1Z33A

Crystal structure of trichomonas vaginalis purine nucleoside phosphorylase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
235
structure length
235
Chain Sequence
ATPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINRIRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEETTAEERQNSFQNMMKIALEAAIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine nucleoside phosphorylase
publication title Identification of a subversive substrate of Trichomonas vaginalis purine nucleoside phosphorylase and the crystal structure of the enzyme-substrate complex.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transferase
total genus 83
structure length 235
sequence length 235
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z33A00
4TYMA 4IP0A 1JE1A 3OZDA 4D98A 1Z36A 2AI2A 2HWUA 2A0WA 3U40A 1QE5A 3FWPA 4QEZA 4ECEA 1TCUA 3OPVA 1V3QE 3KUKA 2AC7A 3GB9A 1N3IA 4F3CA 4DA0A 2QPLA 3EUEA 4JP5A 1Y1RA 4GLFA 5FAKA 1ULAA 3P0FA 3OCCA 4EB8A 1PWYE 4GLJA 1A9PA 4TS9A 1OTYA 1U1GA 4MCHA 4U2KA 1YQUA 4L6IA 1A9RA 3DPSA 1RXSA 4OGKA 4TXLA 2ISCA 2I4TA 4F2PA 1PK9A 1LV8A 1V4NA 4QARA 1NW4A 4M1EA 2RJ3A 1Z37A 1PR2A 3P0EA 3KVRA 3UT6A 1YRYE 1T8YA 1XE3A 3OF3A 3PNPA 4LDNA 1T8WA 1JDSA 5C80A 4YNBA 4R31A 2H8GA 5F7OA 5B7QA 1K3FA 1RXYA 1SJ9A 1Q1GA 2OC9A 1OTXA 1Z33A 1ODJA 1VFNA 1Z38A 2ON6A 4L5CA 3C74A 5K1ZA 1Y1SA 5IFKA 4DA6A 4FFSA 2PGAA 3IOMA 2QSUA 1Y1QA 3DJFA 1TGVA 1CG6A 4MCIA 1PR0A 1G2OA 4DAEA 4UC0A 1RFGE 4EARA 1Y6QA 1JDVA 2Q7OE 1ZL2A 1T8SA 1ODKA 3BSFA 2HSWA 3OOHA 1PF7E 1I80A 4OEHA 3UAYA 4WKBA 2IQ5A 3FNQA 4LZWA 4WKCA 1PR6A 1U1EA 2QTTA 4NSNA 1JYSA 3GGSA 4E1VA 4TTIA 4X24A 1RSZA 1Z39A 1Z35A 1VMKA 1NC3A 4WKNA 5F7ZA 1K9SA 1T8RA 4TTAA 5EFOA 5B7NA 1ULBA 2A8YA 3O6VA 1PW7A 3NM5A 1OV6A 4QATA 1T0UA 3KVVA 2P4SA 3INYA 4R2WA 2OECA 3DF9A 1PBNA 3LA8A 2QDKA 1RXCA 4I2VA 4DABA 3E9ZA 3OZCA 5I3CA 1RYZA 4L5YA 3NM4A 1RT9A 1ODLA 5CXSA 1SQ6A 4TS3A 1A9TA 3KHSA 4QAQA 3D1VA 4LNHA 3UAVA 2OXFA 1JDTA 3FOWA 1JE0A 4TTJA 2B94A 2A0XA 4PNPA 3OZBA 5F77A 5EUBA 1LX7A 1ZOSA 2I8AA 4OF4A 3MMSA 1A9QA 4D8YA 4OGLA 3LGSA 3MB8A 1V2HE 1FXUA 4DAOA 1A9OA 1RCTE 3FAZA 1TCVA 4TXJA 5F76A 4BMZA 1TD1A 2AI3A 3TL6A 3E9RA 2OC4A 4F1WA 4WKPA 5B7GA 5JPCA 3DP9A 1ODIA 4G8JA 4YJKA 3BGSA 4DA7A 4DARA 5F78A 4DANA 4OY3A 1NC1A 3E0QA 3SCZA 4D9HA 5KB3A 4L5AA 1WTAA 1U1FA 3IEXA 5ETJA 1YQQA 4F3KA 3PNSA 1U1CA 4M3NA 4NS1A 1PR1A 2AI1A 1PR4A 5CYFA 1V48A 1Y6RA 4QASA 4BMXA 3T94A 4YMLA 4MARA 4QFBA 4TXNA 1SD1A 3F8WA 3PHCA 2A0YA 1Z5OA 3DDOA 1U1DA 4TXHA 4YO8A 4D8VA 1RR6A 3UAZA 4RJ2A 3BL6A 4P54A 1V41E 4JOSA 4WKOA 1Z34A 3UAWA 5EPUA 4F2WA 4G89A 3QPBA 1B8OA 1ECPA 1V45E 1Z5NA 1A69A 5DK6A 1RXUA 3LBAA 3FB1A 1YR3A 4DA8A 3NM6B 3KU4A 1LVUA 1A9SA 1Z5PA 4BN0A 1JPVA 5F73A 1PR5A 1TGYA 3ONVA 4NY1A 2HN9A 3O4VA 1K27A 1OUMA 4PR3A 3OZEA 3NBQA 4OJTA 5CCDA 2BSXA 4M7WA 3FUCA 4LNAA 1PK7A 4GKAA 4GMHA 1C3XA 3KVYA 3EMVA 4R2XA 1M73E 5CYGA 3BJEA 1JP7A 4BMYA 4K6OA 4TXMA 1VHWA 5IU6A 3K8OE 5F7XA 3ODGA 5CXQA 3K8QA 5B7PA 1JDUA 1SD2A 1Y1TA 1CB0A 1YBFA 4L0MA 3ENZA 3EEIA 2HRDA 1OU4A 3UAXA 2QTGA 1B8NA 3EUFA 1PKEA 5F7JA 4KN5A 4H1TA 1JDZA 3OOEA 5CCEA 4LKRA 4D8XA 2XRFA 4JWTA 1OVGA 2GUWA 1VHJA 4G41A 3PHBE
chains in the Genus database with same CATH superfamily
3V1LA 1ND5A 2FW6A 2GYWA 2GESA 1XZGA 1WF6A 1ZK0A 2WFZA 2DVMA 2ZRLA 3DXZA 3FJ1A 1KDYA 2IEAA 2M98A 4S0ZA 3G0DA 4NYIQ 3HFRA 1I30A 3N7UA 3TM5A 2GJSA 1JLSA 2ZE6A 1AF7A 4JWKA 4X6UA 4ZJPA 4ZFNA 1KAOA 2W98A 3L7MA 1D9XA 3PQ5A 4YONB 4IILA 3ZHXA 4D98A 1YASA 1TQHA 3FUXA 3K0BA 4QQRA 1M2JA 2IEDA 1DAMA 2RGNC 3FNEA 4I5IA 3QKTA 2EBUA 3HTXA 2BUCA 2FWPA 2QROA 3KXKA 4PYIA 5BRNA 1ZKMA 1ZNXA 2YWHA 2H7YA 3KTDA 1NRIA 3HUEA 3GLIB 3ZN2A 1BQ4A 5JOQA 1GNQA 1KK0A 1V7QA 3U1TA 2GA8A 2HSJA 1YS6A 3IVRA 5IVDA 4C21A 3GHYA 3I04A 2AEEA 2IZ6A 2I3GA 2QVLA 4NCHA 4PPGA 1V71A 3RYIB 2CVQA 3ENWA 1FNMA 4TTTS 5TNXA 2GJ8A 1OY1A 2GKGA 4C9BA 1QYVA 1X8KA 3FWNA 3Q7PA 2HR1A 3G9QA 1JHAA 1T15A 4QO7A 3EGVA 3COPA 4WCVA 5EKXA 2QU7A 3O3OB 3IE2A 1D0VA 1LFAA 2JLAA 4BLTA 3VI3B 2C97A 4XE5A 3EW9A 3E23A 3S55A 3BFVA 3TFWA 3ZHYA 4AZ3A 5JS1A 2PJDA 4NMLA 3P0FA 3ZJTA 1SUEA 2EKBA 3OEYA 821PA 2VQ3A 2NYVA 1KIAA 2FDCA 5JVDA 4JJ8A 3OFVA 1BKYA 3X1WA 4YBZA 2GRJA 3DA8A 2JZOA 1AQ6A 1UBJS 1UXHA 1DBPA 4R6WA 1MQ9A 5G1OA 1GV1A 4EYOA 1DAOA 1BCSA 4CMJA 2SCUA 3T9CA 4NPHA 4JHLA 3TN7A 2GD6A 2Y68A 1N8KA 3A26A 4IOJA 4Q3AA 4B82A 1U7ZA 3KDAA 1WE2A 5FLXA 2X13A 4IV5A 2O5VA 1QOQB 3MJ4A 4DMRA 1PSZA 2ZYGA 2ZB7A 3G9ZA 1W1UA 3EXEB 4AJHA 2IIPA 1LKZA 4E30A 4UNRA 4AQYB 1M6VA 1AT1A 2YXLA 3BFJA 1JSLA 4NE2A 1ONNA 3RBXA 5I5EA 2JD1A 4OHYA 3PPIA 1X1BA 2C7VA 2F1RA 1MA0A 3OMXA 1SQ0A 2FZ4A 3TB6A 4MWBA 3K5HA 1OKKA 4CL0A 5L45A 3OE5A 2CNLA 1ZEJA 3C3JA 4EFKA 3X43A 4IV8A 1FX1A 1YWGO 2JGEA 3AFGA 3KVRA 3P0EA 3GMIA 1L7EA 1QBGA 4BXOA 1GZVA 1PD0A 1V3TA 3JZFA 2D4HA 1GAWA 2R2AA 3FIJA 4NOKA 4NNJA 3IHTA 3ZCXA 2V6FA 1UJ4A 4JVOA 1SWWA 1VKOA 3OJCA 1MO4A 3OO1A 3AP3A 4LWQA 3CG4A 2MIIA 2VRNA 4M0EA 2OBYA 1P1CA 3FOCA 3TOZA 2O6HA 4CMIA 4NBLA 4LY3A 1U7PA 3JQ8A 5BSTA 4KDRA 1H4TA 1CUFA 1R15A 4L0CA 1SXIA 4O1IA 5C9ZA 2Y1GA 4DB2A 3WV5A 3FYTA 3ONDA 1HEYA 4I81A 3LBFA 5FR1A 4Q19A 5FL7D 1RI2A 4E4YA 5AVQA 2WHEA 1QVAA 3NJRA 5DNDA 5B64A 1C9YA 2ZAIA 3RUAA 5D1NA 2O48X 1ZM3A 3ZQKA 1V11A 2BHLA 2P68A 4KCGA 5JVDB 1HFEL 1KZ7B 2V7PA 1M7GA 4UD2A 3H2BA 2JIPA 2HO4A 5J59A 5T8KA 3CT4A 1OBCA 3SBOA 1BCSB 1ENYA 4XUDA 1KYIA 2SCUB 2P3QA 5IJAA 2QMUA 2X40A 3QUQA 4Y8VA 4YJ2F 3JXEA 1SG9A 3V48A 2L19A 3E9YA 4DZRA 1YL5A 1ZGBA 4IGAA 4EHFA 3TLXA 3NATA 3WBBA 1G21B 1R8YA 1TU4A 1GAEO 5CVUA 4ZDWA 2H00A 1FDTA 3ZDBA 2ID9A 1M72A 5KUTA 1NW9B 2D1YA 4YJ2A 3QK7A 2BEUA 2IU3A 2F59A 4O8CA 4BQQA 1Q16A 4OJQA 1ZONA 2DAPA 2RGXA 1YGPA 3GJ8A 1HMYA 1PF7E 3PWSA 3S99A 3UWMA 5LQKA 4JUCA 1DOZA 4WFKA 1E3DA 1LS6A 3NT4A 2GZDA 1JHXA 3F3YA 1O9GA 3CKLA 3I01A 3QP9A 4WKBA 3B52X 2UV8A 4LBYA 3LWDA 2FPMA 4MV0A 5JROA 2FX5A 3HJGA 3DT6A 4HK4A 3UMBA 4BXOB 1N6OA 3EAQA 4H77A 3WKEA 4Q18A 3UTCA 1S8OA 3RVMA 3C70A 3DNFA 4O2RA 1JYSA 2YOHA 3KZKA 1KXJA 3ELDA 5EKTA 4P7BA 3RQIA 1M76A 2EQAA 2UYOA 2C4NA 2WWRA 4HXYA 3RU7A 3WGHA 4YMWA 5TQVA 2E37A 4O4HB 2XUHA 4QM7A 3EXIA 4F4CA 2MCFA 2ARKA 1RYFA 1E2LA 1EVIA 1P2VA 2R5NA 2ZXEA 1V7CA 1F7UA 1Y81A 2GI4A 2HAEA 1YZKA 3D6AA 3RPEA 2A9RA 2KYRA 1LQ2A 2WJGA 2AYYA 2Z3VA 4WBSA 1ULBA 3KEMA 4QUIA 4ZC1A 3BSYA 5AKIA 5B7NA 1T3ZA 5TARA 4QATA 1SC9A 4XKJA 2A5GA 2QM8A 2PRYA 3EK2A 5J5AA 1N57A 4II2A 1MOZA 3SYLA 1Q7GA 5F52A 3MBKA 4R2WA 2D6FA 2EL9A 2COKA 3H5VA 1QV6A 1VSVA 2WILA 4AMVA 1V11B 3E8MA 4IOLA 3M8KA 3OZCA 3O0TA 4LSMA 3ZH2A 4B4VA 4PGMA 3PUVA 3JWPA 5C8YA 4NX2A 5DO9A 2PXHA 3UYKA 5PGMA 1IUNA 4C0SA 4BEBA 5HZHA 3TB4A 4XVQA 1T9KA 4TS3A 1V95A 4EF5A 1A9TA 1UFQA 2PSEA 3BVPA 1Z2PX 3DMTA 2QTNA 3JS5A 4FUTA 4IXMA 4QAQA 3UC9A 4EBFA 4XIJA 2GPWA 1PWZA 5EINA 3E5HA 4DNXA 1V47A 1VG9B 3BICA 5FOVA 4EB3A 1R12A 5EAIA 1KO5A 1U11A 3DOCA 2GF0A 3VX4A 4BJ1A 2BF7A 4F9GA 2UZ4A 1JFSA 1O94C 3ND5A 2HT6A 2PGJA 3LHIA 4KBGA 4LBVA 4IKOA 5HIAA 2PS9A 2ZJOA 1RKQA 4RXMA 2WV7A 4R8MA 2KW5A 2QM3A 3NIDB 4MJ7A 3W8RA 2GEBA 2QE6A 4QOHA 1VRCA 3MT0A 5ISMA 1QO0D 2GNPA 3R4VA 2BGMA 3SYRA 2RB4A 2G82A 3SZMA 3CH6A 4KLNA 4PQYA 3DT9A 2PQMA 1GTZA 1PQWA 3LGSA 4O29A 4G0YA 4PR0A 3D3NA 1EGAA 4GMKA 4DLBA 3FVRA 3BHMA 3R5HA 1W0KD 4U2BA 2ZPTX 2R9VA 3KR9A 3EXIB 3LH5A 4M8IA 3S6JA 4F56A 2X7XA 5C1DA 4ARUA 1KRHA 3CLHA 3QVMA 4LDQA 5ELMA 2J3JA 3QW2A 2J9YB 5CLGA 5FH9A 4HH0A 5BORA 1V5GA 1ZXLA 4ZVMA 3IKJA 3CVWA 1ZW1A 3QMPA 1JQJC 1KO7A 4LVNA 2PU5A 2PMWB 2RBKA 1NXXA 4V24A 2FSUA 3SP1A 3W90A 3E7DA 3WMGA 5AW0A 1BN7A 3MGGA 5GVSA 3VZCA 5I3ZA 3ZWOA 5ALLA 2IUTA 3ZWAA 3UANA 1EEHA 1PYGA 3H2HA 3E03A 1Y8RA 4NBUA 5E9QA 5H9VA 4AJ9A 2G0TA 1RCFA 4M9SA 3R7AA 4AX4A 4UHEA 4FNAA 2YVUA 3IPAA 3SN6A 1BH6A 5F12A 5FLYA 1NBME 1NN1A 1K7XB 2EEZA 5F78A 4ZCPA 4LDZA 4OHFA 5E7IA 3CVUA 2WPDA 2D1SA 3BMNA 4OY3A 3ED1A 3TMKA 5KDDA 1OPRA 2C9BA 3P27A 1Y5NA 2CV2A 3A3PA 1V8PA 1K98A 3OHSX 1AMNA 1YK0A 4PFSA 5A0FA 3WWPA 3LBYA 1UOEA 1U0JA 2V54A 5DW3A 1NYQA 2VAPA 3BB4A 3WQHA 4M76B 4A4DA 1VBNA 2VOEA 3FOFC 5H8WA 1XTUA 4PVDA 4DG5A 3WRXC 3PNSA 1A7UA 4NZOA 3ESAA 1KGSA 4HGNA 2XCTB 1I7PA 1BOFA 5LUBA 2X58A 1EHYA 3DDCA 4FFPA 1J25A 4KPGA 3ECSA 4HNSA 2PJZA 3A6LA 3C7DB 4PCAA 3ED5A 5CYFA 5DLEA 1HT1E 3N2GA 1W2HA 2C2BA 2X1HA 2PZMA 1GZ7A 3UB2A 2JAUA 3RG8A 1NTOA 2QTVA 4FSDA 1U6JA 3ETHA 2W43A 1VPTA 4RZ3A 4BNYA 5FUVA 3PEWA 4RU1A 4EHIA 4ZVNA 3T3NA 1KY3A 1RI3A 4JJAA 1QONA 2FMFA 2ZRJA 4FLFA 4YRDA 3K6SB 1VIMA 3OFJA 3LKVA 3CBQA 1WM1A 4FT2A 4L28A 5TT0A 3PDJA 4PIPA 5K4GA 3M6AA 1YB7A 2IOFA 2VSFA 4RGBA 4Z54A 3RC8A 2IFTA 4DR6B 1TA9A 3K1TA 3ENVA 3DT8A 4YRTA 4XCXA 4MGHA 3X1XA 2ZJ1A 5A4AA 5K45A 1FZTA 1ACMA 3KZNA 3W5JA 1D07A 4L8FA 4R83A 4MW7A 4B71A 4X20A 1UBUS 4A92A 4U6QA 1FZQA 2IY9A 4LOKA 1RR6A 1TVEA 3CLTC 5EIBD 2XMRA 2GD2A 4ALMA 4TPKA 3FGPA 4DEVA 3U5TA 1LU9A 1W0JA 4PY2A 3R0QA 4R98A 5LU8A 1NDHA 2EQBA 4WFQA 2Y1XA 1O0BA 1KKUA 1NVFA 3FVVA 5K3FA 4EFMA 5GIOE 2ID8A 2IKQA 4PWZA 2AN9A 4NFSA 3D4OA 5BQXA 1S2NA 4BQFA 1UIMA 4DFDA 3IP8A 2E4WA 4UBLA 1IIRA 1BWQA 3JYQA 1NUHA 2GJ4A 4F2WA 1T4BA 4URUR 3B3FA 2GCOA 3OT1A 5HEKA 4EG8A 4P4GA 1ZA2A 3EPHA 1ONOA 2FFJA 2KWIA 2O2JA 4U2DA 1RPNA 4C1BA 1QCZA 2P90A 3GFOA 3RUFA 1N2HA 1W94A 1L9XA 1XU4A 2V3WA 3ITDA 4X94A 5EIFA 3V2HA 3O03A 3HQ4O 1KJ9A 1SBHA 4V0OA 2FPKA 1B23P 1Z4LA 3FB1A 1Z17A 3AR6A 4PXSA 5IM5A 3JVDA 1A9SA 4UCFA 4BVAA 1RXVA 1A0OA 1PT5A 4CTMA 3AHHA 3STUA 2JAHA 4I19A 2Z09A 1QGDA 2XT9A 4LX8A 3IVGA 3NDJA 4OU4A 4EX7A 5KOHB 3AHJA 4J90A 1LBHA 4WRRA 1E7SA 3HA7A 4QUHA 4N5DA 4CNBA 2QTVB 1H85A 1ZJ4A 2PUVA 3OJOA 1L5RA 3IEPA 1A98A 3E9NA 1R5JA 4OM7A 1MT3A 4MVXA 1QFJA 5HP4A 1NVKA 3O4VA 5FKJA 3T9EA 1E9AA 3LQKA 1GZ6A 5AK3A 1E3EA 4U7JA 1C7IA 2O3QA 3OM8A 3TQQA 1NPDA 4GSKA 4K9OA 1CT9A 1IHPA 4IZOA 2W2LD 2A59A 4MZXA 4P6VF 4MPPA 3ZHCA 3ZLTA 1FQJA 5K99A 3EQ6A 3Q87B 2P9EA 1SBIA 4FK8A 2FGKA 1MORA 1GKYA 2PS3A 3BH0A 3M7IA 3OHMA 1IN8A 1RABA 4M1ZA 5EL0A 1U65A 1T36A 1SBTA 1X86B 5F1PA 3FI9A 1UEXC 1SVIA 1G42A 4UREA 2XZLA 3D7NA 1MGOA 2A4MA 3RK4A 3O73A 3ICWA 5LJLA 3EXHB 2QB5A 1VLHA 3GJ7A 2AJBA 2GM9A 5EP4A 3L9WA 2IS6A 4QG7A 2AJDA 1DJOA 1Z4JA 1EDBA 4JSRA 3VNUA 3MGCA 3LZCA 2PD3A 3EZXA 2UZ1A 1F60A 2RI0A 1GA1A 2NZXA 3GJYA 1KF0A 3G82C 4UQPA 4A73A 3QBTA 5AW8A 3MRVA 2GCOB 3HUTA 3NHJA 1OBVA 3OT1B 4MJXA 3EIXA 5A4DA 2J5RA 4KQEA 2OXTA 1R88A 4HB0A 3BXEA 4MUYA 3EBOA 4DC0A 3BMQA 2R8BA 4N7JA 3IDQA 3CRQA 4G86A 3AEKA 3B6KA 4D4KA 4G5XA 4Q05A 1DXYA 2WG1A 4MZDA 4Z4GA 3EQ2A 5SZJA 2PUGA 3E7FA 4JITA 1Q7EA 4ZEMA 3VOTA 1E2UA 5LR6A 1SZCA 2QT9A 2NVWA 5CH3A 2RH4A 3DP7A 5KDLA 1YUNA 1G5TA 1XTQA 2GD1O 1OIXA 1WCV1 2DKNA 2W2KA 4QUDA 5E3IA 3F49S 2EBFX 3MTQA 3R7WA 4L0MA 1QV7A 5A0TA 1SXJE 2ZK7A 3BKWA 3VQTA 5TMPA 1I5EA 2W6JA 4KXLA 1D5CA 3HGQA 5IVIA 2QRZA 3UB3A 1G4AE 1JZSA 4F06A 4YCLA 1K7YA 1QE3A 5IF9A 1A95A 5CNKA 2DBRA 4J6FA 3I9V6 4HRYA 4EAQA 2WT4A 4B7AA 4J75A 2CK3A 4FHGA 3L7AA 3PXCX 2FLWA 2ZSDA 2W0SA 3MNFA 4KYTA 4MRNA 3LYLA 3LTEA 5KX5F 3FSJX 3FKQA 5EUCA 1ZU5A 3D3EA 3MJSA 4UTXA 1DKQA 1I36A 2C4KA 1LJUA 4DSTA 5BRAA 1P91A 5B5SA 4FC7A 4AT1A 4AP5A 1O03A 2V8BA 1GGFA 1P0IA 1T36B 3FHLA 3G2OA 3HC7A 2XDWA 3PPYA 3LS2A 4GDMA 1OI3A 3IR5A 1FFBA 3F74A 4UVDA 4WCFC 4EO9A 5JMTA 3DMPA 1JBEA 1KY5A 2VWHA 5FD8A 3L2OB 2JPDA 2ZZKA 3Q3GE 4BO2A 4PS0A 4M1QA 4N82A 1W4CA 3CTMA 1G66A 1G0NA 3BWXA 2V9PA 3E1GA 3BGOS 2W8BA 3K96A 7ADHA 1AO3A 1ZD2P 3QQ5A 5IC5A 2JL1A 1QGED 5K8VA 1ULZA 4BUZA 1W5EA 2UZ1B 3U2QA 4S1VA 4MLZA 1SY7A 2WJWA 4FYIA 4CMHA 5LZ7A 2NIPA 2DRIA 5L51A 4Z1MA 1L8AA 2HPAA 4DJJA 2OXRA 2UDPA 2YMPA 4BNZA 1VHQA 2OGSA 3CUEF 1GCOA 4YPFA 3ZGZA 1RYHA 1JIQA 2XMCA 3HBMA 5DYGA 3ZQJA 1C14A 3IKTA 1RBMA 4R0VA 3IV6A 1IBKB 3H9GA 3VKHA 2VNAA 2FSFA 3R6TA 3P2OA 4GC5A 2FH5B 2WFAA 3SJBA 5I48A 3OUUA 1RE1A 3G2MA 4QDKA 4FYXA 4K6CA 2W2KB 5TT1A 3N3AC 1RNLA 3GLHA 4NYMQ 3R7WB 2OCPA 2KBFA 2DFDA 2JF0A 3L4EA 4E46A 4UHHA 3AZOA 4R7GA 1T4MA 4CLRA 4LF5B 2SBTA 3P9QA 1LRJA 4FNGA 2JLYA 1WW8A 2H4WA 3ETGA 3A1SA 2H1VA 3E82A 1YRWA 3KJGA 1MG0A 2OSVA 1IBSA 3BRWA 3FUTA 4JC5A 4C4YA 1YDMA 3DZ8A 4EB8A 4J94A 2V1XA 3DDNA 1OTHA 3U9TA 1QQ5A 2A9OA 2F1OA 3QSYA 2EIXA 1Z62A 2WWVD 3WWOA 4NPCA 1O5TA 4RLSA 5G3ZA 5C8YB 4QU9A 3NFYA 4OGGA 3VHXA 4C7VA 5HKKA 4AJ1A 4PC1A 4DLPA 1KJQA 2V4UA 4LMPA 3FRHA 3K4HA 4TXLA 3E22A 5K03A 2YIDA 5KPDA 1YDGA 4F2PA 2W8BB 1FS5A 3HB9A 2O2HA 4KXQA 1IBLB 1C9JA 2FR8C 4YJ3F 5ADUS 3DBHB 3DMFA 1XZKA 4NZPA 5CPFA 2R85A 4NV3A 4E07A 1QPBA 3Q6IA 3K0KA 2D5AA 3GJTA 3MXOA 4FD2A 1YD7A 1PR2A 4MCJA 4ZV7A 2PGOA 4ENVA 4MLCA 3D6JA 4YJ3A 1M1NB 4WK4B 4QPZA 2VF7A 2DUUA 2YXDA 5HA5A 4QIHA 2HZ7A 3A28A 3OUZA 2HRRA 1ZH2A 1OFTA 2XT6A 3JAWA 4P22A 1B74A 3IALA 1SXHA 4KGDA 4ZQFA 3SR0A 2C57A 4XPIA 2V7WA 3SS8A 1T0BA 5CFNA 4K9KA 4ROSA 3L7LA 1VE3A 1M8GA 1JHUA 3D7SA 1FCJA 5D5QA 2BELA 5DGCA 3KSMA 1DINA 1O6CA 3FMVA 1J00A 3GLHB 2O5CA 5DHRA 1QHHA 3T52A 5DNVA 2HGSA 3BILA 3EZYA 4O5OA 4DUGD 3DAPA 4LYGA 4CLRB 1AA6A 1XA0A 1ZQ1A 5ALGA 3R3VA 1A27A 1ODCA 1TUGA 2YZKA 2VJYA 3EZNA 1CDDA 4BNVA 4EVRA 1Q3HA 5J4YA 1YDFA 3AXSA 3VNBA 2WKRA 3Q7EA 2X1VA 3C5VA 3PFKA 4FFSA 4DLNA 1RWQA 3G9UA 2QY9A 3Q7IA 4QWMA 3ZE6A 2FEAA 1AJEA 1GGNA 1TF2A 1L5OA 4Y0VA 2FQ1A 1NONA 2OGTA 4JUAA 2WF6A 5A06A 2DXIA 3WDLA 1H2HA 1LA2A 4U02A 1CY2A 5SY6A 4PZ9A 2AX3A 1QG6A 1PG0A 2RMKA 3IAAA 1PYDA 4ZRDA 3UC5A 2KI5A 3NETA 2IY7A 1ZVKA 4IDQA 3ZW8A 4FX2A 5LQRA 1CUAA 1Q1QA 3D8TA 3DLTA 2BC9A 3GNTA 4RD1A 2XV1A 2XYPA 1IM8A 4I1RA 4MKXA 4RZHA 2RIPA 4TN1A 2O57A 3OFSA 5CT8A 3NEYA 2OCGA 4C7JA 5KQRA 2VWPA 4X66B 3JQCA 1TO1E 3E22B 4F4JA 2ZQYA 1JQ3A 4DSAA 4YI3A 3OPNA 4P86A 3HXTA 4QM6A 3PNKA 4EUFA 4R7TA 4NMHA 3HU1A 1QQBA 3K9CA 1XZLA 2R8XA 2EWVA 2W6OA 3AONB 2PGIA 3CLUD 3LDHA 2Q6VA 3B6ZA 3LU1A 4GHWA 4M99A 4OEHA 3NVKI 1A72A 1W6UA 2X4LA 3RHFA 1YA4A 3K70C 2H18A 4JYCA 4BWYA 1OBFO 3A1WA 4YJGA 3F5DA 1Y5IA 1DAIA 1GCAA 2IHTA 3MWDB 3DWFA 3AR3A 4YFVA 5JNTA 3JAWB 3HNPA 2GAAA 2VF8A 5ALZA 4XPIB 3F97A 3UAGA 2C2HA 2RAFA 3Q41A 3TI9A 3RVRA 1X3SA 3LP6A 3GFTA 2H7XA 1WP4A 2OD2A 3DTTA 4MW1A 1NC3A 3GRRA 3TUIC 2ZI6A 5BPFA 1QHHB 1EZ1A 3QEJA 3RRMA 1W29A 2B0CA 1T8RA 4CCAA 5KREA 1HZZA 1RFLA 4P82A 3WGMA 4OQQA 2PCLA 4JBYA 3DXXA 3H3FA 4Y98A 3R5TA 5DBGA 4Y30A 1T0UA 4NBKA 4JFAA 4D8UA 3ABOB 5IWAB 4H3VA 1TZKA 1U9JA 2BWJA 4CL3A 4ALIA 3N2YA 3WGIA 3DF9A 1XEWX 1PBNA 3KE8A 2PJUA 3P2YA 1FEZA 4DABA 3TW4A 1SCIA 2O2XA 2PLAA 1U90A 3NAMA 1T0JB 4LVCA 1Y4ZA 1W7AA 3RABA 3UOWA 1QFYA 2VYVA 2W0MA 3ILYA 3MS2A 1ODLA 1XZMA 5CXSA 5G0WA 4DIEA 2AOWA 9GPBA 3DTVA 5BO5A 1F7VA 1GUFA 3LT1A 4A10A 4EB6B 1K89A 2JGKA 4HTFA 2A1TR 5A6SB 2ZJAA 4D0LB 5K9ZA 2VRCA 5JTUA 1GUZA 4HYEA 5FTMA 4MPDA 3WLSA 1JEYB 3SMVA 4COKA 2A6PA 4PS1A 3GGDA 2NZUG 4QREA 2AKAB 1IM5A 4L51A 3GAMA 4D44A 1SM4A 1WULS 1Z4KA 2JIQA 3DR3A 2YVKA 3HCFA 4Z9XA 3QU7A 3TG2A 3UPUA 2DB3A 2NO1A 2CFSA 4B83A 3O75A 4NK4A 4ZIRA 1LX7A 1ZOSA 4R1OA 4I4TA 4MO9A 2OPHA 1C1HA 2P5SA 3WR5A 3SHVA 5BMVA 4F46A 3CG0A 2GK4A 4QXPA 2R6ZA 1GUAA 4YK7A 1L1QA 1GGHA 3C6YA 3DQPA 4YJGB 3GRUA 2EXXA 2WE8A 1LLCA 5BSEA 1ADGA 1DIGA 1RTTA 1H2BA 1OIWA 4B3TB 3VYWA 5GAJA 1SUWA 3NUGA 5H3LA 3U80A 4C7OA 2JARA 5TC4A 5PNTA 3UHOA 5BN1A 1F2UA 4D1YA 2XXJA 1N75A 3GBPA 4DUPA 1YVPA 2DT8A 1Z45A 2AEJA 1XZBA 2GVNA 3I5YA 2ETXA 2O8CB 4J0FA 3LQRA 2IWHA 1G2QA 3E2MA 4L5IA 1TLLA 3H1BA 2VDOB 3TL3A 3HCBA 2Q2VA 4ERNA 3EZGA 4MICA 2FUG6 4S1WA 4C78A 3WG9A 1EE1A 2M6LA 3PRYA 4KQ6A 3EEYA 4Z5XA 1E9RA 3IIKA 1ODTC 4HDAA 4OXKA 3LX8A 1VJRA 3SM3A 3R75A 5K2OA 4GVXA 4LTMA 3ZIDA 1CZHA 4JJGA 3ZWNA 1P29A 1QK4A 3ETJA 4DA7A 2IA5A 5AJVB 4YXWA 3U4GA 3JQFA 1W5TA 2D7JA 1IN7A 1JFLA 1E5DA 3NGLA 4YCAA 2CLIB 3TTVA 4ZZ0A 3FYUC 1Z0SA 3CNQS 3L02A 3DTVB 3KT0A 1TK3A 3QG1A 5CW1A 4Y9DA 4ZCQA 2O5EA 1L5QA 1ZSYA 3GLIE 4HTFB 3AL3A 1XHEA 2G09A 1IDOA 2X41A 5HCIA 1JQAA 2GLXA 3KALA 5GONA 1Y9AA 3U4IA 3LP8A 1HDCA 2V6IA 3I73A 2ZTLA 2PWYA 2XI4A 3LCMA 1MJGM 5FO0A 2Q1TA 1PR1A 3I9V1 5EJGA 4E08A 1JWLA 4JL5A 1PR4A 4LFBB 121PA 1SC3A 1XZEA 4MI9A 4P7FA 2VSXA 3CUWA 3PXAA 1QB8A 4MUXA 1CQXA 4I4TB 3TD6A 4XJTA 3H11A 5BMVB 4ZI3A 2BFAA 3PNOA 4MDEA 1SZDA 4NABA 2XOXA 3IEUA 1ZS9A 5HK9A 2XBMA 2F90A 3A32A 1MPXA 1BA2A 1DKMA 1TECE 3PNBA 3WGKA 3D8SA 4BLUA 1X6VA 1ZZEA 3AEXA 2WDPA 4I8XA 1CU1A 4XGKA 1CY6A 1KI6A 1Y3IA 2Z56A 4C7OB 4HP8A 4LJ4A 3K0EA 3HJAA 3HH8A 3DSRA 3TZEA 2YXNA 4ZC8A 5FJJA 5T57A 4KQJA 2QAGB 5IANA 3GQVA 4JAVC 4HQNA 1XUOA 5DLDA 1H4VB 1LJ8A 5JD6A 2M6SA 5BMOA 1KU6A 4KH0A 1AXEA 3GLTA 1HK7A 2GNOA 5L7YA 3VR5A 3V5NA 1LBSA 2V7UA 1JR3A 2HA6A 4TRJA 5CDYA 1AC5A 3PUXA 3JTEA 3P97A 2A9PA 2ONCA 4W7IA 2NO0A 4IF4A 3DL4A 1WDMA 4H6VA 4ASUD 4KQ1A 2HJVA 5AOAA 1EINA 4ESEA 1FFEA 3PX3A 1BQEA 3NB0A 2FZCA 4FNMA 4JKYA 5E8JA 3TJRA 1T0HB 3ETLA 3LZ6A 4N65A 4EI9A 1NW7A 2QG6A 5CB8A 9LDTA 1FFSA 1DI0A 1UCFA 3C3WA 3M5CA 4Y1FA 4PHGA 3LCUA 1DTSA 1L4YA 1UMBA 1JEJA 1H66A 5DISB 1FA9A 1EJBA 4HX2A 5GONB 1QHYA 3W9YA 2MINA 3IV9A 1WUJS 2VUSA 5AJHA 4RD2A 5B4UA 2J59A 4GBMA 1W5SA 3SE7A 2PSSA 4OOEA 4C4AA 1IAQA 1RAAA 2QVBA 2P6UA 1GTG1 2O50A 4OSOA 1DU4A 2GZ3A 2UUAB 2CZQA 1H2AS 3JVEA 2GGSA 3V4LA 1UBTS 3ZG6A 3AR5A 2ZJ7A 1O2DA 2EZ4A 1R0SA 1OSNA 1CUEA 1U4NA 2WAYA 3FZYA 4NIMA 1SA0A 3ZWYA 1GR0A 1QTIA 3G2PA 3NAQA 5IDQA 1LLDA 4N0EA 1M0TA 1RLJA 3VNAA 5KVAA 5IVKA 1BRMA 1S7CA 3MGAA 2JFGA 2EFHB 2QBYA 5LZ9A 5K0SA 5CUQA 5H1YA 1II0A 5JZSA 4C2BA 4GOMD 5KZMB 3WRVA 1APBA 4MPTA 3IEVA 4LZAA 3GLKA 2QYSA 1MF7A 3G0GA 4MV3A 3LHFA 3TIGA 2A0KA 4IDNA 4MP6A 3ONWA 1G21E 4HDKA 4Q02A 3ELBA 3WL6A 1KPGA 1OWOA 2WA1A 3H5RA 2V5AA 3UB4A 3VPBA 2Q2OA 5TEVA 4A2CA 1KP9A 1VPVA 1E1CA 1FNSA 1UBOS 3LK7A 4W9NC 5EIXA 5DT9A 3HLTA 5KTPA 1RYBA 2CN1A 4E1BA 1QB7A 1W44A 5B30A 2HMVA 4YJFB 4GU5A 4US2R 1N2GA 2J6HA 2KLBA 2J33A 4FR0A 1ZN8A 5LWQA 1JDJA 1H5NA 3GEGA 4P81A 3WK9A 3QXCA 2XDYA 3I4LA 4NZ9A 4YP1A 4CG3A 1ES9A 4OJYA 3KZ1E 4UXIA 3FHOA 2OVFA 4EJFA 3QPAA 4OAOA 1PIWA 1DAPA 1M7BA 1C1XA 3OPQA 2C5BA 1XVAA 2F67A 1OLXB 2W22A 2FRXA 4QTUB 4UTPA 1I4WA 4BMYA 5HBRA 1T0PA 3T5AA 2ZS8A 4EIWA 2RHCA 1DKOA 4INZA 1GQQA 5B1YA 7REQA 3GP5A 4MAAA 5DBFA 3RNLA 4CTNA 2UYQA 2MINB 4KBFA 5I4KA 5CG1A 1ZD9A 1WZNA 3RSOA 1DE0A 4TSRA 3B1XA 5B53A 3SBXA 3TFOA 2NGRA 4UZEA 2EHJA 3K8QA 5IUKC 2SECE 2H3EA 2QVXX 3ZVKA 4W1QA 2NQ8A 1N6NA 1GPAA 4GSLA 5GM1A 4BZQA 1EFUA 1MQ8B 3BC1A 1R6AA 1UUFA 3L0DA 3GAZA 2ZBDA 2HQRA 2PX5A 1H65A 4KXMA 1QRSA 4KLCA 4TYWA 1Z6PA 2JIZD 5JSZA 2OBBA 1C7FA 5EQFA 1P7YA 4N6NA 3UK7A 3NEAA 3I1JA 4TZKA 2O2DA 1AKYA 1D04A 1RBZA 3VOBA 3QI2A 4G1UC 2PQ6A 3WKBA 3ZDQA 1NNUA 4FEEA 4CYMA 3M89A 1L1RA 1TJ3A 2MTBA 3AWDA 3CMMA 1XRQA 3ON5A 4G26A 1SCNE 2B35A 4MQBA 3BIOA 1T6BY 1TXGA 4KXXA 1NBHA 4LY0A 1MFPA 4UHCA 3LUKA 4GNRA 4HDKB 4W5RA 4KNYA 4G5RA 4QJ5A 1GN9A 4IZ6A 2BCEA 1ZFNA 2OM6A 4R7ZA 4TQ9A 4DY6A 2R44A 2WNHA 1YOBA 2HSEA 4FGKA 2FX2A 1E1CB 2VZ8A 1E2JA 2PMFA 1F38A 2NZ2A 1MHTA 3B70A 1T8PA 4ZQHA 2X0KA 4GLLA 2GYYA 5C52B 1V5IA 3IMFA 3K0SA 2FEMA 2ZBRA 4BEWA 1YOVA 3O3MB 3TSCA 2OCXA 5I7SA 4PZUA 3B1FA 3QOFA 4JD5A 4UNIA 2J07A 2XECA 1T8UA 5KYUA 4GRDA 1KC3A 2WSSA 1L1FA 2RGWA 2Q9BA 2YBDA 1FYWA 1C1XB 2DR0A 3LHDA 1V5FA 2C2OA 4RMHA 3KDSE 3I42A 3R3UA 4L0DA 4RIIA 2HWUA 4B09A 2ZIAA 3NYQA 1LUAA 3VSDA 4XIFA 3BWYA 1X1DA 1XZHA 2ZSAA 3IJEB 3QFFA 4L5JA 2QLBA 1EU1A 3IPXA 2I8LA 1Z28A 1MDFA 2OWEA 3P2JA 4F72A 4FW9A 4GPEA 1GA6A 5A9RA 4ESVA 2R8ZA 3VHQA 3H2JA 3OWXA 1PFVA 1Y9DA 2PMCA 2I2BA 1PLKA 4PQGA 5E7MA 3PX7A 3L92A 3VO1A 5E3HA 1NMEA 2G1KA 2QX7A 2X2FA 1PUIA 1NE7A 2CBZA 5EJAA 3HP7A 4BNDB 1PFGA 4XFKA 4R8KA 4X63A 1I5OA 1LDNA 1P7WA 4DBZA 3W5AA 4RS4A 2XTAA 1GPYA 1YJXA 2EP5A 1Z22A 2OAEA 3S2SA 1FPQA 3GRZA 3I05A 2AUMA 1T9DA 4YI5A 3ZK7A 3T5TA 1TYAE 2D5CA 4BO1A 5JSZB 2YXPX 1JR6A 2AKYA 3HLKA 4QGFA 1NF8A 2Q5HA 3UK1A 3COZA 3V8EA 2NTYC 5DYIA 5AVTA 1DBWA 1E3TA 1JIUA 2E4XA 4TM8A 1E2PA 4F4UA 1DZIA 3A6JA 3OLCX 4TKLA 4YV0A 2FY8A 4G07A 2Y77A 4H1HA 3KB6A 2QLMA 1DBQA 2PT6A 4MAMA 2VDJA 1U0HC 3OKPA 2NYRA 2NU8A 2UUPA 5JBNA 4MUGA 3O1IC 4B3FX 4TS9A 4ZHQA 3SDZA 4PSKA 4BKOA 3IEMA 2PLRA 2A33A 2AW3A 4RAQA 3RRNA 1YS4A 3BIXA 2GH1A 4DQDA 3I52A 3A4TA 3KOMA 1GITA 2A7QA 2D2IA 2ZIFA 4I9UA 4ROTA 5AHWA 1CLUA 3VYTB 1HDZA 1XHLA 1Q2UA 1YOVB 4W63A 4AY2A 2JAQA 4IAOA 1P7PA 2GJAA 4W82A 1AKVA 1EB9A 3P9PA 4L8LA 3CYFA 1NUQA 1XJWA 3USES 3GA5A 2P4HX 3U39A 4AJIA 1E1MA 1X38A 2E4UA 2OOKA 3R2JA 3RAGA 3OQJA 2ZUEA 1Z37A 1N1MA 3PI7A 4KN9S 5B3JA 1YBMA 1E3QA 5B6IA 5K3OA 5CTJA 3KV1A 1E5QA 4O2BB 2GZAA 5I9MA 1YB4A 2FWNA 4HNUA 3H2IA 2XJ9A 4PBRA 2JI6A 1OH5A 3D6VA 4LDNA 2OWDA 5T3UA 3HYTA 4RD6A 2RKBA 4C3ZA 2A58A 2FUG1 3IYLW 1ZSNA 2O8EB 4I50F 3CURA 1C7RA 1L3IA 1SIWA 2H2DA 3TI7A 2XXAA 1TYCA 4QUBA 1SJ9A 1CY1A 2YS6A 4CT0A 2Z2IA 4UKDA 2H4JA 1TKRA 2B1JA 1RC8A 3FTDA 3GLUA 4RMGA 5GQSA 5BY2A 2B99A 4MYHA 2QPTA 2O7RA 4G0WA 2P4QA 3KLOA 4GMDA 1IULA 1C80A 1SKYB 3CNOA 3E8SA 3LTNC 4OP3A 1ZD3A 4YGYA 1WDLA 3GZNA 2PH7A 2ZJZA 5I9TA 2Q5EA 2R7NA 5FBQB 1NXWA 4WZAE 1GT91 1Z38A 3GFPA 5CT9A 3RIMA 3WZLA 3RFXA 5HSGA 1FMFA 5TPZD 5EIWA 1VHLA 4KQ9A 4U8HA 3IPYA 1T1RA 3KUUA 4FMDF 5CGZA 4J0CA 2QSZA 1NKSA 1CF9A 1GPUA 1QVWA 3KKEA 4YALA 4DVGA 3KQUA 1YSCA 4H6PA 2OV6A 3QWFA 4UMEA 3GJQA 3K4PA 3TLKA 2NU8B 4NDZA 2X86A 5I7RA 1HNXB 3CHYA 2YKGA 4ZHQB 4M1OA 3LPAA 4OJKA 2COUA 5D51S 1N4AA 4PRLA 3TRFA 4JBHA 4YR7A 2MYPA 1ICIA 1P4HA 2TSYB 1A97A 3O91A 1TKBA 4RSRA 4EHBA 2OFXA 3S7TA 1UF9A 2WJVA 4AF6A 4MK4A 3NDRA 4FB4A 3N2IA 1PQPA 4E22A 1VQ1A 2Q45A 4TSFD 5L7WA 4KDFA 2R6CA 4EY7A 1YCDA 2AFHA 3NIFB 1VP3A 1FVXA 1B6RA 4L74A 1AN0A 4TLAA 2V7VA 4R1MA 3OESA 4OQXA 3RVLA 2BZSA 1EUDA 1AX9A 4JI0B 2OZLA 2QQEA 2WM9B 5JAZA 1JAYA 3MJEA 3DEZA 4X61A 1M66A 1Q74A 1OI2A 5EWLA 3OICA 4Q4HA 2W2MA 4RKFA 3RRXA 4CL8A 3B85A 4FDMA 2Q8NA 5LYJF 2PDAA 3R77A 5KNCD 1C29B 2J9XB 4Q48A 3QHPA 3IJPA 3M4XA 1NXTA 1LPBB 3GXBA 4RK0A 4BRWA 3HDVA 2XXAB 5FNVA 3ML1A 4NZYA 4Y2QA 2PH1A 3L7JA 2GKOA 2QF7A 4JXXA 5LYJA 5CNIA 3PF8A 4NU8X 4BMDA 2XEDA 4GPAA 4MYDA 3FFBA 1EVQA 4JP1A 3GZNB 3O6VA 3JZAA 1NI4A 2X0JA 1OX5A 3A05A 3RVBA 4CN8A 4D9NA 1K06A 3EUAA 2J0UA 1TLFA 4TQAA 2B82A 4HWKA 1V3UA 2O2EA 3NNDA 5HJ5A 4II7A 4LQ4A 3RE1A 4MRPA 2YFQA 3CLRC 4UD6A 5FL7A 1O57A 1A9XA 1GGVA 3INTA 1WSWA 3GG2A 4D0NA 5AK4A 3L4BC 3WLLA 2IYTA 4G01B 3ZI7A 3CNLA 4HXEB 1W9MA 1Y5RA 4DC1A 1MQAA 4YYZA 3F4KA 5LP1A 2GN4A 3DE5X 3A3KA 1TFRA 3IT1A 1DX4A 4M0DA 2QZ4A 4I9HA 1QUFA 4J16C 1QZZA 3UMSA 4KQ2A 3TEFA 2OGUA 3SSOA 4PSCA 2YICA 1UWCA 5B1DA 1JFVA 4KMRA 3S0JA 1L4UA 3W7VA 5BQOA 3DB2A 3RVJA 4B9EA 3W5UA 4RPIA 3R1IA 3I83A 3AF1A 3LL7A 4G4SP 2AFHB 2Z9BA 5A3JA 3I12A 2IWRA 4B81A 3SLGA 5KINB 4UHBA 5D5HA 1A4XA 3SD7A 4CU2A 4JT8A 3EIUA 2YQZA 4ZV4A 1R0XA 2HUPA 2OZLB 1LW6E 4DR2B 2I78A 1M6EX 1MC1A 2V0CA 2LIVA 2JB9A 3QKWA 5EWLB 4N1AA 2HA7A 4I1VA 3EGEA 1P1BA 4LJAA 4Q4HB 4OGLA 4AP9A 1IY1A 4DV0B 1DXHA 2FQXA 5CU7A 1BFKA 5GZ6A 2CNOA 4LTNA 3IP3A 4G97A 4TXJA 1NT4A 1S02A 4DG9A 5F76A 2FPPB 5FNVB 4MDHA 3UGJA 1QRUA 3SVZA 5JRZA 1P2UA 4FZ5A 2YV2A 2GN9A 2DC1A 3IP9A 3ZGVA 4ZEXA 4HQ6A 3I9JA 3E2IA 4F1WA 2YX1A 2OO5C 4WKPA 1ESCA 5C3MA 1J7KA 1IEXA 1NI4B 3Q0TA 3AVWA 3N6RA 3WV4A 1Z0DA 4MV4A 1KC1A 3QU5A 3ND6A 3L07A 4JUIA 3CW2A 1JG6A 3BGSA 2PG3A 4CHGA 3G17A 3GYGA 3K16A 4XB6B 3UHAA 3V8VA 3G5AA 5CFZA 3L1UA 3R74A 1N6HA 2DSNA 1DO2A 3B7GA 2PUDA 5A3SA 2GEUA 3VJMA 1A9XB 3GFGA 1P9OA 1XQ9A 3JWHA 4I36A 4YAGA 1OZHA 4C0XA 5BUSA 3OKCA 1Z6ZA 3QA3E 2WJZB 4Y6PA 2DPXA 1XZIA 3GROA 4P2BA 1X8LA 2X2PA 4P4TA 1XMIA 2QMHA 3GU3A 3UMCA 4D9HA 2HCTA 4C14A 3B3QA 3LT5A 2I4MA 1CR2A 1JIKA 1GLGA 1N5OX 1E6LA 2DOKA 4YP9A 4MVJG 5AH0A 1GILA 2OBMA 2AG0A 3C24A 2H07A 1WPRA 1TMYA 2BV3A 2QQ0A 1GKUB 4OP2A 3F6EX 1TTPB 1U6IA 4WOPA 3URKA 5IEJA 2WD8A 5DASA 1U3UA 1V6CA 2AI1A 3B9BA 4XDZA 4O4LA 3WL8A 4E6PA 3UMYA 3X0DA 1HQCA 4IIFA 2QRMA 1EVLA 1TTHA 3H7AA 4AVYA 3DKVA 1RQ7A 3NGXA 4HYYA 4P35A 4P36A 1X7ZB 4DLTA 2Q0XA 2H51A 3UGTA 1JQDA 3AL2A 3TVTA 5FI3A 1YAJA 1ZIYA 4E5KA 3W5IA 2YV5A 4YMLA 3SHTA 1RBYA 3WSVA 1DL5A 1I6MA 3S2EA 3N8KA 1Z5ZA 5ICFA 2JHCA 4RHEA 3UXHA 1S4QA 1L8QA 1U63A 1E0DA 1PZGA 1BE6A 1XROA 1KSFX 3OA0A 2BKEA 3FOBA 4I4IA 1QO0A 1SVKA 2GEKA 1U0RA 2HCBA 3G3EA 3EGIA 1E32A 2CJFA 3EVAA 3JALB 1RKBA 3QJ5A 3KB1A 4D4HA 4NDAA 2J67A 4PPQA 1HLPA 1PFKA 1SOWA 2B2NA 1L5VA 1ZMTA 1W0KA 1E3IA 2Q3BA 3B20A 3BXOA 3QSGA 4OHXA 3AERA 2VDKB 4ZU6X 3W4IA 4IDCA 3RFUA 4D8VA 5E1BA 1ABFA 5B3KA 1IG3A 4RVDA 2YY6A 3J7TA 1KH1A 1W19A 2C2ZA 3MIZA 4OHWA 3UCFA 5F9MA 3TR5A 2NUPA 1W2WB 1L5YA 3ZGLA 1G41A 2Q1YA 2Q3EA 3HACA 3LWZA 1MPTA 4C22A 3HP1A 4ACBA 1XEXA 5ALOA 1KVUA 5K05A 1AV6A 1XNQB 1JVSA 1YI8A 1GU7A 3KS9A 4OYHA 3LDAA 3PJDA 4HTAA 4LE0A 1M6WA 2XW6A 4OXRA 1T4DA 4WN9B 5EPOA 3TDKA 4AKIA 5IPFA 3F46A 3M4YA 1BMFD 1XWIA 2W2VA 2EAUA 5DGDA 1UKAA 1YJBA 3L7YA 3IR7A 4JQYA 2WDZA 3EBPA 3WTBA 1E4YA 2ZW9A 1Z73A 1WZIA 4II3A 2NPOA 3VZDA 4K6GA 3NOVA 4BZZA 4HWGA 3V2IA 4ZZ3A 3STXA 3JASA 2M1ZA 4WJZA 1LVUA 2AOUA 2XR1A 4NZZA 4NBSA 4PQRA 3TLJA 1U8FO 2RHWA 1GNPA 2J5QA 5DX0A 2REXB 4DLUA 2C04A 2ZRBA 2OCKA 3HS3A 4MS3B 1ZH0A 4O4LB 2CLMB 4FIZA 4KPFC 2CJYA 3SZRA 3CVYA 2IRWA 4JI8B 1G20E 4F92B 1EX1A 3ITKA 1V8BA 4QOFA 2Q41A 3HEBA 3F7TA 1JG7A 1DJLA 4CT4B 2HN9A 3CLSC 3SYTA 1WBJB 2ZI3A 2JLRA 2QUBA 421PA 4B3SB 2HHHB 5DF1A 4BRZA 2OBNA 2QRPA 4ZAYA 5HE9A 2QTAA 2GWHA 2ZR0A 4ONEA 2O1WA 1TUBB 5EXSA 4TQUS 4J3JA 3QIVA 4JI2B 3OE1A 4Z86A 3RFTA 1UZLA 4YX9A 3RKSA 4KFTA 3ER9A 3GZJA 1JKJB 4K3VA 1DX9A 1ORIA 4F84A 5LP6F 1F0NA 4Z49A 1NG9A 4DYDA 4EGSA 5CR9A 1M2NA 1QS0A 2DFLA 2XTMA 3DGEC 2QUAA 3DFZA 4C05A 3QF7A 5JS7A 1JPUA 1I1QB 1UJ6A 3OLXA 3OLQA 4QU0A 2BAGA 4UUPA 5LP6A 4LNAA 1NQTA 3F6YA 4J8PA 2IBSA 4DR5B 2P4UA 3CPSA 4LYJA 5AWFC 1QCCA 1YF3A 3QUBA 4BVEA 1QAMA 1CQJA 2PA3A 3DDHA 3UMFA 4RDIA 4U6NA 5E0KB 2ZAYA 3M9XA 3OY7A 4QDTA 2OCDA 2GM3A 4Z0PA 1Q7RA 4C07A 1QIIA 2F8LA 1IJBA 3G2LA 2QG4A 3EY4A 3CF4G 4N9QA 4IDAA 4TN5A 3EPKA 1VSTA 3QTTA 3QMMA 2GXAA 3V2UA 1DC3A 1GO2A 5BR8B 2JLWA 4TRNA 2Y1KA 2GXSA 5DXFA 1OGYA 5C8DA 3DBRA 2JCXA 1ZCAA 2H0AA 2AOUB 3WMRA 1MJHA 4E5SA 3PFGA 2RHMA 2B4AA 5TPWB 2RBEA 3A4IA 3FHCB 5DTQA 3IVCA 1MVOA 3R3WA 5CLLA 4F4IA 2YWEA 4E14A 4RELA 2NYAA 4KH1A 4P5EA 2R6GA 5K0GA 2Y3IA 4UMVA 4B40A 3QE2A 2XH8A 2WBLC 4G84A 3BXXA 2OP0A 2ZB4A 5CIWA 2ZRAA 1LPSA 3D64A 2P1DA 1L8OA 1QHEA 3KTOA 3FCXA 4JL6A 4UUOA 3SBDA 1KMMA 2WKSA 2X7HA 1L5ZA 1RQRA 4MV8A 3DOFA 1Z5VA 1XFDA 4LXYA 4RZQA 1WJGA 1WQ3A 4RKEA 1Z25A 4BC1A 1AUXA 5IXYA 4DV7B 1DKNA 1QVZA 3GPCA 3JSXA 3GW8A 2B2CA 4Y2YA 4RVCA 1IG0A 3S5JA 4XVCA 5F7JA 3ORSA 2VHQA 1MDBA 1POWA 1V8OA 4LSWA 4M9QA 5FOXA 5F5NA 1Z4MA 1EX6A 6YASA 2Z2ZA 3JQPA 1GZ4A 5EP1A 1FC0A 3ADBA 1RCUA 2Z5FA 1YCHA 4Q03A 2G07A 4L4YA 2W2LA 3FGOA 2CLSA 4H7FA 4CLXA 2YMLA 2ZREA 5AUOB 5HOQA 4BQOA 4ZXFA 4NH4A 4C6RA 2OQVA 4UM9D 3DCIA 3KXLA 3ZNOA 4B34A 4V3CA 3PQ7A 3ESYA 5J40A 4B6GA 3RUCA 2VQEB 2WAAA 3PHBE 2HMTA 4AY6A 1O3YA 4HL6A 4H6WA 2VHEA 2NXCA 3MC1A 1BZYA 2VI5A 5HR5A 3B78A 1M10A 2H29A 3V2GA 4DCVA 4ZVTA 1KOGA 1RIIA 1J2UA 4F91B 1ZK3A 4RD0A 3FDJA 4P34A 3LNTA 2F9MA 2PUWA 5ALDA 1NNLA 1AVTA 3G8CA 3S7ZA 3AIKA 4BKUA 1SCUA 5ARCA 3ZXUB 4DLRA 2I4IA 5BV8A 5AXBA 4Q34A 5K01A 3DBRB 4GZLA 4L75A 1E1LA 1NQOA 1UKZA 1YRAA 1ZK2A 3ESQA 3LWBA 4AY3A 4CF3A 5BV0A 4RAOA 3V42A 3PE6A 3SK0A 1DO8A 1DWQA 2RK6A 5BNZA 4KPYA 1T29A 2EQ5A 2OAGA 1QKIA 4GX1A 5LP6C 3TQRA 1PJZA 4AXBA 4KWTA 2P2LA 4FNOA 3CKMA 3V4FA 3ZJUA 4QNRA 5JAPA 1OYYA 1U3GA 3EULA 1KO1A 3B89A 1FRVA 4DSOA 1UBMS 2GD0A 3MCWA 2A5JA 2X5XA 1KBZA 2XMDA 3K1JA 3O38A 4P3OA 5IXJA 2GZ1A 2VUHB 3GCGA 4JP5A 2HQOA 3CZAA 4D0SA 3MUFA 4KK3A 4MMZB 4TMTA 1PWXA 1SURA 2FLKA 2XMPA 1YKSA 4WACA 2O06A 1PLLA 3TEMA 2ZB3A 1XTZA 3GUUA 1T43A 3WK6A 3RS2A 3U48A 1FP6A 2P9YA 4Q7EA 3ZX4A 5GGYA 4WDQA 2B9VA 3MWLA 3AFMA 3N58A 2ZQ5A 3L6OO 3NUQA 4IH4A 4NDNE 4BO0A 4E31A 3WLHA 2YQ5A 3PS9A 1EFPA 4F7WA 3DYBA 1UJ2A 2AUNA 1UINA 3C48A 4N7MA 4KIWA 1I4EB 4UBKA 5F1KA 1XJ0A 3MOSA 3O5AA 3E48A 2CUNA 3RUEA 3WA6A 4XUEA 1E61A 4YRIA 2CXUA 2I4TA 3D0KA 2WVGA 3VKVA 1PK9A 3II6X 1G5PA 3SJUA 1GCUA 3ISTA 4D4GA 3H1EA 2HSZA 3EIEA 3ZJ4A 1NW4A 3I5XA 4M1EA 2CUTA 1A2KC 3U1BA 1FTNA 4AMUA 1A5TA 2PZKA 4RMNA 2PY6A 4O4JF 3ZE8A 2JEZA 4H1UA 2QQGA 3MG9A 3ORQA 4UXJA 2WTAA 4KWEA 2HI0A 2IPXA 4OHMA 5C5EA 3V3TA 2DWUA 4RA9A 2AMYA 1X14A 2D1TA 3FY4A 4UEOA 1KKMA 2EJBA 4YNBA 4O4JA 2B4TO 1HTTA 2OG2A 1DNPA 1EJ6A 1V25A 1YRHA 1A5SB 3L1KA 1SBYA 3CEJA 4B35A 4ZCTA 3BTVA 1K3FA 3E1KA 4AWXA 4BN5A 1L4BA 3Q85A 3VKWA 5HKOA 1OXKB 1BOOA 4IGIA 3R9WA 2H4ZA 3LO5A 1FLAA 4LMRA 1JJAA 2ZR7A 4LJ6A 2VATA 4PYRA 3IOCA 3CPJB 4CCYA 2PXAA 4JEHA 4I1YA 1FFAA 1ST2A 4RVSA 1R4ZA 2V03A 5DWDA 4ZREA 1VYHA 5IMBA 3ZW7A 4IJMA 7GPBA 5C0OE 5D84A 2NTNA 2QRKA 5K1ZA 2F3QA 2H85A 3LF1A 2I2XB 3N74A 1YUMA 3A1VA 4ZAVA 2WT8A 2LD4A 5B37A 3RS9A 5IZCA 4KR7A 5EHXA 3G85A 1CUIA 5KU7A 1FSPA 1EP1B 3DJFA 3IELA 3PUYA 3OJEA 5GOTA 5HK8A 4YPOA 1Z2CA 5BN5B 2IE0A 3JTMA 4HN4B 1XFAA 2LDXA 1MEOA 1O08A 4QTZA 4RF4A 3WJ2A 1I94B 2E4YA 3E6AA 1LY1A 4RL4A 1J8QA 3HNOA 3QENA 5FWYA 2DUMA 1HV8A 4JQSA 5K5EA 2WD9A 4EKYA 3ABZA 4CKBA 3HKEA 2ZRHA 4XGNA 3EGDB 3S8YA 1VBKA 4QPCA 1JMKC 3FYDA 1YHNA 5LNK1 1O54A 1P5FA 5FX2A 1RWXA 2VWQA 3L0CA 3STVA 1Z26A 2AEFA 1QIEA 4YPVA 2GCNA 3IUEA 4UDOA 4RM3A 4WGFA 1IBRA 4PHTA 4EKGA 2R8RA 3NO4A 1NRWA 3T8YA 4MS4B 3ZUGA 3FMIA 1COZA 4NMMA 3S44A 4N41A 3A9SA 3CW9A 3ZU4A 2NNLD 3B1ZA 3ZHRA 1K2WA 3D4LA 2CJPA 4RA9B 3TR6A 3B2NA 5FWAA 2ZRKA 1R5NA 5H02A 1NY5A 4JP3A 4O4JB 1TJ4A 2CJWA 4YEDA 4M0LA 1LC0A 1J33A 4AM8A 1JHRA 4FOLA 1ISSA 1DTWA 3NALA 3DO5A 3SSMA 3THOA 4MV9A 4FWBA 4ZYTA 3B9RA 4R0MA 4ZYZA 1GUDA 1Z35A 4G09A 1G3IA 4XIYA 2N42A 1Z5GA 3DD1A 2WSYB 3BFPA 3GF4A 3IKMB 2ZAGA 8ABPA 4GZ6A 4Q15A 4TTAA 4F3YA 4NCXA 2ZBEA 3AO0B 2GPSA 3HJFA 2ECFA 3F7MA 4MIYA 3RG2A 3RSHA 3GL9A 3GGOA 2OQIA 2E55A 2C59A 2OK8A 3G5LA 2GTIA 2OHVA 1NIJA 3ZVRA 3GRFA 4E4RA 5ABPA 5ICCA 1NE2A 4I7EA 4EY8A 4M55A 4YCNA 3FETA 4RCZA 2GEFA 4DUGA 2WWYA 1P1KA 2QI9F 1BG6A 2B98A 2WMNB 1C3OA 3ZYZA 4L57A 3GRAA 4YAWA 3F4BA 2MMGA 1XRJA 2Z3WA 3ZE7A 4OXYA 1B1CA 4FUQA 5ALXA 3I5MA 3OHPA 1U28A 3PXUA 2F9FA 3ASVA 1QYRA 1UDAA 4GVPA 4D74A 3F6CA 4F1JA 5KYNA 1HDRA 3GJZA 1YI0A 3HKEB 4FILA 4CKBB 1WZCA 2CXOA 4HDCA 3U49A 4AQ7A 2Z8YM 4EF4A 4EB6A 1HC7A 1PGNA 1Q0HA 1WAMA 3GX1A 4A6PA 1EUYA 1P74A 1KDTA 1O4VA 1BX1A 2CFOA 3HL0A 5DM60 5EY5B 1RMTA 1X94A 5FAXA 2XUDA 1BIFA 2ASEA 4DMKA 4DV3B 1P45A 1RQPA 1W2GA 3MFYA 1B14A 3QMWA 3JVIA 2RHGB 3CXUA 2H6EA 4HEA6 1A9QA 1DHRA 1P17A 1ULTA 4IOMA 4RGYA 3WZ2A 1R8QA 3WSWA 4BB9A 2I4NA 2O2IA 1EH5A 3RGWS 3CISA 2DFTA 3GEIA 1SUAA 1P72A 2OO7A 3B1JA 1SVSA 1VB5A 2CJWB 3C5HA 3QX7A 5GJWC 3WLPA 1EFLA 4TMYA 1EE2A 3CR3C 4JI1B 1VOTA 1DTWB 4DAOA 1RI1A 2QZZA 3TQOA 4J1NA 1XDWA 2L82A 4HUQA 5DHTA 4CU5A 2ZP1A 2IBTA 2EFEB 2K7FA 4DT1A 1CIVA 4E13A 4F5YA 1DXOA 4TYYA 2XB9A 3KWMA 4HUTA 2ZI4A 3QX8A 3PK0A 2GJKA 1LI5A 2MR6A 1N6LA 1ND6A 4IHJA 4JODA 4XWWA 2M2IA 1TCBA 4RD3A 4F2GA 1VZ3A 5E7JA 2ZYAA 3R7BA 4KAXA 3UCEA 3ZY5A 4CF5A 2PGXA 3UT5A 3CTPA 5G53C 4CKCA 5BV1A 3QWIA 4QUGA 5H16A 2W42A 3JYHA 4B33A 4IFEA 4HAYA 4IIBA 4UOQA 5JNVA 4PSUA 5CT6A 4BWFB 3CB2A 5ALSA 1C3OB 3NBZC 4BC0A 4MA0A 3GOHA 3GARA 4GQIA 4BVJA 5J4KA 3EAGA 4U7HA 3QEBZ 4RHUA 1UOOA 1AN9A 1IH8A 3WHLA 1P75A 1WTCA 1L5SA 1GARA 1AHNA 1HETA 4BFZA 1NC1A 1EBUA 1TQDA 1JSCA 3QUCA 5AKZA 5FUQA 3WHKA 1QLWA 2G70A 2IYEA 4GOJA 4QHTA 5AI8A 3SJCA 1CB7A 4QYIA 1L3CA 5AI4A 3TRDA 4GI3A 5FR2A 1W73A 1KWGA 3RRZA 1Q15A 1W35A 1S1MA 3DC7A 1PS0A 1KPIA 3G7UA 4JJ7A 2PGDA 1ZH8A 4YUAA 2YIVX 1Z15A 4TTQA 4JA2A 4LXIA 3CIOA 4FYJA 4TX1A 3OPMA 4M3NA 2X8WA 3P4XA 2FK7A 4H31A 4K05A 2H1WA 4WECA 4FTWA 5C34B 3QG5A 4Y1EA 1OGJA 1U9CA 4P5PA 4BZPA 1PZEA 2I29A 4RYLA 4XLZA 3WIBA 4D3DA 1QFMA 3HCPA 1GEEA 4Q3LA 3OQPA 4TKVB 4F85A 3KQSA 221PA 3ZW9A 5M04A 3IOEA 1I2MA 2P62A 3T94A 3BOSA 2P2CA 3CLKA 1WVGA 4IS2A 3U26A 3NCHA 3LUCA 4QFBA 2R6R1 1CIPA 3RVPA 3L6CA 1RM5A 3MT8A 1YL6A 4KIJA 4BJ5A 1QCYA 3K5PA 4D02A 4ALJA 1FVOA 4F5WA 3WLEA 3A1CA 5FA5A 1NU8A 4CR8A 1TYZA 3DUWA 3IP1A 3F6RA 4LHVA 2BEVA 2O3JA 4NFHA 3DLCA 2Q62A 3FTFA 3L7DA 3BTOA 3EY9A 4CM3A 4IHJB 1FXWA 2JH3A 3TPFA 5EIAA 2H1LA 5A2QA 2QUKA 2Y93A 1JXMA 3HYRA 5LMCA 4Z2YA 3SM9A 4XYLA 4CKCB 3P9IA 4IVQA 4FJ0A 1EJ2A 2GK3A 4CM7A 3TECE 3GRVA 1WP9A 3I1FA 4AY5A 1CP3A 3DF7A 4EUSA 2PUHA 3QOWA 5TB5A 2C2WA 1PFQA 4WW0A 3T34A 4DHEA 2PUJA 3PV0A 4YIHA 4LSZA 1NKTA 1SOMA 1G0OA 3T1OA 3QPVA 4MQ6A 4P98A 4MUNA 4W9MC 4J03A 2NVUB 1NP3A 1JJIA 3E3OA 4C03A 1D5WA 1H94A 3MPUA 5DTRA 1XA4A 2RFLA 4EG3A 4QX6A 3C5EA 3F5MA 3S2ZA 2BBOA 3COYA 5BWMA 1GRVA 3QTBA 4B4OA 2ECPA 3RRYA 3WNVA 2XVXA 1XDGA 3LBAA 1CUSA 4HDNA 4MP3A 1SXJD 2IYVA 4PO8A 1XVUA 2A5LA 2V4ZA 4D9IA 2G3YA 3A6FA 3HCDA 4ILKA 5C32A 1SKYE 5DIZA 1YR1A 5JD5A 1H69A 1OXXK 3W2EA 4KAAA 5D85A 2NUBA 2HU5A 5H81A 3WADA 13PKA 3D6UA 2R7AA 3DHVA 4WEQA 4IEFB 4Q47A 3SZUA 2ZE7A 3WJ7A 5C8ZA 2JGAA 4UCWA 3VHLB 1JI3A 1OWLA 2F64A 3FTNA 3KSUA 1PZXA 4R3NA 1VG8A 3PXEA 5DEOA 3ZHUA 4GPBA 4JR2A 1TEVA 2E6KA 2OYCA 4HWTA 2HLDD 1Z0ZA 2NZVG 1D4OA 2V6MA 4GG1A 5IMSA 4ZK6A 3R6DA 2V0GA 3H65A 5D6OA 3S1LA 4TWJA 3OJ0A 1UP6A 3U3XA 2X1LA 2BOVA 1ZN7A 4LZJA 2C1XA 3N9IA 1L1EA 3AB3A 4KYVA 3UO8B 4EYSA 2NOAA 1CS0A 4JUFA 2BFBB 1EFRD 2YV4A 4PAWA 5HKLA 2OYSA 3TVDA 1J0XO 3AY7A 1NMXA 2BHNA 4J4BA 4U0KA 4TZTA 4HQ0A 2GBCA 2J7KA 2ZRMA 5AJUA 1OPXA 4HDRA 5FYDA 4Y67A 3UEOA 1Q1ZA 3CT6A 2RG1A 3B82A 4YN3A 1MO2A 1TM2A 4R1QA 1YHZA 3O92A 2MWMA 1P61B 1AOXA 2PZLA 1P6XA 4TLMB 3WKCA 4HRXA 2V7BA 2OUIA 3QEKA 3GJ4A 3U4CA 3FMGA 3NV9A 1XQ6A 2IP2A 4U9IS 3IBFA 1M73E 2GLTA 4L85A 2DUJA 3LUDA 1IZYA 5LVAA 2JBHA 2PH5A 3GRKA 1M34A 1I0LA 3LQ2A 3T1QA 5EMHA 2VPTA 4ASUA 4U2FA 2FFAA 1JU4A 1Y5LA 2H92A 4LJ9A 5A6VA 4Z3DA 4HDNB 4JX9A 3LDUA 3K0CC 4OFWA 3G6KA 2JIOA 5A9SA 2HIGA 5DSXA 4B6OA 1SD2A 3WFZA 2HD4A 1UBFA 2ZJ8A 2RK4A 5SZIA 4MQ4A 2WT9A 3ZPXA 1J7JA 4QDZA 3WGTA 3UQYS 2AYZA 2NO6A 4D3SA 1SU4A 5M5BA 4RIFA 3NBAA 3KD2A 1MA3A 4AJEA 3X1ZA 3ASZA 5EESA 1YZVA 4M49A 5IN4A 4HB4A 1SKBA 3AKEA 5JASA 2W6NA 4Q82A 1KDVA 1PFWA 4D56A 1UC9A 1OA1A 2X77A 5B12A 3S2IA 4I9NA 3RLFA 1FP4A 1XNRB 1H8ED 2X19A 3DLPX 3UJ9A 1HE8B 1MEEA 3D2LA 2ZE8A 4XR4A 1I32A 2DY1A 2YV1A 5G0UA 4BNHA 3EVZA 4N0DA 2IYRA 2F43A 2IYLD 2O0LA 4OQZA 1VSBA 2Q7XA 3G88A 1ISPA 2PGNA 5F5LA 3EIFA 3UJ6A 1UPTA 2G08A 1P7CA 4F11A 2H2FA 4YRCA 1KAQA 3F71A 3RBAA 1CS0B 4NQRA 5DTMA 1UBHS 4Y9SA 4L8VA 2IV7A 2C4VA 5E4FA 5B4VA 2I3DA 2QA5A 3W0LB 5E6SA 2H2WA 2ZAMA 3GJSA 4J07A 4N12A 1KK3A 1Y8ZA 2PUCA 4E5VA 4U1RA 1A2BA 1O77A 4HDRB 4LOAA 1JPNA 2CD9A 4RE5A 4K9NA 2EW1A 2IW3A 1QG0A 2AEMA 4IDFA 4AZ0A 1W1IA 3RS0A 1NBAA 2HJRA 5BNTA 5KWVA 1ZK4A 2NO9A 1G8AA 3Q7QA 1C3JA 2PYIA 5FEUA 1QR6A 3B7WA 2DHQA 2XNKA 2CMGA 1NQWA 4ZVPA 4B85A 2OBXA 1THZA 3IB6A 3FZQA 5B3AA 4DWJA 5T41A 2XA9A 3KKMA 3T0IA 1M34B 1FRZA 1EUCA 1NQVA 3DV0A 1TQ2A 1N8NA 1K4MA 2CBXA 4ZT6A 5REQA 2C7PA 5B1IA 4M1SA 1AK2A 5EMLA 3KPVA 1R50A 2H54A 2HQSA 5A9SB 3HXLA 4DR4B 4EWLA 1D2MA 2UYCA 1QR2A 2NQ2C 3WIVA 1VSQA 4F5DA 3UV7A 1RKXA 3K1YA 4CM1A 4LZNA 3M9LA 4YH1A 1MC5A 4DA0A 1HNNA 2VHWA 1MJGA 1EJ0A 2YZ7A 1EFCA 1ORVA 3ZK8A 3OPYA 1GTMA 4QQKA 2QY6A 3UTDA 3IMCA 2C3PA 1R4MA 3C45A 3OZIA 4BB5A 1J2TA 1FX0A 4TGLA 1RAHA 4Q16A 3IJ5A 4AG6A 2JIRA 5KSZA 3AESA 1FP4B 1MIHA 4ZVQA 3ZKWB 1XTVA 2ETVA 2JZNA 2PYDA 2JIZA 2R1TA 2C54A 2F43B 1HQYE 2ECQA 3L43A 4HMPA 5KKAA 1XMJA 1B8PA 3EPPA 1RC0A 3B1KA 4CETA 2GO1A 5IDVA 3DR5A 4PM4A 2JK1A 1XZDA 1JEQB 2BDEA 5DXJA 2R6DA 4N9WA 2JGDA 3K5WA 5D01A 1PGOA 1MENA 3KLNA 1KEVA 4OGKA 2ZDGA 1XC7A 1KAEA 1PNQA 4PN7A 4RF3A 3T4UA 1MX5A 4FGZA 4IMPA 5FOSA 5HIMA 4AZ0B 1KMHA 3MT7A 1DKPA 1ZGJA 3CKYA 4YA6A 3RWOA 1U3WA 1EHIA 4OA8A 4QGHA 4L02A 5A7GA 3AVOA 2RHDA 4I3HA 2C0CA 3O8QA 2ORYA 2CBGA 4TZ6A 3RIYA 4LY9A 5AW6A 3TLAA 4C4ZA 1AQYA 2H5EA 4G9BA 5GWXA 3IQFA 1DAFA 2HDNB 1E1NA 1FSSA 2ZGVA 1UC5B 3DV0B 3EWSA 1TF5A 1S96A 3ND8A 3FDIA 4MVJF 4Q4LA 2B4QA 4R31A 4QGBA 4TTPA 4RESA 5AKGA 5C80A 1YRBA 1ZU4A 2AQKA 5HE8A 3H5OA 4EKDA 1WBDA 3BTUA 3ICOA 3LE8A 4AJ2A 4AJKA 4WOKA 4BYGA 1BWPA 5EIBC 2HF7A 3FCSB 1L5FA 4P9NA 4EB0A 2VWGA 3TKYA 3PE3A 3QPDA 1MX3A 2QZJA 3MBOA 4K6MA 5MGBA 5CG2A 4XYGA 3ENNA 3OPYB 4HKTA 3BH7A 2IXFA 1R4MB 1DC5A 4N39A 2Y1EA 1MH1A 3FZEA 2O20A 4YT2A 1FX0B 5IKEA 3T3IA 4L5CA 1D2RA 5K4HA 4PCUA 1JSXA 3P26A 1UZMA 4NENA 5JC1A 3AESB 1E2DA 1MKYA 2NV6A 2VP4A 3OTIA 2PGAA 3UJ3X 3HYSA 5JY6A 4U39A 2XWSA 2R1TB 2A5DA 2QG9A 1YKFA 2G80A 1NPYA 3EGXA 3LX5A 4CCSA 3PRJA 4QLBA 4L8GA 1RHQA 1BX3A 1M33A 4QYSA 1HORA 1F8UA 3BULA 4WXPA 2Z8ZA 1IN4A 2JLQA 2O54A 4LRWA 3WLMA 2WHYA 3F5FA 1R6UA 2H16A 2JGDB 5D5PA 3ANYB 2SHKA 2C5FA 4H7DA 4OJMX 5BN4A 1KMHB 1MNQA 1TZ2A 4P3PA 4GE3A 4RH3A 3QVGA 1BEEA 2FPGA 4DQKA 2QV0A 4RC9A 3CJRA 4TWRA 2GTPA 4XOIA 1E7QA 3DXFA 4RMJA 3CWQA 5AJXA 5FT9A 3SEFA 2XA1A 3E84A 1L0BA 3AU8A 3MIIA 5A4MS 5CBPB 2DEUA 2EC5A 4BMNA 1JHDA 1HTWA 1HTBA 3K20A 3TSYA 3BAZA 3F7OA 1PL0A 2GF2A 1P8AA 4H7JA 1SGWA 1XYGA 5CM9C 5CB0A 3I32A 2C96A 4REMA 3E3NA 4FQ8A 4LDPA 3F9RA 4X84A 4YT4A 2GILA 2HCJB 4LTDA 3TGPA 1N2XA 4G8DA 2IU4A 4NNPA 3FOEC 2AR9A 3GGSA 1W4AA 4R2IA 4AN4A 1GNRA 3ADCA 3LDGA 2WWIA 5DK4A 4DMMA 3UATA 5FUMA 2OORA 1G64A 5TLSA 3BORA 3GP8A 4IY1A 4X1KA 2QRNA 2QRVA 3ADKA 3REFA 3WLJA 2Z95A 1F8GA 1KZ1A 4O08A 2VJKA 4HQOA 1IB6A 4GYJA 4Q3CA 1E6MA 2WSMA 5F7ZA 5FI5A 2YHBA 4LZOA 3UHPA 1XZJA 4LISA 5BVHA 3LSYA 5K6RA 4DIOA 3WB0A 4RQAA 1J70A 3IIIA 4MGEA 3K8ZA 1C3VA 4BV3A 1O6GA 2OOSA 1YONA 3RHSA 2IF2A 1Y5MA 3OX4A 3ROQA 1RXCA 2F1JA 3STTA 2JJQA 2JH9A 4KI7A 4AZWA 4RTQA 1Z7EA 5KTNA 2YYAA 1X77A 4B4WA 4W1RA 1XCGB 3SIXA 3AVXA 5TPZA 3ICPA 3MJHA 3EGXB 5DBEX 4Q4AA 4F4FA 3NHRA 4DV1B 4FM9A 1KXZA 1VBFA 3M4NA 4PGHA 3TNFA 2G1PA 4E11A 4NXMB 2VTEA 1W8IA 1XTRA 2R60A 4QVIA 2XIJA 1Y4AE 5LIRA 2AIRA 4IIDA 5EYPA 3FFWA 1H05A 1D1TA 3AEZA 4EA8A 4YUWA 2RAPA 2HWKA 2I9PA 2Y66A 5BN4B 3NH9A 3BHIA 3FOWA 4P31A 3PJFA 4XM2A 3QVGB 2FPGB 3IAHA 2NUAA 1ZD8A 4GI2A 1XDZA 3CUUA 3Q3IA 1WCYA 4E2ZA 2GPNA 4LQDA 1E96A 3Q3EA 4URZR 3RBZA 4ER3A 4NWIA 2LGJA 1M9NA 5CA0F 4ZAZA 2UVPB 4X93A 2K7ZA 3GLGE 1C9DB 1VMAA 1C0LA 2VJPA 3H8SA 1IZ7A 1WVIA 1UKEA 2DUWA 1OR8A 2ONKA 2Q2NA 2QNBA 3HA2A 3IERA 4TSFA 3NDBB 1P81A 4R51A 3CF4A 4XR9A 1NLFA 3MQFA 4BFXA 1L5NA 2L17A 3PIRA 4PHCA 3ITNA 3BCUA 4W5HA 4XSVA 4YUZA 2O8DA 1L5WA 1A9OA 4ID3A 5DOZA 1BQ3A 1L4KA 1AUOA 4KSBA 5NULA 2VZLA 2XQIA 3BF8A 3PDCA 4N6GA 4TRRA 5HVNA 2W4QA 1YCFA 3F9IA 3TL6A 4RJTA 4Z4EA 2R6JA 4IS3A 5CT5A 3VPHA 5H83A 4P53A 3EHDA 1H8HD 3I6YA 1QUEA 4BNXA 2OC4A 5KNCA 2PKQO 3EWNA 4EDFA 4QKQA 5A04A 3QFTA 5ESWA 3DC2A 1JX6A 4JVSB 1Q77A 5AM5A 1ETHA 4GI5A 2J9FA 3NBMA 3TYXA 2AG1A 4CM4A 1RHKA 3C3CA 3I2JA 1AS2A 1KK2A 1ZAKA 2QUZA 2ZWVA 3CGGA 3W79A 1GAQA 1WPGA 2PPVA 5EE9A 4D9EA 2ZS9A 3NUZA 4RQBA 1XRSB 4Z3OA 3DO6A 4Q4AB 4PINA 4N3CA 5E2AA 3PI6A 4UU1A 4E1AA 3UMMA 1Z47A 3GEPA 4OTZA 3ER6A 4ZQGA 5J9FA 5HZGA 3PC4A 1UFOA 1Y89A 3B60A 4LGMA 4RJIA 4P3XA 4BTLA 4C87A 1U0BB 1GG2A 1W4ZA 2PRSA 1EFKA 2VJBA 5EYPB 4YDRA 4DDMA 5IZ4A 3NCTA 5F4BA 3R3JA 1QVVA 3Q1LA 5DVZA 2DCUA 4M1YA 5D3QA 1N7IA 3HZOA 4YCJA 2NUAB 2YVQA 4NS1A 4DMGA 4Q93A 1HRDA 4UXHA 4XM1A 2ZWIA 1TQ8A 4XAQA 3RFVA 6AT1A 5LD2C 1V48A 2WF7A 3H75A 3NP7A 4MNTA 4RKQA 1HL3A 3FGNA 1K6JA 2JAXA 4MULA 4EGFA 3U62A 4QOJA 1E6UA 2Y6UA 2QN3A 3BHJA 5KJ1A 1WXWA 3C1UA 3GHHA 5ECYA 4EEZA 2WOOA 4ZCRA 2WYOA 2PYZA 4Q9IA 4LRTB 1LK7A 2J4FA 5YASA 1U7XA 1XF9A 3PL5A 1SXGA 4FOTA 3UWPA 4D4IA 2FWMX 4W8OA 3RU2A 3T0GA 1R6BX 3PR3A 3PXBA 4JP8A 2Q0SA 3G0BA 4KHPB 2QRJA 3CRNA 3ZEAA 1ZG3A 1FDVA 2IEYA 1F8YA 4J1TC 3MJTA 3KM0A 3F8WA 2ZRQA 3ANXA 2P6NA 4OL9A 3L93A 4UHJA 1B73A 1HI9A 3PHCA 1BDIA 1LQUA 1KRXA 2FSPA 4D96A 3G2HA 2E89A 3DYIA 2B7CA 1F1BA 4K03A 5C7IO 2AQHA 3DZJA 3JW8A 1K63A 4A8TA 4FKZA 3KXPA 1W36D 4ZGWA 5KSPA 4HAXA 1T4GA 4L4XA 1BKDR 2IYYA 4OQFA 1KQNA 4CM4B 2BP7A 3AY0A 2Z1NA 2I33A 1NYLA 3DE6X 4ZYLA 2XMQA 3MERA 3FCUB 1WBBA 2WYIA 1PJ4A 4BQSA 4BECA 4MYUA 1EUZA 1X9HA 2I1VB 3EA5A 1OILA 4MGZR 2FSVA 1HO3A 3UAWA 5HYVA 1Q0SA 4OOFA 4XJXA 1QIDA 1J0EA 4WQMA 5EP2A 3AJAA 2Q50A 5JMWA 1LC3A 2NN3C 4YRJA 2DULA 3P96A 2V97A 5DCWA 2PFKA 1FTGA 1FFHA 2ONYA 1XQWA 2OCAA 4KO8A 2ERXA 1T9GR 4QSHA 1KI1A 1RTKA 1UKYA 2BMFA 3D7LA 1QWSA 3NXSA 2HA0A 1ML4A 3WB9A 5HNKA 3LBHA 1BDHA 4LF6B 3AOGA 1AQLA 2QGZA 1M2EA 3OX1A 3PWTA 4FMPA 2W6PA 4Q66C 3N76A 3DOIA 4QBFA 5IW8A 1XMPA 1U7TA 5U4XA 3EXFA 2CYCA 3QF4A 1E8DA 2FFBA 4M36A 1KQ3A 4UUNA 1O0CA 1CW2B 2HLNA 4HAWA 4ABTA 2AR0A 2R6FA 1Y82A 2QL5A 3U7QA 2R3SA 3NYIA 1ZYUA 5H3CA 2QI9C 3W2IA 3I5AA 4ZYUA 3RJTA 3O90A 5ALKA 1PX0A 4CLOB 3EQ9A 5AR1A 4L73A 2VDUE 2D1QA 3OCWA 3KNZA 2BCJQ 3QJYA 1EIWA 2AHRA 1DIAA 1SCDA 2ATXA 3OJLA 4KI0A 4M0KA 3WS7A 1QGYA 1QRAA 1Y3HA 4BNGA 5IDXA 2FN3A 4OO3A 3EMKA 3GP3A 4JZYA 5EZQA 4WZBE 3SC6A 5L4NA 2RCYA 5A1JA 4GT1A 5FWXB 1SQ5A 2WQ7A 4DDTA 3PGMA 2UZ0A 3AXTA 3HABA 1Z13A 4KNWA 1CRPA 4GGOA 1MIOB 1EZ4A 4QDUA 4YFYA 4ZVRA 2EEPA 1P5JA 3TLBA 5IAAA 2Z04A 2AVNA 2O7SA 3K94A 3KWLA 1OV4A 1VE7A 3U56A 3ICQB 2ZCUA 1XHFA 4B80A 1KR5A 3CLUC 2HJWA 2O1EA 3K5IA 4PZZA 3ZE0B 4UTRA 3N3BC 3RSLA 3ZIAD 4E33A 2NUTA 1UPXA 3EG9A 1C3XA 2IODA 3I9OA 1W47A 4G0NA 2WHPB 3TRJA 2GAJA 4LA4A 4C89A 3ZD7A 4AN0A 2XUGA 3MVEA 1I9CA 3DPIA 3G79A 4UFOA 5CYGA 1E7MA 3GT7A 4PYNA 5E3JA 3R0VA 1HYHA 2QTHA 3UHFA 1YZHA 4J3NA 5LLDA 4GUDA 1XL1A 2G06A 3SQOA 5TRTA 4Q4JA 2D8AA 4R8VA 1BMFA 1XRLA 3K2EA 4KVFA 2ZVQX 5JO0A 5JTTA 1QK5A 1G5RA 3UVEA 4GPTA 3D2BA 2ZRIA 2JLUA 4V0MA 4E2YA 2Q0HA 3U7QB 3BT7A 3NHSA 2I7TA 5BSUA 4X6YA 1BU8A 1QIHA 2NV2B 1N2CB 3QH4A 3RYHA 1GP2A 2HBZA 3GD5A 5CCBA 4PG4A 4UU8A 5HCNA 4J9VA 4EMBA 4DMUB 2G4LA 1S2DA 3VR3D 1NP6A 4RJJA 4ZQBA 4Q0MA 5C1IA 5LDDC 2DTXA 4PLYA 3C3YA 5LYYA 1R27A 5DU2A 1IQRA 1G5IA 5EEHA 3D1LA 3QXXA 2BN4A 2Q4TA 4BYMA 5HS4A 1ADJA 2ESRA 1RWPA 2YOGA 3PVSA 4RV5A 4XQEA 1GTRA 3I28A 3KBOA 3W6PA 5IDWA 2Q6TA 5CJJA 5KAPA 3SEAA 1FJXA 1XX6A 4IO0A 4UBNA 2WWXA 1GTJ1 1FMLA 3Q7TA 4I46A 521PA 2OCYC 3RNOA 2FMXA 2F8TA 3P1JA 3RBVA 3IQDB 4JA0A 1E2FA 1STOA 2AZ4A