1Z2EA

Solution structure of bacillus subtilis arsc in oxidized state
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
139
structure length
139
Chain Sequence
MENKIIYFLCTGNSCRSQMAEGWAKQYLGDEWKVYSAGIEAHGLNPNAVKAMKEVGIDISNQTSDIIDSDILNNADLVVTLCGDAADKCPMTPPHVKREHWGFDDPARAQGTEEEKWAFFQRVRDEIGNRLKEFAETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures and Backbone Dynamics of Arsenate Reductase from Bacillus subtilis: REVERSIBLE CONFORMATIONAL SWITCH ASSOCIATED WITH ARSENATE REDUCTION
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Arsenate reductase
total genus 52
structure length 139
sequence length 139
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z2eA00
3LOPA 5BRJA 4RXTA 4KMRA 4RY8A 3C3KA 1FQWA 1Z13A 3KYIB 3C6QA 3E3MA 5FWYA 3JVIA 1QO0A 4MQEA 2FVYA 3DZDA 3HO1A 4Z9AA 1DZ3A 5D2CA 4W5QA 1W25A 5IUJC 3N0XA 2GWRA 1JYEA 3CU5A 5CNMA 1APBA 3K4HA 2PUCA 4Z4GA 3KYJB 5HKOA 1QP0A 3SG0A 3W9SA 4PEVA 4TLMB 4MLCA 5JS1A 3OQMA 3LTEA 1JBEA 3FFWA 4UHKA 3ILYA 5BRAA 4O1IA 5DCLA 3EODA 4EVSA 3F6CA 1PUXA 1SXIA 1DRJA 4Z4EA 4Y9TA 3QLVC 2AYZA 3MQ4A 3N75A 4JASB 4IILA 1JFSA 2CD7A 3KJXA 2DRIA 3CFYA 2WJAA 5ED4A 2BGGA 3RVRA 1ZHHA 5B3JA 1K68A 1GUDA 3NHMA 3H75A 1DCKA 3FMVA 3IPCA 2R4QA 3QEMB 4OATA 3C3MA 1PEYA 2FEKA 3NNNA 3F73A 2WB4A 1KGSA 1JL3A 3GBPA 1D5WA 4JB0A 1MB0A 3L6UA 4YGXB 4EUKA 4YO7A 3GT7A 3T8YA 2LUOA 5KQGA 1NXXA 2IDMA 4WZZA 1NXVA 4KZKA 4LDAA 3BRSA 3EDCA 5TQJA 3RVJA 3DGFC 4CBVA 2H0AA 2QSJA 1VPWA 4ZMRA 4N41A 4RV5A 5TQ2A 5FWYB 1QKKA 3Q7TA 5HQJA 1ZN2A 5TPWB 3HSYA 3QK7A 1U8TA 3NNDA 1Z12A 1ABFA 4YV7A 5PNTA 1QO0D 4GPAA 4P1ZA 3OMWA 3UK0A 3GBVA 1SXHA 5B3JC 5IUNC 2V0NA 2IPAB 3D8UA 4RWEA 2FLWA 1OXKB 3LUJA 1JWLA 1ZGGA 1JFTA 1RNLA 3LUHA 4RK1A 1D1QA 1XHEA 9ABPA 1TMYA 3LKVA 1QQBA 3DLHA 3A0RB 5EWJB 4RY9A 4MS1B 1TJYA 3FDFA 3HZHA 4XXHA 2FMFA 2WRZA 3G1WA 4PE5B 1AB6A 3SY8A 2CHEA 1GUBA 2FN9A 4NCAA 3OO0A 5JNVA 2LIVA 2N9UA 1L5YA 1NY5A 3RVNA 1PEAA 1FFSA 4RDCA 4XLTA 4Z4CA 5IULC 4RXMA 3NNSA 3IP6A 2LP4Y 3HS3A 3GWGA 4TMYA 3OQNA 3R0JA 2HSGA 4EYKA 1MAVA 3BBLA 2JRLA 1QQAA 1BA2A 4KNYA 3H5TA 3H5VA 4XFKA 4M88A 5T3YA 4YRZA 1Z26A 1WETA 2PLNA 3Q7SA 5FBHA 3RVMA 1U2QA 1DC8A 2GKGA 2JB9A 4P98A 2Q5CA 1QMPA 2GX6A 3O1JC 5ABPA 2FW0A 3CNBA 2FXIA 1FFGA 4OTZA 1C0EA 2RGYA 3MIZA 1E6KA 3QX8A 3EJWA 5KQMA 3OM0A 4MQFA 3A0UA 2QXYA 4S04A 5TQ2B 2VYCA 1QP7A 4QPJC 2OQRA 2R48A 3TD9A 3EQZA 4W5TA 2E4VA 4JB2A 3EAFA 4MR7A 1OXBB 1JFVA 2E4WA 3H1FA 1E6LA 3H5OA 2PMCA 1A0OA 1FFWA 2IPMA 3MMNA 4OG2A 4Z4FA 3KCNA 3T6KA 4NV3A 5KQPA 1EFAA 3EULA 5EWLA 3OO1A 4O1HA 2FSPA 3RVQA 4EYQA 3Q15C 1Z25A 1DRKA 3CZCA 2E4ZA 4HNSA 4E7PA 3LUKA 2QU7A 1CEYA 1A04A 4D6XA 3CZ5A 4ZPJA 3FFTA 5TPZA 4DQDA 3M6MD 2M1ZA 4Q6BA 3CRNA 4KFCA 2QV0A 4N76A 3M9XA 4DN6A 5IEJA 4MS4A 3ROFA 4G0YA 1MIHA 4WXMA 3HUTA 3CS3A 4MS3A 2IPLA 3CHYA 1F4VA 4O5AA 4Q7EA 4EYOA 4LDZA 3GL9A 3H6HA 1W9HA 4KQCA 2RDMA 3MF4A 4IGAA 2FKAA 2MYTA 3HJFA 1DJMA 2ZAYA 4DADA 3I09A 2HPHA 5EWJA 4JAVC 2L2QA 1NTRA 1P2FA 2PL1A 4F12A 3MYYA 2FLKA 3O21A 2FMKA 4H3KB 4OBBA 4KRFA 1GLGA 3QLUC 5DKFA 2PAFA 5KC8A 1ZVVA 3IP9A 4MRMB 1ZH4A 3HXMA 4NICA 2XDYA 4G0QA 1BDIA 1USGA 3A3KA 4RK5A 2I6FA 3OM1A 5KWSA 3B2NA 4MR9B 3OLYA 4WT7A 3IP5A 1DP4A 3ILHA 4H60A 4IMIB 5BQ3A 4W5RA 1T34A 2E4UA 3GV0A 4YR7A 1H9CA 1MVOA 4LE1A 5KI6A 3O1HB 4N0QA 1DBWA 2IOYA 4PYRA 5F64A 1LBHA 2WMYA 4FB4A 1I3CA 1ZAYA 2JVJA 4KK3A 2PUAA 1P6QA 2MYNA 2R25B 1RXEA 3KKEA 1Z18A 2FN8A 5TE9A 4ZJPA 3DLBA 4KPYA 2M98A 4IMJB 4LZLA 1YTUA 2QZJA 1PNRA 2NT4A 4KQ9A 2FEWB 3H5WA 2PUDA 2PUFA 3I5AA 3SM9A 4JOQA 2CWDA 5GOTA 5DLEA 4JP1A 3QLTA 4ETIA 4W5NA 1EWVA 2QW1A 2HQRA 3N53A 1YK0A 3GA5A 3KS9A 4MR7B 2LPMA 2PUBA 3DBIA 1NXPA 2J48A 4MLDA 5DGCA 4KK4A 5JNUA 3S99A 5IUKC 4L4UA 4RY0A 3CG0A 3OMXA 4MYRA 5CNIA 5EWMA 1DC7A 3CG4A 2YHAA 2A9RA 3GYBA 3URMA 3HK2A 2MYUA 4Z4IA 1KRXA 1JHZA 3LMKA 4W5OA 2TMYA 2JBAA 5KC9A 3QLUA 5FBKA 2L19A 5BR1A 3QELB 5T7BA 3LFTA 2PUGA 2WY2D 3Q41A 2JCGA 3TB6A 1YMUA 1FSPA 4N03A 3OLZA 2A9OA 4KV7A 4QYWA 2ZWMA 3JVDA 4YLEA 3RVLA 3H5IA 2AYXA 2HQOA 3RVPA 3LUAA 3N6VA 2QR3A 1K66A 4MS1A 5FWXA 4N47A 1LJLA 2JBAB 3OLWA 4KREA 5CNKA 4S05A 2CHFA 1BVHA 3JS5A 4PICA 4RXUA 5DTEA 1XWWA 4Z4HA 1YMVA 2OENG 3E61A 2FEPA 5C5CA 4HYEA 1U2PA 4G0PA 2JVIA 4H3HB 3H1GA 1DCFA 3UUGA 1DBQA 2F8SA 3O2QB 1NATA 1EAYA 3NHZA 3BRQA 1JLKA 1IIBA 1ZDMA 1EWTA 4RKRA 1QP4A 1YK1A 3C3WA 1NXSA 3T38A 3LKBA 3O2JA 4IRXA 3JPYA 3SAJA 1R8JA 4HNQA 3KSMA 3O75A 3IP7A 3FFXA 1AB5A 4EGSA 2L18A 1M5UA 2A9QA 3O1IC 4MS4B 4MGEA 1U0SY 4MR8B 4F11A 2RJOA 1HEYA 3D02A 4F06A 2JK1A 3O74A 8ABPA 1SRRA 3NBMA 3IPAA 2RJNA 3EQ2A 1DG9A 5TQ0B 4ETNA 5HM6A 2PJUA 1DCMA 1USKA 1YS7A 1PNTA 4YWHA 3RQIA 3EGCA 1GCAA 2VUHB 1BAPA 1D4ZA 2GI4A 4RU1A 5C5EA 3DGEC 4KVFA 2NZVG 1S8NA 4WWHA 1ZGZA 4G0XA 4TN5A 1F51E 2FMHA 3Q9SA 1M5TA 1QNLA 5CHYA 3O2SB 3F6PA 4TLLB 3QELA 2VUIB 4RK4A 3H6GA 2KYRA 2HQBA 3UKJA 1TLFA 1ISSA 3BREA 4XASA 3HUUA 1PHRA 1DBPA 5JNWA 4G0MA 4MPTA 4G86A 1JYFA 1EHCA 1QPZA 3LUGA 3RVSA 2PUEA 1RPJA 4OLBA 3SQNA 4L85A 4YS6A 2QVGA 4F8JA 4MS3B 1RZRD 4B09A 3LUFA 3KTOA 1NXTA 4Z0NA 1B00A 2VK2A 5I4CA 3L49A 4Z9BA 2ID7A 4MRMA 2PE5A 4RKQA 2WWVD 3HV2A 2F8TA 1YIOA 4UHJA 3OQOA 4ML3A 4Z99A 4WXEA 3TX6A 1URPA 1U04A 2MSKA 4QYMA 4Q6WA 3QEMA 1UDRA 5JNTA 3N0RA 4FE4A 2QVCA 3C97A 3I45A 1JH9A 1Z2EA 4RK0A 2FTKE 3LUCA 4PZ0A 1CHNA 3RVOA 1D2AA 4YP9A 4EVQA 1CYEA 1Z2DA 4XARA 2IYNA 4MR9A 4ZMSA 2B4AA 2O20A 3I42A 1Z17A 3CLKA 2GBPA 1VLZA 1Z15A 4LX8A 4IF4A 4RK6A 3G85A 2PL9A 5TQ0A 4N0PA 2W42A 4MQEB 4NQRA 5E3JA 3KLNA 4D6YA 4F3TA 5EWLB 5TPZD 7ABPA 1NXWA 3QX9A 4WUTA 1TM2A 1ZITA 4FE7A 1YVUA 6CHYA 4JA2A 1A2OA 1TVMA 3Q7RA 4RS3A 6ABPA 3K9CA 3M9WA 4QICA 1LBIA 2JVKA 3MM4A 1M2FA 5KQLA 2YHBA 3OLXA 4G0ZA 4RK7A 3HDVA 2B1JA 1E2BA 1L5ZA 3VNAA 3RH0A 4HNRA 4ETMA 3QLVA 4EY3A 5TPWA 2P9HA 3TMYA 3JPWA 2NZUG 3KLOA 2MSWA 2P4UA 1JF8A 1SD5A 3KG2A 5JS2A 1SXGA 1EWKA 3OLVA 4E7OA 3JY6A 1YS6A 3QEKA 2WJWA 4RSMA 5HSGA 4RZSA 4MQFB 2FQXA 1KRWA 1ZH2A 4MAAA 1J56A 1Y1LA 2FQYA 3JTEA 3CKMA 5FWXB 1RXIA 1P8AA 5IC5A 1P6UA 4EYGA 3A10A 3FGZA 3VNBA 2HJ9A 2R47A 2NT3A 3HVRA 2PKXA 1Z16A 3N0WA 3HM9A 3BILA 4XAQA 3P9YA 3RVKA 4G97A 1GCGA 2ID9A 3N8IA 5IEBA 2L17A 4GNRA 2LBPA 2H3HA 2A9PA 3F7NA 4NCBA 1C4WA 1ABEA 3TO5A 1ZESA 1JDPA 3HEBA 1LJUA 2FQWA 4D74A 1ZY2A 5IBQA 2MSLA 4G0OA 2IPNA 1XHFA 2E4YA 4LE2A 4YCSA 1MB3A 3ROTA 1JDNA 1E6MA 1LK0A 5IX8A 3LUDA 4MR8A 1M2EA 2MYPA 5EWMB 2X7XA 4LRQA 4OLAA 3HDGA 1ISRA 3IDOA 5GQSA 1BDJA 1RZRA 1D1PA 3GRCA 4LE0A 1JX6A 3KHTA 3SNKA 2IKSA 2FMIA 1NXOA 2NUBA 3T95A 5JNRA 1USIA 5JNSA 1VKRA 3HCWA 4ZYLA 1BDHA 1VRVA 4EVRA 3CTPA 3H1EA 5CNJA 3H5LA 2E4XA 3MA0A 1KMIY
chains in the Genus database with same CATH superfamily
2CCJA 2R5NA 3OPVA 1J1ZA 4FGLA 2H1OA 2RB4A 4CKEA 1OFHA 3VPSA 3STTA 3PFKA 2ZYVX 3CVYA 1UKVY 1TC2A 4RGBA 5A2GA 1SCBA 2WWGA 4M53A 3BZWA 3F67A 3WK9A 5DWQA 4M1YA 5FQNA 1L7PA 5KYYA 1HDRA 3W8EA 1MQAA 4DIFA 2Y6UA 3KYCA 3U44A 4E5NA 2GWRA 4KVGA 3DVAA 1NJ8A 3G9QA 3K4HA 1E1MA 1P4GA 2V6GA 3G88A 1CT9A 4W5HA 3FZGA 1MN6A 4X6UA 4XD2A 8ATCA 5AKLA 4PEVA 2QW0X 1D6JA 3QI2A 2QQFA 1OV6A 4Y98A 4Q93A 2C4HA 2H2GA 3U80A 3Q9LA 3F6CA 2B83A 4NMWA 4D9EA 2R1TA 5DNEA 1QZTA 4AO8A 1Q6ZA 2AYZA 5AI9A 3Q85A 4BUCA 3E5MA 4L5BA 3O4VA 1YR8A 3GDHA 3VZCA 3C3PA 1PR9A 2QD3A 2WJAA 3IX7A 5ED4A 5AXDA 1VXRA 4D4GA 2CBZA 4I4IA 4C89A 3KV3O 1RACA 4AUEA 2XCLA 1JLSA 3GJ6A 4IG9A 2RHGB 4ZQEA 3ACBA 4V3BA 1ZXXA 3C3MA 4PG4A 2JA2A 2WUDA 1ETHA 4YECA 3F73A 1D4FA 4MTCA 1U1DA 4JXJA 2MOKA 3I30X 4YO7A 3T8YA 4LUCA 2W2OA 3T34A 1Z4KA 2QW8A 2MSDB 1KDZA 1V7PC 2JAWA 4W9RA 1NMYA 3ZOKA 4BOYA 3PF9A 5HJ5A 2HW8A 3RIHA 4WVFA 1KI2A 1BZYA 1Q17A 1R9GA 4IOMA 2JFGA 4LRYA 1WDWB 3V8VA 4ZMRA 3ZWQA 2DBYA 2ESRA 4WCFC 5BUCA 1BOOA 3AHCA 4MI9A 4CM6A 3RC7A 3SM3A 2YV2A 3QK7A 1DJLA 2OKGA 4CR7A 3ZZMA 4C14A 4DLBA 4NCNA 1C9KA 4CLHA 5B3JC 3P26A 3NBYC 4FCVA 4UNIA 1SKMA 3IVCA 2Q5HA 4DMFA 1JR6A 2C5BA 2NU9A 1J39A 3IIIA 1UBOS 4MWDA 1LLFA 4UU0A 2P2YA 5DTQA 4RNCA 2ONJA 4MVJM 5CCEA 1SZDA 1ENZA 4MZDA 2FP4B 2Q7XA 1RP1A 1UBRS 2Y0PA 5H02A 4B85A 1FRNA 5AM5A 4ADSG 4CT5A 5IKMA 1DTSA 4DKJA 1OH7A 1A9RA 3HACA 3I0ZA 1Q0LA 5AH0A 5EWJB 2WTUA 1KKUA 4G5OA 2WRZA 3PYMA 2NAPA 2GEBA 2PX3A 2RH5A 4GE3A 5DBGA 3W6NA 2I2DA 3OOWA 4G5YA 1QYCA 3BIFA 3ES9A 2E5LB 1L5FA 2X22A 4G89A 4II2A 2DEUA 4QU0A 2DFKB 3A3PA 4XRRA 2N9UA 4X7RA 1CR1A 5ALFA 1VP3A 5D86A 1Y1SA 3UENA 5BSHA 1B1CA 2ZYRA 3D6HA 2CVOA 2HBZA 2UV8A 1SCJA 4NI5A 4RHTA 3H4IA 1CLEA 4A5OA 1K2WA 5CBPB 3E9MA 4JYPA 1E4OA 3H0CA 3PV0A 3EC7A 2R2AA 2VFAA 3HS3A 5FBQB 1HK7A 1NOJA 1ZM2A 5B3KA 5LBTA 2EP7A 3D4IA 1CEQA 3UA4A 4AJIA 2QR5A 3LO8A 2MMGA 1M2OB 3GY0A 4MB2A 5K8UA 1WETA 2IY8A 3B1KA 5FBHA 1J2JA 2GEJA 4BRZA 4R2KA 5KJ1A 4P98A 2KBFA 1JTEA 1GR0A 3CNBA 1TC1A 1ICEA 2AJTA 2D00A 4I66A 4DEYA 2P30A 1UAYA 3MW8A 5JRZA 3LBIA 1QVRA 2V9CA 2VHJA 1W9MA 3K6KA 3UUEA 2UUCB 1L5MA 1RRCA 3PGXA 4EMBA 1ZW6A 2ZITA 1PK9A 2QD2A 3P71T 4PBRA 4QULA 1UMDA 1CBUA 3G9ZA 2IPMA 4B8YA 4BWYA 2CNLA 4XFJA 2AOUA 2OBFA 1SXJE 3ZQ4A 4ZDIA 3LWDA 2CMHA 5J2UA 3K32A 3HXTA 3OJCA 5I8PA 1G5IA 2C03A 2A5GA 2G5GX 2EP5A 4RZXA 3WK4A 4ER5A 5B4VA 4MRSA 1NQ5A 3TIXB 2O2EA 1VPVA 4U5QA 3JQGA 3L7DA 3TOXA 2AMFA 4BNMA 3FYUC 1HEIA 2JFBA 3B8HA 3U7QB 4MW6A 4N5IX 4FHZA 5CHEA 3TVDA 3MUOA 2SKEA 3ANYB 4Q6BA 3CRNA 5JALA 4JSYA 1JH8A 4E5SA 3KOMA 4OFWA 2NADA 4C4SA 1B0UA 1FU8A 4RYDA 5JHHB 1WXWA 2CVHA 2XDWA 1E9DA 2ZIAA 4DQKA 3W8FA 1A5SB 3RYCB 2EFYA 2ZUBA 3FDXA 1VGRA 4KRXA 3U49A 2BCGY 3KWJA 1C0PA 2GYYA 3QVSA 1M75A 3VSBA 3V46A 2LCQA 3TFQA 4UEWA 4DADA 3EC2A 1SUDA 2ZSHA 3H2HA 3HU2A 2XOKD 3L77A 1GPLA 4KQ1A 5I9NA 1RRMA 1XYVA 1VMIA 2ZYIA 1P2FA 3SJUA 5DHTA 3V4PB 1BMFD 2BH9A 4N39A 5EJIA 3ONFA 3DOIA 3T9DA 5LQKA 3KQKA 2J1LA 4H3KB 1X9IA 1N8KA 3HP1A 3MB5A 4UTVA 5JD6A 1GLNA 3CUKA 1PS9A 2R87A 1GV0A 1PL6A 3DM5A 4JLAA 4JLVA 5JHGB 1U3WA 4M0DA 4G0QA 2XEXA 1LRLA 1TJ5A 3EZLA 1C29B 3OC6A 4JYCA 1U8YA 3TQCA 3M2TA 5ALGA 1E99A 4UOEA 2CKDA 3GUHA 5FNVF 1HZZA 4YR7A 3ZE0B 3LKDA 4CLDA 1MVOA 3HB1A 2V5AA 3GPIA 4JIMA 4KACA 5HRUA 2VQDA 4A03A 4CKXA 2C5AA 2WSSD 3FLEA 3I1YA 4U0JA 4YNBA 4CU2A 2Z43A 1XDBA 5F35A 3TPZA 5TE9A 5KTKA 1ZH0A 3T5BA 3MTAA 2YZMA 1VBKA 3K7EA 3VPCA 2QD4A 5H5JA 4H1VA 5TRTA 3MXTA 1PEDA 5LCXA 4IEFB 1XU4A 2VAPA 4I3FA 5E4YA 3IA2A 1YTUA 1A2BA 1AZTA 2AV6A 1XJWA 3Q8KA 2L42A 3QF7A 4X0EA 3SICE 3VPBA 3C4QA 2E5WA 3T5MA 2Y1OA 4OUDA 4A1FA 1IVSA 5JATA 1IHDA 1J2EA 1D2CA 3NWOA 1M8KA 1JKJB 3L0BA 3N53A 5D01A 3WBBA 4E32A 4HXYA 1QGZA 1PI3A 3KPVA 1SULA 3PLAE 3A9UA 2X77A 4O4HA 4WBNB 1YZNA 4LDNA 4NBWA 4N8DA 3SJBA 5LJIA 2A1TR 3RIMA 1GUFA 3OJXA 2V4MA 3F9CA 1CRZA 2A6PA 4X1IB 2A9RA 5AVYA 1T5OA 1I5RA 2CNWA 3ZGOA 3OJ0A 5A6VA 1DX9A 2C98A 5KC9A 1SCKA 4IUYA 1KJ9A 1IZYA 1UC4B 2BFFB 2QORA 1DAFA 2PUGA 1VTKA 4IHJF 3DAFA 5K5EA 2IYXA 2JC3A 2VH2A 5G0UA 3BB4A 2VKTA 1E2NA 5H70A 3C15C 2EDAA 2DM6A 1YVRA 3P32A 3RVLA 4DRXA 2ZIGA 2ZW9A 4UATA 2W2KB 4IUCS 5BR4A 1MUUA 1OPXA 2AG0A 1TM5E 1ORWA 2HLDD 2Z6UA 4O4LA 1LJLA 1SFRA 4OQXA 1E4EA 5HYVA 4NECA 1JFSA 2OESA 1E9EA 3RU7A 4R0MA 1ZXLA 2AEMA 3M9LA 5B3AA 4AZ3A 1EYZA 3GPCA 3IJEB 4MIEA 5K8LA 1YS1X 1TUBA 1JQLB 3E4DA 4WXYB 3JQPA 1PLLA 1TYCA 1JPUA 1Q16A 3ZBPA 3ZHZA 5A9RA 3NYQA 1PJ4A 4C4AA 3SNHA 1G8PA 2FEPA 2J59A 2KW5A 2ZTUA 4INZA 4NDNE 3W8RA 2QQ0A 3GRKA 4X92A 2QNBA 4Z1MA 4YALA 1NJSA 3HYTA 1PR6A 2QVLA 4EJ0A 1DAOA 5JWOA 1IIBA 4F4DA 4TVSA 2PBLA 4LQCA 1D09A 3IV9A 1KJ8A 5CCBA 5FOSA 5FYDA 1U8CB 3HKEB 5H16A 1WBBA 3CWZA 1P2SA 1HE2A 3O2JA 4JOBA 1FXWF 3REQB 4EECA 1XWIA 1P9WA 1QHFA 1S3GA 3D6AA 3T9AA 5IZCA 1FNMA 2XWQA 1G21B 4U9HS 1FBNA 1G7CA 4A0GA 1E2EA 4IXDA 3RIEA 1A9YA 5A3RA 5CW2A 2Z98A 5IKOA 3I5MA 2VCEA 3Q7IA 4U2KA 3ORHA 4ER3A 1C1YA 3A6LA 3O74A 1EXWA 2NTNA 2PRZA 4L16A 4FFLA 4YH1A 4BE7B 3W5CA 2LVBA 1J23A 1MU0A 3CWCA 2P8SA 2DPLA 2ZBPA 3OCCA 3LFUA 3D6MA 1IEQA 2BJHA 1U3CA 2CNOA 2XXJA 1T9GS 2FUEA 4ZT5A 1I7QB 1NF9A 2ZR9A 3OUZA 1Z2PX 3I6BA 4IQ0A 2NUPB 1DIRA 1W2HA 2EJTA 3KZNA 4LX0A 1PR0A 2VHZA 4B6QA 2VL7A 3F3YA 1N2HA 1QGAA 3WTCA 4AAYA 2HNBA 4GP9A 1P0CA 4KWIA 3RRFA 3U81A 4B46A 2YJGA 2Q6LA 5AIAA 1TA4A 4AKSA 3GOQA 3C1OA 1W6RA 2D62A 2RB5A 1JFRA 3MEQA 5IK2D 1P29A 3PGA1 2O59A 4HQNA 3OSZA 2DR2A 5CEJA 1U0FA 4OXXA 5GONF 4QRDA 2FJUA 4MGKR 2CDCA 3S1AB 4DXAA 2OG2A 2GM9A 1UDCA 3H3XA 3NTLA 3SXPA 3UV6A 5BWLA 5JSZA 3AZOA 1Q2XA 5K6TA 4Q01A 4XQGA 4NFLA 4HDSA 1NYRA 4JHXA 1QDUA 3ZY4A 1CJKC 1QDEA 3UT0A 3VZDA 1WXXA 4GWLA 2BN4A 2W2PA 1J22A 4AJLA 5H3CA 1G3MA 3RANA 1ORIA 2Z08A 3TW4A 2OCXA 1V4NA 3AF3A 4XUCA 5HE9A 5IHPA 4B1FA 4AF8A 4IDPA 4P38A 1GNLA 3RE1A 5BMVF 3RASA 5JVDA 3A27A 4B4KA 1S96A 2EFCB 4JXKA 4MVJI 4R1SA 1E1RD 1MDFA 1QIFA 1OA0A 3MUFA 1G7SA 1HE3A 2YVAA 3IBFA 1D0SA 3NZEA 1G5FA 1EQ2A 3OT1A 1DKRA 1QM5A 2XTNA 2OSBA 4NS4A 3X1KA 3N2KA 2NV2B 2F3UA 4WCFA 2FSFA 2E3JA 2FY8A 4M89A 3BIOA 4GYWA 3FF1A 4OYHA 2XA2A 2HCBA 2TYSB 2VKQA 3JASB 4WN9A 4DWOA 4X66B 1CQZA 3G0CA 5E0KB 1FX0B 5J2TF 4KXLA 4JT4A 1U7XA 1M2JA 1KBZA 1BMDA 1JG7A 4L72A 4D8TA 5AXAA 4DQUA 2I22A 3IVMA 2P1DA 4IOJA 1M8GA 1RLOA 3QX9A 3EEOA 1TM2A 2DAPA 3OEHA 4KAAA 4R7TA 1XZQA 4RSHA 5CXSA 1E2PA 2EQAA 1YVUA 2P69A 3IE2A 3KYDA 5BNWA 4PLCA 3ZU5A 1T0PA 1XQYA 2GVDC 2I1WA 1AK2A 5HCNA 4LJSA 3FOCA 4BZWA 1IPHA 1X14A 1XU7A 4QGFA 3CIFA 2FI1A 1NBAA 2GPYA 2PSDA 3PT9A 4F2DA 3NDIA 3GJ7A 1VJRA 2BZ0A 4WESB 3UJNA 2CLOB 1WY7A 3U3KA 1ESCA 5DP2A 4U00A 4U7HA 5K6RA 2O1XA 3OD5A 3ZHOA 3B13B 3G2QA 1J2YA 3LPMA 3RARA 3REGA 1NNUA 3B12A 3PCTA 4LRXA 3RUHA 4B6EA 3ITKA 1BCSB 2OHXA 3QE2A 1JF8A 3VISA 2IHYA 3NRJA 1G5RA 1ZUHA 3C24A 2WTBA 1E62A 1EWKA 2G0TA 2P27A 2QY9A 3DVLA 3GAZA 3PXDA 3WGMA 4B84A 2ZRLA 1RXUA 2C1XA 3CLTD 3L8MA 3UUFA 3NPMA 4V0LA 2Q4RA 2QL9A 4AYWA 3ZEAA 3EDRA 3CW2A 1L5KA 2KLBA 3S29A 2YH2A 3M49A 1UUFA 2W00A 1TK3A 4M1ZA 3M4JA 3NP9A 1YB5A 4I2NA 3RUPA 3N0WA 3S27A 3HVRA 3AZPA 3BXEA 4DMMA 4PIPA 5BN1A 4XAQA 5KYTA 4TZTA 2YKGA 1N6PA 3EUAA 3IDFA 1ONOA 3P2IA 3TLZA 3TLYA 4S1OA 3ZV3A 2PX4A 4PXSA 5FPPA 3D4LA 2X0IA 3TM5A 1SCDA 2HA6A 3HCBA 3OCJA 3CCCA 1AKQA 3K8QA 2Z1MA 1U2RA 2CNWD 4WAUA 2PA0A 1JKFA 1KO8A 4J4HA 4PHFA 4LE2A 5CJPA 4BLPA 4QXMA 1E5VA 2A9VA 4I5GA 3ROZA 3DPUA 2QM0A 1YOVB 3GP3A 4MJ7A 4QPZA 3QNUA 3STYA 2GCIA 4DEXA 4NU8X 3D8BA 1X39A 1CEXA 3PI7A 2GUGA 4W7HA 4YQZA 1X70A 3GRCA 1ZC4A 5CRIA 1KFBB 2J5BA 3DMTC 3HY3A 2JLRA 1AG9A 4FWIB 1N7JA 1QYIA 5KVQA 4CT4B 3SWWA 2VJMA 1KQGA 1CRWG 3ZK9A 2AS0A 2HMTA 3BG5A 2FPSA 1J24A 3GRYA 4NJOA 4YT2A 1ZJ5A 1KK3A 4ZZIA 4BX0A 5E1BA 1IEVA 1ZKDA 1MOPA 3COSA 1D6MA 2ECQA 3SZRA 4MW1A 2VJCA 2DECA 1BWRA 1VJCA 1ZIPA 5JAMA 1WKBA 2YFQA 1QO7A 2BMEA 3PKIA 4BAZA 5AIBA 2XB2A 3DPIA 3WIBA 4CMEC 1ELOA 2QL6A 5BXYA 3Q3HA 2CEAA 4H1UA 4YRLA 2I62A 5KUTA 5DWDA 2IYOA 4RZQA 4YLYA 1VJ1A 1A7KA 2GKOA 3INGA 1IWPB 1C9NA 2JANA 4LMRA 5FUQA 3F4KA 5ALMA 3R6WA 1YRBA 2F3PA 1OFVA 2WYVA 1GPUA 3PPVA 3FWPA 4PO1A 4AB1A 5B57C 4QOSA 4U7TB 4I1VA 5DCLA 4Y2PA 1KQ3A 1LRKA 1KI8A 2I55A 2IEYA 2IXBA 3VC1A 1QFYA 1SXIA 2PKQP 3TIIA 4F6CA 2Y1KA 1Q77A 2C0QA 2PZKA 4Z4EA 3N2YA 3QLVC 1CULC 1G63A 2HN9A 2QRVA 3FSEA 4B71A 3IJPA 3R3YA 4Z53A 4MMYB 4RMNA 2ZYUX 4FXOA 3CF2A 4QUHA 5DMHA 5ALLA 4U02A 3HYNA 3V48A 3T9CA 2PZFA 4C6TB 2A4KA 1Q44A 1JU3A 1I0ZA 1IHPA 4D3SA 1R9JA 4UUPA 4UHFA 3NHMA 4DIDA 3ZVMA 3WNCA 3DTVD 1W581 2HCJB 4G1CA 4IDBA 5CD9A 2VJLA 3BX1A 3V97A 1C8LA 3HU3A 4ZVVA 1P80A 3NR2A 4G6ZA 2QX9A 3TIFA 4JB0A 1ZX1A 3D59A 4BFCA 1XZ8A 3HEAA 4GXRA 5DI9A 3IVAA 3ZY3A 2XF2A 4Q34A 1RYEA 4TKZA 1NXXA 4WOKA 2QPLA 3DBHB 2PU7A 2YY6A 3C7KA 1PT6A 2HNKA 5TQJA 1ZAKA 2C94A 2GESA 3BXOA 3ZW8A 1U9JA 4H0NA 3SVLA 4YROA 4HDMA 1Q0HA 4Q1EA 2YHUA 5SZIA 3UT5A 1XRQA 3OKPA 2OZKA 2GZRA 1NE7A 1IN7A 3QXJA 3E2IA 3BORA 3HV0A 3K9FC 4P1ZA 2VQSA 4QG3A 1N2JA 1XXLA 2OHIA 3A6DA 4KE6A 3EPJA 2N46A 4GQAA 1OXKB 2IYLD 2PX6A 4BP8A 4YCLA 4L50A 4ZICA 1JWLA 3EZXA 3HDYA 1AVTA 1RBQA 1AQLA 1X1EA 4MLZA 4PQFA 4XTRA 4J16C 3LUHA 5EIXA 2ZPUA 3UBTA 2AOWA 4FYHA 2JLVA 3MILA 1SC1A 4LSMA 5K8TA 1W36D 1TIPA 4O29A 1OAOC 3KEFA 1XXHE 3CNHA 4UHDA 3SFTA 2W2QA 3VAAA 2PS0A 2XGJA 4ILKA 2Z2YA 3HZHA 3PQ2A 3G1WA 1QS0A 1AB6A 3IUNA 3W2GA 3FTFA 2Q6VA 3DMPA 2AL7A 4ZVPA 4PN3A 4GM4A 1DBSA 3N8HA 3N39C 4FZJA 1DE0A 3G5MA 1XDWA 3VZRA 3ZGZA 5IW8A 4FT4A 4WTOA 3AY3A 1RBZA 3VTFA 1V8PA 1BX3A 3UWDA 5FBZA 1W93A 2V5VA 5FLKA 1EXNA 3G2JA 3KSZO 3I9NA 4NYIQ 1ZMRA 2HTEA 2XX3A 4JFAA 1X19A 2JDIA 3A58B 8AT1A 3WV5A 4V1CB 4Q4CA 1REQB 1ZRNA 2ZULA 3BD6A 3EG9B 3WB2A 1AMOA 3A1WA 3RTGA 4CHTA 1VE9A 1CUWA 3EOBI 2LGJA 3GIWA 3K9HA 4FOSA 3V5NA 2PSSA 2C3UA 2WUEA 1EGMB 4Z3OA 4RJTA 3M5CA 5KIAA 2R00A 1KMHB 1FFGA 1PG5A 2WSIA 4UEOA 3B51X 3OLQA 4OQLA 8MHTA 5U4QA 1J5PA 1OLUB 4RIFA 2GZSA 4UOQA 2VYCA 3PGVA 3PNSA 1FDRA 3KXKA 3ZCRA 4P4NA 3ZDCA 1LU9A 5K0CA 5KYVA 5AXCA 4XRGA 1AGRA 3BRWD 1HDIA 1IXRC 1VZ2A 2FKNA 4JB2A 1PJTA 4JLKA 4NJMA 5ARDA 4BE9A 5FPKA 2R6GA 3UPUA 5TT0A 1FW6A 4BNLA 3OKCA 2PMCA 1TQ2A 2DQYA 2DQSA 5DSXA 1V1JA 2OBNA 1GG8A 1K7FB 1DKOA 4PX2A 1PLKA 3OX3A 4DM3A 2OT3B 4XH9B 4TXJA 1W1WA 4DREA 4TV8A 2PSFA 2Q2VA 5AKHA 2R6ZA 4F7WA 2ZBDA 4NY1A 3RVQA 4FFMA 1RCFA 1EK1A 1F5SA 1SVKA 5F5NA 4XJTA 3CZCA 1I3NA 4EYQA 5BWMA 3MELA 3U4MA 2P6RA 4PCAA 4K87A 3RFUA 1ORDA 4MULA 2D54A 2OILA 4YAOA 3RAPR 1VM6A 4KGZA 1GTSA 1J8FA 2QV0A 3RC1A 4LCEA 4Q47A 2VT2A 2GILA 3ROFA 5IC4A 4KR7A 3H17A 4MAMA 3ZCTA 2HV9A 3CHYA 2RIPA 1T3SA 4I1PA 2AI1A 3PJGA 1E77A 2AVDA 4I0WB 2H7VA 2RDMA 4RD3A 4FFSA 4POOA 1PLJA 2MCFA 2I8AA 2VSOA 3CPSA 5BW5A 3HJFA 3ETEA 1YE8A 1A88A 3VHXA 3JQ8B 3WG9A 1JZTA 3IQZA 4F12A 5DVZA 3BMQA 3Q7PA 4PRYA 4Y6RA 2IHUA 5FO0A 4BYMA 3FUTA 4L9SA 5KVSA 1XTTA 2AWNA 4C07A 4MRMB 2CXNA 3LC0A 3JD3A 2BDTA 3D5TA 5CDFE 3D3NA 4FW9A 2GN2A 2CMFA 1USGA 2PT7A 1NQAO 3UWPA 3Q0TA 1WB5A 5T6BA 4EY4A 5C37A 1DFGA 1N7IA 1VE1A 5FOWA 3U0VA 1TVEA 1FS6A 3N87A 4I4TF 3CISA 3OLYA 3UICA 4IMIB 3BRWA 2P1ZA 4YJFA 3D5QA 4E88A 5HXAA 4PRZA 4DKXA 4L15A 5LKRA 1PTJA 3PHJA 1E8MA 1R3UA 1UMBB 5LQCA 3H9BA 1U0EA 2QN3A 4MYSA 3FJ1A 4YJHB 4DMGA 5IZCC 3U17A 3O82A 4IVRA 1ZAYA 4PX9A 2PUAA 1KSHA 4R41A 2FUG1 1KQOA 3IAHA 3MWEB 5LUBA 4AS2A 4B3FX 2BLNA 1JNXX 4GLJA 3WFJA 5JMPA 4UNSA 2YZ7A 1X38A 4IEEA 3IAM1 2QMEA 3TMKA 1LUAA 4JOQA 5CPFA 5GOTA 2OLJA 4B43A 2OCGA 1U0TA 1EG2A 2M6RA 3DHEA 4MWBA 3AJ9A 1Y9DA 2GXSA 3F98A 3RW9A 1BGXT 2Z09A 2FF5A 4LNHA 5ESDA 1WPRA 2XGSA 4BJ6A 5DMXA 2WU1A 3OURA 1XEAA 2HJGA 1L5LA 1W5SA 2I80A 2F1JA 2WIJA 3FG9A 4JQOA 3AWIA 1JBKA 1E9SA 3E9QA 2OGTA 3FHOA 5EPUA 1RJGA 3AOEA 4QIHA 1X1QA 3UA3A 3GZNA 4JBXA 5E2IA 2UZ1A 3BF8A 2OEPA 4EHIA 1SCUA 2GJ8A 3L02A 3I5XA 1DV1A 2EYQA 2BZSA 1CUIA 4FFBB 4LBWA 1NTOA 2RFLA 4XGIA 3GU3A 4BVEA 5KNLA 1L4LA 2D5CA 4KXWA 1YDFA 1EUYA 4A16A 2X0NA 1BEZA 5T7BA 5HVNA 4ABTA 5HMLA 1YZVA 3X1XA 1GSIA 2FXVA 4C76A 5BYJA 3TLJA 3JQRA 4BO6A 3T7DA 4B2LA 1Z4QA 1HT0A 2X1HA 2ZBRA 3TLXA 1A77A 3E5RA 1VHJA 3W2HA 2HHHB 3ZU3A 4B8WA 1EFPA 3B48A 3C1TA 1UBCA 2DU8A 4HR7A 2XAAA 4UEJA 5FWXA 1CR0A 3FCXA 1GT91 3ZZTA 5HM8A 3DMNA 3H0KA 1TD9A 4JI4B 1BVHA 2G1PA 1DU4A 2ODQA 2OPBA 1X1BA 2HJSA 1G20E 1A82A 4KQEA 4ZYWA 1Z4NA 3RS4A 1FFEA 3DO6A 3TS1A 2FR0A 3ZNQA 3H2ZA 3FPGA 2RIRA 4JITA 2F62A 4PAMA 4QFBA 1RWWA 1S3SA 1DCFA 3DVSX 1HR0B 2AZXA 2X4DA 4R1PA 3IKMB 1U7DA 3EZ7A 5M3BA 1EAYA 3WS7A 2PSHA 4B6JA 1I7SB 3RRMA 1IDOA 3QVWA 1P0QA 3MBIA 3GGPA 4LRTB 2VYND 1XALA 4G9GA 3EWAA 4DNOA 4LMPA 5I7HA 3FFAA 4RIIA 3DJFA 3OX2A 3PQFA 3WWPA 1E1RA 3MS2A 2DKOA 5E6SB 5EFZA 3T3IA 1VSQA 1VA4A 3GFVA 3SQMA 3T7TA 1QG6A 4ZALA 1IU9A 4HAXA 4PAOA 3VC2A 4X00A 2B8WA 4DGQA 3TIGA 4A82A 4GU5A 4YP7A 3TJMA 1OLSA 2ZJ4A 4BEVA 4J0FA 1PUIA 4ZI7A 4PNZA 2D0OB 1ZPDA 2YWBA 1AT1A 3SF8B 2RJNA 2XGGA 3EQ2A 3ZVLA 3QPUA 2PANA 4QHSA 4Y6SA 3ESAA 1QHGA 5FXMA 4W1PA 5L40A 3MTEA 4DUYB 2P75A 2W2VA 2YVQA 1YR9A 1GD1O 3N9IA 4S1PA 4OHWA 3TLCA 3TVYA 5C1BA 1JLRA 2W6MA 4YRDA 1I1HA 3F9RA 2R0QC 1UBLS 3MRTA 3G5AA 1STOA 1YE5A 1PGNA 1TFUA 1U98A 3F6PA 4CM8A 2BJWA 5J1TB 1W36C 4OM8A 4RK4A 1XCGB 1NMZA 2GMWA 5KMGB 1U2GA 3KZ1E 3QXCA 5BQPA 2FPKA 2UVPB 3RIXA 3VH2A 3T3NA 4QDZA 3V1NA 2Q99A 3ZI0A 1FP4B 2CJWB 2SECE 3MZ0A 4QXOA 3VPFA 5LP6C 3VGJA 3HSKA 4XIJA 1G66A 2PWBA 2QTNA 4F2PA 1Z22A 1NJ6A 3N5KA 1YWGO 1UJ6A 2BR4A 1I51A 4KAXA 4LQDA 4B3TB 1RPJA 3MQFA 1AUOA 1JEAA 1NUAA 1P8JA 1WKVA 1Z5ZA 2XUOA 4L27A 5D5QA 2UZAA 5FTMA 3T5DA 3JQ7A 3RKUA 2O9JA 3GHYA 2VK2A 2ZYGA 1JWBB 3DYBA 4Y0NA 1C7IA 5ALYA 1W75A 1JR2A 1B76A 4MUGA 1ZISA 3MOSA 3NAQA 3OTQA 4DLKA 4NMXB 4QNMA 1KDRA 2SICE 4L5YA 5JYDA 1P7CA 4D4KA 1Z56C 3GPLA 3FETA 1YZQA 1MZVA 1V1MB 1RMYA 4MWEA 3X2SA 2F1RA 1O9BA 3P0HA 2UAGA 3NWPA 3T1VA 3TRFA 2AQIA 2GYWA 4LHZA 2UVDA 1FMFA 2AQ8A 1IAVA 3HGQA 2GLXA 4EVQA 3HJNA 3QJGA 2VAVA 3L5OA 2ZATA 4K6FA 2IYNA 2WYIA 1XZLA 2AK3A 1Y1QA 3M6AA 2AOXA 2V7BA 3HWWA 2FAXA 4BV3A 5J47A 3MJEA 4DV6B 4KREA 1Z6AA 4FP9A 4ZKEA 1YD7A 2I9KA 1NI4A 5EP1A 2MSCB 4MQEB 5ALRA 2A86A 5E3JA 2GD6A 3G2IA 5EWLB 2WIKA 2XNDD 1Q5PA 1KDTA 1X94A 1ZD8A 4IKOA 2NWQA 2IYQA 3VI3B 3ZZ1A 3I01A 2EW2A 2ZK7A 4MH0R 4AZ0A 4UFPA 1J5EB 1PZHA 2ZKIA 1X0VA 3BHNA 5E1OA 3H04A 4G5SA 2EJWA 2WU0A 2BM9A 3GXOA 4W7IA 4E94A 3QKTA 2PTHA 2QP4A 2OP1A 2YY5A 3OLXA 3PUZA 3OZCA 3QIAA 4D8WA 4E07A 2WWRA 3VNAA 4YMHA 1Z6TA 3WSTA 4DC0A 1RPTA 1XTVA 2BFCA 3C3JA 2YCBA 2P9HA 3HKCB 3P96A 1AGNA 5SY9A 3QE9Y 1KYZA 4NDAA 1DOZA 2AG6A 3NT5A 4OO3A 1IY0A 5FPYA 5CVUA 1U8ZA 1YIDA 2OOSA 1QH1B 2QYOA 3D31A 4OUKX 3MTBA 4CMHA 1CQWA 4WXRA 3FRIA 1PJRA 1UFKA 4Z0HO 1XJQA 1GCIA 1SKBA 2ZR0A 4RJJA 4HEA1 1VIVA 2WWTA 1NSFA 1X9HA 2BTOA 1L1EA 2GM4A 4GEKA 1V41E 3K9WA 2W90A 4EHDA 1YS4A 3LXXA 3IEPA 3P9RA 2NMVA 3EW7A 3RVKA 3P9YA 3PUYA 5BUQA 4RHUA 4RE5A 1QXSA 1GCGA 1YMQA 1U7WA 2B4KA 4G97A 3LX4A 4X1OA 3FKSA 2IHKA 3JVVA 4JN6B 1M5RA 4TT3D 3I1IA 3AFOA 2XSZD 4ASUD 2H3HA 3AF1A 4OB6A 5IDVA 1Y82A 5E7MA 5ED0A 4OH7A 2WP0A 5JXJA 1KAQA 1N1GA 4OBXA 2IE8A 1Z7BA 3DUFB 3I0NA 4V0RA 2YHIB 3GAMA 4LBYA 5EKDA 1CUGA 1I6LA 5CGQB 2WG2A 3QG5A 2D1FA 5B1EA 1Y8RB 2VPQA 4UEKA 2O4UX 5DFAA 1XLUA 3ROMA 4DSOA 1M2EA 3GG9A 1L3BA 4YJFB 3U7EB 3HDGA 5KYWB 3ESXA 2OCAA 1M74A 3NBXX 4CQLA 3KJIA 2FG5A 1NYTA 5F21A 2RK6A 3RRJA 1Y4SA 3M82A 4BWVA 2JIOA 4DZZA 2XMQA 4D9IA 4PHGA 3KE9A 1BDHA 2FE1A 2Z3ZA 3OZFA 1EE9A 4CEJB 1M3SA 4RANA 1RJFA 3U7HB 1V1RB 2AQKA 1HFKA 4URWR 5AVVA 3GQBB 2JKVA 2R1ZA 1Y42X 1OLXB 4P3XA 3PNLA 3V33A 4KITB 1BE8A 2B20A 2QRQA 1YTLA 3GH3A 1N0VC 4GOLD 5A5VA 3IOCA 3KP1A 5MN4A 3DOHA 4BFVA 1N2OA 2RKOA 3R8FA 3WYEA 4JV5B 2Z6VA 4OXIA 3DBLA 1JDBB 1M1XB 2XMCA 3GGSA 3T4PA 4BWFB 3OE7D 2QX4A 1GA1A 1L3CA 1N5JA 1IBCA 2ZBVA 1YQQA 3ZKWB 3NPAA 2LWIA 1E2GA 3TUZC 4EHKA 1ZW1A 3AESB 3SCZA 1JBEA 4QHTA 1CUVA 4F1WA 5KBYA 2QE7D 4R1NA 4I4LA 1EFTA 1E89A 3WAGA 1OAOA 4YRPA 3EA0A 3OF3A 1HFJA 3GLKA 2VHEA 3T3DA 5EI5A 4XVHA 3WL7A 1KE1A 1FP7A 2FRDA 3F3KA 1E6WA 2BY4A 4K46A 5KX5B 2K2QB 2CD7A 2GJSA 2OKCA 2XH8A 1G3RA 3D54D 4JWKA 5U9CA 4HAWA 1T43A 1LK5A 1GCUA 3UMFA 3LZDA 3OQHA 4D82A 5LQRA 5A62A 4NZNA 1P5ZB 2QPOA 3BE8A 1RI3A 1K68A 1ZIOA 4PAQA 3V32A 1K3FA 3P5BA 4TROA 1VMDA 2C5HA 1DUIA 3VSEA 2MHCA 3FMVA 4AQYB 4RQUA 1N9ZA 3DW3X 3EZFA 1C0KA 3NONA 4CV3A 1EIWA 1G3UA 1JDBC 2WB4A 2R1TB 1MG5A 2J5XA 5CBKA 2V0CA 4V0SA 1WUHS 3BSWA 3D6UA 1C9YA 2LUOA 3GT7A 4KJXA 4WZBA 5DASA 2GYUA 3MC1A 1Y4ZA 2IDMA 4CHGA 1COZA 3H5RA 1YQUA 1IM2A 1NF8A 3EDCA 4KW7A 4UM8B 1II8B 4Y1RA 3F3MA 2XMRA 5EPOA 1DQSA 2PZAA 1LC0A 2J3HA 2P90A 2PSEA 3QKSB 4RV5A 5AKGA 1KKMA 3OFNA 4V03A 4F86A 3HUDA 2A1UA 5CM8B 2CT8A 4ZYYA 1ODKA 3I2GA 4IIVA 4C2TA 1Z12A 3KJEA 2QGNA 3EZYA 3FOBA 2P0EA 1ND6A 2J0UB 3OMWA 3RBAA 4L76A 4GWGA 4WN3A 4NZYA 1THGA 5CDYA 1JHXA 1HFEL 2AI2A 4HGZA 4MQ4A 2EIXA 2NTYC 4A92A 3U48A 4B3CA 1UBJS 1DRWA 1E6UA 3NBKA 3AG5A 3GN2A 5C46F 2K5UA 4LF9B 3EDOA 1BH2A 3LKVA 3M81A 2YNMA 5AJTA 4H7FA 5AYVA 2CV0A 2HZ7A 2LR0A 2DETA 3B7WA 4YP1A 2XZLA 1OREA 4PPNA 3NWJA 1W35A 2EKPA 3TTTA 4TYPA 3LTNC 3GRAA 3EARA 2GVZC 3BC1A 3VVBA 1U65A 3CTMA 3DDNA 4P5EA 2AXPA 1F6DA 1PBTA 4H3SA 4RJIA 3PKZA 2AZTA 3OO0A 1H4QA 3WJ7A 1S9DA 2VRCA 2EIHA 2YNMC 3A9CA 3JQ9C 2VF5X 4DSNA 3JATA 4L4XA 4XLTA 4WOCA 2BYTA 3QXXA 4DUGD 3CGGA 1FFDA 4CMEA 3TSYA 4U63A 3FNFA 4FT2A 4TMYA 3TD2A 1EDDA 1VKZA 2HSGA 3NC4A 4QJBA 1C3XA 2O8CA 4KQJA 3UTDA 2JRLA 1ZD2P 3J81A 3NORA 3G0OA 1PKXA 1Z37A 1I80A 4ES6A 2OG1A 5T3YA 3MCAA 1VP9A 2GKSA 3L4EA 1MRZA 3E82A 3LT4A 4KLCA 5EMJA 1UBFA 2EGGA 1U8UA 3GLRA 4CCSA 4II7A 3DMTA 3HCOA 1P7PA 3O8CA 4S1VA 5DNVA 5I5EA 2Q8PA 2VBCA 1NR1A 2BR5A 1R0WA 4Z1OA 3ACCA 4R9UC 4J29A 4CM4A 1V6SA 3DTTA 9MHTA 3VNSA 1W29A 4GE0A 2G4LA 4R3UC 3LK6A 1IB6A 3F78A 1YC5A 1W59A 2YZGA 1FYEA 3C6ZA 3EAGA 1W5TA 1DAHA 3KPWA 4XB1A 2OP0A 4W5TA 1DJQA 3SZ3A 3AHHA 4ER0A 3BGDA 2AD5A 4M6WB 3H1FA 4P84A 2O8BB 2NO1A 2X0KA 5DNAA 3S8YA 3OY7A 1PZNA 2JGRA 2R85A 3Q4GA 3WGKA 3WO0A 5U1PA 5CJJA 3OFJA 4O1HA 3I04M 1CQPA 1C14A 2FRDC 3GVXA 3CMMA 1DX4A 1CCWA 5LWQA 1VDZA 3NHWA 5JW6A 4D3ZA 4NYMQ 4PGFA 5DXFA 2J31A 5F9HA 3C3EA 4PGGA 4EA7A 3FFTA 5TPZA 1XB2A 5HS6A 2VYNA 2IW3A 3MD0A 2V4UA 2PZJA 2V97A 1MIHA 1TIKA 1R66A 1YDEA 2BFDA 3CS3A 1HC7A 3SR3A 4CM7A 2CJXA 4LDZA 4YJ3A 1TF5A 2YFHA 2NACA 1XZBA 5GM2A 1E18A 3MF4A 1SGWA 1SY7A 4F9GA 2FKAA 3JQGB 4GMKA 5ALWA 2HIMA 3AKYA 3I09A 2ICAA 2GCOB 2FDXA 1HV8A 2EL7A 1PFGA 1FYDA 2VDLB 3KDPA 4RA6B 4TVKA 2R7MA 3WXMA 3O8OA 3LC1O 3RWMB 5F5LA 2BFPA 4M9XA 1DOAA 2H4JA 2YMQA 4JODA 4WLEA 2FLKA 3O21A 3UEOA 2MDTA 3E0QA 5FLYA 3EUFA 3U40A 4PHTA 3X1WA 1JE0A 1B43A 3OQBA 2GRUA 2WJHA 4QDXA 4U2GA 4TM8A 3A8TA 4EQ6B 3FMPB 1N57A 1PVVA 2XB9A 4P22A 5JISA 1YFZA 1LEHA 1UM8A 4NFHA 4EUSA 2VBFA 421PA 1QR2A 2J9ZB 3S1AA 1MRNA 1C7FA 5B7PA 3RUCA 3E7PA 5JZMA 3M6IA 5AVOA 2D1SA 2FZEA 3A04A 3TRIA 5CG1A 5HG0A 3O3CA 3LL7A 5PGMA 1RDFA 2I1LA 2YYZA 2FX2A 2J9XB 2O1EA 3GJZA 5AK3A 5E8RA 1DKLA 1AKUA 1X92A 2D0DA 4G3XA 1WMFA 2X5JO 4MDYA 2G76A 1LFAA 1YL5A 4M9RA 3OHPA 4UAUA 4TL9A 3FVWA 4EVIA 1F17A 3CY6A 2D1QA 5KNCH 2M98A 4C87A 1MGPA 4BO0A 3TTUA 1ZGBA 3RRZA 1BJRE 5GZ1A 2NT4A 1XXHB 2HK7A 2ZEJA 3CJRA 4OP3A 2JPDA 5CP8A 4BS9A 1P7ZA 3TW6A 2EQ5A 3OQIB 3UWOA 2P5SA 1ENPA 5T5QA 5A4MS 1JQ5A 4J1TC 2JCSA 3PUXA 3P5SA 2WZBA 2CXOA 1W4AA 2FZWA 4R81A 1KSJA 5CM9C 3ASYA 1GQSA 3ZG6A 2BONA 2E82A 3R5FA 4PYOA 1N3LA 4FCTA 2IOFA 3WX0A 4C5CA 5IN4A 3SVTA 4Q9HA 3OP4A 2QX8A 4CL8A 2C4VA 3N2GA 1KEKA 1JEOA 3H1AA 1N6LA 3QMWA 1RKXA 2W11A 2VSFA 2JA1A 2VC2B 4Z4IA 4MOWA 2Y1DA 1JKJA 1EFVA 1BA3A 3KSRA 4G85A 4CF6A 2QTBA 1ZIDA 3V4VB 3R9WA 1KI1A 5AI0A 5EIHA 3TZLA 4PO8A 2XA9A 5BT9A 1QU2A 2QQEA 1JEQB 3GELA 3BL5A 3REOA 1U7PA 1HSOA 3EXHC 5LQNA 2G40A 2RHRA 3KTDA 4O59O 4Y2QA 4EA8A 1FYXA 3ZDFA 3KFLA 5HUJA 3RVPA 5KHOC 3S70A 4MX8A 2IYYA 4RPIA 1IY9A 3ELBA 4UUAA 5ANRB 3K0FA 3BAFA 4NYMR 4BX9A 4O2LA 2ZIEA 2DUWA 5BMOA 3RODA 4IR7A 4EHAA 2I4MA 4KXQA 4C3UA 3SEFA 3UJ6A 5M7EA 4BE4A 1NPDA 4O63O 1YMVA 1KJZA 4QSMA 4FN4A 4ZQCB 1EK5A 3T9EA 4EO7A 3UV3A 3OCWA 1AV7A 4XVCA 4WQMA 4CQMA 3I8XA 3KX2A 3R7FA 3WGVA 5IKPA 2H1IA 3OLCX 5K3AA 3PWSA 2QE7A 2VG8A 2SNIE 3DE0X 3TNJA 2ZB4A 4X6XA 3VO8A 2CVZA 1DXQA 3EZ9A 1OJLA 2VYVA 5CG2A 1W4RA 2JCYA 5EJ6A 4F4CA 3KAPA 4BNDB 4XR9A 4IIHA 5LBIA 3B5EA 1H2ZA 1B93A 1KGDA 2X9GA 4KP7A 3ZBTA 4P9NA 4BO7A 1IXZA 5BN4B 4Y2VA 2OFWA 4HZGA 3I05A 2RHLA 4QGHA 1X1CA 3DLCA 4IO1A 3HVHA 4UC0A 4TUYA 1SZPA 4GVXA 3E8MA 1XRRA 3L1UA 3NEJA 4GXNA 4P35A 5ERYA 3ZJYA 4CL3A 5C7OO 2PN1A 4MWCA 4JL6A 5D8DA 2ODPA 1G1AA 4A5SA 2XHZA 2N47A 1B2RA 2I2BA 4UVDA 4YDQA 3GLSA 5B1IA 2RGDA 3IPAA 2AE1A 2GH1A 2PAAA 5LP6A 3KWMA 5D5HA 5JPDA 2BC9A 2FCAA 16PKA 1IUOA 3W90A 4E09A 3E7FA 2DXIA 2R8YA 3GDOA 5I9MA 3FA2A 1OBHA 3ME5A 2DTDA 3B60A 2YQ5A 3DGEC 3FFBA 1NUUA 3M2PA 1S89A 4PLWA 2NZVG 3RG8A 4Z51A 4DA8A 4MPJA 3AHJA 4NBTA 3SHOA 4L4ZA 4E2ZA 5AR1A 1ZP6A 3UJAA 4LZAA 4Q4JA 2V6MA 3V4OA 1XTRA 4B3RB 2OHOA 1ULSA 4LCJA 2HQBA 3VGPA 1TLFA 2R6FA 4P5PA 3DT8A 1ND5A 3U9SA 3QXGA 4QUKA 2ZP1A 3R23A 1RJ9A 3R6TA 2A30A 4GZ6A 1MABB 2QF7A 3H5AA 4OXYA 4E31A 5M34A 1EDZA 4TN1A 3U3OA 5GIPE 4P4SA 2P4HX 3BMNB 3REFA 4GI1A 1RBMA 2AUMA 3RC8A 1XNJA 1I4TD 2YNMD 4DCGA 3G3EA 4RHCA 3Q7EA 1JEYA 3ZD6A 4WV3A 4GSLA 5A6SB 3KLPX 1MX5A 3R20A 2Q0XA 1FMCA 1SIOA 4J7AA 3ABZA 5DM70 5BSFA 1P45A 1NGSA 4KQHA 5JTTA 1KZ9A 2ZUCA 1WCV1 3KQLA 5KNCA 4FQ7A 1YIOA 2GEUA 3K1AA 3L92A 4M4SA 4BO8A 3KZVA 1F0PA 4K8OA 2CZQA 2P3SA 3VRHA 3HRKA 4MV6A 3FOWA 3LYLA 5DLYA 4RADA 1FLVA 1RWVA 3ENWA 2O2YA 4YIHA 2GN0A 3K0KA 2PT9A 5CR9A 2PXXA 5LZ5A 2Q3LA 3T3HA 3CVOA 4AO7A 1BYIA 1E2UA 1SEVA 1VE3A 2PYIA 2WDPA 1WDKA 3A4TA 1E9VA 2AI3A 1ZRMA 4JNCA 3WLAA 2O5CA 2PVPA 5BQOA 1M1YA 4GW3A 5JCOC 3BK2A 4XARA 5IH7A 1QDLB 2ZB2A 4MR9A 3SIWA 4UQLA 5IBPA 2XLBA 2V3CC 5DLQC 1D1SA 3CO0S 2MIIA 2EEPA 1RYMA 4ZT7A 1VLZA 4PO3X 2QJOA 2XGMA 2PL9A 1HDOA 2X9VA 2FWNA 2YV3A 2AC7A 3FHCB 2QP9X 1F0KA 4GPTA 2V7VA 4QREA 3IR5A 4HSGA 1NVKA 3BJEA 1MOZA 1EA5A 3N3AC 2Q4DA 4NMLA 2WLTA 4DYVA 2H31A 5MGBA 3M9WA 3QOXA 5C4GB 1ZK3A 4EGJA 2H92A 5TMEA 4IIYA 3IESA 1JHYA 5SY6A 3A26A 3OIUA 4MQMA 2B1JA 4DA9A 4FGJA 4YAIA 4DGSA 1N92A 3E23A 4ETMA 5DHPA 4BCBA 1LDBA 2YWDA 3EMVA 1MPXA 4RD2A 2J9FB 4O2AF 2IUTA 4ND8B 3GEHA 1Z5GA 5LA6F 2C2ZA 1SD5A 2NXWA 3WLQA 2LXNA 2P2CA 3S6JA 3DZ8A 4N3AA 3O0TA 1K7EB 2GEVA 1N6RA 1HLPA 3SS9X 5EE3A 4EPXA 3C1AA 2IA5A 2C3YA 2Y05A 3O4GA 1KEEA 4LFAB 2FQYA 4X3OA 3THXA 4NL4H 4QG7A 4BZXA 5C51B 3O7MA 1RAAA 5CB4F 3ZCQA 4C7KA 5H83A 2A33A 2Q5FA 4JP5A 5BSRA 1SXPA 3NHBA 4BNWA 1T36B 2JNWA 4WOJA 3UY4A 3MMZA 5BOSB 2VRNA 1WU8A 3BMXA 3O8OB 2CV2A 3P2YA 4H17A 2V0GA 1KU6A 2KS6A 4K9OA 3P4YA 1P19A 1D9XA 4CLXA 2HNAA 3AR6A 2GZ3A 1KERA 1E6EA 5JZVA 2EFEB 5E7QA 3T5PA 2IIPA 3GFTA 2OXRA 3ZLBA 4TKVB 4D74A 4X90A 1P1KA 2P3OA 5DBOA 2FPIA 3GGOA 1Z39A 2V3WA 1UXKA 1G0OA 4LJ9A 3I5UA 1PNOA 5GJBA 1TUEA 4KVFA 4C01A 3NUZA 5D6OA 1JZQA 1E7RA 1UZMA 3L8YA 3P9KA 4WDRA 1D1PA 1WXDA 2WNHA 1L5HA 3WRVA 4BAUA 3IIMA 3IEIA 1MFZA 1IMOA 3BN3A 4EITA 1NXOA 1ECCA 1ISFA 4KYIB 3L7YA 1USIA 4QDJA 3VBEA 3A28A 1ZJWA 3NV9A 1C7EA 2E4AA 2G25A 4Q7QA 1WAMA 3LOPA 1AKMA 3GH1A 2XMDA 3OIWA 4MV4A 1WVGA 2JKYA 2DX7A 4NZ9A 5HGXA 5BVGA 2Q0QA 2QGFA 3QG1A 3BKXA 1QO0A 3K9QO 5JC8A 4AJKA 3PHGA 4XOIA 4YN3A 1A7AA 2FWMX 1NW5A 2Z2IA 1J0BA 4DV0B 2VZEA 1W48A 4Q3DA 3U4IA 2ZJAA 2A9FA 4IS3A 4P0PB 4TLMB 1C0IA 2FWAA 3H2BA 3L8CA 4JVOA 4L2IA 4MQ5A 4QUIA 1SZJG 2O1WA 2HJRA 4KIJA 3QPAA 4WOBA 3THOA 3W5HA 3O8LA 3N2GB 1IBSA 4XDHA 1PQ4A 1W4BA 4OQYA 4FGSA 2I29A 4HD8A 2Q1SA 5BORA 4Q19A 5A4AA 2Q28A 3AERB 4JIGA 5AK6A 1XDSA 1BGWA 2IXAA 1ZK4A 3H13A 4OHRA 3G0DA 4R7GA 3SOPA 1EP3B 2BEVA 2PSJA 4YDRA 1JE1A 1EU1A 1CR2A 2C2BA 3CR3C 2FX3A 2JGAA 1H5NA 3K6JA 4RE6A 2ORVA 4M0EA 3MTQA 1WMBA 2G08A 1EHYA 5B3JA 2JGLA 4JSTA 3S0JA 5F77A 1AKVA 4HQ6A 2CJFA 3NHAA 3WVNA 1VYVA 4C7OB 2YJ6A 4HDKB 2ZBUA 3ILXA 1JL3A 1XD8A 1SU7A 3QBJA 4A0QA 1T8RA 1G2IA 4Q1DA 1YCGA 3LT5A 5KYUB 4Y7DA 2ZI9A 2PHZA 3N6XA 4RX1A 2DPMA 4ZI3A 1HE8B 4WZZA 1JA1A 3VNRA 4RKYA 2IUSA 4URVR 3LGSA 3CPJB 4P7FA 4HEA6 3AF5A 1Q7CA 1WS6A 4D92A 1E1KA 2BM8A 2GPNA 1Q57A 4E21A 2YZNA 3G5LA 2UUPA 3N8DA 3FVTA 2FR8A 3MYRA 2W98A 5KYNA 3ZIUA 1XQ1A 4TWZA 2F7SA 2QX7A 4FIDA 1JUDA 1QO0D 5PNTA 2F3QA 2DQZA 1A76A 1OBVA 2RHMA 3GBVA 3HJAA 3A6FA 4D3YA 3OOHA 3JSAA 2R7LA 1FS5A 4I4NA 3BTSA 1IPFA 1CY4A 1SH7A 2PMKA 3G8CA 3RQSA 4I8XA 4O2BF 1I2MA 3PFCA 4R8MA 4C0XA 1JFTA 2YOHA 2IS4A 3QWIA 1D5CA 5K9ZA 2E87A 1O6GA 1QFMA 3UT5B 5A04A 1M34A 2ZRAA 3AF0A 5EJ8A 1GRVA 1U8AA 3EIEA 3KKKA 4QSHA 1VPTA 2H0QA 4MJLA 4E0BA 3EOAI 1IAQA 1G4AE 1ECJA 3DC7A 3K96A 2XE4A 1FDSA 1SNYA 2LIVA 4OP2A 4F6LA 1U9ZA 4DCSA 3K70C 2MJLA 1BWPA 1L8QA 2GN1A 2QJTA 2YYAA 2ZAMA 1R16A 2ZRHA 3E7XA 3ETDA 3FB4A 4LDJA 3RYIB 3WBKA 1AM4D 5KYYB 1I8TA 4J16A 3WDKA 1P9RA 1Q3TA 3AF4A 2Y9PB 1AURA 1IEXA 3MJ4A 3E27A 3OQNA 4K88A 4MLPA 4RY2A 3W78A 4MWTA 4P2BA 1MAVA 2HF7A 3BBLA 2HSWA 4EEKA 2BI8A 1DQZA 1QQAA 2FUKA 4QODA 2A9KA 3UMYA 3H5VA 1Z0AA 4PHHA 2WD9A 2G1JA 1L4UA 4D3XA 2NO0A 3LDHA 2QLMA 3GT3A 2WFAA 1CUJA 1QBKC 4Q15A 4FYIA 4LJ5A 1L7QA 5JNRA 3QFCA 2GX6A 3O1JC 1JT9A 3K9BA 5BYBA 2QZ9A 1N0UA 3LRTA 3NOXA 4HB4A 3OP1A 5FJIA 2HIGA 2BUAA 3M5PA 2J6HA 5HFAA 2B2XA 5TQ2B 1N77A 4D4LA 4MYHA 3AM4A 3RJMA 1C8BA 1C8KA 3FF4A 4LOAA 4D9FA 3IULA 3P2OA 3D7KA 4HX2A 3OPNA 1DBVO 4ARZA 3FZYA 4Z5XA 2H2AA 3V9PA 4LYGA 1KOFA 4ZU6X 3ZHXA 3AU8A 1E6LA 3H5OA 3ER8A 3RK4A 221PA 4KR9A 4OG2A 2C42A 2O8NA 2A8YA 3WLEA 3VR2D 1EVKA 3QMVA 1E9CA 3IALA 5JNLA 1F4LA 1GIAA 3EULA 3S40A 4ZRMA 4EX7A 5IFLA 4M83A 4J0DA 3PKJA 1OX6A 5FFNA 1QYRA 5LN1A 2E4ZA 1RAIA 1DAGA 4GXQA 5FLXA 1A96A 2X5KO 4O4JB 1I4LD 1JXAA 4GXTA 1R8YA 4RUKA 4EJSC 6GPBA 3EVEA 4B4OA 4PTYA 2JAHA 3C7AA 4US1R 2HK6A 5SYMA 1D2NA 1ZZGA 4UAJA 4KR0A 5AM2A 3WA6A 2QLJA 1PT8A 3DNFA 2A5YB 1JHVA 3V2IA 3HU1A 1RYYA 4IGAA 4QTTB 2BGIA 3WYNA 4CG2A 5LMZA 4UVHA 2W71A 2BD0A 2ZTSA 2C9ZA 5EWJA 3LKZA 3QF4A 1SJ9A 1JHRA 1Q0UA 1B4DA 1T35A 4QOEA 5E7IA 1HYEA 2HOQA 3V3TA 3EWSA 2O0JA 2CDRA 2WTMA 4RKFA 5EIFA 4YREA 3MHPA 4DPLA 4GG1A 1V16A 4JJ7A 1I9GA 3U1VA 1RQPA 4FYPA 4CM5A 4IDDA 1UT8A 1MQSA 2B7LA 5LNK6 4LN1A 1YF3A 3AILA 1EM8B 4TRRA 2E4UA 3KTAA 4BVAA 4TLCA 4NCJA 4MW7A 2XQVA 1W6UA 2E1PA 3KR2A 3AU9A 4A15A 4BFWA 1WHTA 1BJKA 5F64A 1LBHA 2OM6A 5B1HA 621PA 3ND9A 4JU9A 4DR2B 1FQKA 1JJFA 4EHHA 1IZ7A 4HRAA 2GF9A 4TS4A 5J63A 3KKEA 4B31A 1IXYA 3TIVA 2ZRKA 2RK4A 5FNVB 2JJ1D 3B9QA 3DB2A 1U3FA 1XTSA 3C16C 2Q3EA 4UFOA 1Z35A 5DM1A 1PNRA 1BU8A 2GZHA 3I5AA 4JDUA 3OF2A 4CKCB 1W88B 4B7AA 5ICMA 1C80A 1UMBA 1JALA 1PFQA 1UJNA 1DQYA 1P17A 1RE0A 1SHKA 1Z8FA 2P9CA 2VWGA 2QW1A 4IINA 4RVGA 4BMOB 2PH3A 1SR8A 3DQPA 3UHFA 1NMSA 4O5OA 1UBGA 1ZNQO 3TLEA 1RW4A 4BASA 1DOHA 3JQDA 4YRKA 5TVKA 3H99A 3K09C 5M29A 1C7RA 3BXZA 4QTUB 5IH3A 1FS4A 2RG1A 2XOXA 4P34A 1L6RA 1T2NA 1YB4A 4QNRA 2TSYB 4UXIA 5DNUA 4X94A 5DGTA 3WQBA 1JTFA 1SQFA 3UXYA 1N0HA 3DE6X 5I51A 2UVQA 2W2LA 1ZI8A 4G5FA 4JGGA 1DZIA 2AMVA 4N03A 5JY1A 2IELA 4YRQA 2RGCA 4DDMA 4PHCA 3VO2A 2ZWMA 3FCYA 3KQQA 1N2EA 3FZQA 3DEFA 4MUAA 3OPXA 1UANA 3V4FA 4PC7A 4TQ9A 2FEOA 3OWXA 3SXUB 2LIPA 3F6SA 5K3EA 5FEMA 1EDBA 4PANA 1UK7A 2ANBA 2CE2X 2WU8A 3OLWA 4CCYB 3PTLA 4EATA 5DW3A 3ABRB 3NYRA 1GDHA 1EVEA 4FC7A 4ZQFA 3ZXXA 4CNQA 3GJ8A 3IBCA 4PSAA 1EJ2A 4RPGA 4MVXA 3GVPA 3IHWA 4D44A 3DEZA 3GOHA 3TH5A 4Y9DA 1DQRA 5ER9A 2Z6QA 3JQAD 1EFPB 2ZJ5A 3AUYA 4PS0A 3UUGA 4MUXA 1QANA 2A59A 4UE3S 5CJ2A 2VTBA 2EF1A 1JDSA 3HJUA 3L6EA 2JGNA 1JLKA 4H31A 4U7DA 3MTJA 1ZDMA 3W5UA 1LSJA 5HTKA 1BD4A 4BLRA 2IV2X 1Y1RA 1H94A 3LVQE 3L7BA 4M0PA 3IL2A 3FM9A 2FRVA 3JPYA 4LXIA 1M2VB 3AEZA 3FDZB 4TVBA 1HX7A 2GNPA 3T9FA 1XFDA 1OXVA 2WTAA 3CNOA 3DQZA 4L74A 4AWBA 1B8PA 5B2FA 1A2KC 3A4IA 1UT6A 2ZJBA 1JNYA 3R6LA 3TDNA 2UZ3A 4HYTA 1MHPA 2CMDA 2OL4A 4RVUA 4YMTA 3W7BA 1OWLA 1O58A 2L18A 4M36A 3VSDA 5GGXA 1U0SY 3D2LA 5CFOA 2RJOA 2AEJA 1T6ZA 2Y1EA 5KOHA 5AM0A 2MINA 2H52A 4ETNA 5HM6A 1XKTA 2CFSA 2JIZA 3ZHTA 1H66A 2C4KA 2ZSUA 1ZMXA 3ICOA 2ZRNA 4GEGA 4BVLA 3NVDA 4YMSA 1FLNA 1L4BA 4OHVA 3LWZA 3FVVA 2OD7A 3GQVA 1A8HA 1J25A 1IXKA 3GF4A 3K0CA 1THZA 3QLJA 5EQTA 3OU6A 4OHZA 4NXNB 3S2EA 3GQBA 2H07A 4I1OA 3DWIA 3NKVA 2IU4A 5ENDA 1MAWA 1VG1A 3H2SA 1CJMA 1BWQA 4BMYA 1V0JA 4PSDA 4F2HA 1E0AA 2DJ5A 3JYLA 4G0MA 1SVUA 2JLXA 2XNHA 1Z8DA 3D7NA 4PXAA 3OT4A 4IFBA 1EHCA 2NO7A 3T0IA 3FSJX 1YUMA 3PFFA 3OOJA 4ABYA 1HM5A 3AINA 4JLPA 1MXFA 3SQNA 2FR1A 4JUBA 5AJYA 2HM7A 2ZUDA 4UM7A 2BL4A 2XTZA 4AIIA 1NNLA 4B09A 1KQPA 3LLUA 4BTLA 5G41A 1JIIA 3HVUA 2EKZA 3RADC 1D2GA 2B1GA 1XR3A 4GYYA 2ANCA 2RH8A 3W77A 3HJBA 4G4SP 2AJCA 4I08A 1IONA 2X8LA 3SC2A 3HN6A 4IH9A 5T64A 3EASA 3OQOA 2XITA 2OO5C 3G8DA 3IT3A 2OCBA 3W2TA 4J03A 4I1YA 4LRUA 1IHYA 4EKYA 4YCAA 1SG0A 4IDGA 3N0RA 4JD5A 3TLMA 2DY0A 4R40A 4WBSA 5K0LA 4GKBA 3SSAA 4IJ6A 2IZ0A 2A4MA 4HZUA 4LYJA 3QVTA 4R6XA 1RMTA 1NW4A 2BMAA 2M1XA 3KT3A 5DHAA 1HKHA 5CA1F 5EJ4A 3AUSA 1R6TA 2J6BA 1U9IC 4C4PA 2ZBGA 4WZBB 5KWJA 3GBSA 3AQIA 3L46A 3M6WA 4M0CA 3AR7A 1J7KA 4IF6A 4NV0A 3BJZA 3DLIA 4X7MA 2E18A 4AKHA 3LECA 5JZSA 1O0BA 4E5DA 1NWCA 3N07A 3E0XA 4PTZA 2C2GA 3VVCA 2XTMA 3CMCO 4C05A 2Z56A 2VHWA 1WIWA 5IJXA 4YMGA 4MCAA 1NXWA 5LZ9A 4CV0A 2FNAA 4IVQA 4F3RA 2YWGA 2D0PB 5JAHA 5LOVB 3KXLA 4HWSA 1I2BA 4OH1A 2JLAA 3PHBE 2DZDA 3K9CA 3ZD7A 2X4GA 4EY8A 1R50A 2Q5OA 1QH8B 2Q4EA 1H2FA 2FN7A 3HLKA 3OUTA 1KETA 4WY8A 3VR3A 4EG1A 1N9KA 5HZKA 1CF4A 3M0EA 4UM5A 2AOVA 3ZXSA 4IL5A 2Q9UA 2GPBA 4OLHA 5TMDA 4WLVA 3KLMX 3LW8A 2H1WA 1O4VA 5D51S 5EJ2A 4B3GA 1UJ2A 2RC6A 3TSAA 3U3ZA 4FNAA 1ISGA 2NUTA 2X0DA 3UJ9A 4UREA 3PHCA 2C8KA 3IT1A 3R2JA 4DBZA 4J7XA 3IXMA 3MNFA 2ZB7A 3FNHA 5A4KA 2VIIA 1J56A 1Y1LA 1K0FA 2BFWA 3CKMA 1EP1B 4JT2A 1AS3A 1ODJA 2ZROA 3VYRB 4DB2A 1BW9B 4JBWA 5JASA 2FWIA 1MA0A 5FBKA 4S12A 4D56A 1JPNA 1JW9B 3EEFA 2ZE5A 4CL2A 5KVVA 1ONPA 2JJYA 3FUCA 5TEVA 3B7GA 3GGCA 1AHPA 3LQQA 3GEIA 4J3JA 1Y1PA 1LVUA 2DHQA 2G4CA 3G8BA 4HOYA 4MUMA 4OFBA 5EZSA 3TTSA 4DARA 3VNUA 5LIPA 4BATA 1KHTA 4DCNA 4LVOA 4YAUA 4P08A 4TQGA 3OCVA 5J2TA 1ULHA 1IQPA 1EUZA 2JGDB 1II0A 1W5AA 3HEBA 1PSDA 1TLTA 3SHTA 2ODNA 2QRGA 3SBEA 1MDBA 1MC5A 2OCLA 3FCAA 4ROTA 1MJGM 1D8TA 1YFKA 2P65A 2XWPA 3GJTA 1D3AA 1MB3A 3IHLA 4TV9B 4OMFG 5CIQA 3VA7A 2ZUFA 3MAGA 2FUCA 1DFHA 3F5SA 4GBJA 3V2GA 2X7XA 3AEKB 3FDIA 4OSPA 4ZCPA 4GYKA 4KH0A 4F2GA 1M72A 5GQSA 1NQTA 1O94D 1UWVA 1XPJA 1RYZA 2QAGC 4Z86A 3R8CA 4AT1A 2FMIA 2Z5FA 3BIJA 3EQ9A 3HP7A 1Z73A 2VZLA 3DDUA 1KNXA 3MVEA 5HQTA 4UPDA 5J43A 1Y6ZA 4I14A 3R24A 1ZOLA 5JCJD 4RF3A 4V3CA 1KMIY 2AOTA 4FYJA 4RXTA 2QOEA 4JL5A 4S0XA 1CE8B 2A0KA 2VNSA 3MXOA 3RROA 3ZHVA 1DX6A 1HFWA 4PYKA 1Z13A 2WIBA 3KYIB 4D9CA 4J9UE 5IANA 3TTWA 5FUMA 1NULA 1YBHA 2I6TA 3V8RA 3CSDA 1WDMA 4AMBA 3DAPA 3HO1A 3FCCA 1TAHA 5A5DA 1I24A 4PZLA 3TQRA 1R37A 3P9IA 1YASA 2UYCA 4G2NA 3A6EA 4GMHA 1EZZA 2IP1A 4GRIA 4H1WA 2OPHA 4EG5A 4DIEA 4Z4GA 3SYMA 2HA4A 2QLFA 3DW1X 4CF7A 1RHJA 3ROPA 3BMOA 4DIKA 2QBYB 3FYCA 4Y8VA 3TAHA 5FNZA 1HRDA 4N7MA 3WLNA 4YAFA 4HDAA 5L3QB 5AQ1A 4LYEA 2C4TA 4Q18A 3L8FA 1FF9A 3ZUPA 4G0VA 1TXGA 5SV2A 3DBLB 2BBOA 1BFKA 1QZUA 4AJJA 4ZAVA 1CB0A 1X1AA 3VU9B 3FPKA 4EHBA 4JT9A 4DJJA 2P7IA 1BXKA 3BVPA 4ESVA 2ZU0C 1KDYA 4BX3A 4RDIA 4Q1VA 2R5WA 4X8HA 1XAJA 2BGGA 3ZWBA 3HJHA 1NR7A 4KN5A 4UPVA 2P79A 4BBZA 4C03A 5E9WA 3WB9A 2OXFA 2I54A 5E6UB 4UUNA 1Z33A 2JFXA 3GNQA 3ADBA 1CS4C 2HT6A 4J43A 1KGSA 4MO9A 2XMGA 3EXAA 2W83A 3RGWS 3WE7A 3PQ6A 5CVCA 4OJMX 1RAHA 2ZSBA 4P4GA 4BV9A 2RSLA 5H4GA 2BM1A 1TAUA 3GP5A 4KE8A 1NXVA 2GBCA 3CZRA 1XDZA 4KPFC 1F2DA 3TKYA 4L5JA 5JJ5A 1PL0A 2C04A 3IDQA 4NAUA 4J3NA 3DMGA 1ADYA 2QSJA 1VFPA 2AFHB 2YN0A 4J2HA 1KNQA 1MV8A 2Z4SA 1MQ8B 1XROA 4R98A 3E18A 3IAUA 1U7TA 4LJ8A 1ULTA 1ZNWA 1CUDA 1RQ2A 3L7JA 3L6OO 2C3PA 4UDNA 3CKYA 3IOMA 2SKCA 2WAOA 4JC4A 3DL4A 1MEEA 3NRBA 4IRMA 2GD1O 3H5NA 4QPNA 1RRKA 1YA4A 1Z4IA 2FLWA 1TUIA 3B20A 4BB9A 4K1XA 1BVYF 1GZ6A 3OJLA 2WHYA 5FR1A 1FXUA 1ODIA 3HDQA 4DRZA 3CLSD 2WFLA 2O23A 3MRVA 3P9SA 1MFPA 4B4VA 1R0ZA 3ORQA 4BQPA 4CCWA 3DLHA 2Q0HA 1ADGA 1RLIA 1V5FA 1DAPA 1JLHA 3NATA 4BBJA 4DA7A 2YVUA 2VAMA 5IMBA 5FUYA 5FX2A 5JDIC 2L82A 2P4QA 1T1IA 1ZK2A 4Y0AA 2P67A 2CHEA 4U7WA 5EUMA 4XLZA 4CV2A 2UU9B 3TRDA 4GX5A 5I4IA 2NTVA 3SKYA 4ZTUB 2R6CA 5GPBA 4I81A 4XDZA 1GJRA 1NY5A 4LBZA 5AJWA 3BM5A 1CS0A 4F04A 4L0DA 1RQGA 4OL0A 4ZRNA 5L6MB 1R0LA 1OFTA 2JFFA 2RI0A 3B1XA 3LX5A 3NDPA 2PJRA 1Y3AA 5DM4A 4DAOA 1GZDA 3GWGA 4JMPA 5EIWA 1ZK0A 7ADHA 3ZEIA 3T0FA 2BGJA 1XMIA 5DOZA 3EG9A 1KS9A 4ZT4A 4EYKA 4GR4A 5DCWA 3GO4A 1Y7LA 2ODBA 5ALDA 3T54A 5AUPB 1BA2A 2QTVA 4A6XA 3IB3A 2BRUC 1Z0JA 1U6JA 2IQIA 3P9PA 1T6YA 4UTXA 4CL0A 6LDHA 3RVMA 2DFVA 3Q1KA 3KOZA 1XRPA 3T1NA 3NJ8A 1GNRA 1UKYA 4U2DA 3ZDQA 4BO2A 1DC8A 2GKGA 1BOFA 1NF3A 2JB9A 2P2NA 2Q5CA 3I04A 5CUQA 5JDCC 1QQTA 1ZOPA 3H16A 2FXIA 4JI5B 3WLHA 3DXXA 2FPWA 2RGYA 4DHEA 2G1KA 3LA8A 3U56A 5T4BA 4U1RA 4BLSA 1OV4A 5LL6P 2ES4A 2VI5A 2XVXA 2A14A 2WV7A 2I4LA 5A4DA 5J9FA 4DCCA 4M9UA 2OQRA 2PXAA 4N7JA 5JTUA 1O87A 1PJ3A 4Q21A 4WK4B 1F2UA 3CZPA 5H4HA 1FUKA 3KOOA 3T4XA 1JFVA 2OO3A 2V96A 1KXJA 3QA3E 5U4XA 2IEAA 4XCVA 4XDYA 1CNFA 1HYHA 1KDPA 2YIJA 4V0ME 1A4XA 4W99A 3B6KA 1A1SA 4M22A 4JI1B 3TR0A 5FA8A 3WLJA 3U1BA 4KAFA 1NW3A 2FP4A 4MVJP 3ZIAD 1UOOA 2A0FA 1M2WA 4HPXB 4BB0A 1SC9A 1GGNA 3L84A 1J9GA 4G37A 4NABA 2WV9A 5FULA 3JRNA 3TL6A 3UJCA 4DJAA 1WBJB 2O7VA 2PYDA 3HZRA 1T9DA 2IC5A 1ICIA 1VL6A 3LPCA 4EHNA 1D2MA 2DPGA 2OAQ1 4EW2A 3S2GA 4YIKA 1U8EA 4V02A 2AT1A 1TEXA 2X1VA 2A5DA 3AMVA 2QYHA 3FPSA 3L41A 5L3ZA 1M9NA 1C50A 4JP3A 4YACA 2BR3A 4QQRA 1JR3D 3KO8A 4WVLA 4WZ6A 4AWXA 2PKQO 1TCUA 4Q4HA 3WNBA 1CSEE 1L2TA 3ENZA 2JLBA 4U9IS 3CSUA 3VHXB 5IJ9B 5J40A 1C1XA 3UBMA 1JT2A 3O8DA 3EEBA 3EIUA 4GPD1 2GD2A 4L6AA 3DE7X 5JMOA 2P5UA 2XKJE 4OQZA 3FYSA 2IU3A 1WPQA 3TRJA 1U3TA 1PX2A 4QPPA 4RGYA 2CSXA 4P3PA 1JAHA 2PGLA 4N0DA 4IDOA 4ZVLA 2IX3A 4Y6LA 4KRFA 1POWA 1CQIB 4NBLA 2D2VA 3HDTA 4I5EA 3JWIA 2PDAA 2ZDHA 3A36A 4FFRA 4C20A 3DDWA 3NHUA 4RV9A 1QIDA 4DDKA 3GLGE 3ZVNA 1QRTA 1GZ3A 1XZKA 2C9DA 2YJ4A 1FC0A 4NG4A 4PF1A 5I7AA 3B2NA 1EZ4A 5KWSA 1KU0A 3E6AA 3OQ6A 5JCJA 3JYHA 1ITZA 2C4WA 1Z6GA 4QGAA 2NUTB 1C41A 2XY4A 4RMGA 5FV4A 3H87A 5BN3B 1B6GA 1N6IA 4DVGA 4LE1A 1HDGO 3A3YA 2LE0A 1KI6B 1C3VA 1T4BA 1YDGA 1C7JA 5CFQA 2IOYA 2IUYA 2PRYA 4W63A 4NPCA 3M5WA 2JVJA 4KK3A 4R1QA 2A5FA 4QBGB 2R1VB 2YJZA 1K5HA 1JEEA 2EV9A 1P18A 4KN6A 5TR9A 1CRLA 5DV9A 4KXFB 3QPCA 4BQIA 2J30A 3OCUA 5IYZA 3KEMA 3O47A 2V55B 2F43A 4H4DA 4IQGA 2BH2A 4KQ9A 4WDQA 2AOUB 4K9NA 2JLWA 4HFNA 5GTDA 2ZSIA 1OXSC 4HJRA 2Y1FA 1C3OA 1S6YA 3LVRE 1FFHA 4XJXA 5HDBB 3GA5A 1XCOA 2ZRQA 3BB3A 1NBOA 3LBAA 4G36A 4IIBA 4JWTA 2WT8A 1NXPA 3PDCA 3VVMA 4P36A 2WWWA 4KK4A 3HXQA 3U16A 1QOPB 1LNQA 2H51A 3CG0A 1AUXA 3JD0A 2XRFA 1GNVA 2LCFA 3BSFA 4C0BA 3PNPA 3UJ8A 4Z1MD 3ZLJA 2WHPB 1GADO 1F0NA 1JJBA 1H42A 4HN9A 3TN7A 3LO5A 1TM4E 4QRHA 3URMA 4N3BA 4YMIA 3U44B 4P3KA 1YI1A 4U8GA 4XJSA 5CVJA 3VBCA 1KRXA 2IUEA 1UL1X 1Z0UA 2VSNA 1TZ2A 2AXEA 1DFIA 2KMLA 4I55F 1P4AA 3F7TA 3I72A 3CURA