1Z2FA

Solution structure of cfafp-501
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
121
structure length
121
Chain Sequence
DGTCVNTNSQITANSQCVKSTATNCYIDNSQLVDTSICTRSQYSDANVKKSVTTDCNIDKSQVYLTTCTGSQYNGIYIRSSTTTGTSISGPGCSISTCTITRGVATPAAACKISGCSLSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifreeze Protein Isoform 501
publication title Solution Structure of an Antifreeze Protein CfAFP-501 from Choristoneura fumiferana
pubmed doi rcsb
source organism Choristoneura fumiferana
molecule tags Antifreeze protein
total genus 58
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.20 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Insect antifreeze protein 1z2fA00
3GQ7A 1Z2FA 1M8NA 3SUCA 1L0SA 3GQ9A 1N4IA 3GQAA 1EWWA 3GQ8A
chains in the Genus database with same CATH superfamily
5E3QA 1KK6A 4E6UA 2JF2A 4M98A 3R2WA 5E3PA 3TISA 3OH0A 3OUPA 3DJ4A 4EABA 1SSQA 1HV9A 2OI7A 4E79A 3VBNA 2GGQA 3FSBA 3TV0A 3PMOA 4EA9A 4HCQA 4E75A 1S80A 1T3DA 3D98A 3P47A 4G3SA 1OCXA 1SSTA 1KK5A 2GGOA 1SSMA 3GOSA 4N6BA 1V3WA 3SPTA 3VBJA 3BFPA 3HJJA 4MFGA 3OH1A 1QQ0A 2WLDA 1V67A 3IGJA 1HM8A 1MR7A 2QIAA 4R7PA 2WLEA 2NPOA 3DHOA 4M9CA 5F42A 4HURA 1N4IA 4E1KA 1KHRA 1KRRA 4N27A 4AC3A 2QIVX 1EWWA 2OEGA 4H7OA 3KWCA 3R3RA 3OGZA 1XATA 4KNRA 3TWDA 4HUSA 3FTTA 3OH4A 4N69A 4FCEA 3FSXA 3OH2A 3VBIA 1TDTA 1YP2A 1YP3A 3FOQA 3P1BA 1G95A 4K6RA 2OEFA 1QRLA 3R5AA 1KGQA 1LXAA 4IHGA 3D8VA 2VHEA 2WLCA 3GVDA 3OH3A 4MZUA 4EAAA 4E6TA 4KPXA 3BXYA 3FSCA 4G3QA 1MR9A 1KQAA 1Z90A 2V0IA 4M2BA 1KK4A 1XHDA 2W0WA 3R5DA 3I3XA 4J09A 5U2KA 1M8NA 1MRLA 3GUEA 3R5CA 3R3IA 3NZ2A 3IXCA 4KPZA 3EG4A 4EQYA 2RIJA 3OW5A 5DEMA 4J18A 4KNXA 5AFUU 3TDTA 4AA7A 2XATA 3KWEA 4N6AA 1L0SA 3OTZA 3R0SA 3ST8A 3BSSA 4IHFA 5ADXU 1FWYA 3DK5A 3EH0A 3V4EA 4R37A 4EA8A 2VD4A 5AFUV 1HM0A 2FKOA 4DCLA 1THJA 3EEVA 3FS8A 2I5KA 3FSYA 3T57A 3VBLA 4ISXA 4M99A 5L6SA 3BRKX 3C8VA 2IUAA 3VBPA 1FXJA 3R8YA 2W0VA 3SRTA 3VNPA 2WLGA 2Q4JA 3CJ8A 3KWDA 4IHHA 3I3AA 2V0KA 4AAWA 3GQ9A 5E3RA 3GQAA 5DG3A 1KRUA 3VBKA 4MYOA 3GQ7A 1J2ZA 1Z2FA 2OI5A 2ICXA 3Q1XA 4EA7A 2WLFA 3BSYA 3HSQA 3JQYA 4R36A 3F1XA 3MC4A 4G87A 3BSWA 4HZDA 2V0JA 2P2OA 4M28A 2OI6A 2V0LA 3TK8A 4KQLA 1QREA 1QRGA 1QRFA 2AQ9A 3SUCA 3R5BA 3VBMA 2JF3A 4HZCA 2IU8A 5ADXV 2V0HA 4EGGA 2QKXA 1HM9A 4M2AA 1G97A 5DEPA 3FWWA 3TIOA 4G3PA 1QRMA 2IU9A 3OTMA 5L6VA 1KGTA 2ICYA 3ECTA 3R1WA 2IC7A 3MQGA 3MQHA 1YP4A 3OU9A 1KRVA 2TDTA 3GQ8A
chains in the Genus database with same CATH topology
3GQ7A 1Z2FA 1M8NA 1EZGA 3SUCA 1L0SA 3GQ9A 1N4IA 3GQAA 1EWWA 1L1IA 3GQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ7 A;  1Z2F A;  1M8N A;  3SUC A;  1L0S A;  3GQ9 A;  1N4I A;  3GQA A;  1EWW A;  3GQ8 A; 
#chains in the Genus database with same CATH topology
 5E3Q A;  1KK6 A;  4E6U A;  2JF2 A;  4M98 A;  3R2W A;  5E3P A;  3TIS A;  3OH0 A;  3OUP A;  3DJ4 A;  4EAB A;  1SSQ A;  1HV9 A;  2OI7 A;  4E79 A;  3VBN A;  2GGQ A;  3FSB A;  3TV0 A;  3PMO A;  4EA9 A;  4HCQ A;  4E75 A;  1S80 A;  1T3D A;  3D98 A;  3P47 A;  4G3S A;  1OCX A;  1SST A;  1KK5 A;  2GGO A;  1SSM A;  3GOS A;  4N6B A;  1V3W A;  3SPT A;  3VBJ A;  3BFP A;  3HJJ A;  4MFG A;  3OH1 A;  1QQ0 A;  2WLD A;  1V67 A;  3IGJ A;  1HM8 A;  1MR7 A;  2QIA A;  4R7P A;  2WLE A;  2NPO A;  3DHO A;  4M9C A;  5F42 A;  4HUR A;  1N4I A;  4E1K A;  1KHR A;  1KRR A;  4N27 A;  4AC3 A;  2QIV X;  1EWW A;  2OEG A;  4H7O A;  3KWC A;  3R3R A;  3OGZ A;  1XAT A;  4KNR A;  3TWD A;  4HUS A;  3FTT A;  3OH4 A;  4N69 A;  4FCE A;  3FSX A;  3OH2 A;  3VBI A;  1TDT A;  1YP2 A;  1YP3 A;  3FOQ A;  3P1B A;  1G95 A;  4K6R A;  2OEF A;  1QRL A;  3R5A A;  1KGQ A;  1LXA A;  4IHG A;  3D8V A;  2VHE A;  2WLC A;  3GVD A;  3OH3 A;  4MZU A;  4EAA A;  4E6T A;  4KPX A;  3BXY A;  3FSC A;  4G3Q A;  1MR9 A;  1KQA A;  1Z90 A;  2V0I A;  4M2B A;  1KK4 A;  1XHD A;  2W0W A;  3R5D A;  3I3X A;  4J09 A;  5U2K A;  1M8N A;  1MRL A;  3GUE A;  3R5C A;  3R3I A;  3NZ2 A;  3IXC A;  4KPZ A;  3EG4 A;  4EQY A;  2RIJ A;  3OW5 A;  5DEM A;  4J18 A;  4KNX A;  5AFU U;  3TDT A;  4AA7 A;  2XAT A;  3KWE A;  4N6A A;  1L0S A;  3OTZ A;  3R0S A;  3ST8 A;  3BSS A;  4IHF A;  5ADX U;  1FWY A;  3DK5 A;  3EH0 A;  3V4E A;  4R37 A;  4EA8 A;  2VD4 A;  5AFU V;  1HM0 A;  2FKO A;  4DCL A;  1THJ A;  3EEV A;  3FS8 A;  2I5K A;  3FSY A;  3T57 A;  3VBL A;  4ISX A;  4M99 A;  5L6S A;  3BRK X;  3C8V A;  2IUA A;  3VBP A;  1FXJ A;  3R8Y A;  2W0V A;  3SRT A;  3VNP A;  2WLG A;  2Q4J A;  3CJ8 A;  3KWD A;  4IHH A;  3I3A A;  2V0K A;  4AAW A;  3GQ9 A;  5E3R A;  3GQA A;  5DG3 A;  1KRU A;  3VBK A;  4MYO A;  3GQ7 A;  1J2Z A;  1Z2F A;  2OI5 A;  2ICX A;  3Q1X A;  4EA7 A;  2WLF A;  3BSY A;  3HSQ A;  3JQY A;  4R36 A;  3F1X A;  3MC4 A;  4G87 A;  3BSW A;  4HZD A;  2V0J A;  2P2O A;  4M28 A;  2OI6 A;  2V0L A;  3TK8 A;  4KQL A;  1QRE A;  1QRG A;  1QRF A;  2AQ9 A;  3SUC A;  3R5B A;  3VBM A;  2JF3 A;  4HZC A;  2IU8 A;  5ADX V;  2V0H A;  4EGG A;  2QKX A;  1HM9 A;  4M2A A;  1G97 A;  5DEP A;  3FWW A;  3TIO A;  4G3P A;  1QRM A;  2IU9 A;  3OTM A;  5L6V A;  1KGT A;  2ICY A;  3ECT A;  3R1W A;  2IC7 A;  3MQG A;  3MQH A;  1YP4 A;  3OU9 A;  1KRV A;  2TDT A;  3GQ8 A; 
#chains in the Genus database with same CATH homology
 3GQ7 A;  1Z2F A;  1M8N A;  1EZG A;  3SUC A;  1L0S A;  3GQ9 A;  1N4I A;  3GQA A;  1EWW A;  1L1I A;  3GQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...