1Z2MA

Crystal structure of isg15, the interferon-induced ubiquitin cross reactive protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
152
structure length
152
Chain Sequence
WDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKSDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Interferon-induced Ubiquitin-like Protein ISG15.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords interferon, alpha-inducible protein (clone IFI-15K)
total genus 35
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1z2mA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1z2mA01
2CR5A 2CHZA 2KLCA 4ZDVA 1TBEA 1WE6A 1WJUA 2BWES 3IG3A 3N3KB 4MSMB 3H1UA 4PS3A 2CU1A 1TGZB 2AWTA 2PE9A 3PLUA 2JXXA 2MWSB 3UF8A 1UH6A 1WJ6A 2KJHB 2LI5A 2ZVNA 2ZVOA 4K7WA 4WAAA 1OGWA 4K81A 2I1JA 4YL8A 3ZLZA 3A1QB 2KQSA 3N32A 2MRPA 2AEHA 3U8ZA 1RRBA 3V6CB 5J2RA 2LGXA 4FN2A 2IY1B 1UGMA 2JWZA 1E7UA 2V3SA 3ZTDA 3IHPC 4LDTB 2KWUB 1C1YB 3L10B 3BY4B 1E5WA 1WR6E 3B0AA 3PRMB 2RGFA 2D3GA 2DZMA 2R2QA 1WMHA 4JL9A 1LXDA 4BFRA 2LUEA 3RZFA 2KKCA 5LXHA 2J0JA 3NS8A 5CHFA 5C23A 2C7HA 4MEMA 3SD5A 4M8MA 3H7PA 4DHZE 2PJHA 1V49A 1WGDA 4GIVA 3KUZA 2KX0A 1L2NA 2KMAA 3AU4A 3TCAA 4M0WB 3H6NA 2AYOB 3ZRFA 3IFWB 3A9JA 4FJYA 3VTWA 3PT2B 4GDLB 5J17A 3ZNGC 2L76A 2L8JA 3HM3A 1Q0WB 4W9JA 3PREA 1RFAA 2B3AA 4GN1A 2AL3A 2N4FA 3KUDB 1SE9A 3H9DA 3L54A 1K8RB 1YX5B 4HXDA 3ZTCA 4IM2A 2A4ZA 2DZKA 2HTHA 3IBEA 2JZZA 2DX5B 1WX9A 2KK8A 4ANUA 3NOBA 4MGIE 2LVOA 1Z2MA 3TMPB 4GXBA 1ZGUB 1IPGA 3DVGY 3U30A 2LGYA 1V9JA 2MX2A 3DDCB 5DPWA 4TQ1A 4MDKE 3ZNZB 2K1FA 4AUQC 4W9GA 1YIWA 2IO3B 3OJ4B 3L17A 2LWPA 2KO3A 1WZ0A 2DZJA 3AULA 2KOXA 1WIAA 4WJPA 2KC2A 3PZDA 2BGFA 2DZIA 1SGHA 1RLFA 1V86A 2IZVB 4XZ4A 4EOYA 2MW5A 4WWNA 1VD2A 3QA8A 4GDKA 3BINA 3C0RB 3P2BA 2OJRA 3HIZA 3JW0X 4MSQB 2KD0A 3A9KA 3L16A 2MBBB 3CMMB 3ZW3A 4W9DA 2C9WB 1M94A 4TUUA 3CSFA 4JLCA 3EHVA 3UIPB 5C1ZA 3PRPB 3KYDD 3B08A 2MLBA 4DBGA 1WGRA 4W9LA 4G50A 2DYMA 2MP2B 2XEWA 3RT3B 5IA7A 1XQQA 1IYFA 2D2QA 2V4LA 3B1LX 4GMVA 4ZYNA 2MSED 2FCMA 2K8BA 1ISNA 4W9IA 2ZPNA 2ZNVC 4BKSD 1C3TA 3L08A 1WJNA 1ZKHA 1WRDB 4KIKA 3VFKA 3ALBA 2BYEA 2ZJDA 2L00B 4FULA 2FIDA 1YX6B 4ZRJA 2KDIA 2ZPYA 1LFDA 2L0TA 4NJ7A 1D3ZA 1BT0A 1V6EA 1VCBA 4P7IA 5KHQA 2KZRA 1P1AA 3RZWC 4GOCA 3QARA 4WJOA 1X1MA 4B6WA 4CO7A 3WANA 2ZCCA 4LJPB 2YVCA 4HK2A 3EFUA 2ZNVB 1OQYA 4A3OA 1WXSA 2JPHA 3H7PB 5AZFA 2KLGA 4K7SA 3SU8X 5G2NA 4E74A 2RR9A 1WYWB 1S1QB 2DYBA 3M62B 4EFOA 3APFA 4WWPA 3ZDMC 4MJSA 4AJYB 1GJZA 4HDOA 3PV1A 1HE8A 2L05A 1T0YA 2IO1B 3V62A 4DK5A 5J18A 4MGYE 2RPQA 1YJ1A 2M1MA 4HJKA 4HPMB 2AL6A 4OVUA 1WE7A 1LQBA 1WGHA 4OVVA 1WY8A 4HWIB 2PPHA 3TJPA 3RULA 4URKA 2I1KA 2MBOA 3DQVA 3ZDTA 4ANXA 4A20A 2K8CA 3T9LA 3NZUA 1Y8RC 1KM7A 3VVWB 2FNJB 4NQLB 2FCSA 5L83A 3KH0A 1NBFC 4DHJB 2N1WA 2R2OA 2KANA 4ICUA 4NY0A 3X23A 1WGYA 4GDKB 1NI2A 4KIKB 3R7RA 2ZZPB 2BPSA 2D10A 3A33B 3M95A 3ZRCA 4BBNC 2QHOA 3APCA 3I3TB 5IAAC 3V61A 3QJZA 3TBLD 3JYUA 1FXTB 2G3QB 3Q3JA 3N30A 2PE6B 5GMVA 2O2VB 3LJ3A 3A9JB 3VUWA 5AZGA 4CYEA 2EMSA 3X0WA 2KFKA 1OEYA 3A4RA 2LRWA 2Z0DB 4G11A 4J6IA 4NPNA 3CF6E 4HCPB 3VUXA 2FCQA 2KC1A 2LJ5A 1EF1A 1U4AA 1KOTA 3DVNU 3W1YA 4WWOA 2WDTB 5JHBA 4BBNF 1UZXB 4EEWA 4II2B 4JQWC 1SIFA 2Z59B 4N9F4 4PS7A 3K9PB 2W9NA 2C7MB 3KYCD 2N7DA 3DVNV 2JVCA 1UD7A 2KX3A 1I42A 1XT9B 1I35A 2KQ7A 4BOSC 2C5LC 2FAZA 2IBIB 2BKFA 2JUOA 4M8NA 2CKHB 2KWVB 4FJVB 4RMAA 3VHTC 5E6PA 2KDBA 1GUAB 1S3SG 4EKUA 2KNBA 3A4SC 4W9FA 4ZRKA 2KDEB 3HK0A 2C60A 3JSVA 2MQJA 1UBQA 4WQOB 4IG7B 3PS6A 2LVQA 1J8CA 4XX5A 3DBSA 4GU2A 5AEKB 3ZIMA 3QWZB 2K25A 4W9KA 2CHXA 4FADA 3V6EB 3ZO5B 3WAMA 3OJ3A 2MP2A 1LM8B 2WYQA 1Q5WB 3EC8A 2NBWB 4AJWA 3M63B 4HLEA 5BO4B 2KDFB 4I6LB 1KJTA 1WZ3A 2D11A 4X57B 5DCNA 1KLVA 4ASWC 1EO6A 1OTRB 4DDID 2FUHB 3AI5A 3VTUA 4AP4C 2IY0B 1GC7A 3MHSD 1E90A 3H7SA 2UWQA 4B95A 2FIFA 2RSUA 1WH3A 3VH4B 4IWQA 4MJSB 2JZ3B 2LZ6A 3PHWB 4DHJD 3A9KB 5DPSA 2K6QA 2M8SA 2KWCA 4IW0A 2KFJA 1NDDA 4HDQA 4KV2A 1WI0A 2HD5B 5D6JB 5JH5C 3L0WB 1V2YA 1MG8A 2O6VA 1R4NI 1R4MI 2HE7A 2VRRB 1OEYJ 3RD2A 5CTRC 5LLIA 4G3XB 4B9KA 4TQ0A 2XK5B 1P3QU 4RM9A 1AARA 2K39A 2GOWA 3R7QA 1E8WA 1WXVA 2KN5A 1E8XA 5CHWA 3UIOB 2XBBC 5CHVC 4BOZB 2JT4B 3GZNI 4I6PA 2N9PC 2ZCBA 3S2AA 2KHWB 4NNJB 3ONSA 5JHAA 2O2VA 1WXAA 2N7EA 1J0GA 4KDIC 1TZ1A 4FHKA 1Q1OA 3DOWA 3WAOA 4E3CA 2JF5A 1ZW7A 5TR5A 5HKHA 3KVFB 3DBRI 3UGBB 5G55A 4IC7B 3W1SA 4IWOA 2GBRA 3A1QA 3K9OB 1L7YA 3QAQA 3EECA 4GGQA 4EZKA 1EF5A 2GBJA 4F1SA 3LDZE 2K8HA 2KJRA 3UQBA 2YLMA 3DCGA 2BKRB 3QK0A 4NAWA 2WWZA 3UINB 4DDGD 4LDTD 2IO2B 2KMCA 4DXAB 4AOFA 2JRHA 2J7QB 2NPTB 3APDA 4KZCA 3QC8B 2GBKA 2NS5A 3VTVA 4JGHB 2KJ6A 2RD0A 1JRUA 3JSVB 2LGDA 2MBHA 4ZRIA 3UQAA 4FBJB 4IM0A 2JY6A 3ENEA 2ASQA 2L3ZA 5L95C 2KTFA 3ML8A 1RAXA 3NHEB 1TTNA 2EKEC 3AU5A 3NZSA 3RUIB 4K1RB 1UELA 1WX8A 2M4NA 3VDZA 3PHXB 4BKSA 2G45B 4E71A 2D07B 2Z0EB 2KFKB 2WX0A 2GMIC 2BWFA 1XD3B 2LVPA 2REXA 4CHKA 4FJZA 1YD8U 2GBNA 1E7VA 4HVBA 5CX3A 3PRZA 2A5UA 4LCDE 4WJNA 4FLHA 1WM2A 3RCZA 3T8MA 1P98A 2KTRA 1V80A 2NCNA 4W9EA 2NR2A 4BKGA 4MH0E 3VUYA 2LXCA 2KVRA 2N9EB 1GG3A 2DHZA 2NBUA 3SDLC 4PYZA 4II3B 4IWPA 1QZEA 1H4RA 4K7UA 5AZHA 2LRUA 4ANVA 2DAJA 2M0XA 2OOBB 5D94A 1A5RA 3CSTA 2XK5A 2NPTA 3WALA 4F7ZA 1F9JA 4ICVA 3JVZX 3V60A 5LXIB 1IP9A 2LASA 2DENB 2MCNB 1G6JA 3NY5A 4MGZE 4IUMB 3DBLI 4GB9A 4BVUC 1H8CA 3VAWA 3QHTA 4HPLB 3WAPA 2JRIB 2IYDB 4GSWA 4F8CB 2DAFA 3VH3B 2DYOA 2FCNA 2LXAA 5DPRA 3PTFC 2J0MA 4AWJA 4MELA 3D32A 2IO0B 1Z5SB 2O6VB 3M3JA 3DPDA 4NQKE 3ECIA 3TIXA 3PSEB 3PGEA 1EUVB 2MA9B 1P0RA 2Y5BB 2O6VD 3IVFA 4JIOU 1E8ZA 4MM3A 3AXCA 2PEAA 3W1SC 3ML9A 4WJQA 1WF9A 5DPTA 2MBEA 3ZVVA 3HM6X 1V5OA 2G4SA 4NAWB 3ZNHB 4TV3A 4ANWA 1V5TA 1PQSA 3KW5B 1WXMA 3VQIA 3VXWA 2N1VA 4RM8A 2G4DB 5E6OA 4KSLC 2K6DB 2NBVB 4KSKC 2CS4A 4A3PA 4KDLB 2L7RA 4NJ6A 3MTNB 5KHOA 4EZLA 3R3MA 1UBIA 4PYUA 1V81A 1WJ4A 1WM3A 2CHWA 2WX1A 3PLVA 2BF8B 4TKNA 3WA0A 3TL5A 4FA6A 3QCAA 4KVGB 2BYVE 4PS8A 2L0FA 3QX1A 3SHQA 4DHZB 4EUTA 4HCNB 3WIMA 4DWFA 5EDSA 1YQBA 2MBQA 2BYFA 4I6NB 4IM3A 2C7NB 2EMTA 3R66C 1GNUA 1WMHB 3OLMD 3O65B 3PPAA 2UYZB 1GC6A 3DBHI 1WR1A 4FHJA 2GBMA 2V1YA 1P9DU 3U7DA 5FR6A 4GDLA 4W9CA 5JZEB 3GOEA 2ZEQA 3ZKJC 2M17A 2LD9A 3OAWA 1WFYA 3KUCB 3PVLA 3ZUNA 3QQ8B 2NVUI 1WX7A 3QIJA 3Q3FA 2HJ8A 4LJOB 2J0KA 4MGKE 3MJWA 5D2MB 4EZJA 1E8YA 3ZNID 3L13A 4G0NB 2N9XA 3DVGX 1J19A 2KXJA 5D7GA 1WGGA 2KTRB 4W9HA 5E6NA 3HHMA 4XC2A 4BKTA 3RYTA 1CMXB 4KZ0A
chains in the Genus database with same CATH superfamily
1T5XD 2BB5A 1TBEA 2MJ3A 3N3KB 3H1UA 2CU1A 2AWTA 2PE9A 2E6XA 2JXXA 2N9KA 3UF8A 4WAAA 1OGWA 2I1JA 1VR9A 2QDFA 3ZXRA 2IY1B 1E7UA 2V3SA 1YNTE 4LDTB 2DLBA 3BY4B 1E5WA 3BVGA 3SR6A 4US8A 4KKJA 3E56A 1SE2A 2YEPB 4M8MA 1JALA 5D3DA 3NZ3A 1SJED 1Q10A 1L2NA 2FBWB 1M4VA 1NEKB 3ZRFA 4FJYA 3RMKC 2WGSA 4GDLB 3ZNGC 1L0XB 4W9JA 3PREA 2PKOA 4GN1A 1J7CA 1OQRA 1IGDA 1I4QA 4HXDA 1YX5B 4MT5A 2DX5B 1WX9A 4ANUA 4MGIE 2LVOA 4P6VF 3TMPB 1IPGA 3T3OA 3GP7A 2QCZA 3U2SC 2K1FA 4W9GA 1YIWA 1IGCA 1N5WA 3N1XC 1YMHE 3VR9B 1VD2A 4EE2A 1I7HA 4XWWA 1GB1A 2ONQA 3E9SA 3CMMB 3ZW3A 1XLOA 4W9DA 2K9XA 2C9WB 3RI7C 3EHVA 5C1ZA 3PRPB 3ZJTA 2IPKD 2DYMA 2XEWA 1V97A 1IYFA 2D2QA 5HG2A 1ISNA 2QEJC 2V4IB 3ALBA 2JZPA 4FULA 2GRIA 4OZAA 2FIDA 1YX6B 4ZRJA 2VH1A 1LFDA 2L0TA 1D3ZA 3URYA 1VCBA 2JU6X 5T8IA 5KHQA 4CO7A 2K3UA 4HK2A 3EFUA 1OQYA 2JPHA 1QKZA 3P4RB 2KDMA 2KLGA 3MJ5A 4K7SA 3M62B 3APFA 1KH0A 2B76B 1HE8A 1T0YA 2IO1B 5J18A 4MGYE 1YJ1A 5BYQA 4HWIB 3GB1A 3TJPA 5AUKA 3TEYA 4URKA 2I1KA 3ZDTA 4ANXA 1GAQB 2K8CA 3T9LA 1KM7A 1PUTA 2VZKD 1NBFC 2MEKA 1IBXB 2KANA 1WGYA 4R3DA 3A33B 1SXTA 4TMAB 4BBNC 3I3TB 3QJZA 3RN9C 2INPE 3Q3JA 2PE6B 2NTSA 2D3CA 3LJ3A 1J7AA 4CYEA 2EMSA 3AE7B 3A4RA 4J6IA 3CF6E 4HCPB 3VUXA 1CJEA 2KC1A 3P42A 1EF1A 3ZJVA 1R7SA 3DVNU 2WDTB 2WXQA 4EEWA 3HVZA 2Z59B 4N9F4 1L5PA 3K9PB 5BYRA 3DVNV 1I42A 2KX3A 2ON8A 3FILB 3P63A 4EKUA 1PGAA 1YN5A 3A4SC 3TEXA 2C60A 3JSVA 2AQ1B 1UBQA 2LVQA 2Y5PA 3DBSA 1C76A 5AEKB 2KACA 2BS3B 1Q5WB 3EC8A 4AJWA 3M63B 4RCOA 4HLEA 2XNAC 3MC9A 5BO4B 2KDFB 1KJTA 4X57B 5DCNA 4C56C 2NMQA 2RSUA 3AE8B 1EWCA 5DPSA 3ZXVA 2KWCA 1WI0A 4B0EA 1V1PA 4WIPA 3L0WB 4BZAA 1MG8A 2HE7A 2VRRB 1VZ6A 4G3XB 2XK5B 4RM9A 4KGRA 1TT5B 3R7QA 3B9JA 4C00A 5CHWA 3UIOB 1SB3C 4I6PA 1KTKA 3S2AA 2KHWB 2OEDA 1XF5L 2O2VA 4KDIC 1TZ1A 2VZKB 5EE3A 1I4RA 1Q1OA 2JF5A 3KQ4A 3KVFB 2TSSA 3UGBB 5G55A 4IC7B 3W1SA 4P1CC 4PK1A 5MPOA 3LDZE 2K8HA 2GLSA 2BKRB 4NAWA 3TEZA 2WWZA 1MPEA 1HXYD 1QOFA 2LGSA 4A8XC 2XN9C 4AOFA 4C4VB 3QC8B 4ZRQA 2CU3A 1FNUA 3AE2B 4OHJA 1JRUA 2LGDA 2MBHA 1MI0A 1QLBB 2ASQA 4DXGA 3NHEB 1WSPA 4LLGM 2EKEC 3AU5A 3RUIB 3PO0A 1RFKA 2G45B 4E71A 1FNWA 4GLSC 1XD3B 2WXLA 2REXA 1A70A 4N6EB 2MH7A 1ZDVA 4BAXA 4RNAA 2BBCA 4LCDE 4RGNA 1FM0D 2EELA 2WP9B 4W9EA 2NCNA 3VUYA 5BMHA 5AZHA 3U7ZA 2M0XA 2OOBB 5D94A 3WALA 1JWBD 4NAMA 4YSXB 3BYYB 2KWDA 2MCNB 1L4DB 5D3IB 1TS3A 4IUMB 4GB9A 4BVUC 1H8CA 2NTTA 1PGXA 3BVMA 2LJIA 4RGMA 5DPRA 2J0MA 1T0QC 2W54A 3RNFC 3D32A 3AM9A 1C79A 3U4EG 1VZ7A 3PSEB 1EUVB 1P0RA 4MM3A 3AXCA 4M01A 2V3NA 1V5OA 1JWAD 2RDHA 1FFUA 1V5TA 2LGIA 3AEFB 5E6OA 2K6DB 4A3PA 1YN4A 1TYGB 3R3MA 1V81A 1WJ4A 1WM3A 2WX1A 3PLVA 2BF8B 4FA6A 5H8YE 4EUTA 1XCTL 4DWFA 5G5GA 1FCCC 3R66C 3PPAA 1WMHB 1TIFA 1L0YB 2GBMA 1P9DU 5FR6A 1VRAB 1D5XC 3ETRA 4J3OD 3OWEB 4HROA 2NVUI 2VH2A 4MGKE 3MJWA 2L1AA 4G0NB 3DVGX 4RH6A 1J19A 5D7GA 1TJEA 1LO5D 3IG3A 4PS3A 5HFYA 1JWMD 4JWUC 2MWSB 2LI5A 4K81A 3ZLZA 1TY2A 1RRBA 1ZXHA 3B0AA 2EKIA 1N5XA 3Q8EA 3AEEB 2D3GA 1ET6A 3IXSA 4DQOC 1SE4A 1LXDA 2BQQA 3WCQA 4BFRA 2KKCA 2DWQA 3NS8A 5CHFA 3SD5A 3H7PA 4DHZE 1DOIA 4N58A 3SFDB 3N20C 3KUZA 2KMAA 2WQYB 4M0WB 3B2FA 3IFWB 1V8CA 3A9JA 3VTWA 3PT2B 2D5GA 3HM3A 2OHFA 2N4FA 1ZE3D 1K8RB 4IM2A 1XCQL 2DZKA 3B2GA 4OZCA 4AS1A 4UDUC 3U30A 2LGYA 2KYWA 1PDXA 4B0MA 4AUQC 1XLNA 1D6EC 3L17A 4RGTA 3CIRB 2DZJA 3AULA 1QT9A 4WJPA 3PZDA 1TKYA 2DZIA 1FIQA 1SGHA 1V86A 1KLGD 1JQ4A 4WURA 3BINA 4HEA1 3L16A 3AMZA 2MBBB 1M94A 3UIPB 3KYDD 3B08A 4W9LA 2MP2B 1C3TA 4KIKA 3DHHC 1GOZA 4NZLB 4A90A 3W9CB 1QOAA 3I57A 4MH8A 1C78A 5C3JB 2WS3B 1V6EA 1FNVA 4P7IA 3RZWC 4GOCA 4WWMA 1X1MA 1GPXA 2ZCCA 1CK1A 2YVCA 1RYJA 3SU8X 5G2NA 2RR9A 1WYWB 4WQMA 2WXKA 4MJSA 3V05A 1GJZA 3AECB 4HDOA 3PV1A 2RPQA 1D4BA 2AL6A 1WGHA 1P7EA 1ZOYB 3DWGC 4A20A 3VVWB 2FNJB 4NQLB 5LNK1 4XWTA 2R2OA 2KMMA 3AE6B 1AYFA 4GDKB 1F52A 3FAHA 2ZZPB 2BPSA 4YSYB 3ZRCA 3APCA 2CJOA 4ARIA 3JYUA 4N59A 5GMVA 3I9V1 3A9JB 2IDYA 2Z0DB 4G11A 3AH7A 1U4AA 5JHBA 1WWTA 1UZXB 2YEPF 4M0WA 1FD6A 2KAJA 3KYCD 5H92C 1N6ZA 2QJLA 1UUPA 2KQ7A 4BOSC 2C5LC 4RMAA 2JUOA 2KWVB 4FJVB 2CJNA 3VHTC 3P4SB 1HZ5A 2KDEB 2KN4A 3EGRA 2D3BA 1XXGA 4IG7B 1J8CA 2K25A 3LXFA 3V6EB 1LM8B 2WYQA 2J4XA 1WZ3A 1L6VA 5HI1A 1OTRB 4AP4C 2IY0B 1GC7A 2UWQA 4IWQA 2JZ3B 3PHWB 4DHJD 4JPSA 2INNE 2M8SA 4KV2A 1NDDA 5JH5C 3AEGB 1AW7A 1OEYJ 3RD2A 4OZBA 5LLIA 3AV8A 4TQ0A 1AARA 2K39A 3NVVA 3W5UB 2WXIA 2AX5A 1K51A 4BOZB 1WXQA 1F1HA 2N9PC 2ZCBA 3AE1B 3ABVB 1WXAA 2QMTA 5BMGA 3AEDB 1WYGA 3H8HA 3WAOA 1KFYB 1ZW7A 2FUG1 5TR5A 5HKHA 4C7YA 3NUHB 1L7YA 3QAQA 2RDGA 2GBJA 1HQRD 2KJRA 3I63C 3UINB 1R4NB 4LTUA 2IO2B 2PVGC 2ZW1A 2JRHA 2V0GA 1DGJA 2NS5A 1YJIA 2RD0A 3JSVB 4FBJB 4IM0A 4ZOHC 5L95C 1N63A 2IJ0A 2JX5A 2WXGA 3PHXB 3AB5A 3KWLA 1PFDA 1PGBA 3RNCC 2KVZA 1E7VA 2IGHA 5CX3A 2A5UA 4WH4A 1L6UA 1CQVA 1P7FA 3RCZA 3DHIC 2LXCA 2RDBC 2KVRA 3TSSA 2DHZA 2PLPA 4PYZA 4IWPA 2QILA 2DAJA 5IOIA 3CSTA 1B9RA 2XK5A 4L2YA 1J7BA 2NPTA 3KLSX 2LUMA 1T6BX 4F7ZA 4ZHPA 1F9JA 3IAS1 4JWSC 2LASA 2DENB 3Q8AA 1BUIC 1OFFA 5FR3A 1JW9D 3DBLI 1TKEA 3MP9A 3QHTA 3MC8A 3PZ8A 2DYOA 4XYCA 2FCNA 2LXAA 3BVZA 2KQ4X 3DBHB 2IO0B 2M19A 4RF1A 3BIID 3R2TA 1WGKA 3TIXA 2O6VD 4WJQA 2G1EA 4NAWB 1PQSA 1WXMA 2SAKA 3VXWA 2G4DB 4LNFA 4KDLB 3Q3NC 2CHWA 4P1BC 2WLBA 2WU5B 2JYTA 3ZJUA 3QCAA 2BYVE 3DBLB 2L0FA 3SHQA 3WIMA 2WXJA 5EDSA 1YQBA 4I6NB 2BYFA 5IN7A 3OLMD 3O65B 2PVOD 3Q6BA 4GDLA 4CQNA 1LGRA 1CZPA 3GOEA 2ZEQA 4HRSA 1YN3A 1YQ3B 3ZKJC 3DHGC 2MHJA 3ZUNA 1D5MC 3KUCB 3QQ8B 3Q3MC 4EZJA 2KXJA 3NVWA 2ZW0A 3Q3OC 3IAM1 4KZ0A 1UNSA 2CHZA 2KLCA 4ZDVA 1WE6A 1WJUA 1RWSA 1TGZB 1T0RC 1WJ6A 2KJHB 2ZVNA 1TS2A 2X8XX 2MJEA 4YL8A 2KQSA 3N32A 2AEHA 5J2RA 4FN2A 1UGMA 3C19A 5I4DA 2KWUB 4ACFA 1C1YB 3L10B 4XE0A 4RFBA 1K53A 1EU3A 2DZMA 3IT4B 1SF0A 3Q14C 2J0JA 1BMLC 2C7HA 1HZ6A 2PJHA 1V49A 1NVID 2KX0A 1ZDXA 2AYOB 2Y5CA 1MHXA 2L76A 5EE9A 1RFAA 2B3AA 2AL3A 1SE9A 3ZTCA 1SE3A 2A4ZA 1TS4A 2HTHA 4M00A 2PIAA 1KLUD 3IBEA 4YXDB 1UWMA 3NOBA 4GXBA 1ZGUB 2HDEA 3KWVA 4YTMB 2MX2A 1F2RI 3DDCB 5DPWA 4TQ1A 2M56B 2IO3B 3OJ4B 5AUIA 2KO3A 1HTQA 4YWGG 1RLFA 2R61A 2D3AA 4XZ4A 4WWNA 3QA8A 2GB1A 1NYRA 1T0SC 3P2BA 2BT6A 2OJRA 3HIZA 4MSQB 3CSFA 3MHZA 1IUEA 1L0VB 4A55A 2MLBA 4DBGA 4L1BA 4G50A 4H2AA 2J42A 3AE5B 4LK0M 5IA7A 3RT3B 4GMVA 3B1LX 2MSED 2FCMA 4W9IA 3RNAC 3NG0A 2ZPNA 2L52A 2ZNVC 1FXIA 4D2KA 3P4QB 3L08A 4OVZA 1ZKHA 2BYEA 1EWYC 2ZJDA 2INCC 5BYSA 4LNNA 2L00B 5IO9A 1VLBA 4OW0A 1BT0A 2BVCA 1P1AA 1TS5A 4B6WA 2WDQB 3WANA 4AQ7A 1WXSA 3H7PB 5EE0A 5AZFA 4KGSA 4E74A 3J9CA 3ZDMC 2UU7A 4DK5A 2J53A 4HJKA 4HPMB 1WE7A 1LQBA 4OVVA 1WY8A 2PPHA 3RULA 2Z8LA 3MFGA 5TSSA 3DQVA 2LEKA 1FCLA 1YQ4B 1K52A 2FCSA 3KH0A 4DHJB 3X23A 1NI2A 2D10A 1C77A 2QHOA 3W2DA 3TBLD 2WXNA 1QF6A 2WU2B 5EE1A 2KFKA 3AE3B 2LRWA 3RPFC 1ET9A 3Q8FA 2LJ5A 2JXTA 4WWOA 4LNIA 4A9AA 4II2B 4JQWC 1FFVA 1JROA 1SIFA 2BS4B 4PS7A 1FO4A 2C7MB 1JRPA 2PTLA 3Q2AC 2JVCA 2K0PA 1I35A 1E0ZA 5E6PA 2KDBA 1S3SG 1ZPSA 4QAYA 4W9FA 3HK0A 1TZOA 4WQOB 3PS6A 4GU2A 2IGGA 3QWZB 1IBXA 4W9KA 2CHXA 2HJ1A 2MP2A 2NBWB 2AQ3B 3IT6B 3FC4A 2LHEA 1ZUD2 4I6LB 1F2RC 2D11A 4ASWC 2WDRB 4DDID 2FUHB 2QSDA 2RMMA 3VTUA 1E9MA 4B95A 1E90A 1JWSD 3VH4B 4MJSB 1TKGA 1UWXA 2LZ6A 1ZXIA 1E7PB 1PYWD 2KFJA 3AE4B 4HJGE 2WXRA 3NRZA 1V2YA 2O6VA 2QIEB 2N0SB 5CTRC 4B9KA 1STEA 2GOWA 1WXVA 3MC0B 2XBBC 3Q8BA 4ZHOA 3GZNI 3AEAB 5JHAA 3FILA 3BYTB 3DOWA 2BW2A 3DBRI 4IWOA 2GBRA 3K9OB 2WDVB 1C9FA 3EECA 4GGQA 4EZKA 4F1SA 3QK0A 1SSNA 2GI9A 4DXAB 1JWUD 2J7QB 4KZCA 1EU4A 2KJ6A 1FEHA 2L3ZA 5IP4D 3GZNB 1TTNA 1B1ZA 5C2TB 2M4NA 1N62A 2N9LA 1C4CA 4BKSA 2D07B 2Z0EB 2H88B 2KFKB 4MM3B 1HTOA 1F0ZA 2WXHA 3EA6A 4FJZA 1YD8U 2M0AA 1YOVB 2GBNA 2WXFA 2OJWA 4FLHA 1WM2A 1P98A 2KTRA 1V80A 4BKGA 2NR2A 4HKQA 1E10A 1JCKB 1GG3A 2NBUA 3SDLC 4II3B 1H4RA 4USAA 4ANVA 3LB8C 2AQ2B 4C4VA 4ICVA 3JVZX 3V60A 4FXCA 1UF0A 5LXIB 1OQQA 3NY5A 2IGDA 4MGZE 4XDCA 1DYQA 2RPVA 4HPLB 3WAPA 2JRIB 2IYDB 4MACA 3PTFC 4AWJA 4MELA 2O6VB 1EM7A 1R4MB 4NQKE 3ECIA 4IKGA 4ZYSA 3PGEA 2Y5BB 3IVFA 4JIOU 1E8ZA 5DPTA 1WF9A 2MBEA 1YJJA 2G4SA 3ZNHB 4C80A 3KW5B 3L4PA 3Q8CA 4KSLC 4JX1C 4KSKC 1ROEA 4NJ6A 2L7RA 5KHOA 2I2YA 4PYUA 4DXFA 1SBBB 3SEBA 3FKYA 3TL5A 3QX1A 4HCNB 2MBQA 4IM3A 5E6JA 2C7NB 1GC6A 4FHJA 2V1YA 3SFEB 3U7DA 1AN8A 4W9CA 2SEBD 2I38A 4NJCA 3PVLA 3QIJA 3Q3FA 2HJ8A 2J0KA 1RM6C 3ZNID 3L13A 2N9XA 3ZQ4A 1FPYA 4RF0A 1CMXB 2CR5A 2L83A 2BWES 4MSMB 1C4PA 4Q2JA 3PLUA 1UH6A 4K7WA 2ZVOA 1C4AA 1XEEA 3A1QB 3N1YC 2MRPA 3U8ZA 3V6CB 4ITKA 2LGXA 2JWZA 3ZTDA 3IHPC 1L4ZB 1WR6E 3BZDB 3PRMB 2RGFA 2R2QA 1WMHA 4JL9A 1JMLA 2LUEA 3RZFA 5LXHA 2PMVA 5C23A 4MEMA 1WGDA 3VR8B 3EUB2 4GIVA 1ENFA 2W55A 3AU4A 3TCAA 4L23A 3HRDD 2WXMA 3H6NA 2DNFA 3ZYYX 5J17A 2QC8A 2L8JA 1Q0WB 4C7ZA 5HHDG 3KUDB 3H9DA 3L54A 4IOIE 1GB4A 5IKCM 2JZZA 2KK8A 1Z2MA 1N61A 1FMAD 3DVGY 3RNGC 1V9JA 3ZNZB 4MDKE 1I4PA 2W3RA 1KRHA 1I4XA 1Y56A 2LWPA 1WZ0A 1QOBA 2KOXA 1WIAA 2KC2A 2BGFA 2IZVB 4EOYA 2MW5A 1D5ZC 3I5JC 4GDKA 3C0RB 3JW0X 2KD0A 1MHHE 3A9KA 4K3BA 3GS2A 3O13A 3AN1A 4TUUA 4JLCA 4S17A 1WGRA 1XQQA 4ZRPA 2V4LA 4ZYNA 2K8BA 4BKSD 4KKIA 3AEBB 2BTEA 1WJNA 1NI3A 1WRDB 3VFKA 2PW9A 2KDIA 2INDC 2ZPYA 2FE8A 4KX6B 4NJ7A 2KZRA 3QARA 4WJOA 1V1PB 4LJPB 2V3PA 1XO3A 3LYYA 2ZNVB 4A3OA 2Y3AA 3HUIA 2L32A 2BYTA 5BMIA 3N1ZC 2DYBA 1S1QB 3VRBB 4EFOA 4WWPA 4AJYB 4ARCA 2L05A 3V62A 2M1MA 2HTME 4OVUA 4M02A 4PT5A 2N7JA 3EFCA 5FKAC 1MG4A 2MBOA 4IDIA 3DBRB 3NZUA 1Y8RC 4WAFA 1QOGA 2WXPA 5GXGB 4RGOS 3Q69A 5L83A 2BB6A 2N1WA 1N60A 3BK1A 4NY0A 4ICUA 4KGTA 4YSZB 4KIKB 3R7RA 3M95A 4S0RA 5IAAC 3V61A 1FXTB 2G3QB 3N30A 3C8YA 2O2VB 3VUWA 5AZGA 1MFWA 3X0WA 1OEYA 2ACZB 4NPNA 2FCQA 3GE8C 1KOTA 1AWDA 2ICIA 3W1YA 2WXOA 4BBNF 2W9NA 2N7DA 2WHIA 1XLQA 1UD7A 1T3QA 1XT9B 2FAZA 3VRAB 2IBIB 2BKFA 3NJTA 4M8NA 2CKHB 1GUAB 2KNBA 4ZRKA 2MJDA 1FRRA 1FXAA 2MQJA 4YTPB 4XX5A 3ZIMA 4FADA 2K22A 3ZO5B 3WAMA 3OJ3A 1F77A 1UGJA 4JE3B 2V9HA 4YTNB 1KLVA 1EO6A 2LMCA 3AI5A 1KF6B 3W5VB 3MHSD 3H7SA 2FIFA 1WH3A 4K3CA 3T3NA 2LFIA 3A9KB 4TSSA 5FK9C 2K6QA 4IW0A 4HDQA 2HD5B 1WRIA 3RNEC 5D6JB 1ACCA 2JYEA 1R4NI 1R4MI 2JWUA 1FRDA 3N9YC 1P3QU 3HVDA 2E3TA 1E8WA 5G5HA 2KN5A 1E8XA 1BXTA 5CHVC 2JT4B 4O1NA 4NNJB 3ONSA 1I4HA 1V1OA 4LNOA 2KT7A 2N7EA 3R8BA 1J0GA 4FHKA 1VJKA 3DWMA 4E3CA 2DBYA 3A1QA 4HPPA 4YT0B 1EF5A 3ZGZA 3UQBA 2YLMA 3DCGA 3P4PB 4DDGD 4LDTD 2KMCA 2G9HD 2NPTB 3APDA 2GBKA 3VTVA 4JGHB 4ZRIA 3UQAA 3OG5A 2JY6A 3ENEA 2X38A 3BK2A 2KTFA 1HEZE 3ML8A 1RAXA 1NENB 3AE9B 1DOYA 3NZSA 4K1RB 1UELA 3TEWA 1WX8A 3VDZA 1I4GA 3V3XA 2H89B 2WX0A 2GMIC 2BWFA 2K5PA 1XLPA 2LVPA 1SJHD 4CHKA 2J52A 4HVBA 3PRZA 4P16A 4WJNA 3GE3C 1QILA 1E6EB 2WNMA 3T8MA 3PZ7A 4MH0E 3NS1A 2N9EB 1QZEA 4K7UA 2LRUA 4XDDA 1VDVA 1A5RA 1HA5A 2W3SA 3NVZA 3R2IA 4HKZE 1IP9A 1DOXA 1G6JA 1VZ8A 3RNBC 1MJDA 3VAWA 4GSWA 4F8CB 2DAFA 3VH3B 3CWIA 3RFZB 1SEBD 4US9A 3UI3A 1Z5SB 3M3JA 4A6QA 3DPDA 2LHDA 2MA9B 2PEAA 3W1SC 1ESFA 3ML9A 3U52E 2JQRB 3ZVVA 3HM6X 3BWUD 4TV3A 2JSVX 4ANWA 3VQIA 2N1VA 4RM8A 1ZP0B 1TY0A 2NBVB 2CS4A 4XGAB 1SIJA 3MTNB 4EZLA 1UBIA 3NVYA 4TKNA 1NYQA 5JXVA 3WA0A 4KVGB 4PS8A 2Q5WD 4DHZB 3P1MA 4LNKA 1QQRA 2EMTA 1GNUA 1MVKA 2UYZB 2W82A 3DBHI 1WR1A 5JZEB 2M17A 2LD9A 3OAWA 1WFYA 1WX7A 4LJOB 5D2MB 1E8YA 4REZA 1WGGA 2KTRB 4W9HA 5E6NA 2BS2B 3HHMA 3TUOA 1K50A 4XC2A 4BKTA 3RYTA
chains in the Genus database with same CATH topology
2CR5A 2CHZA 2KLCA 4ZDVA 1TBEA 1WE6A 1WJUA 2BWES 3IG3A 3N3KB 4MSMB 3H1UA 4PS3A 2CU1A 1TGZB 2AWTA 2PE9A 3PLUA 2JXXA 2MWSB 3UF8A 1UH6A 1WJ6A 2KJHB 2LI5A 2ZVNA 2ZVOA 4K7WA 4WAAA 1OGWA 4K81A 2I1JA 4YL8A 3ZLZA 3A1QB 2KQSA 3N32A 2MRPA 2AEHA 3U8ZA 1RRBA 3V6CB 5J2RA 2LGXA 4FN2A 2IY1B 1UGMA 2JWZA 1E7UA 2V3SA 3ZTDA 3IHPC 4LDTB 2KWUB 1C1YB 3L10B 3BY4B 1E5WA 1WR6E 3B0AA 3PRMB 2RGFA 2D3GA 2DZMA 2R2QA 1WMHA 4JL9A 1LXDA 4BFRA 2LUEA 3RZFA 2KKCA 5LXHA 2J0JA 3NS8A 5CHFA 5C23A 2C7HA 4MEMA 3SD5A 4M8MA 3H7PA 4DHZE 2PJHA 1V49A 1WGDA 4GIVA 3KUZA 2KX0A 1L2NA 2KMAA 3AU4A 3TCAA 4M0WB 3H6NA 2AYOB 3ZRFA 3IFWB 3A9JA 4FJYA 3VTWA 3PT2B 4GDLB 5J17A 3ZNGC 2L76A 2L8JA 3HM3A 1Q0WB 4W9JA 3PREA 1RFAA 2B3AA 4GN1A 2AL3A 2N4FA 3KUDB 1SE9A 3H9DA 3L54A 1K8RB 1YX5B 4HXDA 3ZTCA 4IM2A 2A4ZA 2DZKA 2HTHA 3IBEA 2JZZA 2DX5B 1WX9A 2KK8A 4ANUA 3NOBA 4MGIE 2LVOA 1Z2MA 3TMPB 4GXBA 1ZGUB 1IPGA 3DVGY 3U30A 2LGYA 1V9JA 2MX2A 3DDCB 5DPWA 4TQ1A 4MDKE 3ZNZB 2K1FA 4AUQC 4W9GA 1YIWA 2IO3B 3OJ4B 3L17A 2LWPA 2KO3A 1WZ0A 2DZJA 3AULA 2KOXA 1WIAA 4WJPA 2KC2A 3PZDA 2BGFA 2DZIA 1SGHA 1RLFA 1V86A 2IZVB 4XZ4A 4EOYA 2MW5A 4WWNA 1VD2A 3QA8A 4GDKA 3BINA 3C0RB 3P2BA 2OJRA 3HIZA 3JW0X 4MSQB 2KD0A 3A9KA 3L16A 2MBBB 3CMMB 3ZW3A 4W9DA 2C9WB 1M94A 4TUUA 3CSFA 4JLCA 3EHVA 3UIPB 5C1ZA 3PRPB 3KYDD 3B08A 2MLBA 4DBGA 1WGRA 4W9LA 4G50A 2DYMA 2MP2B 2XEWA 3RT3B 5IA7A 1XQQA 1IYFA 2D2QA 2V4LA 3B1LX 4GMVA 4ZYNA 2MSED 2FCMA 2K8BA 1ISNA 4W9IA 2ZPNA 2ZNVC 4BKSD 1C3TA 3L08A 1WJNA 1ZKHA 1WRDB 4KIKA 3VFKA 3ALBA 2BYEA 2ZJDA 2L00B 4FULA 2FIDA 1YX6B 4ZRJA 2KDIA 2ZPYA 1LFDA 2L0TA 4NJ7A 1D3ZA 1BT0A 1V6EA 1VCBA 4P7IA 5KHQA 2KZRA 1P1AA 3RZWC 4GOCA 3QARA 4WJOA 1X1MA 4B6WA 4CO7A 3WANA 2ZCCA 4LJPB 2YVCA 4HK2A 3EFUA 2ZNVB 1OQYA 4A3OA 1WXSA 2JPHA 3H7PB 5AZFA 2KLGA 4K7SA 3SU8X 5G2NA 4E74A 2RR9A 1WYWB 1S1QB 2DYBA 3M62B 4EFOA 3APFA 4WWPA 3ZDMC 4MJSA 4AJYB 1GJZA 4HDOA 3PV1A 1HE8A 2L05A 1T0YA 2IO1B 3V62A 4DK5A 5J18A 4MGYE 2RPQA 1YJ1A 2M1MA 4HJKA 4HPMB 2AL6A 4OVUA 1WE7A 1LQBA 1WGHA 4OVVA 1WY8A 4HWIB 2PPHA 3TJPA 3RULA 4URKA 2I1KA 2MBOA 3DQVA 3ZDTA 4ANXA 4A20A 2K8CA 3T9LA 3NZUA 1Y8RC 1KM7A 3VVWB 2FNJB 4NQLB 2FCSA 5L83A 3KH0A 1NBFC 4DHJB 2N1WA 2R2OA 2KANA 4ICUA 4NY0A 3X23A 1WGYA 4GDKB 1NI2A 4KIKB 3R7RA 2ZZPB 2BPSA 2D10A 3A33B 3M95A 3ZRCA 4BBNC 2QHOA 3APCA 3I3TB 5IAAC 3V61A 3QJZA 3TBLD 3JYUA 1FXTB 2G3QB 3Q3JA 3N30A 2PE6B 5GMVA 2O2VB 3LJ3A 3A9JB 3VUWA 5AZGA 4CYEA 2EMSA 3X0WA 2KFKA 1OEYA 3A4RA 2LRWA 2Z0DB 4G11A 4J6IA 4NPNA 3CF6E 4HCPB 3VUXA 2FCQA 2KC1A 2LJ5A 1EF1A 1U4AA 1KOTA 3DVNU 3W1YA 4WWOA 2WDTB 5JHBA 4BBNF 1UZXB 4EEWA 4II2B 4JQWC 1SIFA 2Z59B 4N9F4 4PS7A 3K9PB 2W9NA 2C7MB 3KYCD 2N7DA 3DVNV 2JVCA 1UD7A 2KX3A 1I42A 1XT9B 1I35A 2KQ7A 4BOSC 2C5LC 2FAZA 2IBIB 2BKFA 2JUOA 4M8NA 2CKHB 2KWVB 4FJVB 4RMAA 3VHTC 5E6PA 2KDBA 1GUAB 1S3SG 4EKUA 2KNBA 3A4SC 4W9FA 4ZRKA 2KDEB 3HK0A 2C60A 3JSVA 2MQJA 1UBQA 4WQOB 4IG7B 3PS6A 2LVQA 1J8CA 4XX5A 3DBSA 4GU2A 5AEKB 3ZIMA 3QWZB 2K25A 4W9KA 2CHXA 4FADA 3V6EB 3ZO5B 3WAMA 3OJ3A 2MP2A 1LM8B 2WYQA 1Q5WB 3EC8A 2NBWB 4AJWA 3M63B 4HLEA 5BO4B 2KDFB 4I6LB 1KJTA 1WZ3A 2D11A 4X57B 5DCNA 1KLVA 4ASWC 1EO6A 1OTRB 4DDID 2FUHB 3AI5A 3VTUA 4AP4C 2IY0B 1GC7A 3MHSD 1E90A 3H7SA 2UWQA 4B95A 2FIFA 2RSUA 1WH3A 3VH4B 4IWQA 4MJSB 2JZ3B 2LZ6A 3PHWB 4DHJD 3A9KB 5DPSA 2K6QA 2M8SA 2KWCA 4IW0A 2KFJA 1NDDA 4HDQA 4KV2A 1WI0A 2HD5B 5D6JB 5JH5C 3L0WB 1V2YA 1MG8A 2O6VA 1R4NI 1R4MI 2HE7A 2VRRB 1OEYJ 3RD2A 5CTRC 5LLIA 4G3XB 4B9KA 4TQ0A 2XK5B 1P3QU 4RM9A 1AARA 2K39A 2GOWA 3R7QA 1E8WA 1WXVA 2KN5A 1E8XA 5CHWA 3UIOB 2XBBC 5CHVC 4BOZB 2JT4B 3GZNI 4I6PA 2N9PC 2ZCBA 3S2AA 2KHWB 4NNJB 3ONSA 5JHAA 2O2VA 1WXAA 2N7EA 1J0GA 4KDIC 1TZ1A 4FHKA 1Q1OA 3DOWA 3WAOA 4E3CA 2JF5A 1ZW7A 5TR5A 5HKHA 3KVFB 3DBRI 3UGBB 5G55A 4IC7B 3W1SA 4IWOA 2GBRA 3A1QA 3K9OB 1L7YA 3QAQA 3EECA 4GGQA 4EZKA 1EF5A 2GBJA 4F1SA 3LDZE 2K8HA 2KJRA 3UQBA 2YLMA 3DCGA 2BKRB 3QK0A 4NAWA 2WWZA 3UINB 4DDGD 4LDTD 2IO2B 2KMCA 4DXAB 4AOFA 2JRHA 2J7QB 2NPTB 3APDA 4KZCA 3QC8B 2GBKA 2NS5A 3VTVA 4JGHB 2KJ6A 2RD0A 1JRUA 3JSVB 2LGDA 2MBHA 4ZRIA 3UQAA 4FBJB 4IM0A 2JY6A 3ENEA 2ASQA 2L3ZA 5L95C 2KTFA 3ML8A 1RAXA 3NHEB 1TTNA 2EKEC 3AU5A 3NZSA 3RUIB 4K1RB 1UELA 1WX8A 2M4NA 3VDZA 3PHXB 4BKSA 2G45B 4E71A 2D07B 2Z0EB 2KFKB 2WX0A 2GMIC 2BWFA 1XD3B 2LVPA 2REXA 4CHKA 4FJZA 1YD8U 2GBNA 1E7VA 4HVBA 5CX3A 3PRZA 2A5UA 4LCDE 4WJNA 4FLHA 1WM2A 3RCZA 3T8MA 1P98A 2KTRA 1V80A 2NCNA 4W9EA 2NR2A 4BKGA 4MH0E 3VUYA 2LXCA 2KVRA 2N9EB 1GG3A 2DHZA 2NBUA 3SDLC 4PYZA 4II3B 4IWPA 1QZEA 1H4RA 4K7UA 5AZHA 2LRUA 4ANVA 2DAJA 2M0XA 2OOBB 5D94A 1A5RA 3CSTA 2XK5A 2NPTA 3WALA 4F7ZA 1F9JA 4ICVA 3JVZX 3V60A 5LXIB 1IP9A 2LASA 2DENB 2MCNB 1G6JA 3NY5A 4MGZE 4IUMB 3DBLI 4GB9A 4BVUC 1H8CA 3VAWA 3QHTA 4HPLB 3WAPA 2JRIB 2IYDB 4GSWA 4F8CB 2DAFA 3VH3B 2DYOA 2FCNA 2LXAA 5DPRA 3PTFC 2J0MA 4AWJA 4MELA 3D32A 2IO0B 1Z5SB 2O6VB 3M3JA 3DPDA 4NQKE 3ECIA 3TIXA 3PSEB 3PGEA 1EUVB 2MA9B 1P0RA 2Y5BB 2O6VD 3IVFA 4JIOU 1E8ZA 4MM3A 3AXCA 2PEAA 3W1SC 3ML9A 4WJQA 1WF9A 5DPTA 2MBEA 3ZVVA 3HM6X 1V5OA 2G4SA 4NAWB 3ZNHB 4TV3A 4ANWA 1V5TA 1PQSA 3KW5B 1WXMA 3VQIA 3VXWA 2N1VA 4RM8A 2G4DB 5E6OA 4KSLC 2K6DB 2NBVB 4KSKC 2CS4A 4A3PA 4KDLB 2L7RA 4NJ6A 3MTNB 5KHOA 4EZLA 3R3MA 1UBIA 4PYUA 1V81A 1WJ4A 1WM3A 2CHWA 2WX1A 3PLVA 2BF8B 4TKNA 3WA0A 3TL5A 4FA6A 3QCAA 4KVGB 2BYVE 4PS8A 2L0FA 3QX1A 3SHQA 4DHZB 4EUTA 4HCNB 3WIMA 4DWFA 5EDSA 1YQBA 2MBQA 2BYFA 4I6NB 4IM3A 2C7NB 2EMTA 3R66C 1GNUA 1WMHB 3OLMD 3O65B 3PPAA 2UYZB 1GC6A 3DBHI 1WR1A 4FHJA 2GBMA 2V1YA 1P9DU 3U7DA 5FR6A 4GDLA 4W9CA 5JZEB 3GOEA 2ZEQA 3ZKJC 2M17A 2LD9A 3OAWA 1WFYA 3KUCB 3PVLA 3ZUNA 3QQ8B 2NVUI 1WX7A 3QIJA 3Q3FA 2HJ8A 4LJOB 2J0KA 4MGKE 3MJWA 5D2MB 4EZJA 1E8YA 3ZNID 3L13A 4G0NB 2N9XA 3DVGX 1J19A 2KXJA 5D7GA 1WGGA 2KTRB 4W9HA 5E6NA 3HHMA 4XC2A 4BKTA 3RYTA 1CMXB 4KZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CR5 A;  2CHZ A;  2KLC A;  4ZDV A;  1TBE A;  1WE6 A;  1WJU A;  2BWE S;  3IG3 A;  3N3K B;  4MSM B;  3H1U A;  4PS3 A;  2CU1 A;  1TGZ B;  2AWT A;  2PE9 A;  3PLU A;  2JXX A;  2MWS B;  3UF8 A;  1UH6 A;  1WJ6 A;  2KJH B;  2LI5 A;  2ZVN A;  2ZVO A;  4K7W A;  4WAA A;  1OGW A;  4K81 A;  2I1J A;  4YL8 A;  3ZLZ A;  3A1Q B;  2KQS A;  3N32 A;  2MRP A;  2AEH A;  3U8Z A;  1RRB A;  3V6C B;  5J2R A;  2LGX A;  4FN2 A;  2IY1 B;  1UGM A;  2JWZ A;  1E7U A;  2V3S A;  3ZTD A;  3IHP C;  4LDT B;  2KWU B;  1C1Y B;  3L10 B;  3BY4 B;  1E5W A;  1WR6 E;  3B0A A;  3PRM B;  2RGF A;  2D3G A;  2DZM A;  2R2Q A;  1WMH A;  4JL9 A;  1LXD A;  4BFR A;  2LUE A;  3RZF A;  2KKC A;  5LXH A;  2J0J A;  3NS8 A;  5CHF A;  5C23 A;  2C7H A;  4MEM A;  3SD5 A;  4M8M A;  3H7P A;  4DHZ E;  2PJH A;  1V49 A;  1WGD A;  4GIV A;  3KUZ A;  2KX0 A;  1L2N A;  2KMA A;  3AU4 A;  3TCA A;  4M0W B;  3H6N A;  2AYO B;  3ZRF A;  3IFW B;  3A9J A;  4FJY A;  3VTW A;  3PT2 B;  4GDL B;  5J17 A;  3ZNG C;  2L76 A;  2L8J A;  3HM3 A;  1Q0W B;  4W9J A;  3PRE A;  1RFA A;  2B3A A;  4GN1 A;  2AL3 A;  2N4F A;  3KUD B;  1SE9 A;  3H9D A;  3L54 A;  1K8R B;  1YX5 B;  4HXD A;  3ZTC A;  4IM2 A;  2A4Z A;  2DZK A;  2HTH A;  3IBE A;  2JZZ A;  2DX5 B;  1WX9 A;  2KK8 A;  4ANU A;  3NOB A;  4MGI E;  2LVO A;  1Z2M A;  3TMP B;  4GXB A;  1ZGU B;  1IPG A;  3DVG Y;  3U30 A;  2LGY A;  1V9J A;  2MX2 A;  3DDC B;  5DPW A;  4TQ1 A;  4MDK E;  3ZNZ B;  2K1F A;  4AUQ C;  4W9G A;  1YIW A;  2IO3 B;  3OJ4 B;  3L17 A;  2LWP A;  2KO3 A;  1WZ0 A;  2DZJ A;  3AUL A;  2KOX A;  1WIA A;  4WJP A;  2KC2 A;  3PZD A;  2BGF A;  2DZI A;  1SGH A;  1RLF A;  1V86 A;  2IZV B;  4XZ4 A;  4EOY A;  2MW5 A;  4WWN A;  1VD2 A;  3QA8 A;  4GDK A;  3BIN A;  3C0R B;  3P2B A;  2OJR A;  3HIZ A;  3JW0 X;  4MSQ B;  2KD0 A;  3A9K A;  3L16 A;  2MBB B;  3CMM B;  3ZW3 A;  4W9D A;  2C9W B;  1M94 A;  4TUU A;  3CSF A;  4JLC A;  3EHV A;  3UIP B;  5C1Z A;  3PRP B;  3KYD D;  3B08 A;  2MLB A;  4DBG A;  1WGR A;  4W9L A;  4G50 A;  2DYM A;  2MP2 B;  2XEW A;  3RT3 B;  5IA7 A;  1XQQ A;  1IYF A;  2D2Q A;  2V4L A;  3B1L X;  4GMV A;  4ZYN A;  2MSE D;  2FCM A;  2K8B A;  1ISN A;  4W9I A;  2ZPN A;  2ZNV C;  4BKS D;  1C3T A;  3L08 A;  1WJN A;  1ZKH A;  1WRD B;  4KIK A;  3VFK A;  3ALB A;  2BYE A;  2ZJD A;  2L00 B;  4FUL A;  2FID A;  1YX6 B;  4ZRJ A;  2KDI A;  2ZPY A;  1LFD A;  2L0T A;  4NJ7 A;  1D3Z A;  1BT0 A;  1V6E A;  1VCB A;  4P7I A;  5KHQ A;  2KZR A;  1P1A A;  3RZW C;  4GOC A;  3QAR A;  4WJO A;  1X1M A;  4B6W A;  4CO7 A;  3WAN A;  2ZCC A;  4LJP B;  2YVC A;  4HK2 A;  3EFU A;  2ZNV B;  1OQY A;  4A3O A;  1WXS A;  2JPH A;  3H7P B;  5AZF A;  2KLG A;  4K7S A;  3SU8 X;  5G2N A;  4E74 A;  2RR9 A;  1WYW B;  1S1Q B;  2DYB A;  3M62 B;  4EFO A;  3APF A;  4WWP A;  3ZDM C;  4MJS A;  4AJY B;  1GJZ A;  4HDO A;  3PV1 A;  1HE8 A;  2L05 A;  1T0Y A;  2IO1 B;  3V62 A;  4DK5 A;  5J18 A;  4MGY E;  2RPQ A;  1YJ1 A;  2M1M A;  4HJK A;  4HPM B;  2AL6 A;  4OVU A;  1WE7 A;  1LQB A;  1WGH A;  4OVV A;  1WY8 A;  4HWI B;  2PPH A;  3TJP A;  3RUL A;  4URK A;  2I1K A;  2MBO A;  3DQV A;  3ZDT A;  4ANX A;  4A20 A;  2K8C A;  3T9L A;  3NZU A;  1Y8R C;  1KM7 A;  3VVW B;  2FNJ B;  4NQL B;  2FCS A;  5L83 A;  3KH0 A;  1NBF C;  4DHJ B;  2N1W A;  2R2O A;  2KAN A;  4ICU A;  4NY0 A;  3X23 A;  1WGY A;  4GDK B;  1NI2 A;  4KIK B;  3R7R A;  2ZZP B;  2BPS A;  2D10 A;  3A33 B;  3M95 A;  3ZRC A;  4BBN C;  2QHO A;  3APC A;  3I3T B;  5IAA C;  3V61 A;  3QJZ A;  3TBL D;  3JYU A;  1FXT B;  2G3Q B;  3Q3J A;  3N30 A;  2PE6 B;  5GMV A;  2O2V B;  3LJ3 A;  3A9J B;  3VUW A;  5AZG A;  4CYE A;  2EMS A;  3X0W A;  2KFK A;  1OEY A;  3A4R A;  2LRW A;  2Z0D B;  4G11 A;  4J6I A;  4NPN A;  3CF6 E;  4HCP B;  3VUX A;  2FCQ A;  2KC1 A;  2LJ5 A;  1EF1 A;  1U4A A;  1KOT A;  3DVN U;  3W1Y A;  4WWO A;  2WDT B;  5JHB A;  4BBN F;  1UZX B;  4EEW A;  4II2 B;  4JQW C;  1SIF A;  2Z59 B;  4N9F 4;  4PS7 A;  3K9P B;  2W9N A;  2C7M B;  3KYC D;  2N7D A;  3DVN V;  2JVC A;  1UD7 A;  2KX3 A;  1I42 A;  1XT9 B;  1I35 A;  2KQ7 A;  4BOS C;  2C5L C;  2FAZ A;  2IBI B;  2BKF A;  2JUO A;  4M8N A;  2CKH B;  2KWV B;  4FJV B;  4RMA A;  3VHT C;  5E6P A;  2KDB A;  1GUA B;  1S3S G;  4EKU A;  2KNB A;  3A4S C;  4W9F A;  4ZRK A;  2KDE B;  3HK0 A;  2C60 A;  3JSV A;  2MQJ A;  1UBQ A;  4WQO B;  4IG7 B;  3PS6 A;  2LVQ A;  1J8C A;  4XX5 A;  3DBS A;  4GU2 A;  5AEK B;  3ZIM A;  3QWZ B;  2K25 A;  4W9K A;  2CHX A;  4FAD A;  3V6E B;  3ZO5 B;  3WAM A;  3OJ3 A;  2MP2 A;  1LM8 B;  2WYQ A;  1Q5W B;  3EC8 A;  2NBW B;  4AJW A;  3M63 B;  4HLE A;  5BO4 B;  2KDF B;  4I6L B;  1KJT A;  1WZ3 A;  2D11 A;  4X57 B;  5DCN A;  1KLV A;  4ASW C;  1EO6 A;  1OTR B;  4DDI D;  2FUH B;  3AI5 A;  3VTU A;  4AP4 C;  2IY0 B;  1GC7 A;  3MHS D;  1E90 A;  3H7S A;  2UWQ A;  4B95 A;  2FIF A;  2RSU A;  1WH3 A;  3VH4 B;  4IWQ A;  4MJS B;  2JZ3 B;  2LZ6 A;  3PHW B;  4DHJ D;  3A9K B;  5DPS A;  2K6Q A;  2M8S A;  2KWC A;  4IW0 A;  2KFJ A;  1NDD A;  4HDQ A;  4KV2 A;  1WI0 A;  2HD5 B;  5D6J B;  5JH5 C;  3L0W B;  1V2Y A;  1MG8 A;  2O6V A;  1R4N I;  1R4M I;  2HE7 A;  2VRR B;  1OEY J;  3RD2 A;  5CTR C;  5LLI A;  4G3X B;  4B9K A;  4TQ0 A;  2XK5 B;  1P3Q U;  4RM9 A;  1AAR A;  2K39 A;  2GOW A;  3R7Q A;  1E8W A;  1WXV A;  2KN5 A;  1E8X A;  5CHW A;  3UIO B;  2XBB C;  5CHV C;  4BOZ B;  2JT4 B;  3GZN I;  4I6P A;  2N9P C;  2ZCB A;  3S2A A;  2KHW B;  4NNJ B;  3ONS A;  5JHA A;  2O2V A;  1WXA A;  2N7E A;  1J0G A;  4KDI C;  1TZ1 A;  4FHK A;  1Q1O A;  3DOW A;  3WAO A;  4E3C A;  2JF5 A;  1ZW7 A;  5TR5 A;  5HKH A;  3KVF B;  3DBR I;  3UGB B;  5G55 A;  4IC7 B;  3W1S A;  4IWO A;  2GBR A;  3A1Q A;  3K9O B;  1L7Y A;  3QAQ A;  3EEC A;  4GGQ A;  4EZK A;  1EF5 A;  2GBJ A;  4F1S A;  3LDZ E;  2K8H A;  2KJR A;  3UQB A;  2YLM A;  3DCG A;  2BKR B;  3QK0 A;  4NAW A;  2WWZ A;  3UIN B;  4DDG D;  4LDT D;  2IO2 B;  2KMC A;  4DXA B;  4AOF A;  2JRH A;  2J7Q B;  2NPT B;  3APD A;  4KZC A;  3QC8 B;  2GBK A;  2NS5 A;  3VTV A;  4JGH B;  2KJ6 A;  2RD0 A;  1JRU A;  3JSV B;  2LGD A;  2MBH A;  4ZRI A;  3UQA A;  4FBJ B;  4IM0 A;  2JY6 A;  3ENE A;  2ASQ A;  2L3Z A;  5L95 C;  2KTF A;  3ML8 A;  1RAX A;  3NHE B;  1TTN A;  2EKE C;  3AU5 A;  3NZS A;  3RUI B;  4K1R B;  1UEL A;  1WX8 A;  2M4N A;  3VDZ A;  3PHX B;  4BKS A;  2G45 B;  4E71 A;  2D07 B;  2Z0E B;  2KFK B;  2WX0 A;  2GMI C;  2BWF A;  1XD3 B;  2LVP A;  2REX A;  4CHK A;  4FJZ A;  1YD8 U;  2GBN A;  1E7V A;  4HVB A;  5CX3 A;  3PRZ A;  2A5U A;  4LCD E;  4WJN A;  4FLH A;  1WM2 A;  3RCZ A;  3T8M A;  1P98 A;  2KTR A;  1V80 A;  2NCN A;  4W9E A;  2NR2 A;  4BKG A;  4MH0 E;  3VUY A;  2LXC A;  2KVR A;  2N9E B;  1GG3 A;  2DHZ A;  2NBU A;  3SDL C;  4PYZ A;  4II3 B;  4IWP A;  1QZE A;  1H4R A;  4K7U A;  5AZH A;  2LRU A;  4ANV A;  2DAJ A;  2M0X A;  2OOB B;  5D94 A;  1A5R A;  3CST A;  2XK5 A;  2NPT A;  3WAL A;  4F7Z A;  1F9J A;  4ICV A;  3JVZ X;  3V60 A;  5LXI B;  1IP9 A;  2LAS A;  2DEN B;  2MCN B;  1G6J A;  3NY5 A;  4MGZ E;  4IUM B;  3DBL I;  4GB9 A;  4BVU C;  1H8C A;  3VAW A;  3QHT A;  4HPL B;  3WAP A;  2JRI B;  2IYD B;  4GSW A;  4F8C B;  2DAF A;  3VH3 B;  2DYO A;  2FCN A;  2LXA A;  5DPR A;  3PTF C;  2J0M A;  4AWJ A;  4MEL A;  3D32 A;  2IO0 B;  1Z5S B;  2O6V B;  3M3J A;  3DPD A;  4NQK E;  3ECI A;  3TIX A;  3PSE B;  3PGE A;  1EUV B;  2MA9 B;  1P0R A;  2Y5B B;  2O6V D;  3IVF A;  4JIO U;  1E8Z A;  4MM3 A;  3AXC A;  2PEA A;  3W1S C;  3ML9 A;  4WJQ A;  1WF9 A;  5DPT A;  2MBE A;  3ZVV A;  3HM6 X;  1V5O A;  2G4S A;  4NAW B;  3ZNH B;  4TV3 A;  4ANW A;  1V5T A;  1PQS A;  3KW5 B;  1WXM A;  3VQI A;  3VXW A;  2N1V A;  4RM8 A;  2G4D B;  5E6O A;  4KSL C;  2K6D B;  2NBV B;  4KSK C;  2CS4 A;  4A3P A;  4KDL B;  2L7R A;  4NJ6 A;  3MTN B;  5KHO A;  4EZL A;  3R3M A;  1UBI A;  4PYU A;  1V81 A;  1WJ4 A;  1WM3 A;  2CHW A;  2WX1 A;  3PLV A;  2BF8 B;  4TKN A;  3WA0 A;  3TL5 A;  4FA6 A;  3QCA A;  4KVG B;  2BYV E;  4PS8 A;  2L0F A;  3QX1 A;  3SHQ A;  4DHZ B;  4EUT A;  4HCN B;  3WIM A;  4DWF A;  5EDS A;  1YQB A;  2MBQ A;  2BYF A;  4I6N B;  4IM3 A;  2C7N B;  2EMT A;  3R66 C;  1GNU A;  1WMH B;  3OLM D;  3O65 B;  3PPA A;  2UYZ B;  1GC6 A;  3DBH I;  1WR1 A;  4FHJ A;  2GBM A;  2V1Y A;  1P9D U;  3U7D A;  5FR6 A;  4GDL A;  4W9C A;  5JZE B;  3GOE A;  2ZEQ A;  3ZKJ C;  2M17 A;  2LD9 A;  3OAW A;  1WFY A;  3KUC B;  3PVL A;  3ZUN A;  3QQ8 B;  2NVU I;  1WX7 A;  3QIJ A;  3Q3F A;  2HJ8 A;  4LJO B;  2J0K A;  4MGK E;  3MJW A;  5D2M B;  4EZJ A;  1E8Y A;  3ZNI D;  3L13 A;  4G0N B;  2N9X A;  3DVG X;  1J19 A;  2KXJ A;  5D7G A;  1WGG A;  2KTR B;  4W9H A;  5E6N A;  3HHM A;  4XC2 A;  4BKT A;  3RYT A;  1CMX B;  4KZ0 A; 
#chains in the Genus database with same CATH topology
 1T5X D;  2BB5 A;  1TBE A;  2MJ3 A;  3N3K B;  3H1U A;  2CU1 A;  2AWT A;  2PE9 A;  2E6X A;  2JXX A;  2N9K A;  3UF8 A;  4WAA A;  1OGW A;  2I1J A;  1VR9 A;  2QDF A;  3ZXR A;  2IY1 B;  1E7U A;  2V3S A;  1YNT E;  4LDT B;  2DLB A;  3BY4 B;  1E5W A;  3BVG A;  3SR6 A;  4US8 A;  4KKJ A;  3E56 A;  1SE2 A;  2YEP B;  4M8M A;  1JAL A;  5D3D A;  3NZ3 A;  1SJE D;  1Q10 A;  1L2N A;  2FBW B;  1M4V A;  1NEK B;  3ZRF A;  4FJY A;  3RMK C;  2WGS A;  4GDL B;  3ZNG C;  1L0X B;  4W9J A;  3PRE A;  2PKO A;  4GN1 A;  1J7C A;  1OQR A;  1IGD A;  1I4Q A;  4HXD A;  1YX5 B;  4MT5 A;  2DX5 B;  1WX9 A;  4ANU A;  4MGI E;  2LVO A;  4P6V F;  3TMP B;  1IPG A;  3T3O A;  3GP7 A;  2QCZ A;  3U2S C;  2K1F A;  4W9G A;  1YIW A;  1IGC A;  1N5W A;  3N1X C;  1YMH E;  3VR9 B;  1VD2 A;  4EE2 A;  1I7H A;  4XWW A;  1GB1 A;  2ONQ A;  3E9S A;  3CMM B;  3ZW3 A;  1XLO A;  4W9D A;  2K9X A;  2C9W B;  3RI7 C;  3EHV A;  5C1Z A;  3PRP B;  3ZJT A;  2IPK D;  2DYM A;  2XEW A;  1V97 A;  1IYF A;  2D2Q A;  5HG2 A;  1ISN A;  2QEJ C;  2V4I B;  3ALB A;  2JZP A;  4FUL A;  2GRI A;  4OZA A;  2FID A;  1YX6 B;  4ZRJ A;  2VH1 A;  1LFD A;  2L0T A;  1D3Z A;  3URY A;  1VCB A;  2JU6 X;  5T8I A;  5KHQ A;  4CO7 A;  2K3U A;  4HK2 A;  3EFU A;  1OQY A;  2JPH A;  1QKZ A;  3P4R B;  2KDM A;  2KLG A;  3MJ5 A;  4K7S A;  3M62 B;  3APF A;  1KH0 A;  2B76 B;  1HE8 A;  1T0Y A;  2IO1 B;  5J18 A;  4MGY E;  1YJ1 A;  5BYQ A;  4HWI B;  3GB1 A;  3TJP A;  5AUK A;  3TEY A;  4URK A;  2I1K A;  3ZDT A;  4ANX A;  1GAQ B;  2K8C A;  3T9L A;  1KM7 A;  1PUT A;  2VZK D;  1NBF C;  2MEK A;  1IBX B;  2KAN A;  1WGY A;  4R3D A;  3A33 B;  1SXT A;  4TMA B;  4BBN C;  3I3T B;  3QJZ A;  3RN9 C;  2INP E;  3Q3J A;  2PE6 B;  2NTS A;  2D3C A;  3LJ3 A;  1J7A A;  4CYE A;  2EMS A;  3AE7 B;  3A4R A;  4J6I A;  3CF6 E;  4HCP B;  3VUX A;  1CJE A;  2KC1 A;  3P42 A;  1EF1 A;  3ZJV A;  1R7S A;  3DVN U;  2WDT B;  2WXQ A;  4EEW A;  3HVZ A;  2Z59 B;  4N9F 4;  1L5P A;  3K9P B;  5BYR A;  3DVN V;  1I42 A;  2KX3 A;  2ON8 A;  3FIL B;  3P63 A;  4EKU A;  1PGA A;  1YN5 A;  3A4S C;  3TEX A;  2C60 A;  3JSV A;  2AQ1 B;  1UBQ A;  2LVQ A;  2Y5P A;  3DBS A;  1C76 A;  5AEK B;  2KAC A;  2BS3 B;  1Q5W B;  3EC8 A;  4AJW A;  3M63 B;  4RCO A;  4HLE A;  2XNA C;  3MC9 A;  5BO4 B;  2KDF B;  1KJT A;  4X57 B;  5DCN A;  4C56 C;  2NMQ A;  2RSU A;  3AE8 B;  1EWC A;  5DPS A;  3ZXV A;  2KWC A;  1WI0 A;  4B0E A;  1V1P A;  4WIP A;  3L0W B;  4BZA A;  1MG8 A;  2HE7 A;  2VRR B;  1VZ6 A;  4G3X B;  2XK5 B;  4RM9 A;  4KGR A;  1TT5 B;  3R7Q A;  3B9J A;  4C00 A;  5CHW A;  3UIO B;  1SB3 C;  4I6P A;  1KTK A;  3S2A A;  2KHW B;  2OED A;  1XF5 L;  2O2V A;  4KDI C;  1TZ1 A;  2VZK B;  5EE3 A;  1I4R A;  1Q1O A;  2JF5 A;  3KQ4 A;  3KVF B;  2TSS A;  3UGB B;  5G55 A;  4IC7 B;  3W1S A;  4P1C C;  4PK1 A;  5MPO A;  3LDZ E;  2K8H A;  2GLS A;  2BKR B;  4NAW A;  3TEZ A;  2WWZ A;  1MPE A;  1HXY D;  1QOF A;  2LGS A;  4A8X C;  2XN9 C;  4AOF A;  4C4V B;  3QC8 B;  4ZRQ A;  2CU3 A;  1FNU A;  3AE2 B;  4OHJ A;  1JRU A;  2LGD A;  2MBH A;  1MI0 A;  1QLB B;  2ASQ A;  4DXG A;  3NHE B;  1WSP A;  4LLG M;  2EKE C;  3AU5 A;  3RUI B;  3PO0 A;  1RFK A;  2G45 B;  4E71 A;  1FNW A;  4GLS C;  1XD3 B;  2WXL A;  2REX A;  1A70 A;  4N6E B;  2MH7 A;  1ZDV A;  4BAX A;  4RNA A;  2BBC A;  4LCD E;  4RGN A;  1FM0 D;  2EEL A;  2WP9 B;  4W9E A;  2NCN A;  3VUY A;  5BMH A;  5AZH A;  3U7Z A;  2M0X A;  2OOB B;  5D94 A;  3WAL A;  1JWB D;  4NAM A;  4YSX B;  3BYY B;  2KWD A;  2MCN B;  1L4D B;  5D3I B;  1TS3 A;  4IUM B;  4GB9 A;  4BVU C;  1H8C A;  2NTT A;  1PGX A;  3BVM A;  2LJI A;  4RGM A;  5DPR A;  2J0M A;  1T0Q C;  2W54 A;  3RNF C;  3D32 A;  3AM9 A;  1C79 A;  3U4E G;  1VZ7 A;  3PSE B;  1EUV B;  1P0R A;  4MM3 A;  3AXC A;  4M01 A;  2V3N A;  1V5O A;  1JWA D;  2RDH A;  1FFU A;  1V5T A;  2LGI A;  3AEF B;  5E6O A;  2K6D B;  4A3P A;  1YN4 A;  1TYG B;  3R3M A;  1V81 A;  1WJ4 A;  1WM3 A;  2WX1 A;  3PLV A;  2BF8 B;  4FA6 A;  5H8Y E;  4EUT A;  1XCT L;  4DWF A;  5G5G A;  1FCC C;  3R66 C;  3PPA A;  1WMH B;  1TIF A;  1L0Y B;  2GBM A;  1P9D U;  5FR6 A;  1VRA B;  1D5X C;  3ETR A;  4J3O D;  3OWE B;  4HRO A;  2NVU I;  2VH2 A;  4MGK E;  3MJW A;  2L1A A;  4G0N B;  3DVG X;  4RH6 A;  1J19 A;  5D7G A;  1TJE A;  1LO5 D;  3IG3 A;  4PS3 A;  5HFY A;  1JWM D;  4JWU C;  2MWS B;  2LI5 A;  4K81 A;  3ZLZ A;  1TY2 A;  1RRB A;  1ZXH A;  3B0A A;  2EKI A;  1N5X A;  3Q8E A;  3AEE B;  2D3G A;  1ET6 A;  3IXS A;  4DQO C;  1SE4 A;  1LXD A;  2BQQ A;  3WCQ A;  4BFR A;  2KKC A;  2DWQ A;  3NS8 A;  5CHF A;  3SD5 A;  3H7P A;  4DHZ E;  1DOI A;  4N58 A;  3SFD B;  3N20 C;  3KUZ A;  2KMA A;  2WQY B;  4M0W B;  3B2F A;  3IFW B;  1V8C A;  3A9J A;  3VTW A;  3PT2 B;  2D5G A;  3HM3 A;  2OHF A;  2N4F A;  1ZE3 D;  1K8R B;  4IM2 A;  1XCQ L;  2DZK A;  3B2G A;  4OZC A;  4AS1 A;  4UDU C;  3U30 A;  2LGY A;  2KYW A;  1PDX A;  4B0M A;  4AUQ C;  1XLN A;  1D6E C;  3L17 A;  4RGT A;  3CIR B;  2DZJ A;  3AUL A;  1QT9 A;  4WJP A;  3PZD A;  1TKY A;  2DZI A;  1FIQ A;  1SGH A;  1V86 A;  1KLG D;  1JQ4 A;  4WUR A;  3BIN A;  4HEA 1;  3L16 A;  3AMZ A;  2MBB B;  1M94 A;  3UIP B;  3KYD D;  3B08 A;  4W9L A;  2MP2 B;  1C3T A;  4KIK A;  3DHH C;  1GOZ A;  4NZL B;  4A90 A;  3W9C B;  1QOA A;  3I57 A;  4MH8 A;  1C78 A;  5C3J B;  2WS3 B;  1V6E A;  1FNV A;  4P7I A;  3RZW C;  4GOC A;  4WWM A;  1X1M A;  1GPX A;  2ZCC A;  1CK1 A;  2YVC A;  1RYJ A;  3SU8 X;  5G2N A;  2RR9 A;  1WYW B;  4WQM A;  2WXK A;  4MJS A;  3V05 A;  1GJZ A;  3AEC B;  4HDO A;  3PV1 A;  2RPQ A;  1D4B A;  2AL6 A;  1WGH A;  1P7E A;  1ZOY B;  3DWG C;  4A20 A;  3VVW B;  2FNJ B;  4NQL B;  5LNK 1;  4XWT A;  2R2O A;  2KMM A;  3AE6 B;  1AYF A;  4GDK B;  1F52 A;  3FAH A;  2ZZP B;  2BPS A;  4YSY B;  3ZRC A;  3APC A;  2CJO A;  4ARI A;  3JYU A;  4N59 A;  5GMV A;  3I9V 1;  3A9J B;  2IDY A;  2Z0D B;  4G11 A;  3AH7 A;  1U4A A;  5JHB A;  1WWT A;  1UZX B;  2YEP F;  4M0W A;  1FD6 A;  2KAJ A;  3KYC D;  5H92 C;  1N6Z A;  2QJL A;  1UUP A;  2KQ7 A;  4BOS C;  2C5L C;  4RMA A;  2JUO A;  2KWV B;  4FJV B;  2CJN A;  3VHT C;  3P4S B;  1HZ5 A;  2KDE B;  2KN4 A;  3EGR A;  2D3B A;  1XXG A;  4IG7 B;  1J8C A;  2K25 A;  3LXF A;  3V6E B;  1LM8 B;  2WYQ A;  2J4X A;  1WZ3 A;  1L6V A;  5HI1 A;  1OTR B;  4AP4 C;  2IY0 B;  1GC7 A;  2UWQ A;  4IWQ A;  2JZ3 B;  3PHW B;  4DHJ D;  4JPS A;  2INN E;  2M8S A;  4KV2 A;  1NDD A;  5JH5 C;  3AEG B;  1AW7 A;  1OEY J;  3RD2 A;  4OZB A;  5LLI A;  3AV8 A;  4TQ0 A;  1AAR A;  2K39 A;  3NVV A;  3W5U B;  2WXI A;  2AX5 A;  1K51 A;  4BOZ B;  1WXQ A;  1F1H A;  2N9P C;  2ZCB A;  3AE1 B;  3ABV B;  1WXA A;  2QMT A;  5BMG A;  3AED B;  1WYG A;  3H8H A;  3WAO A;  1KFY B;  1ZW7 A;  2FUG 1;  5TR5 A;  5HKH A;  4C7Y A;  3NUH B;  1L7Y A;  3QAQ A;  2RDG A;  2GBJ A;  1HQR D;  2KJR A;  3I63 C;  3UIN B;  1R4N B;  4LTU A;  2IO2 B;  2PVG C;  2ZW1 A;  2JRH A;  2V0G A;  1DGJ A;  2NS5 A;  1YJI A;  2RD0 A;  3JSV B;  4FBJ B;  4IM0 A;  4ZOH C;  5L95 C;  1N63 A;  2IJ0 A;  2JX5 A;  2WXG A;  3PHX B;  3AB5 A;  3KWL A;  1PFD A;  1PGB A;  3RNC C;  2KVZ A;  1E7V A;  2IGH A;  5CX3 A;  2A5U A;  4WH4 A;  1L6U A;  1CQV A;  1P7F A;  3RCZ A;  3DHI C;  2LXC A;  2RDB C;  2KVR A;  3TSS A;  2DHZ A;  2PLP A;  4PYZ A;  4IWP A;  2QIL A;  2DAJ A;  5IOI A;  3CST A;  1B9R A;  2XK5 A;  4L2Y A;  1J7B A;  2NPT A;  3KLS X;  2LUM A;  1T6B X;  4F7Z A;  4ZHP A;  1F9J A;  3IAS 1;  4JWS C;  2LAS A;  2DEN B;  3Q8A A;  1BUI C;  1OFF A;  5FR3 A;  1JW9 D;  3DBL I;  1TKE A;  3MP9 A;  3QHT A;  3MC8 A;  3PZ8 A;  2DYO A;  4XYC A;  2FCN A;  2LXA A;  3BVZ A;  2KQ4 X;  3DBH B;  2IO0 B;  2M19 A;  4RF1 A;  3BII D;  3R2T A;  1WGK A;  3TIX A;  2O6V D;  4WJQ A;  2G1E A;  4NAW B;  1PQS A;  1WXM A;  2SAK A;  3VXW A;  2G4D B;  4LNF A;  4KDL B;  3Q3N C;  2CHW A;  4P1B C;  2WLB A;  2WU5 B;  2JYT A;  3ZJU A;  3QCA A;  2BYV E;  3DBL B;  2L0F A;  3SHQ A;  3WIM A;  2WXJ A;  5EDS A;  1YQB A;  4I6N B;  2BYF A;  5IN7 A;  3OLM D;  3O65 B;  2PVO D;  3Q6B A;  4GDL A;  4CQN A;  1LGR A;  1CZP A;  3GOE A;  2ZEQ A;  4HRS A;  1YN3 A;  1YQ3 B;  3ZKJ C;  3DHG C;  2MHJ A;  3ZUN A;  1D5M C;  3KUC B;  3QQ8 B;  3Q3M C;  4EZJ A;  2KXJ A;  3NVW A;  2ZW0 A;  3Q3O C;  3IAM 1;  4KZ0 A;  1UNS A;  2CHZ A;  2KLC A;  4ZDV A;  1WE6 A;  1WJU A;  1RWS A;  1TGZ B;  1T0R C;  1WJ6 A;  2KJH B;  2ZVN A;  1TS2 A;  2X8X X;  2MJE A;  4YL8 A;  2KQS A;  3N32 A;  2AEH A;  5J2R A;  4FN2 A;  1UGM A;  3C19 A;  5I4D A;  2KWU B;  4ACF A;  1C1Y B;  3L10 B;  4XE0 A;  4RFB A;  1K53 A;  1EU3 A;  2DZM A;  3IT4 B;  1SF0 A;  3Q14 C;  2J0J A;  1BML C;  2C7H A;  1HZ6 A;  2PJH A;  1V49 A;  1NVI D;  2KX0 A;  1ZDX A;  2AYO B;  2Y5C A;  1MHX A;  2L76 A;  5EE9 A;  1RFA A;  2B3A A;  2AL3 A;  1SE9 A;  3ZTC A;  1SE3 A;  2A4Z A;  1TS4 A;  2HTH A;  4M00 A;  2PIA A;  1KLU D;  3IBE A;  4YXD B;  1UWM A;  3NOB A;  4GXB A;  1ZGU B;  2HDE A;  3KWV A;  4YTM B;  2MX2 A;  1F2R I;  3DDC B;  5DPW A;  4TQ1 A;  2M56 B;  2IO3 B;  3OJ4 B;  5AUI A;  2KO3 A;  1HTQ A;  4YWG G;  1RLF A;  2R61 A;  2D3A A;  4XZ4 A;  4WWN A;  3QA8 A;  2GB1 A;  1NYR A;  1T0S C;  3P2B A;  2BT6 A;  2OJR A;  3HIZ A;  4MSQ B;  3CSF A;  3MHZ A;  1IUE A;  1L0V B;  4A55 A;  2MLB A;  4DBG A;  4L1B A;  4G50 A;  4H2A A;  2J42 A;  3AE5 B;  4LK0 M;  5IA7 A;  3RT3 B;  4GMV A;  3B1L X;  2MSE D;  2FCM A;  4W9I A;  3RNA C;  3NG0 A;  2ZPN A;  2L52 A;  2ZNV C;  1FXI A;  4D2K A;  3P4Q B;  3L08 A;  4OVZ A;  1ZKH A;  2BYE A;  1EWY C;  2ZJD A;  2INC C;  5BYS A;  4LNN A;  2L00 B;  5IO9 A;  1VLB A;  4OW0 A;  1BT0 A;  2BVC A;  1P1A A;  1TS5 A;  4B6W A;  2WDQ B;  3WAN A;  4AQ7 A;  1WXS A;  3H7P B;  5EE0 A;  5AZF A;  4KGS A;  4E74 A;  3J9C A;  3ZDM C;  2UU7 A;  4DK5 A;  2J53 A;  4HJK A;  4HPM B;  1WE7 A;  1LQB A;  4OVV A;  1WY8 A;  2PPH A;  3RUL A;  2Z8L A;  3MFG A;  5TSS A;  3DQV A;  2LEK A;  1FCL A;  1YQ4 B;  1K52 A;  2FCS A;  3KH0 A;  4DHJ B;  3X23 A;  1NI2 A;  2D10 A;  1C77 A;  2QHO A;  3W2D A;  3TBL D;  2WXN A;  1QF6 A;  2WU2 B;  5EE1 A;  2KFK A;  3AE3 B;  2LRW A;  3RPF C;  1ET9 A;  3Q8F A;  2LJ5 A;  2JXT A;  4WWO A;  4LNI A;  4A9A A;  4II2 B;  4JQW C;  1FFV A;  1JRO A;  1SIF A;  2BS4 B;  4PS7 A;  1FO4 A;  2C7M B;  1JRP A;  2PTL A;  3Q2A C;  2JVC A;  2K0P A;  1I35 A;  1E0Z A;  5E6P A;  2KDB A;  1S3S G;  1ZPS A;  4QAY A;  4W9F A;  3HK0 A;  1TZO A;  4WQO B;  3PS6 A;  4GU2 A;  2IGG A;  3QWZ B;  1IBX A;  4W9K A;  2CHX A;  2HJ1 A;  2MP2 A;  2NBW B;  2AQ3 B;  3IT6 B;  3FC4 A;  2LHE A;  1ZUD 2;  4I6L B;  1F2R C;  2D11 A;  4ASW C;  2WDR B;  4DDI D;  2FUH B;  2QSD A;  2RMM A;  3VTU A;  1E9M A;  4B95 A;  1E90 A;  1JWS D;  3VH4 B;  4MJS B;  1TKG A;  1UWX A;  2LZ6 A;  1ZXI A;  1E7P B;  1PYW D;  2KFJ A;  3AE4 B;  4HJG E;  2WXR A;  3NRZ A;  1V2Y A;  2O6V A;  2QIE B;  2N0S B;  5CTR C;  4B9K A;  1STE A;  2GOW A;  1WXV A;  3MC0 B;  2XBB C;  3Q8B A;  4ZHO A;  3GZN I;  3AEA B;  5JHA A;  3FIL A;  3BYT B;  3DOW A;  2BW2 A;  3DBR I;  4IWO A;  2GBR A;  3K9O B;  2WDV B;  1C9F A;  3EEC A;  4GGQ A;  4EZK A;  4F1S A;  3QK0 A;  1SSN A;  2GI9 A;  4DXA B;  1JWU D;  2J7Q B;  4KZC A;  1EU4 A;  2KJ6 A;  1FEH A;  2L3Z A;  5IP4 D;  3GZN B;  1TTN A;  1B1Z A;  5C2T B;  2M4N A;  1N62 A;  2N9L A;  1C4C A;  4BKS A;  2D07 B;  2Z0E B;  2H88 B;  2KFK B;  4MM3 B;  1HTO A;  1F0Z A;  2WXH A;  3EA6 A;  4FJZ A;  1YD8 U;  2M0A A;  1YOV B;  2GBN A;  2WXF A;  2OJW A;  4FLH A;  1WM2 A;  1P98 A;  2KTR A;  1V80 A;  4BKG A;  2NR2 A;  4HKQ A;  1E10 A;  1JCK B;  1GG3 A;  2NBU A;  3SDL C;  4II3 B;  1H4R A;  4USA A;  4ANV A;  3LB8 C;  2AQ2 B;  4C4V A;  4ICV A;  3JVZ X;  3V60 A;  4FXC A;  1UF0 A;  5LXI B;  1OQQ A;  3NY5 A;  2IGD A;  4MGZ E;  4XDC A;  1DYQ A;  2RPV A;  4HPL B;  3WAP A;  2JRI B;  2IYD B;  4MAC A;  3PTF C;  4AWJ A;  4MEL A;  2O6V B;  1EM7 A;  1R4M B;  4NQK E;  3ECI A;  4IKG A;  4ZYS A;  3PGE A;  2Y5B B;  3IVF A;  4JIO U;  1E8Z A;  5DPT A;  1WF9 A;  2MBE A;  1YJJ A;  2G4S A;  3ZNH B;  4C80 A;  3KW5 B;  3L4P A;  3Q8C A;  4KSL C;  4JX1 C;  4KSK C;  1ROE A;  4NJ6 A;  2L7R A;  5KHO A;  2I2Y A;  4PYU A;  4DXF A;  1SBB B;  3SEB A;  3FKY A;  3TL5 A;  3QX1 A;  4HCN B;  2MBQ A;  4IM3 A;  5E6J A;  2C7N B;  1GC6 A;  4FHJ A;  2V1Y A;  3SFE B;  3U7D A;  1AN8 A;  4W9C A;  2SEB D;  2I38 A;  4NJC A;  3PVL A;  3QIJ A;  3Q3F A;  2HJ8 A;  2J0K A;  1RM6 C;  3ZNI D;  3L13 A;  2N9X A;  3ZQ4 A;  1FPY A;  4RF0 A;  1CMX B;  2CR5 A;  2L83 A;  2BWE S;  4MSM B;  1C4P A;  4Q2J A;  3PLU A;  1UH6 A;  4K7W A;  2ZVO A;  1C4A A;  1XEE A;  3A1Q B;  3N1Y C;  2MRP A;  3U8Z A;  3V6C B;  4ITK A;  2LGX A;  2JWZ A;  3ZTD A;  3IHP C;  1L4Z B;  1WR6 E;  3BZD B;  3PRM B;  2RGF A;  2R2Q A;  1WMH A;  4JL9 A;  1JML A;  2LUE A;  3RZF A;  5LXH A;  2PMV A;  5C23 A;  4MEM A;  1WGD A;  3VR8 B;  3EUB 2;  4GIV A;  1ENF A;  2W55 A;  3AU4 A;  3TCA A;  4L23 A;  3HRD D;  2WXM A;  3H6N A;  2DNF A;  3ZYY X;  5J17 A;  2QC8 A;  2L8J A;  1Q0W B;  4C7Z A;  5HHD G;  3KUD B;  3H9D A;  3L54 A;  4IOI E;  1GB4 A;  5IKC M;  2JZZ A;  2KK8 A;  1Z2M A;  1N61 A;  1FMA D;  3DVG Y;  3RNG C;  1V9J A;  3ZNZ B;  4MDK E;  1I4P A;  2W3R A;  1KRH A;  1I4X A;  1Y56 A;  2LWP A;  1WZ0 A;  1QOB A;  2KOX A;  1WIA A;  2KC2 A;  2BGF A;  2IZV B;  4EOY A;  2MW5 A;  1D5Z C;  3I5J C;  4GDK A;  3C0R B;  3JW0 X;  2KD0 A;  1MHH E;  3A9K A;  4K3B A;  3GS2 A;  3O13 A;  3AN1 A;  4TUU A;  4JLC A;  4S17 A;  1WGR A;  1XQQ A;  4ZRP A;  2V4L A;  4ZYN A;  2K8B A;  4BKS D;  4KKI A;  3AEB B;  2BTE A;  1WJN A;  1NI3 A;  1WRD B;  3VFK A;  2PW9 A;  2KDI A;  2IND C;  2ZPY A;  2FE8 A;  4KX6 B;  4NJ7 A;  2KZR A;  3QAR A;  4WJO A;  1V1P B;  4LJP B;  2V3P A;  1XO3 A;  3LYY A;  2ZNV B;  4A3O A;  2Y3A A;  3HUI A;  2L32 A;  2BYT A;  5BMI A;  3N1Z C;  2DYB A;  1S1Q B;  3VRB B;  4EFO A;  4WWP A;  4AJY B;  4ARC A;  2L05 A;  3V62 A;  2M1M A;  2HTM E;  4OVU A;  4M02 A;  4PT5 A;  2N7J A;  3EFC A;  5FKA C;  1MG4 A;  2MBO A;  4IDI A;  3DBR B;  3NZU A;  1Y8R C;  4WAF A;  1QOG A;  2WXP A;  5GXG B;  4RGO S;  3Q69 A;  5L83 A;  2BB6 A;  2N1W A;  1N60 A;  3BK1 A;  4NY0 A;  4ICU A;  4KGT A;  4YSZ B;  4KIK B;  3R7R A;  3M95 A;  4S0R A;  5IAA C;  3V61 A;  1FXT B;  2G3Q B;  3N30 A;  3C8Y A;  2O2V B;  3VUW A;  5AZG A;  1MFW A;  3X0W A;  1OEY A;  2ACZ B;  4NPN A;  2FCQ A;  3GE8 C;  1KOT A;  1AWD A;  2ICI A;  3W1Y A;  2WXO A;  4BBN F;  2W9N A;  2N7D A;  2WHI A;  1XLQ A;  1UD7 A;  1T3Q A;  1XT9 B;  2FAZ A;  3VRA B;  2IBI B;  2BKF A;  3NJT A;  4M8N A;  2CKH B;  1GUA B;  2KNB A;  4ZRK A;  2MJD A;  1FRR A;  1FXA A;  2MQJ A;  4YTP B;  4XX5 A;  3ZIM A;  4FAD A;  2K22 A;  3ZO5 B;  3WAM A;  3OJ3 A;  1F77 A;  1UGJ A;  4JE3 B;  2V9H A;  4YTN B;  1KLV A;  1EO6 A;  2LMC A;  3AI5 A;  1KF6 B;  3W5V B;  3MHS D;  3H7S A;  2FIF A;  1WH3 A;  4K3C A;  3T3N A;  2LFI A;  3A9K B;  4TSS A;  5FK9 C;  2K6Q A;  4IW0 A;  4HDQ A;  2HD5 B;  1WRI A;  3RNE C;  5D6J B;  1ACC A;  2JYE A;  1R4N I;  1R4M I;  2JWU A;  1FRD A;  3N9Y C;  1P3Q U;  3HVD A;  2E3T A;  1E8W A;  5G5H A;  2KN5 A;  1E8X A;  1BXT A;  5CHV C;  2JT4 B;  4O1N A;  4NNJ B;  3ONS A;  1I4H A;  1V1O A;  4LNO A;  2KT7 A;  2N7E A;  3R8B A;  1J0G A;  4FHK A;  1VJK A;  3DWM A;  4E3C A;  2DBY A;  3A1Q A;  4HPP A;  4YT0 B;  1EF5 A;  3ZGZ A;  3UQB A;  2YLM A;  3DCG A;  3P4P B;  4DDG D;  4LDT D;  2KMC A;  2G9H D;  2NPT B;  3APD A;  2GBK A;  3VTV A;  4JGH B;  4ZRI A;  3UQA A;  3OG5 A;  2JY6 A;  3ENE A;  2X38 A;  3BK2 A;  2KTF A;  1HEZ E;  3ML8 A;  1RAX A;  1NEN B;  3AE9 B;  1DOY A;  3NZS A;  4K1R B;  1UEL A;  3TEW A;  1WX8 A;  3VDZ A;  1I4G A;  3V3X A;  2H89 B;  2WX0 A;  2GMI C;  2BWF A;  2K5P A;  1XLP A;  2LVP A;  1SJH D;  4CHK A;  2J52 A;  4HVB A;  3PRZ A;  4P16 A;  4WJN A;  3GE3 C;  1QIL A;  1E6E B;  2WNM A;  3T8M A;  3PZ7 A;  4MH0 E;  3NS1 A;  2N9E B;  1QZE A;  4K7U A;  2LRU A;  4XDD A;  1VDV A;  1A5R A;  1HA5 A;  2W3S A;  3NVZ A;  3R2I A;  4HKZ E;  1IP9 A;  1DOX A;  1G6J A;  1VZ8 A;  3RNB C;  1MJD A;  3VAW A;  4GSW A;  4F8C B;  2DAF A;  3VH3 B;  3CWI A;  3RFZ B;  1SEB D;  4US9 A;  3UI3 A;  1Z5S B;  3M3J A;  4A6Q A;  3DPD A;  2LHD A;  2MA9 B;  2PEA A;  3W1S C;  1ESF A;  3ML9 A;  3U52 E;  2JQR B;  3ZVV A;  3HM6 X;  3BWU D;  4TV3 A;  2JSV X;  4ANW A;  3VQI A;  2N1V A;  4RM8 A;  1ZP0 B;  1TY0 A;  2NBV B;  2CS4 A;  4XGA B;  1SIJ A;  3MTN B;  4EZL A;  1UBI A;  3NVY A;  4TKN A;  1NYQ A;  5JXV A;  3WA0 A;  4KVG B;  4PS8 A;  2Q5W D;  4DHZ B;  3P1M A;  4LNK A;  1QQR A;  2EMT A;  1GNU A;  1MVK A;  2UYZ B;  2W82 A;  3DBH I;  1WR1 A;  5JZE B;  2M17 A;  2LD9 A;  3OAW A;  1WFY A;  1WX7 A;  4LJO B;  5D2M B;  1E8Y A;  4REZ A;  1WGG A;  2KTR B;  4W9H A;  5E6N A;  2BS2 B;  3HHM A;  3TUO A;  1K50 A;  4XC2 A;  4BKT A;  3RYT A; 
#chains in the Genus database with same CATH homology
 2CR5 A;  2CHZ A;  2KLC A;  4ZDV A;  1TBE A;  1WE6 A;  1WJU A;  2BWE S;  3IG3 A;  3N3K B;  4MSM B;  3H1U A;  4PS3 A;  2CU1 A;  1TGZ B;  2AWT A;  2PE9 A;  3PLU A;  2JXX A;  2MWS B;  3UF8 A;  1UH6 A;  1WJ6 A;  2KJH B;  2LI5 A;  2ZVN A;  2ZVO A;  4K7W A;  4WAA A;  1OGW A;  4K81 A;  2I1J A;  4YL8 A;  3ZLZ A;  3A1Q B;  2KQS A;  3N32 A;  2MRP A;  2AEH A;  3U8Z A;  1RRB A;  3V6C B;  5J2R A;  2LGX A;  4FN2 A;  2IY1 B;  1UGM A;  2JWZ A;  1E7U A;  2V3S A;  3ZTD A;  3IHP C;  4LDT B;  2KWU B;  1C1Y B;  3L10 B;  3BY4 B;  1E5W A;  1WR6 E;  3B0A A;  3PRM B;  2RGF A;  2D3G A;  2DZM A;  2R2Q A;  1WMH A;  4JL9 A;  1LXD A;  4BFR A;  2LUE A;  3RZF A;  2KKC A;  5LXH A;  2J0J A;  3NS8 A;  5CHF A;  5C23 A;  2C7H A;  4MEM A;  3SD5 A;  4M8M A;  3H7P A;  4DHZ E;  2PJH A;  1V49 A;  1WGD A;  4GIV A;  3KUZ A;  2KX0 A;  1L2N A;  2KMA A;  3AU4 A;  3TCA A;  4M0W B;  3H6N A;  2AYO B;  3ZRF A;  3IFW B;  3A9J A;  4FJY A;  3VTW A;  3PT2 B;  4GDL B;  5J17 A;  3ZNG C;  2L76 A;  2L8J A;  3HM3 A;  1Q0W B;  4W9J A;  3PRE A;  1RFA A;  2B3A A;  4GN1 A;  2AL3 A;  2N4F A;  3KUD B;  1SE9 A;  3H9D A;  3L54 A;  1K8R B;  1YX5 B;  4HXD A;  3ZTC A;  4IM2 A;  2A4Z A;  2DZK A;  2HTH A;  3IBE A;  2JZZ A;  2DX5 B;  1WX9 A;  2KK8 A;  4ANU A;  3NOB A;  4MGI E;  2LVO A;  1Z2M A;  3TMP B;  4GXB A;  1ZGU B;  1IPG A;  3DVG Y;  3U30 A;  2LGY A;  1V9J A;  2MX2 A;  3DDC B;  5DPW A;  4TQ1 A;  4MDK E;  3ZNZ B;  2K1F A;  4AUQ C;  4W9G A;  1YIW A;  2IO3 B;  3OJ4 B;  3L17 A;  2LWP A;  2KO3 A;  1WZ0 A;  2DZJ A;  3AUL A;  2KOX A;  1WIA A;  4WJP A;  2KC2 A;  3PZD A;  2BGF A;  2DZI A;  1SGH A;  1RLF A;  1V86 A;  2IZV B;  4XZ4 A;  4EOY A;  2MW5 A;  4WWN A;  1VD2 A;  3QA8 A;  4GDK A;  3BIN A;  3C0R B;  3P2B A;  2OJR A;  3HIZ A;  3JW0 X;  4MSQ B;  2KD0 A;  3A9K A;  3L16 A;  2MBB B;  3CMM B;  3ZW3 A;  4W9D A;  2C9W B;  1M94 A;  4TUU A;  3CSF A;  4JLC A;  3EHV A;  3UIP B;  5C1Z A;  3PRP B;  3KYD D;  3B08 A;  2MLB A;  4DBG A;  1WGR A;  4W9L A;  4G50 A;  2DYM A;  2MP2 B;  2XEW A;  3RT3 B;  5IA7 A;  1XQQ A;  1IYF A;  2D2Q A;  2V4L A;  3B1L X;  4GMV A;  4ZYN A;  2MSE D;  2FCM A;  2K8B A;  1ISN A;  4W9I A;  2ZPN A;  2ZNV C;  4BKS D;  1C3T A;  3L08 A;  1WJN A;  1ZKH A;  1WRD B;  4KIK A;  3VFK A;  3ALB A;  2BYE A;  2ZJD A;  2L00 B;  4FUL A;  2FID A;  1YX6 B;  4ZRJ A;  2KDI A;  2ZPY A;  1LFD A;  2L0T A;  4NJ7 A;  1D3Z A;  1BT0 A;  1V6E A;  1VCB A;  4P7I A;  5KHQ A;  2KZR A;  1P1A A;  3RZW C;  4GOC A;  3QAR A;  4WJO A;  1X1M A;  4B6W A;  4CO7 A;  3WAN A;  2ZCC A;  4LJP B;  2YVC A;  4HK2 A;  3EFU A;  2ZNV B;  1OQY A;  4A3O A;  1WXS A;  2JPH A;  3H7P B;  5AZF A;  2KLG A;  4K7S A;  3SU8 X;  5G2N A;  4E74 A;  2RR9 A;  1WYW B;  1S1Q B;  2DYB A;  3M62 B;  4EFO A;  3APF A;  4WWP A;  3ZDM C;  4MJS A;  4AJY B;  1GJZ A;  4HDO A;  3PV1 A;  1HE8 A;  2L05 A;  1T0Y A;  2IO1 B;  3V62 A;  4DK5 A;  5J18 A;  4MGY E;  2RPQ A;  1YJ1 A;  2M1M A;  4HJK A;  4HPM B;  2AL6 A;  4OVU A;  1WE7 A;  1LQB A;  1WGH A;  4OVV A;  1WY8 A;  4HWI B;  2PPH A;  3TJP A;  3RUL A;  4URK A;  2I1K A;  2MBO A;  3DQV A;  3ZDT A;  4ANX A;  4A20 A;  2K8C A;  3T9L A;  3NZU A;  1Y8R C;  1KM7 A;  3VVW B;  2FNJ B;  4NQL B;  2FCS A;  5L83 A;  3KH0 A;  1NBF C;  4DHJ B;  2N1W A;  2R2O A;  2KAN A;  4ICU A;  4NY0 A;  3X23 A;  1WGY A;  4GDK B;  1NI2 A;  4KIK B;  3R7R A;  2ZZP B;  2BPS A;  2D10 A;  3A33 B;  3M95 A;  3ZRC A;  4BBN C;  2QHO A;  3APC A;  3I3T B;  5IAA C;  3V61 A;  3QJZ A;  3TBL D;  3JYU A;  1FXT B;  2G3Q B;  3Q3J A;  3N30 A;  2PE6 B;  5GMV A;  2O2V B;  3LJ3 A;  3A9J B;  3VUW A;  5AZG A;  4CYE A;  2EMS A;  3X0W A;  2KFK A;  1OEY A;  3A4R A;  2LRW A;  2Z0D B;  4G11 A;  4J6I A;  4NPN A;  3CF6 E;  4HCP B;  3VUX A;  2FCQ A;  2KC1 A;  2LJ5 A;  1EF1 A;  1U4A A;  1KOT A;  3DVN U;  3W1Y A;  4WWO A;  2WDT B;  5JHB A;  4BBN F;  1UZX B;  4EEW A;  4II2 B;  4JQW C;  1SIF A;  2Z59 B;  4N9F 4;  4PS7 A;  3K9P B;  2W9N A;  2C7M B;  3KYC D;  2N7D A;  3DVN V;  2JVC A;  1UD7 A;  2KX3 A;  1I42 A;  1XT9 B;  1I35 A;  2KQ7 A;  4BOS C;  2C5L C;  2FAZ A;  2IBI B;  2BKF A;  2JUO A;  4M8N A;  2CKH B;  2KWV B;  4FJV B;  4RMA A;  3VHT C;  5E6P A;  2KDB A;  1GUA B;  1S3S G;  4EKU A;  2KNB A;  3A4S C;  4W9F A;  4ZRK A;  2KDE B;  3HK0 A;  2C60 A;  3JSV A;  2MQJ A;  1UBQ A;  4WQO B;  4IG7 B;  3PS6 A;  2LVQ A;  1J8C A;  4XX5 A;  3DBS A;  4GU2 A;  5AEK B;  3ZIM A;  3QWZ B;  2K25 A;  4W9K A;  2CHX A;  4FAD A;  3V6E B;  3ZO5 B;  3WAM A;  3OJ3 A;  2MP2 A;  1LM8 B;  2WYQ A;  1Q5W B;  3EC8 A;  2NBW B;  4AJW A;  3M63 B;  4HLE A;  5BO4 B;  2KDF B;  4I6L B;  1KJT A;  1WZ3 A;  2D11 A;  4X57 B;  5DCN A;  1KLV A;  4ASW C;  1EO6 A;  1OTR B;  4DDI D;  2FUH B;  3AI5 A;  3VTU A;  4AP4 C;  2IY0 B;  1GC7 A;  3MHS D;  1E90 A;  3H7S A;  2UWQ A;  4B95 A;  2FIF A;  2RSU A;  1WH3 A;  3VH4 B;  4IWQ A;  4MJS B;  2JZ3 B;  2LZ6 A;  3PHW B;  4DHJ D;  3A9K B;  5DPS A;  2K6Q A;  2M8S A;  2KWC A;  4IW0 A;  2KFJ A;  1NDD A;  4HDQ A;  4KV2 A;  1WI0 A;  2HD5 B;  5D6J B;  5JH5 C;  3L0W B;  1V2Y A;  1MG8 A;  2O6V A;  1R4N I;  1R4M I;  2HE7 A;  2VRR B;  1OEY J;  3RD2 A;  5CTR C;  5LLI A;  4G3X B;  4B9K A;  4TQ0 A;  2XK5 B;  1P3Q U;  4RM9 A;  1AAR A;  2K39 A;  2GOW A;  3R7Q A;  1E8W A;  1WXV A;  2KN5 A;  1E8X A;  5CHW A;  3UIO B;  2XBB C;  5CHV C;  4BOZ B;  2JT4 B;  3GZN I;  4I6P A;  2N9P C;  2ZCB A;  3S2A A;  2KHW B;  4NNJ B;  3ONS A;  5JHA A;  2O2V A;  1WXA A;  2N7E A;  1J0G A;  4KDI C;  1TZ1 A;  4FHK A;  1Q1O A;  3DOW A;  3WAO A;  4E3C A;  2JF5 A;  1ZW7 A;  5TR5 A;  5HKH A;  3KVF B;  3DBR I;  3UGB B;  5G55 A;  4IC7 B;  3W1S A;  4IWO A;  2GBR A;  3A1Q A;  3K9O B;  1L7Y A;  3QAQ A;  3EEC A;  4GGQ A;  4EZK A;  1EF5 A;  2GBJ A;  4F1S A;  3LDZ E;  2K8H A;  2KJR A;  3UQB A;  2YLM A;  3DCG A;  2BKR B;  3QK0 A;  4NAW A;  2WWZ A;  3UIN B;  4DDG D;  4LDT D;  2IO2 B;  2KMC A;  4DXA B;  4AOF A;  2JRH A;  2J7Q B;  2NPT B;  3APD A;  4KZC A;  3QC8 B;  2GBK A;  2NS5 A;  3VTV A;  4JGH B;  2KJ6 A;  2RD0 A;  1JRU A;  3JSV B;  2LGD A;  2MBH A;  4ZRI A;  3UQA A;  4FBJ B;  4IM0 A;  2JY6 A;  3ENE A;  2ASQ A;  2L3Z A;  5L95 C;  2KTF A;  3ML8 A;  1RAX A;  3NHE B;  1TTN A;  2EKE C;  3AU5 A;  3NZS A;  3RUI B;  4K1R B;  1UEL A;  1WX8 A;  2M4N A;  3VDZ A;  3PHX B;  4BKS A;  2G45 B;  4E71 A;  2D07 B;  2Z0E B;  2KFK B;  2WX0 A;  2GMI C;  2BWF A;  1XD3 B;  2LVP A;  2REX A;  4CHK A;  4FJZ A;  1YD8 U;  2GBN A;  1E7V A;  4HVB A;  5CX3 A;  3PRZ A;  2A5U A;  4LCD E;  4WJN A;  4FLH A;  1WM2 A;  3RCZ A;  3T8M A;  1P98 A;  2KTR A;  1V80 A;  2NCN A;  4W9E A;  2NR2 A;  4BKG A;  4MH0 E;  3VUY A;  2LXC A;  2KVR A;  2N9E B;  1GG3 A;  2DHZ A;  2NBU A;  3SDL C;  4PYZ A;  4II3 B;  4IWP A;  1QZE A;  1H4R A;  4K7U A;  5AZH A;  2LRU A;  4ANV A;  2DAJ A;  2M0X A;  2OOB B;  5D94 A;  1A5R A;  3CST A;  2XK5 A;  2NPT A;  3WAL A;  4F7Z A;  1F9J A;  4ICV A;  3JVZ X;  3V60 A;  5LXI B;  1IP9 A;  2LAS A;  2DEN B;  2MCN B;  1G6J A;  3NY5 A;  4MGZ E;  4IUM B;  3DBL I;  4GB9 A;  4BVU C;  1H8C A;  3VAW A;  3QHT A;  4HPL B;  3WAP A;  2JRI B;  2IYD B;  4GSW A;  4F8C B;  2DAF A;  3VH3 B;  2DYO A;  2FCN A;  2LXA A;  5DPR A;  3PTF C;  2J0M A;  4AWJ A;  4MEL A;  3D32 A;  2IO0 B;  1Z5S B;  2O6V B;  3M3J A;  3DPD A;  4NQK E;  3ECI A;  3TIX A;  3PSE B;  3PGE A;  1EUV B;  2MA9 B;  1P0R A;  2Y5B B;  2O6V D;  3IVF A;  4JIO U;  1E8Z A;  4MM3 A;  3AXC A;  2PEA A;  3W1S C;  3ML9 A;  4WJQ A;  1WF9 A;  5DPT A;  2MBE A;  3ZVV A;  3HM6 X;  1V5O A;  2G4S A;  4NAW B;  3ZNH B;  4TV3 A;  4ANW A;  1V5T A;  1PQS A;  3KW5 B;  1WXM A;  3VQI A;  3VXW A;  2N1V A;  4RM8 A;  2G4D B;  5E6O A;  4KSL C;  2K6D B;  2NBV B;  4KSK C;  2CS4 A;  4A3P A;  4KDL B;  2L7R A;  4NJ6 A;  3MTN B;  5KHO A;  4EZL A;  3R3M A;  1UBI A;  4PYU A;  1V81 A;  1WJ4 A;  1WM3 A;  2CHW A;  2WX1 A;  3PLV A;  2BF8 B;  4TKN A;  3WA0 A;  3TL5 A;  4FA6 A;  3QCA A;  4KVG B;  2BYV E;  4PS8 A;  2L0F A;  3QX1 A;  3SHQ A;  4DHZ B;  4EUT A;  4HCN B;  3WIM A;  4DWF A;  5EDS A;  1YQB A;  2MBQ A;  2BYF A;  4I6N B;  4IM3 A;  2C7N B;  2EMT A;  3R66 C;  1GNU A;  1WMH B;  3OLM D;  3O65 B;  3PPA A;  2UYZ B;  1GC6 A;  3DBH I;  1WR1 A;  4FHJ A;  2GBM A;  2V1Y A;  1P9D U;  3U7D A;  5FR6 A;  4GDL A;  4W9C A;  5JZE B;  3GOE A;  2ZEQ A;  3ZKJ C;  2M17 A;  2LD9 A;  3OAW A;  1WFY A;  3KUC B;  3PVL A;  3ZUN A;  3QQ8 B;  2NVU I;  1WX7 A;  3QIJ A;  3Q3F A;  2HJ8 A;  4LJO B;  2J0K A;  4MGK E;  3MJW A;  5D2M B;  4EZJ A;  1E8Y A;  3ZNI D;  3L13 A;  4G0N B;  2N9X A;  3DVG X;  1J19 A;  2KXJ A;  5D7G A;  1WGG A;  2KTR B;  4W9H A;  5E6N A;  3HHM A;  4XC2 A;  4BKT A;  3RYT A;  1CMX B;  4KZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...