZUWA 4HF7A 3SSNA 4Q4CA 2ZI5A 4UBMA 3JYHA 1TECE 4UHBA 2AKEA 4LWZA 4PYRA 4RA6B 3I12A 2QORA 2Y1FA 4ND3A 3AU8A 3TE6A 3M33A 4F45A 4QLBA 3FNBA 5EJ9A 2M6LA 3DOOA 2Y1OA 1EK1A 1V3VA 1W6RA 1PL8A 2HO5A 4F0JA 1DQYA 4YP9A 1K7SN 1R66A 2ZSIA 3ANYB 3SF0A 3ZQJA 3N2EA 3K0FA 1YZGA 5JYDA 4NL4H 4L8VA 4AKHA 2P0EA 3AF4A 1QIEA 1C80A 3VKHA 3SQWA 1MD9A 3BDVA 5EQFA 3OP1A 3RVMA 4F04A 3ER6A 1U8UA 4O4JB 2X0EA 2UU9B 1YOVB 2R11A 1NW3A 2Y1CA 2ZG6A 2CDNA 3C6MA 3MQ4A 2EERA 3O1HB 1GG5A 3WA6A 5I48A 4EW3A 1EUYA 4KQMA 2FP4B 2Y05A 3M6VA 1D04A 2PUHA 1TGYA 4H7HA 4NDAA 3P96A 3L8CA 1JR3D 4JDPA 4UM8B 3TUJC 3EBOA 3WK4A 1ISFA 1WDWB 4FX5A 4M83A 1B4DA 1QYWA 1UM9B 2J3JA 2QLTA 4IFIA