1Z36A

Crystal structure of trichomonas vaginalis purine nucleoside phosphorylase complexed with formycin a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
235
structure length
230
Chain Sequence
ATPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINRIRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEERQNSFQNMMKIALEAAIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine nucleoside phosphorylase
publication title Identification of a subversive substrate of Trichomonas vaginalis purine nucleoside phosphorylase and the crystal structure of the enzyme-substrate complex.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transferase
total genus 81
structure length 230
sequence length 235
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z36A00
3NM4A 4LKRA 2A0YA 1FXUA 4F2WA 5KB3A 4LNHA 4UC0A 4OEHA 4P54A 1V48A 2AI3A 2B94A 1ULAA 1NW4A 5B7QA 1TD1A 4FFSA 1JDZA 4NS1A 3U40A 4D9HA 4JOSA 4TTAA 4JP5A 5B7NA 4OF4A 3PNSA 4WKOA 4TTJA 1N3IA 3P0EA 5F7ZA 1A9SA 3KU4A 5F78A 3IOMA 3OZEA 2PGAA 5CCEA 4X24A 4TXHA 4NSNA 1V4NA 1K27A 3UAXA 4DAEA 1C3XA 4M3NA 1ZL2A 5EPUA 1K9SA 3BSFA 3DF9A 4PNPA 2A0WA 4QFBA 3UAWA 1Z5NA 5IU6A 4GMHA 1SD1A 3UAZA 1ULBA 1U1EA 1ODLA 1SQ6A 1Y6QA 3O6VA 3KVRA 3BL6A 5F73A 3UAYA 1PR0A 4QEZA 1RFGE 1RR6A 3BJEA 4PR3A 1A69A 1PWYE 1A9TA 5B7PA 1B8OA 2AI2A 4DA8A 4M7WA 4LDNA 1Q1GA 3FNQA 4L5YA 4NY1A 1YR3A 5EFOA 1RSZA 4DA7A 1U1FA 3PNPA 2QTTA 1A9RA 4QAQA 1RXCA 1LX7A 5F77A 5CCDA 1M73E 2AC7A 1VHJA 4TXNA 1VMKA 3LA8A 3EUEA 1Z39A 2OECA 4WKPA 3T94A 2OXFA 4YJKA 3PHCA 4DAOA 4H1TA 1JDSA 5IFKA 1TGVA 1YRYE 3QPBA 1Z34A 3LGSA 5C80A 1JYSA 3OZBA 4WKNA 3UAVA 2RJ3A 2OC4A 1V45E 4LNAA 1A9OA 3OCCA 1SD2A 1ODJA 3DP9A 4DA6A 5B7GA 1RXSA 2A8YA 2HRDA 1I80A 3FUCA 2Q7OE 3KVYA 5K1ZA 4QATA 4TTIA 1RXUA 1Z38A 3K8QA 1Z35A 1JPVA 4L0MA 1T8WA 5CXQA 5CYFA 3OPVA 1PBNA 3C74A 3O4VA 4GLFA 1PK9A 1Z37A 1U1CA 1Z36A 3LBAA 4U2KA 4L5AA 1JDVA 4DA0A 1RXYA 4F3KA 4YMLA 3TL6A 4DANA 2P4SA 3DDOA 3FB1A 4TS9A 2ON6A 5F76A 1ODKA 1Y1SA 4WKBA 1ECPA 4GLJA 1TCVA 3INYA 4WKCA 4I2VA 1PKEA 1JE0A 4TXMA 3FAZA 5F7JA 4GKAA 4D8YA 4MARA 4IP0A 3KUKA 2IQ5A 4R2XA 1JP7A 3NBQA 4DARA 2I8AA 3SCZA 1T8SA 1Y6RA 3EUFA 1JDTA 1PR1A 1B8NA 3E9ZA 4E1VA 3NM5A 3EEIA 4F3CA 3EMVA 1YBFA 4G8JA 4BMYA 3K8OE 3E0QA 2HSWA 3UT6A 5DK6A 1T8RA 3KVVA 1VFNA 1YQQA 2BSXA 4BMZA 1OU4A 1Y1QA 1PR4A 2QSUA 4OJTA 4LZWA 3E9RA 3P0FA 4OY3A 2OC9A 4G41A 2AI1A 4EARA 1Z5PA 4L6IA 1LVUA 2A0XA 3MB8A 4DABA 1LV8A 4RJ2A 1V3QE 1PK7A 1T0UA 1XE3A 1YQUA 1RT9A 4YNBA 1K3FA 4M1EA 5F7XA 2ISCA 1VHWA 4BMXA 1TCUA 1ODIA 1U1GA 1OTXA 3NM6B 1CG6A 1Z5OA 1Z33A 4F2PA 4F1WA 4K6OA 1JDUA 1PW7A 3BGSA 1RYZA 3ONVA 3KHSA 3GB9A 4JWTA 5JPCA 1QE5A 4MCHA 3OZCA 2QPLA 4G89A 5CYGA 5ETJA 4ECEA 4TXLA 1WTAA 1G2OA 2QTGA 5EUBA 4D8XA 1PR2A 1NC3A 4OGKA 4YO8A 5I3CA 2H8GA 3GGSA 1ZOSA 4OGLA 3ENZA 4R2WA 1SJ9A 4EB8A 3IEXA 4QARA 1PR6A 1U1DA 1RCTE 3FOWA 5F7OA 1A9PA 1JE1A 3DPSA 4L5CA 3OZDA 1CB0A 5CXSA 1Y1RA 4R31A 1T8YA 3MMSA 2HWUA 2I4TA 3OOEA 3PHBE 4TYMA 3OF3A 3F8WA 1OUMA 1A9QA 3D1VA 4D98A 1OVGA 1PF7E 5FAKA 1PR5A 1Y1TA 4BN0A 3DJFA 4MCIA 3ODGA 1V41E 1V2HE 3FWPA 1NC1A 2GUWA 3OOHA 4TXJA 2XRFA 2QDKA 4QASA 4KN5A 4D8VA 1OV6A 1OTYA 4TS3A 2HN9A 1TGYA
chains in the Genus database with same CATH superfamily
4DL9A 5IKXA 5T57A 5HZMA 3F9IA 3A26A 1KBZA 1LZKA 2EWWA 1JHQA 2A0YA 2RGNA 2V6BA 2DBRA 2QN2A 2V7BA 1SUSA 3RIEA 4GBGA 4AB1A 4KPYA 1KI9A 2ZZKA 3UT5A 1BRTA 4P54A 2NZUG 2PXAA 3UY4A 1P4SA 3GRVA 2MSKA 4TYYA 3AEQA 3ZHVA 1NW4A 3ZZUA 3P1JA 1UAAA 1JDZA 3MT8A 4B9AA 1CUZA 1HV8A 2NN3C 3UM9A 2H1HA 3GN1A 5KJ6A 1P5RA 1M1UA 4GZMA 4J91A 5KMGA 1S01A 4OLFA 1BX1A 1ZH4A 3CLUD 3HCEA 4A5SA 3NPAA 2VZ9A 4ESOA 2O8BB 1COWD 3D7KA 1DP4A 3UW1A 3DAPA 1CS0A 2GZDA 2G77B 4X62B 1KGDA 2VDOB 4HBGA 2GCOA 2IHZA 2NUPA 5JMWA 2J08A 1IHUA 2C4KA 3IESA 3MJFA 4KGDA 2DVMA 3ML1A 1QX3A 5LZ5A 2DWOA 3B1YA 5F7ZA 2BMAA 1L4KA 3Q85A 1CQIB 5JIBA 4K81B 3PGVA 3I5XA 1A9SA 2BEVB 4FNMA 3EG9A 3KZVA 2OOKA 4JOBA 3EZFA 3JQEA 4M0DA 4RADA 4IO0A 3KUDA 3PQ4A 1LF5A 5G2OA 4UTVA 4CQMB 5KWEA 2FDXA 1OLXB 4OQPA 1ISFA 1RM0A 2C5SA 3GQVA 3JAWA 3R5JA 3PUZA 4MYUA 1IZ8A 2OO3A 1K86A 2JH9A 4HMQA 3QFHA 2OP1A 4NMMA 1FLNA 1K75A 1P1CA 2QTBA 1K27A 3HS3A 2WFLB 4FS3A 5DEIA 3U2QA 1IHXA 3UAXA 1IOVA 3QX8A 4M99A 2EWMA 4DSZA 1MQ8B 3PC8C 3CH4B 3WA6A 2FZGA 4HQ0A 2J0EA 2WJWA 2ZKIA 4O3FA 4QL3A 2PRKA 2XZOA 3OM9A 1H3NA 2JGDB 2P65A 4XM1A 1EJBA 1KO7A 3FKQA 2QW1A 4DLPA 1JSLA 2A1TS 2V6JA 1AZSC 5HZHA 3ROGA 3KV1A 1AQIA 3W2IA 3G2IA 3UTDA 3KT0A 3DV0A 1AO3A 1BN6A 1O95A 1QKJA 2ZB8A 5F2KA 1KU6A 1NR7A 4GMHA 2OYRA 5A4DA 3AF6A 3UAZA 4H31A 2FN9A 3PQ8A 3AK4A 4MMYB 1YBVA 2ZSUA 5EIBC 4BJ1A 1HNXB 1OYVA 5AVYA 1YACA 2EFEB 3AFNA 4GECA 2ZSDA 4FGZA 4GYKA 1PT7A 3P4UA 3WQHA 4URVR 5JLJA 3QXSA 2BUAA 5EHXA 1IWBB 5FUWA 4FEAA 4GAEA 3ZLUA 7ABPA 2XCLA 4YXFA 4L9AA 2IHKA 2O0JA 2OMEA 1PR0A 2R5FA 3N70A 4BC0A 2QUAA 3RABA 2NO4A 1AJEA 1ICEA 1K1EA 2P1DA 4X5OA 3U44A 1YDFA 2EC5A 4HWGA 4HMOA 1RBMA 3H3JA 1YSCA 4I2NA 2QX8A 1GFZA 3RWMB 2B5VA 5CK4A 1E61A 4B2YA 4MPDA 4UPEA 1P9OA 2DCUA 4NS4A 2Y6UA 4PCLA 2QN7A 4XA8A 3FNEA 1RAFA 3VHLB 4PZCA 1BKYA 1SKUA 5EUMA 2AYZA 5TS2A 4LSZA 3SZOA 3SYRA 2VDWB 3TLAA 3AM1A 4K88A 2XOKA 1ZSNA 2AI2A 4DNPA 2W6PA 4JUCA 1QFXA 3QE0A 1J23A 3U0BA 2RH9B 3FNQA 4QJBA 1VJDA 3G5MA 3NNNA 3WTBA 4HX9A 3SHVA 2ZJ7A 4RD3A 4Y2PA 1V3TA 2LCQA 1IHDA 4BO1A 4X41A 2HRQA 4L4UA 1Z06A 4IMJB 3BEDA 5G0VA 3JSXA 2OD2A 1P1IA 1XCGB 2W83A 3EXG2 3QNWA 4JUAA 2RGDA 2WTMA 4IVPA 4D5GA 2YXNA 4S05A 4DA7A 3ZU4A 3AL0C 4LHSA 1H23A 2JIQA 1QJCA 1TT5B 1ENZA 3EXFB 2ADMA 2KX7A 3SF8A 5CK5A 1Y63A 2OE2A 1YS7A 4KG7A 2CYBA 1N2EA 2NZ2A 1R7RA 3EHEA 3EIHA 1TUIA 4MWDA 5HGJA 3T5MA 2GUGA 2O3QA 3L02A 3LBFA 1I4DD 1TQDA 2PH3A 4FBLA 4I1OA 3OU2A 4BUZA 5BPFA 3BJZA 2LIVA 4QOEA 4V0ME 2YJTD 1ZGZA 4O33A 3C2QA 3LM8A 3GFQA 1SU8A 2YCLA 4RWZA 3RBXA 1YNOA 4L57A 3IR7A 1TEXA 3NTVA 3FOEC 3WLRA 3I62A 1WSWA 5JMOA 3RS0A 1GAXA 1ADFA 1FDOA 1EFAA 3THRA 2PX6A 5A0VA 3LP8A 2WAOA 2XZPA 1P9NA 1Q1NA 5KVSA 2XNCA 3NBXX 2OWEA 2P7IA 3DVLA 3GP5A 5BWMA 1NZFA 3CVWA 1JSZA 1KTVA 1B0ZA 5A4AA 1SG0A 4FU0A 4OHZA 3F1KA 3MA0A 1U81A 5HIMA 3T94A 4ZIRA 5BOSA 3GJQA 4XWKA 2AEFA 2QVBA 5D3MA 4BO7A 2C2YA 5A03A 4PIMA 3MVEA 5EJFA 3WWPA 1K5DA 1G2PA 4LJSA 4O4HF 3C3YA 3GFRA 4RZ2A 3OZAA 2OAEA 4O1HA 4TZTA 1RZUA 2PUHA 3GA7A 4TUYB 2R47A 3N28A 5LZ2A 5GM2A 3FOZA 4J3FA 2FI1A 4OIMA 5DSXA 2HUNA 1FU8A 1ZXBA 3DL0A 4MKXA 4CT4B 1Z29A 3O21A 4B81A 4ZYTA 1W0KA 2VJYA 3G8BA 3PCTA 5IK2A 1QAMA 5BVHB 2CXSA 3D3WB 2Y05A 2ATIA 1CUYA 2D06A 2RJ3A 3K9NA 1AQLA 4NBTA 5EPOA 3TPFA 1AHIA 1BMDA 2ZJ2A 3H86A 1SUFA 2GPYA 2O8NA 2O4CA 4RGQA 4TLBA 3DBOB 5J43A 1DJMA 4O2BB 1H5UA 2YNMD 3IIJA 2J3JA 1BCRB 4PGGA 1BW9B 3RC7A 1XMJA 1RU3A 1YZTA 4YJFA 4DC1A 3ND7A 2MCFA 2Y1LA 3CCCA 4IDEA 2OBNA 5AJUA 4M9ZA 2Y77A 2G5CA 3DCYA 1GSOA 4YR7A 4PLZA 4RORA 1I80A 4XD7D 3BE6A 2RKBA 3V1TC 3KVYA 5PNTA 3K8QA 2O2YA 3MJVA 4F6RB 1P8AA 5E9WA 5BNTA 4X95A 2RAVA 4JQCA 1WOMA 4LBZA 2XQKA 4XGNA 2O8EA 1T6BY 4DCNA 5CDYA 3F67A 1OROA 1TU0A 3TM4A 2WWHA 1C5KA 1Q7RA 1TQ8A 3EEQA 5K4AA 7MDHA 1VDZA 4JSRA 4L4XA 4B3FX 4ZICA 1JHZA 1E5XA 3AR8A 1G6OA 2YBEA 3UG6A 4AECA 1P5JA 3N0WA 3V48A 5F2NA 2VNAA 2ECKA 3D6JA 4LXTA 1XZJA 1HMPA 1R6VA 3BF8A 2VTDA 1J99A 3DXZA 3FB1A 1UZNA 1UM8A 4OP1A 4ZI7A 3RYCB 1HUQA 1VIDA 4RAQA 4ZARA 5KSYA 2IYWA 5CD9A 5JJ5A 1FUUA 4XEHA 1ZG3A 3DAHA 1G59A 1CNEA 4HRAA 1HNNA 3IVAA 5EMMA 1MB4A 5CYPA 3VU3A 4I4LA 3P45A 4ITUA 3ZU5A 5K8IA 2ID9A 2QSYA 2XDQB 2NXNA 3GLIB 2PSDA 5D00A 2V55B 3P0JA 1F8FA 3IJPA 1N9KA 1A77A 4ZT7A 4U00A 2JIMA 3PV0A 4HAZA 4QDZA 5IYZA 3KHKA 1RQ2A 3DLHA 2XGMA 3LBYA 1FFYA 1NMXA 4M4SA 2HRRA 1F3OA 3PUHA 1ZI8A 3ZCVA 1MIOA 2R1TA 2WT8A 3TG2A 5DBIA 2PSSA 1N0WA 5ALGA 3O84A 4CLEA 2B78A 2LCFA 2IXDA 2RGEA 3K0KA 3L7YA 4ETIA 5KTMA 3WGLA 3K0FB 4D0LB 1VYVA 2VSOA 2Q4EA 1O77A 2XITA 3WKBA 1MGOA 1X9GA 2E6UX 3VPSA 4FHCA 5DB4A 3TNFA 2NXCA 3WWYA 2A9JA 2IS1A 4ITVA 4NPAA 5IMSA 1HH4A 4LS3A 3DYVA 3L84A 1U2SA 2B20A 1WZNA 4FFPA 1M72A 1K7FB 2D0OB 1RHUA 1TMOA 2HREA 2YHSA 2XH8A 3E9ZA 3L18A 4KQKA 1NP6A 3L5KA 3GNLA 1BWSA 1KPIA 3WMFA 3N05A 1UMBB 1XEWY 5TF0A 5ADWA 4AY2A 5FTWA 2R25B 3ZY2A 5JV5A 1AURA 3L7DA 3O82A 4I36A 5BRJA 4R9NA 3VYRB 3IXLA 5B3JA 2CN1A 3TW4A 2V9CA 1OT5A 1XTQA 2DLNA 3JYHA 2H1FA 3G1TA 3D4OA 3TFOA 1DRKA 4MWGA 3GFBA 3ZZNA 5BSKA 5JQGA 1DT5A 5IDQA 1TJ5A 2OAGA 1WDMA 5AW7A 1SQSA 5P8WA 2PWBA 2OB1A 1LS6A 1YVEI 2I1LA 1GGEA 1KNQA 4BMZA 1JTFA 5G1OA 3RAGA 1DJNA 1YR7A 3ILXA 5TDHA 1N1MA 1P2SA 5HJ7A 5B58C 3J81k 5SY6A 1DUVG 4QDUA 2VPQA 5BN5A 2C42A 2AMJA 3OZXA 2PRIA 2R6JA 4RCYA 1KBQA 2BBOA 2RDMA 3UB2A 3WLSA 4F4HA 4OY3A 1HDOA 3WBBA 3QW2A 4YRFA 3TTSA 5AW9A 3M6FA 4AZ0B 1G9SA 3H2JA 5A4KA 4G0UA 4MVJG 5BW5A 2II6A 5IZ4A 1KDRA 1BXGA 4PRYA 4XWGA 5D8DA 1QCCA 2X5OA 3OHPA 4I14A 4PWYA 4XQ9A 5AI0A 4R0MA 1XTJA 2BP7B 2GOYA 5H70A 1HXHA 5EE9A 5T8KC 3X0DA 2OEPA 1ZR4A 1FUYB 4HQNA 2FJUA 2X9VA 2WMDA 2FF5A 3NT2A 3P9ZA 4XUEA 3S0JA 2E21A 4BLUA 4YT5A 1A5ZA 2QY9A 3AF3A 2IS2A 3E0XA 2J41A 2ZKLA 1EXMA 2COUA 3M1IA 4DLKA 2PMDA 4AN1A 4S3MA 4GOND 4KOAA 4RF5A 5SICE 3SQWA 2EHDA 2WHYA 1ONOA 3AL3A 2V6FA 1P0PA 3GJTA 3QPAA 3ZXUB 2QUKA 4OXKA 3IMFA 2ZYGA 3T4EA 3AETA 5FO0A 1OTXA 2WT4A 4K28A 4ZHQB 1ECCA 2GX6A 1M34A 2B21A 3LXRA 4HDOB 3PL5A 2QLMA 6ABPA 3K1AB 1RC1A 2GCPA 4LJ5A 3EVEA 3ER6A 4OBWA 4YTEA 4FX5A 1USGA 1OC2A 4H15A 4Q93A 2BCJQ 1W5AA 4JP3A 2ZULA 5B6IA 5JPCA 3REOA 4FSXA 4PLFA 1K5GA 5KYUB 1JEEA 1DAMA 2JW5A 5I8ZA 4G89A 2I2CA 2IBMA 1OH6A 4JUBA 3LRTA 2OM6A 5KNCA 1RWMA 4TWZA 4ZQHA 3ZBPA 1CV2A 2A5FA 3FCCA 1NXTA 3EZLA 5CA0B 4DJFC 1NOIA 5BR1A 1NXOA 4J2TA 4Q1FA 3C6KA 3JTEA 1Y9ZA 2V6IA 3Q7SA 3SYLA 3DCNA 5K3AA 1MO2A 2L42A 1FP1D 1GUYA 2FHPA 2OFPA 1WVMA 2HD4A 2SCUA 3MBIA 3OU6A 1EZ1A 3LQYA 2NT3A 3LH5A 1VB3A 4F97A 1V3UA 2ZJ5A 4JNKA 1AZLA 3OZGA 4MV3A 5B2ZA 2YZKA 1KEVA 4JGIA 3DO6A 3UJ8A 4CKXA 1EGAA 5ICMA 5F52A 1F2TB 4DUPA 1WB5A 2K7ZA 3TWOA 1VLJA 1XFAA 1KQGA 1GL3A 3FOWA 3NW9A 3SVLA 4Z51A 3THWB 4KE8A 1LPAB 3RYFA 5A0TA 2YH2A 2IP1A 2JAPA 4MW2A 4PYOA 3EQZA 2G0NA 2JIZD 1GR1A 1O94C 2XA1A 4U0KA 1F14A 4G8DA 3SKVA 2OSVA 3ZH2A 2FJPA 3UFBA 6NULA 2QUIA 5DISB 3VAAA 4HDQB 3QZUA 5EIBD 1Q11A 1H69A 4BYGA 2CVHA 2VNSA 1J0EA 3AB7A 3H42B 2BMVA 2Z6VA 4RPIA 3DLTA 4NP6A 1WBBA 2C3YA 3L7CA 5FB3A 3N2ZB 2PEYA 1VPVA 3W4IA 3E8SA 3K6SA 4TM7A 4YMGA 3KOYA 2I4OA 2Q2QA 4BL5A 3KC2A 1PF7E 5MDHA 1XZIA 2NYUA 3ZKWA 2V4MA 3WL4A 3MXOA 3DZHA 3D43A 1A2BA 3E23A 3K8ZA 1EFRA 4MTCA 4MYCA 3U1BA 3DJFA 4MCIA 1TDJA 3GJ4A 1V41E 1WV1A 4MB6A 1PHPA 4B7CA 1Z2OX 3G17A 5JSFA 2P62A 4BIIA 1UMDA 3NHKA 4FLMA 5IKOA 4YLGA 1KKUA 3ZXYA 1VFPA 4KNVA 1WL8A 4XIGS 1TRHA 4UEWA 5JXHA 1E3TA 3H05A 5JNUA 4P4SB 3BTVA 2PNJA 4ZRNA 1R27A 4RENA 3W9UA 3W34A 3PS9A 4D92A 1V1MB 3OEWA 1MP0A 1EXWA 4EVRA 4B76A 4Q6WA 1DPFA 3NH9A 4R9RA 5A3VA 2HLNA 2ZSFA 5JVDB 2HFJA 3HCOA 4FJ2A 4MW9A 2NTVA 1KA9H 1V8BA 2FWNA 4QXPA 5HZGA 4CFYA 1HE1C 4NCXA 3ZYZA 2O2JA 2QYTA 1TTPB 2A1TR 2JAHA 3T5DA 4BO5A 1POXA 5CM2Z 2YQ5A 5CFMA 2BH2A 3X1MA 1EU1A 1JKJB 3ST7A 1GU0A 3ZOZA 4F2WA 3PE4A 1T4DA 3BJMA 3O7WA 2CMKA 3TRFA 3R3JA 4QICA 4DXAA 1RFLA 1RNLA 3GMIA 1O0CA 1ENPA 4INPA 1KO5A 3KOOA 4OJYA 3KYCB 4WCFC 4F86A 1E1QD 2QN8A 4MVJF 1Z2DA 2P69A 2QTWB 1NBHA 1THMA 4ENVA 4FFSA 3LE8A 4RF4A 3V4FA 2ILVA 3EBPA 3H4VA 2IU0A 1JWLA 4F3TA 3VJMA 1UIMA 2EBHX 2DUWA 2IHTA 2A7XA 3JQPA 4PSAA 4K3UA 5B1HA 5B3AA 3UENA 4NL4H 3USCS 5E1OA 1N6PA 2R6CA 5FNVF 3DQQA 4CIDA 4C7OA 2VNKA 3KETA 1Y4DE 2HK7A 3L8FA 1A71A 4OF4A 4A5OA 3I52A 1GZSA 4JI0B 4K7JA 1ZNQO 4ILKA 4YDSA 3MWGA 4QPNA 2J4DA 2YTZA 2LD4A 1T9GS 4F91B 1FPMA 3DJYA 2YY7A 3CLSD 1GKIA 3JD0A 1OX6A 2CB9A 4FFBB 3CKLA 4FFLA 4GOXA 4KGXA 4X97A 4KIGA 3W2GA 3BXPA 1FW8A 3W7AA 2G4LA 4KKXB 1NZDA 4XPIB 4GEGA 4Z9BA 4ZU3A 3WMEA 3C97A 4UXHA 1KI6A 3MERA 5CGQB 1SVSA 1UJCA 1IOLA 4YCAA 4E32A 1MLDA 3EZ9A 4YMSA 1Y9JA 4PFJA 3QG1A 1PT8A 4ZAZA 1GAEO 1CIVA 1EUCA 1EPUA 5H7XA 2GPWA 2WNHA 5E1DA 4NCKA 1SCBA 4MQMA 5CVCA 1VLZA 4DQDA 1H3FA 3AFMA 1MT3A 1E2LA 2Q8PA 1GT6A 2H51A 2P2NA 2Y0BA 3AW8A 2W6QA 3WYCA 1EFLA 4FFNA 3LX4A 2Y2VA 4WBNB 3PSHA 2DQ4A 1X39A 1XKLA 4N9WA 3UF0A 2YN2A 2ZR9A 4H9GA 3DTTA 4K05A 2Z43A 3B85A 3KJGA 4Z4IA 1W4LA 2XQIA 3BSSA 3DKKA 4HDKA 3GRUA 4RHEA 1E4EA 1V6CA 4I1SA 1P74A 4PAOA 4QA9A 2C2OA 4QYXA 3BFKA 4D9BA 1EG7A 2CNLA 3UKOA 1EINA 3B3AA 2E5WA 3PF9A 2VK1A 4PC6A 3RSGA 1IM8A 3QX3A 3AR5A 1R88A 2WM9B 3IQXA 4B3IA 4BNUA 2ZJOA 1LX6A 4GPTA 4KQIA 4X93A 4AP9A 4IOLA 4R9SA 5DYIA 1YONA 4M0LA 1GPH1 1O0SA 1X7GA 4INJA 5K3CA 3ZXIA 4C3ZA 2W48A 1E4OA 2YWXA 3FBTA 4MLCA 3L1UA 3W5CA 4GZ6A 4PPQA 4DREA 4ZVSA 4L95C 2AG0A 1N2XA 3PFIA 4HLQB 1UT5A 4NYMQ 4E3WA 3ZDEA 2CYAA 1X15A 4B17A 2ENWA 4DW8A 3A27A 3STHA 1A5SB 1SIBE 1M0WA 3NAZA 1S8OA 3TBHA 2XXBA 3DVQX 5KQSA 2ZYWX 3AM3A 3GDHA 5HW0A 2SECE 2AR0A 3GCDA 5KVVA 1MAHA 2YY6A 3FZYA 5BR7A 2RI6A 2EGGA 3IGFA 4LBWA 3LI2A 2XXJA 5DK4A 5IAGA 2BEWA 1IXYA 4IG9A 1TUBA 5I9SA 2XHZA 4ZC1A 4EO7A 4XQ0A 4YPFA 4CDMA 5EE5B 1C1DB 1DC3A 1NJ6A 1DX9A 3EDCA 3WRYC 4P0QB 1M1YA 2QLBA 4QBIA 6AT1A 2DH6A 2MINB 4QAJA 4X45A 3QLEA 4I3GA 4K40A 5CLHA 4EJ0A 1I30A 3HA5A 1M1XB 1W88B 2Z4RA 2GLUA 3LT2A 3QMPA 3V3TA 4C6TA 4Y2TA 5DYTA 3NALA 2BAGA 1BXZA 4BMVA 3V55A 4G1FA 1KEEA 4PX9A 1GRVA 3JQGA 2H5JA 3K2IA 1NLMA 2KYRA 3KKEA 3V8NA 4JBYA 1LBQA 1CJKC 3RIXA 4DZTA 5L53A 1PWXA 4DR6B 1C4OA 4AP5A 2Q4DA 3COZA 1HMYA 2QN1A 3L1VA 1NMQA 5CA1A 2JKVA 1HF3A 3LC1O 3SZLA 3PNOA 1NQOA 3OIFA 4QYWA 5FORA 4EJSB 5F1KA 1ZW6A 1G5TA 1V0JA 1HYGA 3LDUA 1DMRA 2DF8A 2EYUA 2HOQA 2HT6A 5CT9A 5BQOA 4QLBA 2PPLA 1R10A 3MZ0A 1G38A 3BXFA 1DQSA 2WZQA 4Y2XA 5IWCA 3QI2A 1G8KA 1Q50A 2QTHA 4RHCA 1Q92A 1OB5A 4HFJA 1NJ2A 1W94A 4K1XA 3IHWA 3I32A 1WXQA 2WMNB 3AL2A 3IULA 4XR9A 4XXHA 1RWVA 2PL9A 4CQNA 2IY9A 2O8FA 3GLFA 5BNZA 4P3YA 3NAGA 4D96A 1X74A 2N3ZA 4YJDA 4YJKA 1RYHA 4ZVKA 1I13A 1H94A 3A32A 1JR4A 4R2KA 2O3TA 3F6PA 3I0ZA 1G21E 4BZZA 1DEAA 1PRYA 3LY8A 4Y2SA 1GGHA 2ZS7A 1BE1A 4HDNB 2MJLA 4FXPA 2CUNA 2XMCA 3AIOA 3FLAA 1JYSA 3LC2O 4KLCA 2GTPA 4WXRA 5AKZA 5C80A 1ZP6A 1P72A 3KO8A 3CS3A 3VPFA 2UUAB 5EINA 4UVIA 2P2GA 2O2SA 4X92A 2R0QC 4EQ6A 5K4GA 3WKEA 2DPLA 5IF9A 1XXLA 3A1EA 5IX8A 4PCVA 4YCSA 3UAOA 4YRMA 4JHXA 1HTWA 1UJMA 4DDUA 1CY7A 1N3LA 2JFXA 4WCDA 5E9QA 2E87A 3CKMA 1CQZA 2M9MA 3E58A 4B80A 1UBSB 5ES4B 1KR5A 3NGXA 2Z56A 2Q3EA 4KCGA 4D9FA 5KYYB 1E2IA 2A8YA 1VPDA 2QE6A 2YMPA 4FR0A 4HY3A 4KUGA 3E9DA 1EEXB 1IYZA 3T7KA 3WLTA 5GZ1A 3UT0A 3TZKA 4DJJA 3D3NA 2VHWA 1RRFA 2CL6X 3OQ6A 5AKKA 4BE7B 4DMRA 1L4NA 3U9LA 2VCHA 3ODPA 1T8WA 4MO2A 4JT8A 4X1IA 2BDUA 3BEOA 2J33A 4M9UA 3RVOA 421PA 5J47A 3R77A 1NLUA 3O8DA 4JJ8A 2R8XA 4U7HA 3PRJA 5DGIA 5U4XA 4CODB 1OI2A 2WKPA 1R6TA 1XA4A 3MRXA 1YZHA 1X70A 1Z4MA 4ZOLA 3AESA 1T0PA 1U98A 3PQCA 3QXHA 4TRNA 5JBIA 1J9EA 1KP3A 1TW3A 4YMLA 3P4YA 3C6QA 3PC3A 1LEHA 3K09C 3D59A 3FB4A 3IAFA 1CNFA 1G18A 4QNMA 2DHRA 2QZ9A 1EHYA 2GHQA 3W8NA 5TQ2A 1OIVA 1N4DA 4YFYA 1QR2A 2QZSA 1QJ4A 1OAOC 3QIAA 4X8OA 2F67A 1E7QA 1I7NA 2RGWA 1YMQA 1XIVA 1MW8X 1IXSB 1VJCA 2AFIA 4RZUA 4H7HA 2HSJA 1J25A 2F1RA 2X2EA 1WHTB 3FAZA 3K0CA 1D07A 1QRDA 3IILA 4AO6A 5BUSA 3VMMA 3KD3A 3WRWA 8AT1A 1C3OB 1TF5A 5F21A 3I9MA 4QEKA 4Q12A 1J8QA 1CZOA 4KMOA 3UBTA 1K7SN 3KKZA 1JP7A 3OA2A 3PKZA 4KQ9A 5C46F 4CUZA 4MWEA 4I1VA 2OHXA 2ZUUA 3WWDA 5E7QA 2HI0A 3JQAA 4LOJA 3UFXA 2ZU6A 2G28A 4TOIA 1VG1A 3PEVA 1K68A 3D8RA 5B6JA 5LMUB 2FUNB 1O94D 5LB2A 4RL4A 1M83A 2GKOA 3U6KA 1N25A 3X1ZA 4BQQA 1NYTA 4DVJA 5KC8A 1RHMA 1X94A 3B89A 1XTUA 2EP8A 4E6EA 3L5OA 1Q0TA 3HBMA 2BZ0A 4JT2A 4FZRA 1L5VA 1WKCA 1ZCJA 1DZ3A 3DDHA 2Q3HA 4MXDA 1E7SA 4OQFA 4BPRA 3CPEA 4ETNA 1PT6A 3FI9A 3CXUA 2AQIA 1PVOA 1JPJA 2P3LA 5K9ZA 3GI1A 5LDDC 3HSKA 3RSSA 4BGVA 1U8TA 4IVRA 4JQOA 1ZW1A 3DOFA 2VZ8A 1SOVA 1Y6FA 4M37A 4AROA 2VAVA 3EXHB 1GKUB 3RARA 5E9JA 2YWJA 3L49A 1SKYE 1M54A 1QB7A 3OWXA 4YMVA 2HBZA 1G16A 2MDTA 1QE0A 3EZ7A 5F12A 1NNEA 3FIUA 2EZUA 1L6RA 4RLHA 4AIRA 5JAIA 3GFPA 3HZHA 2EIHA 2J67A 1TO2E 2IPMA 3FYUB 2XD4A 2QVGA 1F4LA 4B31A 2IKSA 4ZOEA 1IN1A 3HDQA 4CHGA 4COOA 4HVLA 3A1FA 3KJFA 2VPZA 3AVPA 3CCBA 3RC3A 3P94A 4A0FA 3IHKA 4UMFA 2EEZA 3ADPA 5DYYA 1Z5PA 3CZ5A 4KI0A 3RUPA 2GN8A 1N3BA 2OCYC 4YAEA 4CM8A 1R3DA 4YECA 1FLVA 4W82A 5DGHA 5HX7A 1LDMA 1OH7A 5JS1A 4UULA 3H9EO 3VZDA 1ZK4A 1XPOA 1JEYA 1FYXA 1J90A 4U8HA 3E7XA 4W5HA 4AZWA 1FZTA 2WV7A 1LI4A 3SQXA 3QOWA 2ID8A 1MOZA 3DQZA 3F7OA 3GUUA 4IRMA 4K6GA 3EVDA 2VI5A 4IUBS 4PHTA 4QBGB 3URMA 1IY9A 1NM5C 1FX0B 1Z8HA 3Q6MA 1D8AA 2VLBA 1ULZA 3E27A 1XE3A 3IAUA 1C3JA 4HJRA 4BVAA 4PZ9A 1JB1A 3LT1A 4F5ZA 1LPBB 3SBDA 1A4RA 2Y68A 4KQ6A 3P2MA 4N1AA 1XYVA 1XMQB 3C1UA 2HA6A 4X20A 4O4HB 1P5FA 3L0ZA 3K0HA 2A9RA 2GHTA 3EW7A 4R2IA 4UBLA 1HC7A 2D1RA 2FETA 3OU7A 2X6TA 4G84A 4XQCA 1OLUB 1QGED 1ECFA 1DJLA 2VDKB 2FHSA 2ABWA 3CEJA 3MIIA 2OO5C 4X6UA 2Q9BA 3MYYA 3HVIA 4OQMA 4YVFA 1ZR2A 4JBGA 2ZSHA 1X6VA 3EBOA 1TA0A 4X1YA 7AT1A 1O8CA 3K9FC 1RWKA 3FLEA 1U2RA 1V1JA 4ZVOA 4CCSA 1V25A 3OH8A 5CVVA 3UMRA 4WXYB 4Y6LA 1JDUA 4PGHA 5D86A 3QPWA 1E9VA 4PF1A 1OC4A 2G1KA 1GDHA 3I9FA 3QUQA 1QHEA 2IYZA 4KH1A 3GB9A 4YJHB 5F64A 4EKGA 1DQYA 2ZZMA 2EKQA 1WQ3A 2X1LA 1FBTA 3IT3A 4JQZA 2QXYA 4AQDA 1R3UA 2V7EA 1WCWA 4U5XA 1BGVA 2WKWA 2I67A 3BWYA 3OJXA 2H4FA 2X41A 4I1RA 1UPAA 3VX4A 2HLPA 1AMNA 1KVRA 1G2OA 3WHPA 2ZE7A 1SFRA 1C9KA 4Q9IA 2AT1A 1WNFA 4G85A 2VJNA 1T4CB 3UV3A 1Z0IA 2GNOA 4GL2A 1MGPA 4RW0A 4CVNA 4HO1X 5I3CA 2ICAA 3TQIA 5EZYA 1AN0A 3VPCA 4RV5A 3R3WA 1P2BA 5AJWA 2VYND 1V7CA 2DFLA 2DJIA 1NA5A 1M66A 2WG0A 2A3NA 4IHJA 3ZV6A 4B7XA 3CWQA 1EGQA 4US1R 4CN9A 3F4KA 1EP1B 5KYXB 2Z5FA 4MUAA 5F7OA 1D2MA 4MP8A 2W7TA 2H5IA 3KQYA 4HPWA 2QN6A 1FFXA 2HEGA 2BT4A 1C7EA 2XMZA 4JI4B 3PEUA 3FDXA 4C0WA 1CB0A 1T2DA 4JNCA 1Z6QA 5FBRB 1QO0A 2HXSA 2I3AA 2JD1A 2A92A 4WE3A 5HF8A 1CY6A 4J29A 3PE3A 2HLHA 4G8CA 4GOLD 3HFJA 4W8HA 2HWYA 3ZE7A 4IJVA 4CG2A 2DFPA 2JIPA 3A2NA 3HKEB 2ZWAA 3R74A 5AQ1A 1VXOA 3MWEA 3BRQA 4ZT6A 1VIVA 1TZ2A 1OUMA 3GUHA 3Q0TA 3NYWA 4KQMA 1AC5A 1IIRA 2B8WA 1ITZA 2D1FA 2PZEA 3PFBA 2GHRA 2ZCVA 1EVJA 4C08A 3HV2A 2V58A 1Y6GA 2Q7DA 3R8FA 4YJGB 1H1TA 3Q9SA 5LIPA 1QNFA 1KP9A 1JJFA 2GVDC 4HQOA 3DUWA 2J1LA 4AMZA 3SVTA 4Q4JB 3OCVA 2QA5A 3LO5A 3TK1A 4W8GA 3WZ2A 5JWHA 2VQSA 5DM70 4O4JA 5FA5A 1HEYA 1Z8NA 4J9VA 3M33A 1NBMD 3OT1A 1Z16A 1KL7A 5F23A 1QVZA 2HNBA 2QDKA 1WMSA 3PDHA 4UVHA 3L05A 1Q0SA 3QTTA 1XDGA 4LOHA 2YYSA 1GAWA 4P5DA 1HQKA 1EP9A 4X1KA 5DNDA 2GDZA 5HIKA 2KLBA 4D8VA 3G23A 1SPBS 4F60A 3LVRE 4TS3A 3V8MA 5JSKA 3VC2A 4CLRA 4TZKA 1IJEA 4RVNA 1L5FA 4IQ0A 1POWA 1Q83A 3GFFA 3G2LA 4L4ZA 3AUXA 1SAYA 4V02A 1H8HD 1FOEB 1PR3A 1UXIA 2A86A 3I6BA 4OHMA 4RVFA 5FPSA 5K0TA 5KOJB 4ZEWA 2EFHB 4K9MA 3V00A 4BP8A 3WRXA 1VLQA 2GD1O 4GOKA 3STVA 2V7QD 3B2QA 2OK8A 2JLZA 3JWPA 3U9SA 5LCXA 4B6EA 1GAQA 4CMHA 5DWQA 1DXQA 2B94A 3M83A 3LU1A 3L6DA 2C54A 4D3DA 3FYDA 4UDXX 5H82A 3MHPA 3O4GA 1U5BB 4MDYA 3IEVA 1Z2EA 4XIFA 1CX9B 4UTXA 4C0BA 1MH9A 4C3VA 3NAQA 3HL0A 5HDQA 4JOSA 2PLAA 2J9FA 2XT6A 3GZ4A 2FPIA 3TCNA 3MJEA 2XPCA 2H5EA 3VNSA 4K46A 3RTEA 4Q34A 4RKQA 3VDMA 2WIJA 5IAEA 1V37A 2NTYC 1VSTA 1K7XB 4F6CA 1Y82A 3HM9A 1Z6GA 3HYCA 2C88A 3KAQA 3NEPX 1SHZA 3ZCRA 2GPTA 3UC5A 2A2ZA 3DE6X 2FW1A 3ICVA 2O52A 5TE9A 2EJTA 1P19A 3B3JA 1EE2A 2HPAA 3MGCA 5DO9A 3JS5A 1JHRA 1YA6A 4X7MA 2D13A 2ZR0A 3MUNA 5JDIA 2ERCA 2F3RA 4JJGA 2GPSA 4XGRA 3K0BA 3C48A 3KQPA 3HBLA 4K6MA 4IF4A 4E46A 4OX9Y 1JSCA 2GZ1A 2K6GA 2XI4A 2ROQA 2Z2YA 4RQUA 4YREA 1P1JA 1T3ZA 2X0EA 1MU0A 3DMTA 3JAKA 3FYTA 3QRWA 4MR9B 1AHNA 3HO6A 4K9SA 4TXHA 3TBKA 4NJOA 3P19A 1UKZA 1XHFA 5T6BA 1A8PA 3DDNA 3GLRA 3L0BA 1PSZA 3CGGA 3QVMA 2C84A 2VJQA 1QIGA 3MWKA 2O07A 4IF6A 3SDBA 3MW8A 3FJ1A 4HXFB 4LJLA 4LNUA 5IDWA 2ZXFA 4KBGA 4WSOA 3QUSA 5JNTA 4JI8B 4MKZA 2W11A 4L7VA 2NM0A 3ANXA 3IPAA 4KV9A 1VKOA 3PZRA 5CJ2A 3VVCA 4II7A 4DDTA 1W25A 2AOUA 4Q0MA 4YJ2F 1C29B 1J8DA 1L5ZA 4ZODA 1VG8A 4L8GA 2J3QA 4IM7A 4A92A 3OD1A 1E5TA 3NRBA 4NFSA 1F8UA 2X13A 5IU6A 4W5TA 3R3XA 2D4HA 2W93A 2BFPA 3AOGA 3I0NA 3VA7A 4NOMA 2J9ZB 1ULBA 4MQFB 2AEJA 4Z86A 4MDFA 1O4VA 1XWWA 2VC2B 2GAIA 2EL7A 4L9RA 1SBZA 2MMCA 3A0RB 5CNKA 5DLDA 5KSZA 1QS0A 2H52A 1C9MA 1Q57A 6LDHA 5IC6A 4FWIB 1R6BX 3ZWKA 5M34A 1KJJA 1BO6A 4Q7KA 3GH1A 4W1QA 3CUEF 4LFCB 3LX5A 4TYWA 3EXIB 4AS1A 1FQJA 1SC1A 4BQOA 4KQXA 3GNTA 4FDAA 2Q5JA 2CWWA 4FOLA 1KAEA 3PGMA 1B1AA 1ISPA 3COWA 1FSZA 4DLSA 3K1JA 4CKBA 5BYJA 3PFFA 4WVFA 4CF5A 4B2PA 1U28C 1MZPA 1Q7EA 2YWRA 4QUDA 1SKBA 5IKMA 4UREA 2KLHA 2NGRA 2Y1KA 2V7XA 5LP6C 4R8KA 3QU5A 1UKEA 3L7NA 3M6VA 3F8TA 2BZSA 4F8EA 5LSAA 4AD8A 1UT8A 3Q15C 2V98A 5L3SB 4YMTA 2X19A 3N3AC 4ASUD 1DAPA 3EDMA 2BE7A 3NNSA 4PO1A 2HHAA 1NHGA 4YP9A 1R0BA 2XYQA 1ESMA 3KEMA 4HLUA 4KUEA 3HUUA 5CVDA 4Z4HA 2UXDB 1XXHB 1PEYA 1I94B 3KDAA 3TB6A 2FEKA 3BGOS 5KJEA 1G2QA 2B2NA 2X2OA 1YV9A 1YRHA 3LTEA 1PUJA 4UBJA 3VR6A 4AURA 5J4VA 3CVUA 1EFKA 2KE5A 3I2JA 3DLCA 3ETEA 3F5SA 2XD9A 3PJGA 3ZWAA 5KU7A 2H65A 3H8SA 4DV0B 2Q41A 4XRGA 3KPWA 1GUZA 1QAQA 3OF5A 4ALNA 1NY6A 2F9FA 3RU9A 3ZHRA 4DMMA 3N58A 1SQGA 1MJGA 5KNCH 3W1EA 2CJWA 4M8LA 5CCDA 3JD4A 3OIYA 4BO8A 3I73A 1H2WA 1QRSA 1R00A 1X0VA 3DB2A 5JYDA 2X2PA 3ZW8A 5L4LA 4F9GA 3L79A 1SU7A 2BZ1A 4OI0A 1GFWA 4YBZA 1HE2A 1O97C 3JZMA 4MV0A 3S99A 3IYLW 1NQ5A 3P96A 4FYHA 5AOCA 3W5BA 1CFJA 2XUJA 1XAHA 4B79A 5GAJA 1FK8A 2B36A 4PLCA 3TIGA 4BCCA 5HJEA 4M36A 1UEXC 4XM2A 5DTQA 5IAAA 4Q4HA 2IXBA 3JCZA 4LHYA 4PWZA 1QLWA 2QJFA 4L72A 2PSFA 5FPHA 2ASEA 1GQRA 3PWZA 5DYWA 3OJFA 1OYYA 2OHFA 3U37A 1N8SA 2FPLA 4NFHA 4UHDA 5ILGA 2RGNC 5DI9A 2P8SA 4UAJA 1Y3AA 4LRYA 3ORRA 3HFGA 2P9CA 3PHIA 4EUHA 4U02A 1SVMA 5A6SA 1ABBA 4N6NA 5IFKA 1XQ9A 3PICA 2OQRA 3RSLA 3ZVKA 4P3OA 3IUBA 4JP8A 2FFRA 3V8QA 4CDGA 4XX1A 1DRWA 1RXEA 5FTJA 5K51A 2NG1A 3AP3A 1UXKA 3GGGA 1R8QA 1HOXA 4L07A 4BFWA 1EK2A 4J3JA 3M9WA 3QKWA 2ZI5A 1BXRB 4I5FA 4RJJA 4D45A 3PIRA 3TXAA 1YUNA 4RCZA 3B6KA 3WLAA 5FTNA 4DA9A 3ET4A 1G5RA 3H2SA 4U7FA 2VHZA 3WQBA 4Z7QB 1FVFA 1RI5A 1WW3A 3BSWA 5FNVB 3PUIA 3JZIA 4UE6A 5DLQC 2DU8A 2O3JA 2RGRA 2XDYA 5I4KA 4LF4B 2AHRA 1D7OA 2R4TA 1ODJA 3IE2A 3IIKA 4UUPA 4IXNA 2FV8A 4RETA 1QF9A 4LYFA 1XDWA 3NV7A 3AUFA 3ITKA 1EK5A 1S7CA 5BR4A 2VYVD 1X38A 3TI7A 1A7KA 2YASA 4FWTA 1WB9A 2VHQA 3TSCA 1MC1A 4NBSA 5EP1A 1HDYA 2P0YA 2Q7OE 1XVUA 4N3AA 1TL7C 4NRDA 3VTAA 1FNSA 4D4KA 3AXSA 1V8PA 2FN4A 3KNZA 2H1OA 1XZEA 3RIGA 1E59A 1OWOA 1F9AA 2AFHA 1MQAA 1CRQA 2VT2A 4RD2A 4YQYA 5K6AA 1EESA 2RI1A 1Z2AA 2JHGA 1H93A 1Z7GA 2OD7A 3A70A 1A3CA 3LPCA 1QANA 4BLWA 3U09A 4AAYA 5KQRA 3O4VA 1WHSA 4F5DA 4E33A 3AVYA 1LLCA 5A4JA 3ZWPA 5EHZA 5K0BA 3INTA 4QPJC 2HJGA 1DB3A 2HJ9A 1DJPA 2QEQA 3PX3A 1XO1A 4HNAB 4OO3A 4PYKA 2QB5A 3SICE 5BURA 5KQPA 1YIAA 1ZGHA 2O3SA 2XRMA 2WFZA 3IQZA 3IBTA 2AN4A 4GLBA 4WLNA 2FAXA 1TQ4A 5BQ3A 1GCIA 3I30X 5GIOE 4OFWA 3KYDA 1RYFA 1WM1A 5DM1A 3BB3A 3IQEA 2WP0A 4J94A 4RUKA 1I2MA 4M83A 2JCXA 1JBQA 3CF4A 3JQCA 1O95C 2XUZA 4X71A 1ECPA 4K8RB 4EW6A 2CF5A 4OYHA 4BKMA 1QG6A 3O1JC 5EOVA 4URWR 1J24A 1DJQA 4IEFB 3JYOA 3A58B 2OYCA 1V16B 2AIRA 1QRTA 2H07A 3DUFB 2PD3A 3TVTA 5A1JA 1KORA 5KTOA 4JYMA 4QLAA 1EVEA 4C3OB 4RZIA 1JFLA 2NU7A 1TJ3A 3FRIA 1Z0FA 2WWTA 2Z83A 3BGWA 2Y0EA 4FDMA 4IFEA 2REOA 4P84A 4W9RA 2HR1A 4B3TB 1V39A 3ENKA 4DARA 3ZGYA 3DHNA 5CHEA 2ZIXA 1E9FA 3V2GA 2HIMA 4EW1A 1E60A 3BF7A 5KHOC 5KTPA 1UMCB 3G5UA 4HH4A 5K0NA 5ALHA 4J1SA 5IXYA 5I7VA 1PL6A 1M2OA 1U6JA 2QV0A 3KQVA 1ZVVA 1MUUA 3OECA 2HTEA 1ZKMA 1T2VA 4DCUA 1E1LA 1KEWA 5EFZA 1Z4PX 2PU7A 1XVIA 3IEMA 4UQOA 1NBIA 1NVKA 5HBRA 4AS3A 3GPCA 4PLGA 1XMXA 1E8NA 2QG9A 5HYVA 5LYJB 3B7GA 2PWPA 2WW8A 2RHHA 1Q0HA 3A1TA 3ANTA 3SX4A 3HO1A 3AX6A 3AWIA 3W5SA 1NWHA 1ISMA 4Z7NB 1F38A 3KT6A 4F04A 3OZFA 3PJRA 1VHLA 1GQOA 4QUIA 1EWQA 3PQ6A 5DK6A 2Q99A 2JH8A 1YZ3A 4O29A 3GGPA 1EE9A 1PIWA 3FPBA 2R6ZA 2Y71A 4RPCA 5TNXA 3RUIA 3BMQA 2XCUA 3SR0A 1L3BA 1NI5A 2AOVA 2WIFA 3E84A 3NUGA 4R2LA 4EHJA 3AUYA 3PRKE 2Y3IA 5I7UA 1E1NA 2YUIA 5ALJA 1GZ3A 4GS5A 4LZWA 3CH6A 3T1OA 4B7UA 4DMUB 3E8XA 1U7PA 2NZ8A 2AD1A 2P41A 3MUFA 1NI4B 2OC9A 2LNDA 4N7MA 2WYWA 3A4YA 2BFDB 5TGDA 3A3KA 4EI9A 1YK1A 4TPKA 2TMYA 3PDIA 4TT3A 1LVUA 2QMUA 1U9YA 4RIEA 4TMYA 3RT7A 5JAMA 1OFHA 1CJSA 1OW3B 3KUCA 4JYBA 5KOHB 3WKDA 3STYA 3BWCA 5HSGA 1XEXA 2HMTA 4P4UA 4PBSA 2D8AA 2GETA 2Z2KA 3C98A 4QBKA 5TR9A 5AVOA 3TOSA 3H83A 1T1EA 3I4CA 3PRYA 2VUHB 1TMGE 3CNOA 3FWZA 4CMIA 1FRQA 1ML3A 4RELA 5DPMA 3LCRA 1ML4A 3ED5A 3EGVA 1DDOA 3SBXA 3KLMX 1I4LD 3LPAA 5EMNA 1BE0A 3GUYA 1QHFA 5KDDA 1JW9B 2ZQ5A 3QMWA 4RHUA 3F1LA 4NMWA 5INTA 5FBQB 2WQ7A 1SVKA 1LS1A 1DCFA 3QVVA 4G0ZA 4YGXB 3SJAA 4C07A 2ADOA 2PA3A 1U7OA 1EFUA 2BFBB 1SUPA 1TKCA 4ZCPA 1E7RA 3ZH9B 1S02A 4P4LA 2Q8NA 2NLOA 5CPFA 4TTSA 1G21B 2AGVA 1A8HA 3KZ1E 3AM4A 2QUZA 2YVLA 1Y5RA 1EGHA 1Z4JA 2WF7A 3MD9A 4QDTA 3WGHA 4C06A 4EMBA 5JZ9A 1J5XA 3H1PA 4MQBA 5EJ4A 4CCAA 3S5JA 1ZJWA 1TECE 2EBUA 3LUHA 1P7YA 4ZQCB 2BW0A 4GYWA 5GINE 1J4AA 1PW7A 4PZLA 5BMVF 4M0UA 2WE7A 2YS7A 4CEIB 2RHRA 4S0XA 4LXGA 3NVDA 3KHSA 5TPZA 5FTKA 3R7BA 2BTQA 3EE6A 1PYGA 3M2PA 1BEEA 5FI0B 1R0CA 1SVUA 4K6FA 4LSGA 5FA6A 2I03A 4HF7A 5K0SA 1UT6A 3AKDA 5ESWA 3ZGXA 2V9PA 5EKDA 4LJKA 1ZUNB 2IWRA 4J49A 2CDAA 4RYDA 4Z1MA 3EEYA 3NPMA 2JGJA 1M7BA 1UMKA 3PB3A 4KVZA 4RMJA 3ZD6A 2JGKA 4PVDA 1SPXA 1U99A 4QGBA 4U2GA 1QP8A 3VZPA 1WPRA 2NPOA 1GZDA 3K9HA 1LTQA 1EZZA 2XE8A 3FGOA 3IO3A 4PG6A 3S1LA 4DUGD 4F3YA 2QGNA 2PO7A 1JZSA 4OATA 4OGKA 4R84A 5SYMA 3UKDA 2A0UA 3HYTA 4ZQIA 3B9QA 4OGLA 4E5UA 1R18A 1UR5A 1VJ5A 2MSWA 1L4BA 1GTL1 3FFBA 4GI3A 1N6LA 2MTBA 1WSDA 3BE4A 4LYDA 1W0JD 1NFRA 2ZPAA 3O31A 3ZV7A 3BCHA 4BEJA 4KRYA 4XD2A 1WLYA 3AEUB 4C20A 5JAOA 1E2MA 4AW9A 5FIUA 2WIGA 4N54A 4OLHA 1VPWA 4DPKA 5TMBA 5ALRA 2ZUTA 4M98A 2ZUSA 2EXXA 3WB0A 3OURA 4NYJQ 1EXVA 2HW8A 4PGFA 3S8MA 1KDVA 4D9JA 3FFWA 2HWUA 1EDZA 1JIXA 2E48A 2X3FA 5IDVA 1XMVA 3K05A 2NU9B 1WXXA 3VBCA 3VNAA 4M87A 1BE6A 1GUBA 1MHPA 1O4WA 3AQIA 3W3ZB 1VMIA 4Q1DA 4C88A 2J46A 3CF2A 3EDYA 2G9NA 2H2GA 1A9QA 1TT5A 1VCMA 1CE8B 2HCBA 3LVBA 3AUUA 3DEYX 1US8B 1SC4A 3K9QO 2DAPA 1XNRB 4MPJA 1ORTA 1MO4A 5DFAA 3TIFA 5LQDA 1DQRA 1OD6A 4NEGA 2VJMB 4Y67A 2NV0A 3A2LA 4F3RA 1G8GA 1OFTA 2XSZD 2CVFA 3HPQA 1AS0A 4JBNA 1H05A 3B70A 3EPKA 1Z4NA 4FE7A 2YHBA 3FN4A 3EAQA 4FFVA 3PLNA 5LJIA 3CJQA 3HYNA 3CVXA 4RSMA 3LDAA 1C30B 4WXHA 3NTLA 4FDVA 4G5OA 4IEEA 2EFJA 5AVTA 1M0EA 1TA4A 4R7ZA 3ZWQA 2HGSA 2N1MA 3E5HA 3T3IA 2VF2A 4U63A 1FXWF 2JFHA 2QR2A 4UEJA 2H9AA 1Q1AA 4B2LA 3R3YA 2CMHA 3ZLJA 2IA5A 4ZA2A 5B3JC 2E1RA 3BQMB 3WLFA 1YR2A 1VSUA 1JKXA 1OTYA 1XALA 4I9FA 4OXIA 4PS0A 5GQSA 1VOTA 2BKAA 3WOVA 3X1JA 4YI5A 4CM6A 2HN9A 1MABA 3EWIA 4XFKA 3Q7IA 2QMZA 5IVDA 4AK9A 1WAMA 4UFOA 3X1WA 1TGYA 2ODAA 3IHTA 4DR7B 3NM4A 3QJYA 1O58A 2LDBA 4Q6BA 4JP2A 3H1AA 4MGEA 4L4RA 3IQFA 5C51B 2E5FA 4OYYA 2A9OA 1K5HA 2PRSA 4RQBA 4TUYA 3EQ2A 1ZUHA 1GZHB 1SIOA 2V0CA 3ZKAA 1CQXA 1SKYB 2I5PO 2VH5R 1EHIA 4W6ZA 2HGZA 4WOBA 3O95A 3NO4A 2MSNA 1Y3CE 1PL0A 1S2IA 2ILTA 4UDYX 3VTFA 5JCZA 5ALDA 4F5YA 3W3AH 2AD5A 1L9KA 2NZVG 4XH9B 5EJ9A 4LCJA 1UWLA 1A96A 3C6ZA 1I6WA 1MAWA 3B3FA 3K73O 4EVSA 3BD9A 2IX3A 4TTAA 2C5BA 1CXZA 3M82A 4TGLA 3RGWS 1NKVA 3DVAB 4RD4A 4MRVA 5CTJA 3RVMA 4DCJA 4S1PA 4A7PA 1CR4A 1VYTA 1E9CA 5T3YA 1J8FA 5B12A 3ZWBA 1JYEA 1E3MA 1NJ1A 2OLEA 2VLIA 3R75A 1SXIA 1F5SA 2VUTA 4TKVB 3VKUA 5FEUA 2QG4A 2HM7A 5C53B 1NT2A 3VC1A 2H17A 1Y7IA 4MW5A 2OILA 4Q7JB 3V8BA 1G7SA 1NVBA 1Z6ZA 1JIIA 4E5VA 5F4BA 1JAIA 1H1LA 3OM0A 1BS1A 3T1YB 3IE0A 1EVZA 1JYFA 1QB8A 4CI0B 3VTKA 1YTUA 4LJAA 3UC9A 3GR6A 3WLMA 5CCEA 3BT7A 2QNIA 4J0QA 3QOXA 3BA1A 3DFMA 3EZ2A 4UD2A 2BKVA 1Q12A 4Q16A 1QRUA 1TJPB 1YJAA 4KVFA 2GEKA 3H11B 4IH9A 3FZGA 3MIZA 2PUEA 1FDIA 2IJGX 2RK6A 4MI3A 4OP3A 1R4AA 4BRWA 5L4NA 1DU4A 3SS7X 1RJ9B 1KJQA 2R7KA 4OI2A 1CF2O 1ZD2P 5JH7A 4I1PA 1F51E 1TKRA 1JJAA 4QO8A 3T9DA 5C32A 5H80A 3IVXA 5J2TA 1EM8A 3B78A 1Q7TA 4PLTA 4HDSB 5KDLA 5JSUA 4V0SA 4JFAA 2JJMA 5KEIA 4HAUA 2F4VB 1ZIOA 2OP0A 4Q1EA 2CJXA 4QFBA 2QTFA 3M89A 4EHBA 5CB4A 4TV8F 1J2TA 2PIDA 1TF2A 3CNEA 1L8QA 1ZMRA 2PS1A 4IH1A 1U0RA 2WYIA 3M8KA 4GP7A 4BNMA 4PG8A 1IBMB 1EWYA 2VUUA 1A2OA 2WPNA 3L8HA 1U1EA 4IZIA 2H7XA 1RWOA 4LFBB 1RADA 1SQ6A 1SVOA 4LWZA 5JZOA 4QPCA 1I2CA 3HDJA 3U7GA 5H3HA 3RYTC 3CRQA 2B9VA 1RJDA 1UAYA 3KVRA 4GKJB 5B58T 3MCTA 2NV6A 4OA8A 3BD7A 5AXBA 5HUHA 1JWBB 2I62A 2NUBA 2C2XA 4FIZA 4H7DA 4REMA 4CV2A 4Z9YA 1TAHA 4DEVA 5ABPA 1LSJA 3GOQA 4YEDA 2IV3A 2FQQA 2PX4A 3D3QA 4E51A 3CO5A 1Y4AE 1UMBA 2ZJZA 2GSDA 3LYLA 5SZJA 5JROA 3N1UA 5JNLA 2AOTA 1WXHA 2WUGA 1D2NA 4KKVA 1COZA 1O95D 1OBHA 1P0IA 2WB4A 2VBGA 3A7EA 3M6XA 5L40A 1MJNA 3ZWDA 8ADHA 3PYLA 3VZSA 1D2HA 3IA7A 5TEWA 1QAOA 3OLXA 4ZPJA 1IK6A 1H22A 1KSFX 3C39A 3LOPA 3OSZA 2HLDA 3WXBA 5I7HA 3EMKA 1T5OA 3AF0A 4M7WA 4L4SA 3EGOA 4X7RA 1OFVA 1VI2A 1KWKA 1NPTO 3MYRA 4M54A 5C8YF 4J8PA 4LHZA 4FHGA 1W59A 4X44A 4URXR 3UPTA 2ANBA 2R60A 2LKCA 1XFDA 3P0HA 1SUWA 2VF7A 3T5TA 1EKXA 2YFKA 8ATCA 2EX0A 4UM9B 3ZTYA 3THOA 1N2CE 1YS9A 1FFDA 1ND6A 1GPUA 3R7LA 4B0PA 4US0R 4AF6A 2B0CA 4B84A 4BLOA 4E5SA 3HXMA 3WQSB 1QZ3A 2NNWB 2Z8YA 4AZ0A 1M6VA 1CDZA 4FE4A 4Q3LA 4LF8B 1PZHA 1RIIA 1GL9B 4FI3C 4QGFA 1YTLA 2XOKD 4WJKB 4BOYA 3RI3A 1Y7HA 1HDCA 5CTAA 3UHPA 3O94A 4N01A 3O5AA 2Z09A 1T13A 4JWKA 4N40A 1QHHB 2HX1A 2O4UX 4Y0NA 4AMYA 3PNQA 3PF8A 4TXNA 2XTAA 4CCWA 4IDNA 3RFFA 3C7CB 4KE6A 4IV5A 5I9LA 3DHEA 2R68A 3ND8A 2HSGA 5BWOA 4M9SA 4TVOA 3W2HA 5A1TA 3A4MA 4ZZ0A 1NIJA 1NXVA 2PIAA 4QOHA 721PA 4X6YA 1V7ZA 4EGQA 3F6RA 4EYOA 1U7XA 2V45A 3X2FA 1YAJA 1NIPA 2P77A 2MSEB 4BCBA 3B53X 3HKDB 3SF0A 4LV5B 5HVNA 2GPBA 5FBKA 3UMFA 4PVCA 4HHEA 1FQKA 1GGNA 2P0EA 3CQ9A 1KK3A 3G82C 3CU5A 2B3DA 3NEYA 3LNTA 4A23A 5CB0A 1W87A 3QPUA 1PG2A 5KKCA 5ULLA 3ZHYA 3I61A 2C4UA 4KFTA 1ODSA 5JD6A 1XRSB 1QXSA 1Y5LA 1KOLA 3T5CA 5CLIA 5AOVA 3UNXA 1AB5A 1EK0A 4LZPA 3NDJA 4MV1A 4ER7A 3COYA 1EMDA 2Q5OA 1KPHA 1N5MA 1NUAA 1OBFO 1T91A 4JELA 4G3XA 3SG0A 4UOZA 1KI4A 2WPDA 5BSFA 2ZRGA 3GLQA 1GG9A 3U4DA 5LA6A 2ODWA 3U13A 1FSPA 3U48A 1X7ZA 5KYUA 2GTIA 3G0HA 5JI3E 4KQEA 3P9SA 3NWEA 2FZWA 4KR9A 4PY2A 3H9CA 2Q1UA 4WOJA 4FMPA 4JKOA 2WZCA 3QPCA 1PJ4A 2E7ZA 1A8QA 2IUTA 4LQCA 4S1WA 1SHUX 2O3UA 3JYQA 3EG5A 1CUUA 1IWOA 3I9JA 4YQZA 2OXCA 1FNMA 2ZRJA 3FWKA 1G8JA 1QHGA 3FUCA 3A9CA 5ALIA 3OLYA 3LLVA 3B38A 5LQRA 4PC2A 3AGPA 1OPRA 2BZGA 2DWUA 2PVSA 2GT1A 4P0PB 1GPWB 1YB2A 2JJ2D 1S4QA 2JZCA 1A9YA 1W0KD 2O0HA 3HG7A 4R4JA 1TYBE 2HMVA 2XUAA 3OTWA 4N82A 4TV9F 5DGCA 3V1LA 3OPVA 1JU3A 3N2KB 2DTEA 1N0VC 2JRCA 2C9ZA 2UUOA 2AR7A 2AS0A 4ZRDA 3NNDA 1LJLA 3GLHA 4QJ4A 2LUOA 3LBAA 3TFWA 3UWMA 2VL7A 2ZR7A 5KTRA 1AD2A 2BR3A 2AEMA 3WK5A 3L2OB 5J5VA 4FOTA 1RXYA 1XJQA 2G83A 3RBVA 4DADA 3DTVA 3U7JA 2P4SA 4DANA 4NFLA 3AV0B 2JARA 1IB0A 3P4XA 2IL1A 3EGIA 4PG4A 1UC9A 3TNYA 4Q4AB 4YJ2B 3GCWA 3JV7A 1Z4IA 4FIDA 3Q3IA 4YAGA 5B4UA 2YWDA 4EW3A 4GLJA 4RA6B 1YIDA 4PNZA 2PFGA 4MRNA 3NWJA 2YINC 2A9PA 4MR7B 5LKRA 4JIGA 1LF0A 3LZ6A 3EVZA 4TS4A 4AWBA 3AC0A 4MVJM 1ECGA 2IEIA 2Y8EA 4CF7A 4HZIA 3ZNPA 3HB5X 3INNA 1VJRA 2OQ2A 4HEA1 5AKHA 1AHHA 4GXQA 4U7GA 3UN1A 1A4XA 5DM2A 2I9PA 2KHZA 1TPYA 4P5EA 3LZDA 4EJ2A 1XA3A 1HBJA 2WYHA 5KYWA 2PJUA 5DN9A 1OFUA 2PR7A 5MFPA 2BUBA 3UEOA 1Z0DA 5TMEA 2O1WA 4PC1A 5IJ9A 3I9V1 3EUFA 4UNSA 4AKIA 4P4SA 4CHTA 4Y9TA 4MJ7A 2PKEA 3VC7A 2JI7A 4EHHA 1S9DA 4UJ5A 3ON5A 2RSLA 2B61A 4KNYA 4E1VA 3FZNA 3UO8B 5JVDA 4GWGA 3Q3EA 1NQXA 3TI9A 4H18A 3IP8A 4QT0A 4HNUA 1PQPA 2J9YB 3PHJA 4HOYA 3TTWA 3VSAA 1J22A 1TPZA 4LJ8A 5DULA 2J5QA 2FR8A 1XK7A 1I24A 2VIIA 4HQ6A 4BO9A 1J0DA 3FGNA 4HN2A 2YWHA 4HYEA 1XMOB 3CEMA 1DIGA 1WY7A 2WU8A 1ND5A 2HSWA 1M5UA 1W4ZA 3JARA 1TK9A 5J4LA 3ABOB 4MI6A 2CSXA 4TYPA 3OE7D 1H9CA 1W48A 4DMFA 1M2HA 1MKYA 3TKLA 3UJNA 3I4LA 4KYIB 2FMUA 1UOOA 3L7KA 2XAUA 1GZ5A 1ZU4A 3VOSA 3QU7A 1T3HA 5AVQA 4URFA 2Q1WA 2XX3A 4Y9RA 1TYEB 4UMVA 1UBCA 1M2JA 2J5BA 4RSRA 3TCXB 4XYLA 4LF7B 3DFFA 1SBHA 2NSYA 3KLOA 4EW2A 3GA5A 4V03A 3ABSB 3L4BA 2ZWPA 4CV0A 2C2MA 3BWDD 2ZAIA 4B35A 3HXOA 3U56A 4GI1A 2QKYA 4B4WA 3OM1A 3OQPA 1LTKA 1KSGA 1JKMA 2IYAA 2R96A 1DWPA 3KT8A 4OHFA 3GRFA 4A2PA 4BCDA 4BEBA 2JFPA 4JIMA 2HDNB 4CUKA 4G0WA 5BSTA 2E9SA 4PPNA 3WHLA 4DABA 4ZTZB 5AMXA 4UM8B 4H1HA 4FFBA 3ZWMA 2XE6A 1WP9A 3N0RA 2VRWA 3NC0C 4YO7A 1N2GA 3IJRA 2HRCA 2I6GA 3I4FA 2BHSA 1JDPA 2F8LA 4UTZA 3PUYA 3PGKA 2DPMA 4EQZA 1P9RA 2E82A 1PK7A 5TARA 5JANA 4GC5A 3RQSA 3CR7A 3VOAA 5E3JA 2BYTA 3TAXA 4EH1A 5JAPA 3KOUA 2GVNA 2TMKA 1AUOA 1UAGA 4UAUA 5ALVA 5C1PA 1T5BA 1VL2A 4NAUA 1GNSA 4AO8A 1UH5A 5E6RA 3QBDA 4DIUA 1OGIA 3J80A 1LJUA 1M8FA 2ISCA 4MW4A 1JQDA 3AVOA 1DBRA 3PLRA 5HIJA 2Y1GA 2C3PA 3KDPA 2VJBA 1PZGA 2CUKA 4RQAA 1DDGA 1LBEA 1MFPA 1PLLA 4D3ZA 1F6WA 4F7DA 4BNFA 3V9PA 3K16A 4H4CA 4MUJA 4F1WA 3ZTTA 1N9ZA 3G89A 2FPUA 3P2IA 1LSUA 4HH0A 2IK8A 2IS4A 3ZOKA 3BD8A 4URHA 3AXTA 2ZBQA 1E3IA 2P2ZA 4R3UC 1P1KA 4JWTA 3VRHA 2B4QA 2C0PA 5K8LA 2JB9A 2WUDA 5KYNA 4YBRA 3EAGA 5CYGA 1GQ2A 4HAIA 3L06A 3LNCA 3L7AA 3TOCA 2W90A 3VR4H 2C9DA 1TZMA 1L1QA 1WZCA 4WY8A 3OA0A 3VYUB 4DB4A 4PM4A 1GU1A 1OXTA 2PZAA 2XZDA 3PD1A 4DGQA 2GAFA 1D2CA 1E58A 1ZJ5A 3AW9A 4XVUA 2QE7D 4IR7A 2PGOA 3L1KA 1UUFA 1TM7E 2R2GA 3MTQA 2JGNA 3PXAA 4Q3OA 1SWWA 2R97A 4Z0TA 1EJ0A 2UYQA 3OCWA 4N76A 4X61A 4JDUA 1ZJ6A 4J1NA 5FLXA 1VKHA 3Q9LA 1WQ4A 1X2EA 2YIDA 4EG4A 5AQEA 2HJWA 5CGZA 2OQIA 3ABIA 3IT0A 5HMMA 4J0FA 2PCLA 4YXWA 3SSAA 3GJZA 4XAQA 2BR4A 1E0DA 2V3VA 4J1QA 2A5LA 1C80A 2ONZA 5EQDA 3TLEA 4AMBA 2X0DA 4ZQFA 1AGYA 3PQ5A 1A1VA 1C7JA 4DCPA 2JZOA 4UHBA 4IOJA 1EVIA 4D79A 3RAEC 1JE1A 2ALJA 3A3PA 3EBLA 1RAAA 2ORYA 2QP9X 1ZFNA 4FMBB 1SCNE 5DJ5A 3KPJA 5I7OA 2AVDA 4H4EA 1GGJA 3H9JA 2I2BA 1YJ8A 3NHPA 4FD2A 4IDDA 1JTEA 4R31A 2HHCA 4Q9LA 2I4TA 3EPRA 5DF1A 3T61A 4TYMA 3S40A 2R79A 1J0BA 1QM5A 2FR1A 1D6JA 2PA0A 3GWGA 3K0CC 3R0VA 4GC9A 3G68A 4NHOA 5DXAA 1TVEA 2NAPA 1X3SA 1XX6A 4CF4A 1GSIA 5AVSA 3C16C 5FFFA 4MVXA 2QORA 4R81A 4PZAA 2A7QA 1VSVA 4OG2A 2DBQA 2FSHA 4BXOA 4POAA 1IOWA 1X1BA 5TVGA 1KDOA 4LK3A 3IAXA 3JRNA 3U3RA 1XVVA 2FFQA 3FNRA 3UWKA 3U3OA 2C2BA 1BHJA 2F3QA 1E79A 2XNHA 1Z45A 2AZDA 3C4JA 4F5WA 2ZPUA 1Z47A 1EDEA 2D1QA 3HUDA 4QOSA 5EZSA 1GAJA 4ENTA 4LX8A 3TLZA 2WD8A 3MTEA 1RQRA 2QPTA 3CZ4A 3OOHA 5KYKA 5EE0A 4EY5A 2VHTA 1JDNA 2XMRA 1KZ1A 4AI6A 1NKTA 3V80A 2RGXA 2CNKA 5FBWB 3EX7C 3ZZ1A 2WNIA 3TCKA 3W8DA 4KN5A 1OIWA 1WEKA 2A6PA 1NW8A 3A28A 3R0ZA 3FDJA 2VPXA 3M6AA 2C5FA 4GE0A 2GZAA 4IEIA 5FHQA 3KRTA 5DCUA 4CLOB 1N6KA 2I6XA 2JFYA 4FZ5A 3R9WA 3RASA 3VKFA 2F3SA 2GQ0A 2AZ4A 3FMPB 4H0CA 1NX6A 5LBIA 4EO4A 1KEKA 1EFRD 4ZVPA 2IW1A 2ZYRA 3HCRA 4NKRA 4P1ZA 4B40A 4G65A 4YY3B 4G1MB 2GEUA 2HU2A 1J2JA 4CEJB 3ZCUA 5H9VA 3BUSA 4QJ3A 4YCCA 3TD2A 3WSVA 3H13A 2H4JA 1RQLA 1QIDA 1GZUA 4KSBA 2PLWA 2OHHA 4YYZA 3BS4A 4D4MA 4WZBB 3CIFA 1SN7A 2EZTA 1WUIS 2B2XA 2FFAA 1VPTA 2IU4A 4L9SA 3ZQ6A 2XQFA 3NDIA 2HRBA 5E6UB 4YP1A 5A05A 3G88A 2ECPA 4EZBA 5TPWA 2H8KA 4WMLA 4EKEA 2GESA 3OQJA 4OUKX 1YR8A 2BH9A 5K3FA 5IT5A 2A9FA 3NOOA 3ZK7A 2V7WA 3I9LA 3O8CA 1Y5NA 2PMCA 4C9BA 1RWWA 2ZANA 1ISSA 4G0MA 1L7AA 4UDOA 3TEFA 521PA 1QGUB 4JC8A 4V3CA 1SVIA 1EFPB 3PNSA 2BR5A 1Y8ZA 2P9BA 3A05A 1RLTA 3AF5A 2ZR8A 3KZKA 4FYVA 3H87A 4C7MA 2D3TA 4IXTA 3WLHA 5J23A 1PQWA 4NXMB 4L16A 5JD3A 5GP1A 3T35A 2QF7A 4J4TA 5G53C 1LW7A 3O9VA 5D3ZA 3T0IA 2YWGA 1VQ1A 3FYSA 4O1MA 4PX5A 5IW8A 5HHTA 4PYJA 1I2BA 4WW0A 8LDHA 4GM4A 3DHVA 1JEDA 4Q39A 4AYTA 1ISGA 4EPWA 3EZXA 5K2OA 4K0RA 5K3BA 1LD3A 2CJFA 3IOMA 3TF5A 4CMCA 2DG2A 2JIBA 2WINI 1RPAA 1WCXA 4FSDA 3LD9A 3RYIA 1NVWQ 1G291 1OX4A 4J7AA 5DWDA 2ZUFA 4XFJA 4KMSA 2QXTA 1HYQA 3KM0A 2FA9A 2I6TA 1Z7YA 4LDAA 1DKLA 1V11A 4RF2A 1V47A 3K7EA 4IIDA 1CDEA 1DC6A 2C8LA 3OO0A 1RRMA 3L9WA 5SV2A 2YXDA 3ZNOA 3U7FB 3R5HA 3T7CA 3EH2A 3TLGB 3O3CA 1NV8A 5H4HA 3GPBA 1R6DA 3WV4A 1K9SA 1UKBA 4U9HS 3R0JA 1FP4B 4ZVNA 5AI5A 3BKWA 4ZVVA 2OPHA 5BUZA 2YXPX 2XZTA 1K0FA 2OGTA 4KMRA 2CKMA 3K94A 5LYJA 5HG0A 3OPYA 2BV3A 2DQYA 1WPGA 2ZROA 3HNRA 3ZDXB 2GYYA 4DLZA 5IDXA 3HWRA 5AVRA 3ENQA 1YBAA 1DNPA 3GW8A 2QX4A 3I6MA 5HOEA 3SC2A 1Y6QA 2BFWA 4GNRA 3DZGA 4H60A 4B6PA 2VYFA 3ZPXA 4CV1A 5THKA 5IM4F 3WLOA 4D4LA 1UFRA 1NBME 4IIBA 4V39A 3NHRA 2Q3JA 4C4OA 4G63A 2X86A 3HKBA 4CKYA 4LBYA 1T2NA 3K0SA 3KWJA 3GFTA 3U3DA 1KDPA 1NRIA 2MWMA 4P22A 4X64B 3SDSA 3V4RA 1O0BA 5HFNA 1R1DA 3EQ7A 5EE3A 2QRZA 1QIEA 5E1MA 3ID6C 5CU7A 4BLPA 5MN5A 4MW6A 3KQTA 1XQYA 3K70C 5E8RA 2VEOA 3QI7A 3RVPA 4O4LF 3D6TB 4LDRA 1CERA 4A8JA 1NR5A 1RWPA 1UFKA 1XHEA 3MC1A 1FMCA 1NG1A 2Q9CA 2IXAA 2FE1A 3T3GA 2JLWA 3FYCA 4IY1A 3DBIA 3BDVA 3JU3A 1Q1GA 4PTYA 1Z7EA 4L5YA 2GZMA 2C31A 4NJEB 4UPDA 1A4IA 2R8BA 3AIIA 3AWDA 4I8IA 4M1TA 4EGCB 1LXCA 1RD4A 1U7HA 4M0KA 4OHXA 4W9NC 3JATB 3M3DA 3SNKA 1OBOA 1MQ9A 1N6IA 3U80A 3D0RA 5GY7A 5K6TA 4E21A 2BSQA 4F38A 5AO9A 3FYUA 1QIMA 3QEMA 3VBEA 1GPMA 4CT5A 3NOQA 4I8DA 4MX8A 1WEHA 4DHWA 2JRLA 4IINA 3E6AA 2BFCA 4ZFNA 3Q3VA 1C14A 2Y1OA 2BVNA 2OA0A 1FE8A 1NPYA 1B6SA 2ZI4A 3DBVO 4IOMA 3U5TA 3GJ5A 2Z6UA 4KO4S 5COQA 5CDFA 3GK3A 3VKVA 4IQGA 1GXSA 3MWFA 5F33A 7YASA 3A8TA 4HB3A 2AC7A 4V0MA 5D3QA 3S6JA 3L1JA 1GPJA 3DXFA 4IIFA 5AIAA 1WE2A 3DVRX 2HC9A 1YVPA 1YL6A 3G5AA 5BSEA 3HTXA 3RM3A 4TS1A 1FC0A 3OIDA 5JHHB 3UMYA 3PNMA 4ZGGA 2VDJA 3D8NA 1OI4A 4PNEA 1UK8A 3D2AA 4ME6A 1D2GA 3QELA 5REQA 2DETA 2FX3A 1FSFA 2QN9A 2Y6VA 4HGOA 4UUBA 5HK8A 3WVNA 4B32A 1DQNA 1E8MA 1VG9B 3JALB 2HF9A 5KNDH 3FKSA 1T25A 3I58A 3IJ5A 2XCOA 4FC6A 3SQDA 3WRXC 4PZ0A 4DAOA 2QTAA 4BWVA 2QPAA 4LDPA 2HJVA 3GXOA 3PXDA 3WAGA 1J5PA 1JEQA 4MI9A 1BIFA 4W7IA 2FEAA 2QMQA 1Y1KE 1IEVA 1D9XA 1ZK3A 3EEFA 4UAVA 4MV8A 3VZRA 4ZMRA 1KEPA 2D62A 4BZWA 2FZEA 4OXNA 4UUAA 1DOZA 2EBWA 4QTTB 1IAVA 1JQBA 1T5SA 2X77A 2CCGA 1U8YA 2ZBUA 3WL5A 1LPNA 3R6DA 4DJEC 3OIVA 5AVKA 5GM1A 3G02A 1VE1A 4I8XA 1IHPA 2GRJA 3DSRA 4BKQA 1IRIA 3K1YA 4D0RA 2VSYA 4CR6A 1G42A 2I76A 3GA0A 3OCCA 1SM4A 5C1IA 2H00A 2ZDGA 5A5VA 4CEHA 2Q8QA 4XQGA 4F8JA 4J1TA 1KKLA 3V7UA 4D42A 3I6YA 4KZPA 4V0QA 2Q5HA 5CEEA 1IQUA 5JDIC 4FK8A 3OQMA 3ZBQA 1R0KA 2XRYA 2YXBA 3GEDA 4P35A 4EPYA 3ECAA 1YZQA 1N92A 3BFPA 4NENA 1W2HA 2OV6A 2FWIA 1OH5A 3D7LA 1KI8A 3DMTC 3L0PA 1U3VA 4IV0A 3PTAA 2UYCA 4TL6A 3KOMA 4DCOA 5DN6D 3RUAA 2O59A 3ZHZA 3MAGA 3P9XA 4WERA 4E88A 3BRWA 3G2JA 1GN8A 1KGSA 5D51S 1NXSA 4TMFA 5DV9A 1MN6A 5DNVA 2ZJ4A 2WNSA 3C74A 4BKUA 1LLFA 2JEZA 2JGMA 2JH3A 5HRUA 4EHAA 1IQ0A 5J4HA 4UDNA 3S28A 2VQ3A 2GARA 2C07A 2BI4A 3VDRA 4R51A 4AJOA 5EHQA 4B8WA 1M1ZA 3EGCA 4G23A 4B9EA 1QC5B 1QPBA 4WHMA 2ZJAA 5DNUA 3AF2A 3LRXA 3WBKA 1VJTA 4C3UA 4KR7A 1OU0A 4CCYB 4R1UA 3OO1A 3JVUA 4O2AA 4DBZA 4R68A 1ODKA 5K8CA 4TV8B 2WJ6A 2YWCA 4CM3A 2YBDA 3IBFA 3KEGA 3O3OB 3MWDA 5KTKA 4UBMA 1YK0A 2XNSA 4WKCA 1FFSA 4JSTA 5D2CA 2REXB 4WY2A 3EB9A 2LKDA 3PR1A 1JZTA 1XZKA 1YDEA 4ALMA 3WGIA 1Y8RA 3SE7A 3UGKA 5ENZA 3K4HA 3DPUA 4A0SA 4YJGA 1Z6TA 4RY2A 1WDTA 2DFKB 1L5LA 1QHSA 1RLMA 2I4IA 3HBJA 2X3YA 2PUFA 2GFIA 2NVUB 3CWZA 3KELA 4GMFA 3RSOA 2I1QA 4AY5A 2G5PA 4PRLA 1XDUA 3DZFA 4WA7A 1KO4A 4IJUA 3X2SA 4ER3A 5D6OA 1RDFA 2UUCB 2HA2A 3ONEA 3WBJA 2ZREA 1PR1A 1R9JA 5ALFA 5GOZA 5B1IA 3GEBA 3EMBA 2WD7B 1MAVA 3MN1A 3NIDB 5HFAA 3MPUA 3QITA 3D8TA 5JALA 4O2RA 3ACDA 3CUTA 2XQGA 3TLKA 1G5QA 3OE1A 4AJ9A 5EXDA 3RIYA 1X7YB 2PBLA 2Q6OA 5ITZA 1H2HA 5HDBB 4F93B 2CFRA 3HJGA 2W42A 1FP7A 4QVGA 3GLGB 2IZZA 4POOA 1VLLA 2RHCA 1E6KA 3CW2A 3K9LA 4GGMX 5CYOA 4NAVA 2IV2X 3FVWA 4ZCSA 2HA7A 3C15C 4RL6A 4WGGA 2XVAA 5KC9A 4X6LA 2OFFA 3C8DA 3BXOA 4HLUC 5J4YA 1CUWA 2IYVA 5C8YB 3BYZA 1NLZA 1W0CA 3JQ8B 2QZ4A 1LGYA 3IIMA 1WXWA 4I9NA 2B34A 2IX9A 3JQAD 4Z3OA 2OLKA 2YICA 3VUFA 5GJCA 3DYIA 4TKUB 4MCJA 5DLEA 4F4FA 2PUCA 2MYNA 2XVMA 1FJXA 2NP7A 1B6GA 1MJHA 1DIAA 4RH1A 3FNIA 1DHTA 4CG1A 2CXNA 3PFCA 1N2CB 3G2HA 4XWAA 2QYSA 2CXQA 4LY3A 4BMSA 4ZOQI 5CDHA 5HF5A 4ARSA 3WL8A 2ERYA 4CM4B 3COPA 5KX5F 4EARA 1MFZA 3SR3A 2YL2A 1ZX1A 1FB5A 5D87A 1CVLA 2IOYA 3MF4A 1JHOA 5CVTA 1THGA 3GX1A 1H6CA 2J59A 1KVSA 4ESHA 1UC4B 3HCFA 4CKZA 1U04A 3DPIA 1REQA 1W8IA 3EOBI 3GZNA 4H3VA 5DKFA 4ZCRA 3LCMA 3I45A 2OR3A 6REQA 3QXGA 5KSOA 3GYBA 4GSLA 2X5KO 4HXGA 5DASA 1NDQA 3WWOA 2FN7A 2HV9A 4B71A 3ELDA 2OZVA 4MOWA 1T0UA 1WABA 1QOPB 3SWWA 4CTMA 4MP6A 1ABEA 2GKSA 2INGX 3SI7A 3UV6A 1ODCA 2J3KA 4QLOA 5KYTA 1UIRA 1W2WB 1RYEA 1ZINA 2E18A 3M1AA 3Q7PA 4IZHA 5JJBA 2NW6A 4Z2YA 4WK4B 1MVNA 3EIFA 2FP4B 3EIXA 3E2PA 5JU6A 3HJNA 1ZN2A 1DFGA 3A6ZA 5F7XA 4B4KA 2PY6A 3IAM6 3W2EA 5FX2A 2NYAA 4ODIA 2W2KB 1ODIA 4P7GA 2KB0A 3NM6B 2C00A 4RVHA 1CG6A 1SZDA 4YC7A 3M7IA 3SBOA 4TWRA 5EMLA 5FEMA 3RSZA 2QWXA 4FYXA 4GIBA 3REQA 3M5PA 2I2XB 3DBRB 2BELA 3H7IA 3EFOB 3N0TA 4WASA 1ESCA 4QYMA 3WICA 4IJWA 3GVHA 3WDMA 1RYDA 2F17A 1MENA 2MU1A 1KF0A 3ONVA 4TM8A 3GEIA 4JJIA 4YUXA 3UHAA 4CMGA 1O9GA 3HE3A 1XSEA 1YGYA 2OD9A 2FZVA 4U3JA 4Y6PA 4KBFA 4TMKA 4KODA 2UDPA 2BFMA 4IXWA 4X94A 2P6PA 2F1KA 3K4QA 5ETJA 4JI2B 5IS2A 1VHDA 5EEHA 5KTNA 1XD8A 5MN6A 3ILVA 3N07A 3JQRA 3NHMA 3OCXA 4NYIQ 3SIRA 1QOQB 2W2QA 4ND2A 5CEJA 5K6AC 1KO8A 2WWFA 4PRZA 3RTBA 3JW8A 4PSCA 3EXIA 4TV9B 1WULS 1GRRA 3AUSA 1K8RA 1NYRA 3CE6A 1S2OA 3NYIA 3GG2A 4IPTA 5J1TB 3U3KA 3EWSA 1O03A 1S3FA 2EDAA 3NOVA 4KV7A 3WE7A 1VRVA 4Y9DA 2WYVA 5F2OA 2HK8A 3ZLTA 3DKIA 3HR7A 2G5TA 2VK8A 2Z30A 5BN4B 2QTVA 4Y2QA 1XLWA 2EP5A 1JHMA 3Q3GE 4CQLB 1O08A 1E2FA 3AJ8A 3FPAA 4XGIA 5DEOA 3TD9A 2Q2NA 4GBED 4WT7A 4AJIA 4BU0A 5IF3A 2QRUA 2BMEA 2PNFA 3OZDA 2F2TA 2QD2A 4EBFA 1CC1S 1ENOA 1GT91 2PAAA 3COVA 2O8DA 4LY0A 4NCNA 5BV7A 1ISRA 4W99A 2AH5A 4KWHA 5AI8A 4ZYXA 1ZZEA 5KOIA 2PRJA 1E2GA 5J59A 3EXEB 3DEJA 4CU2A 4B3DA 1ECBA 2ZBDA 1YRBA 3EZGA 5FD8A 2AFVA 1Q20A 3B1FA 5BORA 1P80A 1IUOA 4AZ3B 4Y6RA 1SR8A 4YT4A 1R50A 3Q8XB 4KGZA 4PU0A 1PP4A 1RXIA 2C4VA 4EGSA 3FUUA 5M2QA 5ED4A 1RE1A 1LCIA 1PR5A 4E22A 1AH2A 1HNZB 1T2AA 2ZE8A 4WBSA 3TNJA 1QO7A 1NF3A 2IEGA 4XTCS 3AEKA 3C4VA 1V2HE