1Z36A

Crystal structure of trichomonas vaginalis purine nucleoside phosphorylase complexed with formycin a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
235
structure length
230
Chain Sequence
ATPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINRIRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEERQNSFQNMMKIALEAAIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords purine nucleoside phosphorylase
publication title Identification of a subversive substrate of Trichomonas vaginalis purine nucleoside phosphorylase and the crystal structure of the enzyme-substrate complex.
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 81
structure length 230
sequence length 235
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z36A00
4OY3A 1JDTA 3LA8A 2XRFA 1RXSA 4PR3A 1Z5PA 4DA6A 4EARA 3D1VA 4WKBA 2B94A 1U1GA 1Z33A 2AI2A 3PNSA 3FNQA 1JYSA 2ISCA 3UAWA 4F2WA 3OCCA 1LX7A 5F78A 3DP9A 1OV6A 3LGSA 3EEIA 1JP7A 4QARA 5F76A 1VHJA 4TS9A 5F73A 2HRDA 1JPVA 1TCUA 2ON6A 5IFKA 5B7GA 4GLJA 4R31A 4TS3A 3T94A 4DARA 4OGKA 3BGSA 4LNHA 4YMLA 1TCVA 4G8JA 1V3QE 4QASA 2P4SA 4MARA 4EB8A 4TXNA 1K3FA 1XE3A 3UAVA 1JDZA 1VHWA 1YBFA 3K8OE 1Z5OA 4YJKA 1PF7E 3FWPA 2QSUA 4L5CA 3KVYA 1TGVA 4BMZA 3SCZA 3EUFA 4LDNA 3OF3A 5B7PA 2AI3A 3OZBA 1RT9A 1OUMA 1Y1RA 3BJEA 1VMKA 4D8XA 4DAEA 1ECPA 2OECA 1SD2A 1Z39A 1A9OA 1PKEA 1CG6A 1A9TA 1ODLA 5CXSA 5CCEA 5C80A 1T0UA 4G89A 3FAZA 4IP0A 3C74A 3EMVA 1OTXA 4D8VA 5DK6A 4NY1A 3FUCA 5I3CA 2HSWA 1RXUA 4TTIA 1A9RA 1U1CA 1Y6RA 1PR5A 4E1VA 4F1WA 1RFGE 1A9SA 3UT6A 4QFBA 3U40A 3DF9A 2QTGA 1PK9A 4L6IA 1OU4A 3UAYA 1OVGA 1G2OA 5ETJA 1ODJA 3O4VA 2HWUA 1B8NA 3IEXA 4OF4A 3E9ZA 3FOWA 4MCIA 1V45E 1RXYA 2OXFA 3BL6A 1PR6A 3UAXA 1V48A 3KHSA 4JOSA 1T8WA 3EUEA 1LVUA 1PW7A 3NM6B 3P0EA 2QDKA 1FXUA 1JDSA 3ONVA 4DA8A 4QATA 4R2WA 2RJ3A 1PBNA 3NM4A 1V41E 3ODGA 4D98A 1Z5NA 4JWTA 1Y1QA 4L0MA 2OC4A 4QEZA 4BMYA 2QTTA 2OC9A 4GMHA 1PR2A 1WTAA 3PHCA 2I8AA 3KU4A 1K27A 1T8RA 3TL6A 4OGLA 5CXQA 5EUBA 1TD1A 3QPBA 5IU6A 1SJ9A 5B7NA 3DPSA 1RXCA 2A0WA 1JE1A 4RJ2A 4TXMA 1A9QA 3GB9A 4WKOA 1N3IA 2Q7OE 2HN9A 4R2XA 1V4NA 3OOHA 1Z34A 1ODKA 3OPVA 3DDOA 1JDUA 4ECEA 2BSXA 1PR0A 4PNPA 1LV8A 3ENZA 4KN5A 1YQQA 1T8SA 4D8YA 5F7XA 4DAOA 3DJFA 3UAZA 1K9SA 1Y1TA 1Z36A 3KUKA 1U1EA 3FB1A 1PR1A 1T8YA 5CCDA 1OTYA 2PGAA 4U2KA 1SD1A 1I80A 2A8YA 1M73E 5JPCA 1JE0A 2IQ5A 1RYZA 1A9PA 4GLFA 4BN0A 1RCTE 4K6OA 1Z37A 4WKCA 1B8OA 1NW4A 3PNPA 3INYA 2QPLA 1ZL2A 4H1TA 4M7WA 1ODIA 4LKRA 3BSFA 5K1ZA 4TYMA 4LNAA 5EFOA 1U1DA 4I2VA 1YRYE 4DABA 3OZDA 4YO8A 4D9HA 1ULBA 2A0YA 1A69A 4LZWA 1NC1A 4F2PA 5F77A 3OOEA 1PR4A 4OJTA 2H8GA 3GGSA 4FFSA 4F3KA 4GKAA 4TXJA 4M3NA 5CYGA 4TXLA 3LBAA 1QE5A 1JDVA 3NBQA 3PHBE 4L5YA 4JP5A 4DANA 5F7OA 3KVVA 3IOMA 3OZCA 1RSZA 4NS1A 1PWYE 4NSNA 1SQ6A 4TTAA 2I4TA 4OEHA 4UC0A 2AC7A 3K8QA 3MB8A 1YQUA 1VFNA 2A0XA 3F8WA 1TGYA 4WKPA 4YNBA 1ULAA 3E0QA 5F7JA 4M1EA 1Z38A 4TTJA 4BMXA 1C3XA 4DA7A 1V2HE 5EPUA 3NM5A 4DA0A 5KB3A 3KVRA 4L5AA 1ZOSA 4X24A 3OZEA 5F7ZA 1CB0A 1Q1GA 3O6VA 1RR6A 5CYFA 1PK7A 4P54A 4G41A 4QAQA 2GUWA 4WKNA 3P0FA 5B7QA 1Y1SA 1NC3A 4TXHA 1Y6QA 2AI1A 4F3CA 5FAKA 1Z35A 3MMSA 4MCHA 1YR3A 1U1FA 3E9RA
chains in the Genus database with same CATH superfamily
4YJGB 3HY4A 3BK2A 3WC4A 1J8VA 1NM5C 3FM9A 1GARA 3A6FA 1LNSA 1WXWA 5IXYA 3KZNA 1Y9ZA 2A1IA 2W22A 4ND7A 5FX2A 5KYKA 1J20A 2WT9A 2IT1A 3NGMA 4JKIA 4DE5A 4EGAA 1ZEJA 2XY4A 4Q16A 4US1R 4BNGA 1HFWA 1NF8A 3CLVA 7GPBA 3BIFA 4M9ZA 2G70A 3T1YB 5F4ZA 2J1LA 1KGSA 4BO7A 2IBSA 3L8GA 4AG5A 2FZKA 4RXTA 3LM8A 3H05A 1RLUA 3JD2A 2ISCA 1ZGZA 1X7ZA 3PR1A 4O63O 1XAJA 2WAMA 3QK7A 4HH3C 2VUTA 3IPXA 4OXXA 1ZKDA 1WLYA 1DRWA 2X7XA 1OV6A 4IXTA 4KZPA 1D9XA 3I6IA 1K89A 2EVWX 2P4EA 3PXGA 3E2PA 1NSFA 4MRRA 2BFFA 4HC4A 1SXGA 5FUVA 3DHVA 5TQ2A 5IBQA 1RJWA 5B57C 5IH7A 1REQB 4Q48A 2HT6A 4JMPA 5F76A 5CX1A 5CLFA 1BYUA 3B60A 1GQSA 1NVAA 3C5VA 3O93A 1WSWA 3HNPA 1H1LB 4GPIB 3JSAA 4IAOA 4K05A 5IFKA 1GUAA 5HHTA 3BGSA 1NXVA 4G8JA 1CEEA 4Q9DA 2NO0A 4B4VA 2F48A 2BSAA 4MWSA 4CM8B 2OZLA 2XPCA 3ZN2A 4V0SA 1BD3A 5JHGB 1DIAA 3DBHA 4OH1A 1JDZA 1P80A 3GJ3A 1BW9A 4S1VA 3SD7A 2GNAA 1TVKA 2NUBA 3S1LA 4PLWA 2OQRA 2W83A 3HXKA 4Y6SA 3A2KA 1DXYA 3TYXA 4II3A 2BMVA 1FFYA 1H05A 1FU4A 1NXXA 1UWKA 1XYGA 4JGBA 4Q3LA 4EKYA 5JNWA 1Z5OA 1QLHA 4R9SA 1T2EA 4L72A 4MVJI 3T54A 2VPPA 3KSMA 1RPNA 1Q19A 3OT1B 1PDVA 3PJGA 4MPRA 3W2EA 3KVYA 1X86B 4ROTA 2OV1A 4BKMA 2Q2OA 3IEPA 1L8OA 3DH0A 2RBKA 2OHJA 3KLPX 1GQQA 3MS4A 3ZH2A 3EZ9A 1QUFA 2P2NA 4G0ZA 2I2XB 4B09A 3ETDA 3OZBA 5I3ZA 3DW1X 5BOSB 1M8PA 2XV1A 4DT1A 4X3OA 1HYHA 1UADA 2BBWA 3ZNOA 4JUDX 3ZW9A 3GJ5A 2D0IA 3IV7A 2NVWA 3GVHA 4BX0A 2WTMA 2GCOB 5EGSA 3QV1A 2I2FA 4KDCA 2RGAA 2QDXA 3RYCB 4JMLA 3RVJA 3IKJA 4IXMA 2GXQA 1KFKB 2NU6B 2P4QA 3A10A 3LCJA 4QWMA 2HUPA 4TSKA 4YJHA 3RM3A 2AZDA 5CDFE 4DV6B 1FTQA 3AVYA 1V8DA 2P9CA 1KARA 1E2LA 3HB7A 2OAGA 3IMFA 1TOAA 2OGSA 3HYTA 4MAFA 1JYEA 4GKBA 5GY7A 1QB7A 4ZI7A 2J3KA 4UKDA 2NO5A 1V11B 5JS7A 1K7SN 2D1RA 3EMKA 3PNKA 4LMAA 4TKUA 2C03A 1J09A 3GRKA 1YGYA 4DJDC 1EK2A 1CQIB 3OPNA 3HEAA 4H7FA 3TSZA 4MWEA 4ALKA 4EPYA 3U7QB 2DCMA 5A4DA 3UPUA 1EDZA 3CWZA 4RLQA 1PR5A 1R50A 3IE0A 1ZD1A 4E1VA 2R7MA 1XTVA 4I50F 2E5WA 5E0KB 3GGJA 3N0WA 4G8BA 4UFOA 1LH0A 2I03A 5AJWA 1R8QA 3GJQA 2CUTA 2YS7A 1EWVA 4L7VA 4WXHA 3MLAA 4FK8A 3TTUA 4I2NA 1RADA 4EMBA 2QL9A 2V03A 3C41J 1E4OA 2RGNC 2VDVE 3EDYA 2GXUA 3I8SA 4UHJA 4UU7A 3RSFA 5BW5A 2CUNA 3D1LA 1PGJA 1RYNA 4TWIA 5AJHA 4Z9XA 1GD1O 3LQ4A 2VDWB 4NF2A 1ZUWA 4D4IA 4L08A 4HDSA 4S1WA 1LPPA 2FPLA 3IBTA 3LYAA 2NPOA 2CVOA 2X22A 4FYXA 2VSYA 3AKEA 4OHCA 5B2ZA 4UZEA 1DP4A 3SOZA 2IXAA 1XZNA 3H4MA 1I2AA 3LMKA 5BWCA 2IZOA 3F6EX 3RSCA 1G17A 2IZ5A 4MRPA 4BDTA 2XOEA 3E2IA 4NMLA 1U9IA 3N8HA 3AC0A 4P3OA 3HDQA 4LRSB 1Z16A 2ICAA 2PRZA 3UWDA 3ZX5A 4BGDA 5KKNB 4XA8A 3A9RA 2HO4A 5EIFA 1K06A 1Y4AE 2GBIA 3DYVA 1K4KA 4K9DA 4B75A 2XZTA 3LYUA 3ZGVA 4RAOA 1UDRA 4K86A 1JH9A 2B2CA 5KOHA 1KEVA 3PZRA 4OFZA 2IZ0A 1J8DA 2OEPA 1WW8A 4DCTA 2QVBA 4ZC1A 2F43A 1OC4A 2BCEA 3T4EA 2O0LA 5LVAA 4ZVVA 2VOEA 1XRRA 2FMHA 4MMXB 3ZU6A 2EFJA 4RJLA 2A7XA 5J5VA 3OP4A 4RVDA 4DNPA 5FLXA 5SYAA 1VSUA 4P83A 1BO6A 3QOFA 4LMRA 1ZD3A 3KVOA 5CDYA 5JANA 1GU1A 1E5DA 3K5WA 3I4LA 1H8HA 3SZMA 4D98A 2VTDA 4J16C 4EYSA 1ZOPA 4DJAA 1J8QA 1QE0A 2WSMA 3DHEA 4X97A 4L28A 1ATIA 2AKAB 4BIMA 4DEXA 1UWLA 2PA3A 3VR5A 3JQPA 1WVIA 3S1AA 4EFMA 1Q91A 2BMEA 4MWBA 4YJ3F 4X95A 1WCV1 3UANA 2IX9A 5L4SA 3GGGA 1O0BA 1HTBA 4HOYA 1LXCA 1YJAA 4V03A 3VR6A 1IUKA 4RJJA 1YKSA 4YI5A 3ZV4A 3GNQA 3Q9LA 4HDMB 3NGXA 4OXNA 4K46A 2GX6A 4NK4A 1D1SA 5FLYA 1WAMA 2Z5GA 4BTLA 2HMVA 1EP9A 2NW6A 1DV1A 2FN9A 2PR2A 2Q4BA 4M9CA 5JMPA 5IXJA 2IH4A 3L4BA 5AVSA 4HWOA 2HV9A 5AOVA 2WF8A 1NJ1A 2FCRA 3S7TA 1XJWA 1W1UA 3C3KA 3O8CA 3ZJVA 2IPMA 3E4DA 4FYPA 1V9LA 2BHNA 2HLDD 4GZ5A 3GHHA 1SPBS 3K6RA 3SJUA 4CEJB 3E8MA 2OSBA 1NPTO 3OFJA 4TXMA 1WPXA 2W0MA 3PEUA 1N34B 3H5RA 1TQ8A 1TADA 1E3TA 1Z2CA 3KFLA 3HRIA 3VPSA 1BU8A 5D00A 4ABTA 2ODEA 2CFOA 2A9PA 3QFCA 2J6HA 3EPLA 1A8SA 5C4GB 1KQFA 3VI3B 5IANA 3THYB 3FSGD 4A73A 4B3DA 3NV9A 5FJJA 1U7HA 5ED4A 1E63A 3U16A 3D8NA 2NVOA 2NUAA 4K3UA 1AUOA 3N87A 3EGCA 1X74A 2R7LA 3VBEA 3ESDA 3NEYA 1R64A 2PRIA 4Q37A 5I9MA 4BP1A 1V4NA 5AKLA 3FHCB 3T9FA 4DQXA 5GAJA 4L16A 4Y9SA 1OA1A 1OROA 2BGRA 1YONA 1WL8A 2YVQA 3QMWA 4QHTA 5LM3A 2W42A 1NRXA 3PEVA 3GYBA 2NTEA 5FBHA 1ORHA 1WWKA 4UBMA 1G5TA 1MQ8B 3FMGA 5JH7B 4JIGA 2J09A 3ZCTA 4JUAA 3VKHA 1QIDA 1VIDA 1JDBC 3OU2A 3PJEA 3EARA 5T3YA 5EFZA 4P80A 3I42A 5BN1A 3OCXA 3R7BA 3FLBA 5JCXA 5CA0B 2PWYA 5KYGA 2HNAA 1SUWA 3EEOA 1XPRA 1N6RA 1WXDA 1YBMA 3DDZX 1Q95A 3K53A 3PUJA 4KWCA 4OOEA 5G0VA 5KYNA 1F7UA 1ONNA 3WGUA 2H3EA 2NX2A 3L6RA 4C04A 5BUSA 2FZWA 3DO8A 2ZUBA 1XOIA 4FHFA 5HUHA 1OFVA 1BMQA 3GZJA 4MS4B 3TKAA 4A8JB 1R18A 2H6EA 4RHTA 1N2SA 2FPSA 1M2HA 1E3SA 5DCLA 3FD8A 2QQEA 521PA 1JWAB 1XDWA 1Z3CA 3OM8A 4FYWA 2KYRA 5KYWA 1N78A 1SZJG 5FPQA 3PPWA 3JTMA 4IDGA 1RKXA 2I4LA 1QZTA 2JCXA 3VPCA 2B1IA 2B1QA 2IYZA 1JLLA 2OD7A 3MJHA 3NNDA 3QVUA 1DL5A 4JK3A 1M3SA 4M46A 3BXHA 5EJ4A 1NMXA 3DYBA 5BSKA 5J63A 4CHGA 3MCUA 3PQEA 4NI5A 4KVZA 5E9QA 1JE0A 3WYCA 3SIRA 4EG5A 1U65A 4HAIA 1IBMB 1EBUA 3BD8A 1A9PA 4KXWA 5AVTA 4XFDA 2GDJA 2BH2A 4DZZA 3TOSA 2NOAA 2JAXA 2C1XA 1NBHA 2R3SA 3HFJA 4XTCS 1FVXA 3D7RA 5AWFC 1RYBA 3UMBA 1E2IA 3VJMA 4BC1A 1JBQA 1M2WA 5DSXA 6Q21A 4PSVA 3R09A 3K0CA 1JIUA 3UOGA 4EELA 3TGWA 1MX1A 3T9AA 3T95A 2H4WA 1ZL2A 3AEZA 4R40A 4WVFA 4JBIA 4LI3X 2AUNA 5G3ZA 5T8KA 2B8WA 1DUSA 2HJVA 2WICA 3HNOA 2GK7A 3M6IA 4G5SA 1XXLA 4C4YA 3I2JA 4ENQA 1VSTA 2P3OA 2EZ4A 1GNQA 1CZUA 3BSFA 4YP9A 3M9XA 3AP3A 3RC3A 3ZYZA 5A4FS 5EOVA 5CLJA 4TYMA 3STXA 3PDCA 4ONEA 5AM1A 2Q9BA 1R6TA 1C7FA 2Q1SA 2DSNA 4KB5A 4UUAA 5HTKA 5JD5A 4XM1A 4DR1B 2ZWOA 2XD4A 3MBIA 1EFUA 2FPXA 3ZS9A 4E5MA 4ZK2A 1U4SA 1M2KA 1XDBA 2V7QA 2V45A 3CH5A 3PKIA 3UKOA 3V9AA 2ISSD 4IDOA 5HFAA 4F6LA 1IUNA 1L9KA 3C8UA 3H84A 4J7XA 5H02A 3DBOB 4HNHA 4DCSA 1W8DA 5TPWB 1JI3A 2Z4SA 3B6JA 1YHYA 2BMFA 4RPCA 5L3QA 3HFGA 1R9NA 3QFSA 4AP5A 3M4JA 1MKYA 2GF2A 3M6XA 4LJRA 1V9SA 2C7BA 3EVAA 4DCNA 4C06A 3ZW7A 3RKUA 3P20A 5BW8A 5H68A 1G60A 1E5QA 4QGBA 4WZBA 1W4BA 4N12A 3W9YA 4EF5A 1K68A 3SF8A 4X00A 1CY8A 3GJYA 4C0WA 1HNWB 3HCNA 2BMAA 3N76A 2WD9A 2HSJA 1AMUA 1SBZA 3VHLB 2FW1A 1E3MA 5IYZF 5AFSA 5JBQA 1WV1A 2B6HA 1Y4UA 3KUXA 2I91A 4XWOA 1Q1BA 2QYTA 4HN4B 2MR5A 4OFBA 4OUDA 3QTLA 5FOUA 4QLBA 4JLMA 2VQDA 3PDWA 2JA2A 3M6LA 3PFFA 5KYXB 2CUZA 2VYQA 2ZS8A 3MG9A 3T3HA 3W5SA 3EGXB 2VUHB 3QY9A 4IWXA 3AB7A 2VNHA 4EG3A 1P2DA 4D8WA 1DC4A 2ZVPX 3KPVA 2MYUA 1JKJA 2PYIA 1WCIA 4NZYA 4LYDA 3E3OA 4PC7A 1Q77A 1T6NA 3QEMB 5HUQA 4TTAA 5H8WA 2IEDA 1UJ2A 2MTBA 3E84A 1SVWA 3F1LA 1CRZA 4GMKA 4TWJA 1HRKA 2FN4A 4X5OA 4EX7A 4LV6A 3C6ZA 4N7JA 1H9CA 2CDNA 3D4NA 1BWRA 3WFZA 2L82A 3F49S 3IXLA 4DZTA 4IVNA 3F8WA 5JOQA 4IOKA 2YYZA 4AJ1A 4B3RB 4O2AF 4R4JA 3KSAC 3OZWA 1YKFA 5CLHA 2GAFA 2PT9A 4RZQA 1E1QA 1M5UA 4P0TA 1AX9A 2AX3A 2CHGA 4QBFA 3SX2A 3NM5A 4O33A 1XLVA 1E9EA 1KH2A 2BLLA 5F1YA 4IIGA 3PFIA 3RVRA 1EVZA 3JX9A 4GOOD 2FWBA 3QHQA 1HNNA 3PV0A 4ZMBA 2H2WA 1ZOSA 1I1QB 3EDCA 5LKAA 1ZD8A 3FDXA 3OQMA 1N8NA 4A0QA 2RC6A 1XZHA 1MOQA 4KQ6A 1FQWA 1T5BA 1Z29A 4OM8A 1ABFA 2FK7A 3EQZA 2AN5A 4U7FA 2DXIA 1JG1A 3D4IA 5KYUB 4MV4A 4ZQIA 1ZEMA 2KBEA 2O2DA 3AZOA 3O6VA 4BFWA 2V0NA 1ZK1A 3RRFA 4IHJA 1ZI8A 2O0KA 4YCBA 4BZPA 3QKSA 4Q93A 2Q2NA 5A5DA 2ZXUA 2G6BA 2Y8EA 3GA7A 4WNCA 3RUEA 1X8XA 4L57A 1MO5A 4AVYA 1V7ZA 3IDFA 4WESA 4Q18A 4BEBA 1A2BA 4LOLA 2JLBA 1O87A 4ZREA 3NYIA 3ON5A 2ODNA 2NU9A 4YI3A 3U1BA 2REQB 1DKLA 2W6NA 3I5YA 4WKNA 2C9YA 3G2OA 4KE7A 2IS2A 4FLFA 3RVBA 2VHJA 2BFNA 3R9XB 4ME6A 1EUCB 3A26A 3MINB 3JS5A 3GGCA 3TIXB 1IM8A 2GBFA 3KK0A 4UPVA 5ESRA 2ORIA 4DMLA 4X66B 4KXUA 5DIZA 3VDMA 5FAKA 1KI1A 5F1PA 4HT3B 3JZMA 1MX9A 3WIDA 3QLUA 1T5HX 1C7QA 1OXSC 4ZOLB 1BMFA 1YR3A 3OWOA 2LW7A 4B87A 3A6EA 2VWPA 4IUCS 4ZCPA 3PGLA 3THSA 4D99A 5B4UA 3ZE7A 2XNDD 2PS9A 1A0OA 4MB6A 4IEFB 1AQJA 1BS9A 2GO7A 2VG8A 2LCQA 2NUPB 5CFPA 5L6LB 1H85A 4NJMA 1NUPA 3WV5A 2M6SA 2P11A 4JVMA 4PQGA 2QMOA 4B33A 4DA6A 4E5DA 2VDKB 4XJVA 1QFJA 5KDLA 1Q17A 3AUAA 2WJAA 1Y5RA 5JNLA 1QHXA 3FPSA 1WQ1R 4FTWA 1UOPA 2XCLA 4GVPA 4MWZA 2BJVA 3PNSA 1F4VA 4WZAB 1T8UA 3A1WA 1U0NA 1NFRA 3WWDA 4CFZA 3HM9A 1P6UA 1L0BA 1E9DA 2X42A 1QH1B 3SXUB 2FSGA 3W2HA 3THRA 4EY8A 1TYDE 2X6QA 3CBGA 3K0AB 1Q1ZA 5I7HA 3ZWAA 1OY1A 5KOIA 5A3JA 1IG0A 4CCSA 3MCTA 3QBDA 5G1PA 1KZ7B 1QM5A 4WK6A 1I3LA 4DEVA 4G4IA 3EEIA 1BN6A 3SSNA 4EBFA 3RAFC 4HNGA 5EKXA 1TTTA 2NTJA 2QD4A 3KQWA 1QO7A 3NRCA 2B4YA 4TS9A 4NYIQ 5LNK1 3AUKA 2PD6A 3OQ1A 4P5EA 2X3UA 4MJ7A 1FTYA 1UBHS 3ABIA 3AHJA 8ADHA 2OQ2A 1PEKE 1U02A 3D54D 2GR9A 1N6OA 4LBVA 1E5XA 4ZTZB 2JLWA 1V3QE 2ZATA 4UE2A 4TUYF 2WSSA 5EUMA 3TVYA 1A7JA 3NWBA 4XWAA 2JJ2A 1A27A 1EXNA 1GDHA 1XE3A 4N8SA 4FE4A 2X2EA 2DQYA 2EX1A 5LQUA 4KL8S 3JD4A 4JLVA 2VF2A 4ER7A 3F7NA 4P92A 4A16A 2EKDA 4ZI3A 4Q1FA 4ZVRA 1QK5A 1HOXA 1TF7A 3UUWA 5DXAA 1C8BA 2QLNA 3G89A 1M2EA 3IVAA 3QMMA 4BATA 4QXRA 5J43A 3CVYA 4MUHA 3TJMA 2Q5IA 4RSRA 4YWHA 1LGYA 1QFZA 2ZRAA 4B5KA 3DEYX 1FRFS 4CKCB 3NR2A 1PUJA 4L8YA 4AP6A 5THKA 4I1PA 2JFXA 2X58A 1EFVB 3KALA 1P0QA 4NPAA 5LUBA 3KPJA 4JJ4A 4YRMA 1E1CA 3ECAA 3P96A 4C1NA 1AGPA 2Z8YA 1IQRA 2GD0A 4K6HA 5K0JA 4Y3UA 2MYTA 3G68A 5D51S 2Z3VA 4Q9KA 1Y6GA 1B0UA 3O2SB 4PQEA 2OORA 4BFZA 3BT7A 3LC1O 1JXOA 1XLWA 2C00A 1ZOLA 5J1SB 3V3TA 5H3CA 2JH9A 1O8BA 2B5OA 2XOXA 3IV9A 1N9GA 3OCYA 3Q9SA 1R4ZA 4KPUA 2Q3JA 4RMJA 5DV9A 4BO3A 4C78A 2VF7A 5M34A 4QX6A 1FW8A 4U7HA 1VMEA 1Z39A 3IULA 4MDHA 4QTXA 2CD7A 3IIJA 1G98A 4RY0A 4NCIA 4L02A 3OTOB 2UZ1B 4ZI5A 1NBMA 2WG2A 5CVEA 4BJ1A 3LQRA 4CLDA 2B0JA 2Z1MA 5ELMA 1E2PA 1MB9A 4CLXA 1ZR2A 1VA5A 2Z08A 3QEOA 1FOEB 3I2HA 4AMUA 5L9AA 4WNYA 1QH9A 1NOKA 1R0KA 3PGXA 4MDEA 3FUCA 3NLLA 4HWRA 1MD9A 4C6RA 1W73A 2G04A 3KP1A 4D80A 1Q83A 1G5QA 3A8TA 3H6GA 4MUIA 2QA5A 2FU5C 3K2BA 1HDGO 1I4LD 4UM9D 3K1JA 4ARCA 2B1GA 4GYKA 4BRUA 3EXHA 3PHIA 2H2DA 1JA1A 2W8BB 4ND2A 4ZCMA 1LF0A 2E3JA 3LUGA 3GLGB 3HVJA 4AI6A 1WHTA 2X6TA 3D3EA 3UT6A 1J8FA 4KBYA 1TTHA 4I3GA 1FXSA 1MTZA 1NVXQ 2ONYA 1GKIA 2YV3A 3ANXA 3OZIA 3QBJA 5FA5A 1GFWA 4YO7A 1A8IA 3PC2A 1BXRB 2CLLB 4FT4A 4JOCA 3O75A 5IVDA 3RK1A 3H0CA 3QFFA 4FYMA 3GDOA 4QUAA 2FWIA 2Y9MB 3VAZA 3WGGA 3GDGA 3T41A 3RTDA 3RARA 1NLYA 4DR3B 1CIJA 5LQCA 2YV1A 3SQMA 1CE8B 1BNCA 1GGMA 1Y9DA 1XC7A 2QM8A 4HWGA 2ZJBA 2C3UA 3ETCA 3OESA 4J49A 3MTQA 1NFFA 4ZAFA 4ZCTA 4B32A 3E1GA 4NMMA 4RK1A 5CPBA 2DRIA 3KV3O 2PEYA 2LVBA 3L9XA 4C30A 4BVFA 2OV8A 1YZHA 3IEXA 4AN4A 1M2OA 4AUEA 4GNRA 2PAFA 4YDSA 5JCJA 4BVAA 1BGVA 3WV4A 3K4PA 1V26A 1SZPA 1RXYA 3CR3C 5C31A 3WP0A 2WC1A 3OG9A 4PCUA 3RYFB 1SQFA 2JDID 2WUWE 2XMGA 3DWIA 3BAFA 3G6KA 1XK7A 3FYUB 3FWNA 2VJMB 4UVDA 2R1TA 3TBFA 4DMCA 4HLUC 5LZ2A 1T8WA 1TLFA 1Z6PA 4AMYA 3KXKA 4MP8A 3UBTA 4EA9A 5G0WA 2CHVA 3B2EA 2ZULA 1HEIA 2RGEA 3IHKA 4G5OA 4WRRA 1ST3A 2WYVA 5EL0A 5KTSA 2WW8A 3DEIA 1OF1A 1IY0A 1U0HC 2JD1A 3JQ9A 1VHTA 2AOUA 5AKYA 2X6RA 2AEMA 4G25A 4B3SB 1TCAA 4E5NA 3ZJUA 3MRXA 4W99A 5K99A 1NVBA 4MVJM 1BA2A 2V6GA 2BY4A 3CQ9A 1YR8A 2PMEA 4FB5A 4LOJA 2DTDA 2AJCA 4DV3B 4CL3A 4FKZA 3DVAA 4K0KB 3NTLA 1PT6A 4AS3A 1Y1QA 1C9MA 3LUFA 1QHSA 3ETGA 1SOWA 5F2OA 1EG7A 1UDWA 5AVKA 1NX9A 1WSBA 2GQ0A 2PQ2A 4PCLA 1AQUA 1KZ9A 3LE8A 3C5CA 4G85A 4ZU6X 4DIUA 4DMMA 4GWKA 2QGFA 1J9GA 1K27A 4UMEA 3MEQA 2Q5CA 4UHKA 3COVA 2ST1A 5FOSA 3CLRD 4LJ7A 4QC2A 2VT2A 3H2SA 4XR9A 2QE7D 3BUSA 4MCAA 1FRVA 1OFUX 3D3NA 3KR9A 2ZSFA 2ECPA 3H1BA 4KGXA 6PFKA 5KWIA 1F38A 4QHSA 1M1YE 1LKZA 4TZ0A 4J0DA 4OOFA 3R23A 3R7WA 3D8HA 3A1TA 2AX4A 4IG9A 3MLEA 4QDXA 1CJKC 4BQRA 5KNCA 3U4QB 3WRYC 3B9BA 2QW8A 1Y3AA 2H1LA 2RKOA 3DGEC 4ZHQF 2HF7A 3BORA 4JQSA 1Q15A 4ND3A 4UAJA 1EXVA 2RAPA 4O3FA 1NUHA 3THWB 4DWWA 2G4VA 4H1VA 4K9RA 1S3GA 4I8XA 2YJ3A 5D85A 2H51A 2IDZA 3OPYI 5JZ9A 3LY8A 5EWLA 4ARZB 5H4GA 2XBMA 1YRLA 4LX0A 5CCXA 3BWYA 3C5EA 1XZJA 4DLNA 4QXQA 5IYZB 1A7UA 4ISCA 1XTQA 3AUFA 3ND7A 2Q7OE 1D7OA 1NU8A 1PZNA 2HWKA 3DMHA 2FJPA 3NWOA 1O6BA 2C84A 2O5RA 5JAIA 2XUJA 3JRNA 1RTKA 1FXWF 2DY1A 3IT3A 4HEQA 4P7GA 1P1JA 1XA3A 5BW6B 1KYQA 1TI7A 4P08A 2YJ6A 3IOYA 4L5BA 1K5PA 1JTEA 1Z0SA 1PT5A 2BGKA 5CHEA 3DAHA 3W9BA 1KK1A 4EVIA 1RACA 3QIVA 3GZ4A 1NJ8A 4WCFC 4DQUA 4PNPA 1GZ6A 2PS1A 2OBFA 2NU7A 3EXEA 2AWOA 4KAAA 4S3MA 3OT5A 1FYVA 4MW5A 2JHPA 3B7GA 3G5UA 2IYYA 1UBRS 2WTEA 2WLTA 2OXTA 1UJBA 2WM2A 4H3SA 1KC3A 1QLWA 3WRVA 4FIDA 2IXFA 4HQFA 1KJ9A 1A8QA 5HQ3A 2WOOA 4FMCF 1CR4A 4O4HA 3THXA 2X1VA 3COPA 1LWOA 2AS0A 4KVGA 4QTUB 1NUSA 1QPBA 2YTZA 3SK0A 1UEXC 2HDHA 4TTSA 5LP6B 3LAWA 3N2YA 3OCZA 5HCNA 1L3BA 3RVLA 3TNJA 3WDKA 4EYQA 4ZAXA 4TQUS 3CS3A 4U3JB 4UEKA 5T6BA 1YL5A 4BIIA 4CM6A 3OIDA 5DI3B 4O4IB 2PUWA 2AV6A 3T7TA 4CM9D 4CKZA 3AMVA 1FFXA 1JHQA 4LDPA 3UMMA 4WFKA 5F52A 1JEJA 1UPCA 2XDQA 4BCBA 3B89A 1TEVA 3KYIB 4HMQA 2VPQA 1PLLA 2TMDA 3N07A 1VM6A 5B7GA 4BN0A 4PZUA 4P4UA 1MJGA 1ZMRA 4AZ3A 4BU0A 1L5YA 3UICA 4PYJA 1OR8A 3ZWDA 5B3LA 1XZMA 3ZJYA 3ZDZB 2C2BA 2N46A 1HQCA 4NBNA 4CLOB 1S2MA 3OQIB 2W9XA 1LK0A 1SXJB 4B2YA 1IZZA 2CK3A 1KOJA 5FBWB 3RS2A 5KU7A 1M1XB 4QEKA 2DHEA 3DWGA 3SFTA 3R7FA 3OLQA 3AYXB 2HPHA 4BLWA 1OX4A 4KNWA 2OFWA 2EXXA 2H08A 2BJWA 4P32A 3L7IA 1Y4SA 1T36A 3KR0A 4ZA2A 1RBZA 1X9IA 1BXKA 3H5NA 3IUJA 3KAKA 4NJEB 1J23A 3DLHA 5BQFA 4CTOA 1RPZA 4F2HA 2A1TR 1I9GA 1X9GA 1O97D 2WF6A 1VRCA 2D7CA 4MUYA 1C8LA 4O4JA 4PRZA 1GHTA 1UUFA 3PNLA 3ZPXA 4CTKA 1ZU4A 4H3KB 1UJ6A 1NQAO 2R8PA 3LHIA 2FFAA 2IXEA 3TTWA 3BTVA 4DC0A 5DWVA 1DKOA 4YXWA 1QHHB 5LYYA 1Q7GA 4IKOA 3ZTYA 3EJ6A 1KA9H 2FPMA 2WKRA 1YFJA 1VDMA 1K8QA 3P45A 4NDNE 5EC8A 1Q0ZA 4FYIA 2FQQA 2JLVA 3UJ9A 2WHEA 2IYPA 2XR1A 4LFCB 3T9EA 3VGPA 4PSAA 3WDLA 2QE6A 4S0ZA 4U7TB 2ZI9A 1IWPB 3K92A 1HLFA 1PT7A 1YRQA 3C1UA 3M0EA 2QZSA 5DVZA 6AT1A 2NYUA 3F4BA 4CI9A 1FP2A 1P7WA 3DUFB 2G88A 4GHWA 3QMVA 5J4YA 2IYSA 5TQJA 2DVMA 4EQ6B 3BMQA 4F3KA 1USVA 4G1CA 3HYSA 1YS2X 4P38A 1X2EA 4FSDA 4WH0A 5CDGA 4R7TA 5HF5A 4CTNA 1XG5A 2CF5A 3R8CA 5CDSA 5MGBA 2R4UA 2WU0A 1DMSA 1WA5A 4JQZA 5JATA 3IBFA 1AQNA 2I76A 3HADA 3GFGA 3EC1A 1TX4B 1T15A 2R4TA 2WAAA 2FEPA 1NN1A 1XEXA 4LRQA 3TQOA 1WX1A 4BQEA 1YDEA 5AVZA 4D41A 1DEKA 2X9NA 4EHFA 1QVRA 1AB5A 2I1LA 1ESEA 1CS4C 1N2BA 2EAUA 3FKSA 5FTMA 2Z6VA 3HCPA 3TIGA 1XZBA 2AFHE 1ZN8A 2ZDHA 3KDSE 4QRIA 1I4WA 2HU8A 3EXIA 1OMOA 1TNDA 3MSXA 4REQA 1H4VB 3ZWOA 5F7OA 5FWNA 1NIPA 5KWJA 1YUBA 3G6WA 3JAKB 3U81A 1N1MA 2QROA 1H23A 3MWEB 2K2QB 3IPYA 2RGWA 4ILEA 4TKVA 4XQ0A 3AOGA 4ZO6A 4BNMA 4DIEA 5TS2A 3AJAA 3WL8A 2G9ZA 5CM2Z 3ADDA 1EK0A 1BS2A 4J1QA 4QG7A 4XPZA 3K8QA 4KYTA 4CKXA 3CZAA 4JJIA 4P0QB 3HLTA 2HU5A 4J2TA 4RTNA 1NNI1 1NN5A 2H4FA 1C30A 2TS1A 3W8NA 3QEAZ 3NJ4A 5C8ZA 3ZV7A 4B3GA 3GD7A 4LTMA 1SCAA 1IBSA 5TX7A 2P9HA 4JYZA 5DF1A 3DEZA 3PG5A 4OJKA 1NYRA 4ZQBA 5K3FA 3EB9A 1ZN2A 4Y7DA 5JCOC 3STYA 1YDMA 3FVWA 1SUCA 1J1UA 2FRDA 2XUHA 4FEGA 1IK4A 1P81A 3G7NA 3K2EA 3ZQJA 2EIHA 1P7YA 2BISA 2IHTA 1Z83A 2A94A 4L15A 2MSCB 3IEIA 2LV8A 3OZEA 5CRIA 5AKKA 3WIUA 1XVLA 2Q5FA 5EERA 4ERNA 3GGDA 4RD0A 2J6IA 4E1BA 2R66A 1EK1A 4NBVA 4O2RA 4OMUA 4U1RA 5EVCA 3VKWA 4EFNA 4GL2A 1QX4A 1YNSA 4URZR 1U0SY 3HB4X 3VZRA 4AWBA 4LDRA 4R98A 4GVLA 5K0ZA 4OKIA 2D13A 4KGZA 3ZHVA 4O0LA 3VR2A 3UMYA 1E1RA 3TD2A 3FGNA 3G1TA 1OI2A 3OKFA 3IH5A 4XX1A 5AVOA 3WS7A 3IIMA 4E11A 1XZLA 3AL3A 3D8TA 4NP6A 3V4VB 2JD2A 2AXNA 2BHTA 1W29A 2ACKA 1A2QA 3IQGX 2XKKA 2AQ8A 4PGHA 2H8KA 5EJMA 3MWDB 3QIAA 4JXKA 1DFHA 1UK9A 5IC5A 1A95A 3LW7A 4B2PA 4BE7B 1E92A 5A2GA 3MTEA 3T3IA 3QU2A 1JS1X 4GKJB 1XJ0A 1O6CA 5DM70 4Y6LA 4WBXC 5I7VA 2FMTA 4L6AA 3I04M 4JD5A 5H16A 3PFNA 4G0YA 5H3HA 3QUAA 4MO9A 3T1VA 5C1BA 3IYLW 1G8GA 3LPLA 1PFGA 4G86A 4MLZA 3DBRB 3HZHA 5DHTA 2HPZA 3S8EA 2XECA 3FETA 4CMHA 1E6UA 2GZ1A 2XWBF 4L7QA 1DFIA 4I1YA 3UFXB 9LDBA 1AN9A 1PJRA 1AMNA 2O6LA 2QAIA 2CNDA 2QAGB 5DULA 3THOA 3D5EA 2W70A 4GC5A 3EAGA 3LK7A 1J5PA 2J08A 1DKQA 1WU7A 5JXIA 3IP1A 3FDFA 4MGEA 4J16A 1MGOA 2B94A 1Q14A 5TB5A 3GFBA 4OAPA 4RULA 3I6BA 3K2IA 1VMIA 3S4YA 3H97A 3VYUB 4E13A 5KNDH 4BV8A 3WKCA 4YHHB 4V0NA 4OATA 3EGDA 5B4VA 2RFLA 2PT7A 1CIVA 1E7SA 4OXYA 4NHOA 3A2LA 3PUIA 4Y2UA 3T7DA 1C0KA 2XMQA 5GIOE 1T0JB 5ALDA 4AY4A 3W06A 1BDHA 2FJ0A 3Q40A 4GM0A 5LA6F 2Q1XA 4DLRA 1ZAKA 3FIJA 4GWLA 2VXYA 2OUKA 2ERCA 3QBVA 2OVBA 2J45A 2R8EA 4NNJA 3VOAA 2VZ8A 1XQWA 1KU6A 3S29A 1UKZA 1V2GA 1DTEA 2AR0A 2Q3HA 1LJ8A 4H2DA 3SZRA 2WQ7A 2I6TA 4NAUA 5AICA 5FBVB 1DWOA 2FPGB 3HBMA 4CJXA 3QPAA 4J1TA 1F06A 1FTWA 3K9NA 4HGYA 1MIHA 3N5KA 2JHFA 5AUOB 1TCUA 4I3HA 4TVSA 2Z9BA 1ULTA 3I61A 3MTBA 1H2ZA 2HA0A 1JHOA 1O6ZA 4DARA 2O54A 5JJIA 4AULA 5LB4A 4YMLA 5TQVA 4F6CA 2R8YA 3BSWA 2IW1A 4FR0A 2P6PA 3U3XA 1YACA 2ZWAA 1OH7A 1SD5A 3IRVA 2JGDA 4MIOA 3ZK9A 2DQSA 4HUQA 1DDGA 1V8PA 4OFWA 4H0FA 3R4CA 1BU5A 4EL5A 4AY3A 1OA0A 4Z3DA 4NE7A 3O8DA 2Q50A 3BDAA 1V5IA 1O95D 4KOEC 2WR8A 3UENA 5LOVF 2QLMA 3WTBA 3B8HA 3LXXA 1G3MA 3PQ4A 1XHEA 2W6MA 3DB1A 1JG7A 3IO5A 3WLFA 2Y1GA 4X20B 4Y9DA 4RMNA 1EHYA 2E4UA 2FP4A 1JJ7A 5DM0A 2Z2KA 2WKPA 1YRWA 4LN1A 3ZZUA 3H8JA 1BQEA 2AVDA 4CR7A 1FZQA 2DP4E 4PWZA 4ZAWA 4X62B 2KHZA 1J21A 4B2IA 4CN8A 1RIIA 1RWMA 4IDNA 4Q4JA 2FN8A 1ADFA 1DBRA 2VK8A 1XUOA 1MAWA 3E15A 2AQHA 4HLDA 1ZH2A 2IOHA 2R6HA 5BNIA 3H83A 2VJCA 1NVKA 2EKZA 1C0PA 2PKQO 3KT6A 2E5FA 2R8OA 3OJOA 4N82A 3WI7A 2EJWA 3GFTA 1XTPA 2NWQA 3E6AA 3IEVA 2CDBA 4FVTA 2QUAA 4D81A 1OI3A 3DTVD 5JS2A 3EYAA 1I3CA 2H1WA 3F98A 5TV2A 3WHLA 3GDFA 5DNUA 4ZDJA 2PRSA 3STTA 4C89A 4ZGBA 2PBLA 1WHSA 3L1IA 1QGUA 3VDNB 1NLZA 3WGQA 2XRZA 4G23A 5EE0A 4IVQA 4WBSA 3K0SA 1IIRA 4CIAA 1WIWA 1ARZA 3H1AA 3CJTA 1D0VA 2VOJA 3VTKA 1JKMA 2PZFA 4X3CA 3S2SA 1XRPA 2QN1A 1SCQA 3TOVA 5JJ5A 1CDZA 1A4XA 5T67A 3ZZ0A 2X41A 4L73A 4UASA 1IPFA 1IWBB 2OFOA 4YRKA 3U40A 3AO0B 1Q3TA 2AMVA 2QTGA 3DF9A 3GT4A 4QVGA 4L6IA 4X7RA 1EPUA 4QXOA 5IVKA 2Y6VA 5DBOA 1R8SA 4J0FA 5DFAA 1Y80A 1AD2A 1JB9A 1G2OA 1HL3A 3HV2A 3IGFA 4OQPA 1OZHA 2IVFA 2PRJA 3BWEA 4I81A 3W6UA 4EVQA 1ZUNB 1OIWA 3PC7A 1X70A 1RLTA 1RJ9A 2HX1A 2GZ2A 4IDCA 1Q0UA 4YP0A 5B58C 4CQMD 4L2IA 1WXFA 1Y4DE 3A70A 3JQGA 1F8GA 2V5VA 4R6WA 1GPWB 3LRXA 4C43A 3LO5A 1S89A 2WF7A 3F9CA 2PMCA 3C5WP 3P97A 2WTBA 4MVJP 5JYEA 1SBCA 5KHLB 1A1SA 4EQZA 1S9HA 2FFJA 4UULA 1KJ8A 3BL6A 1ZGAA 1UDCA 4PHGA 1EFCA 2JIZA 1S3IA 3OE7D 4AU1A 2O4UX 3F0TA 3L6UA 2NVBA 3O5AA 5SYMA 1SEVA 4IFIA 4EIWA 4JVLA 3ROXA 5KX5B 1CRPA 1C41A 5CBPB 4YMSA 2GMWA 4RTMA 1OGYA 1FXUA 5LQRA 4Z49A 3FPHA 2OCBA 5FT9A 2WWYA 2WTXA 3LF2A 3C98A 1VG0B 3PUKA 4QRHA 4R1UA 1LLDA 3B3QA 1Y9AA 2FR8C 1IOZA 4ND5A 3E70C 3LPNA 5BWNA 5JROA 1P17A 3NM4A 4U0JA 4Q3OA 4QBGB 1QONA 3LRPA 4JP2A 1JG3A 1WCWA 2YC4C 1COZA 2YJTD 3BD9A 4IL5A 4J91A 2EP7A 3VOBA 2XF2A 2ZYAA 4MGHA 3ZU4A 1GQYA 2Y0BA 1SVNA 2CL7X 3L41A 4K6KA 2Y99A 5KBYA 3QBTA 3AYZB 3ZDQA 2IYLD 1TF2A 2ZSDA 2IP2A 1ZLYA 3LFTA 2WIFA 4NX2A 4ARIA 3GMIA 4HEA1 1NW7A 4FEAA 4U9UA 2ZTSA 4G5GA 5AKIA 1PG0A 3GEPA 4HYEA 3AKCA 2EDAA 2C78A 3WKAA 1WBJB 3AJ8A 4OGLA 1OLUB 4E7OA 4PINA 3EBOA 2YRXA 2CHUA 1TD1A 1B76A 1OWLA 1HZJA 4F5WA 2DWOA 3LWDA 2C4WA 3IB6A 4MV6A 4PFKA 2FG7C 5CFLA 3Q9UA 4JI2B 5B53A 3ZR4B 4YP6A 1GSHA 5FNVF 3EFOB 4LYYA 4D3XA 4DIMA 3AW8A 5IT5A 4PGAA 1SO8A 4JDUA 3M34A 1DCTA 1VLVA 2NG1A 3T3OA 1GSOA 1UPUA 4Q7EA 5BYJA 1EA7A 2VNKA 4HNTA 4G5XA 4U6NA 3B3FA 4JB8A 4KN8A 1HA3A 2QF7A 4V3CA 1SA0A 2F3SA 4J1NA 4EEXA 3K8YA 3Q3VA 5KYYA 2XHZA 1XXHB 2QI9F 2GTPA 3B1KA 5JY6A 4YY3B 1K7FB 2IEIA 3G2HA 3LPCA 3E7FA 1W9HA 3B8EA 3R6TA 4WKOA 2XBLA 1OBOA 3D0KA 3GWGA 1JJFA 1T3TA 3INTA 3SYKA 1ZMXA 3TXYA 2C4HA 4P2BA 2HU7A 1RBMA 5AUPB 2C5BA 4AW9A 4ETIA 2L2QA 2OZVA 4AY6A 3AVXA 4FMDF 3A6DA 3ASZA 3ZE9A 2H1SA 3QU7A 5BN5A 1E3DA 1K1EA 1AGRA 2G1UA 1KZ1A 1Z34A 3HB5X 3HKCA 3VU9A 1N0IA 2P68A 1YO6A 4RANA 2WF5A 5CP8A 5AXAA 3T3MB 5C52B 5E1DA 4QQNA 1JG2A 1GPUA 4AG3A 2ZRDA 2VYND 3L05A 2C2ZA 1VZ3A 1X1BA 3BMNA 4ZXPA 4YAKA 3ENZA 1I0LA 3BFPA 4FHEA 5EZ6B 1I8TA 3M5CA 4EHKA 3NUQA 2A3NA 4UJ5A 1GGVA 1DBSA 2AFIA 3QX8A 4WNAA 4CVNA 2UUBB 1SBIA 2V4ZA 3QUCA 5LPNA 1NKVA 1TPZA 2I2WA 4R3NA 1TUBB 2Z1DA 4B6QA 4ZT2A 4N1AA 1M6EX 3KXLA 2C5GA 3REQB 2YC2C 3QENA 3SJZA 5KVAA 4G56A 1EUZA 1Q74A 2A5DA 1ACJA 1QBGA 3AINA 4PPYA 5FFMA 5K3BA 4BP8A 5L4NA 3KLNA 3VH3A 1FFWA 1K98A 4FDMA 1GPH1 2OHHA 4G2NA 3FGZA 3WO1A 1E7MA 1UFVA 4UXIA 3RRNA 3DWFA 4IMIB 4CM5A 1KAHA 4IZ6A 1IUPA 3L8CA 4FMBB 3AUUA 5ERYA 4NPCA 3TD9A 2M98A 1N6IA 2F3TA 5BMVF 5CB4F 1YIAA 4HNAA 4HX2A 2Q4OA 4YS6A 3LG2A 2F62A 1YR6A 4EECA 4M38A 4YMHA 4JYPA 2XTMA 3RVPA 1VTKA 5MDHA 1RQXA 1E6LA 2ZRPA 4BVHA 1V7QA 1FK8A 4A82A 2AJDA 1BVRA 1XCJA 1U94A 3KLMX 4OPMA 5EGNA 1NLMA 3LK6A 1XB2A 4H4EA 5ALLA 3WYGA 5DLEA 1QGYA 1KQOA 3CZ4A 1P1HA 4HY3A 1WF6A 4XUEA 5DISB 5IP5A 4C22A 1QP4A 4JYAB 1VJTA 1YZUA 4GX2A 4MYUA 221PA 1NI4A 1PTKA 5AW6A 5CT9A 3DKRA 3ESAA 1E96A 2XODA 1RAHA 5HS6A 1SXIA 1T6BY 4DWVA 2JC3A 1G7SA 2WPNA 2HA6A 3L4KA 2FI1A 3AFOA 3BHNA 2ECKA 4C0JA 2JG3A 4N8EA 3VR1A 2F9LA 2I9PA 3DLTA 3T7AA 1TMYA 3R3XA 1PJ2A 3WKEA 4B3CA 3RAJA 1YS9A 1PW5A 2IIBA 1S2GA 1XNJA 2M1ZA 5BURA 5L4LA 4FI3F 1J0DA 2BONA 5CITA 4NU8X 4IDHA 1TAGA 2GCGA 3NIFB 4XM2A 1D9ZA 1J5EB 3RUAA 3EDQA 3WL4A 1P3JA 3HBNA 5J5CA 1O8CA 3K6JA 4A15A 2A0YA 2H4XA 4YLEA 4PYNA 1KQGA 2R00C 1VKHA 1CUFA 1FDVA 3D8UA 2YUTA 4WK0B 4DQ0A 4Y9UA 1CT9A 3D0RA 3UT5A 3PRKE 3VSEA 1N8KA 1G8FA 3O8OA 3QVGB 4GOJA 4R1PA 2XTAA 4Z0TA 4LWPA 4CL0A 3D3WB 2R8BA 5AKEA 4YMVA 1WDKA 2Y9PB 4UATA 4N47A 3VU3A 1UIMA 1PSZA 2EFDB 2OTCA 5FA6A 4DKXA 3QRWA 4GM1A 2BFBA 2KWIA 3T5TA 3RT1A 1HE4A 3VVMA 1E9BA 1ZKMA 4DG8A 4AX8A 5JWHA 1CQXA 4CWAA 4HB4A 2EBFX 3PUZA 4MV9A 4XIFA 1PLKA 3ONDA 1KEUA 3Q0TA 2WINI 5ITSA 2WIBA 1MQAA 1OILA 1EXMA 2AT1A 4XSGA 3LKDA 3RG2A 3NBQA 1XN1A 2GRUA 3QU5A 1FRQA 3HY6A 3JYQA 4R2KA 2V7EA 3DKVA 1SB8A 2YN4A 5JXGA 1YF3A 4DLAA 3KQVA 4LJLA 3DOIA 5CCBA 1TQ6A 2HQBA 1Z2AA 1D0IA 3OO0A 3H5OA 5DB4A 2HA4A 2ZYSA 3LQYA 1R6VA 2ZIWB 3I4CA 3GXOA 3WGTA 5HXAA 4ZT6A 2XITA 3ZE1B 4N8DA 1W30A 1R4NA 5C3UA 4WZBE 2HJRA 3ZWBA 4ZDWA 3ISTA 4D9BA 2W71A 5T7BA 1LC3A 1PFUA 1PWYE 2P9YA 1G8HA 3AJ9A 3EZYA 4G1BA 3U0VA 3VOTA 1Y5MA 4I4CA 3ONFA 4P3PA 1UBLS 4BX9A 4IDBA 4GR9A 1BFDA 3R77A 2G9VA 3SZOA 2NO1A 3ZBTA 3AEQA 2C8VA 2P6OA 2V7PA 3O31A 3WLOA 4EHDA 3C16C 3G7UA 4HZUB 1DV2A 1XHLA 3ZHBA 4AJOA 4EYGA 3LX5A 4O1IA 5B1SA 1ZNXA 1E4YA 2A0UA 4IJWA 2ZEJA 3U6KA 3C4VA 4RSMA 4TYWA 1T1IA 4Z4CA 4AJKA 3V7UA 3ZDAA 2FHPA 5IM5A 1PHRA 4V38A 5CG1A 3IIIA 4RDIA 3QYPA 2FFRA 1RE0A 3JAWA 3T7CA 2XMPA 2HYIC 3NB0A 4HDRB 4JGIA 1PJBA 4KMMA 2QRVA 3FFAA 2I6QA 2OT3B 5D2CA 2VXCA 4OA8A 3GUHA 2Y1XA 3OI7A 4OKNA 4Z51A 1DCKA 1MAHA 2UYGA 2FRVA 4L5AA 5KAPA 4ND6A 4RCVA 1JEEA 3IPAA 2R8RA 4KR2A 4FCTA 4Y9TA 5IHXA 3RTAA 2AEEA 3C6YA 4EW6A 2F1IA 2CXTA 2I2AA 5CA1A 1L4LA 1D2HA 3QKRA 2ACWA 3MRVA 5GOTA 3REFA 4BKRA 2WBLC 2QKYA 3LGAA 2H11A 1JQEA 5EVJA 3V00A 1E99A 2PGNA 2ZI4A 3G13A 4GYJA 1CQZA 1O97C 1TMKA 4DNOA 1VLJA 3DV0A 4YCDA 4J4BA 2P9BA 3HUDA 3CSSA 3LX6A 4IQFA 3W3ZB 2UVQA 4C1BA 3A7DA 1NQVA 1KEEA 3G5TA 3ORFA 4LJKA 3OE5A 4MHTA 4IGEA 4GL4A 3A1DA 1HV8A 4QAQA 5EKUA 3HA2A 5K4AA 1XMQB 1M1YB 3JVVA 2YOGA 3ZWQA 3EG9A 2QTNA 4XGQA 2FR1A 1CULC 3S2GA 3SGLA 2VH2A 5DNVA 2C98A 4V0MA 2ORYA 5ECYA 4X1OA 1NC3A 1U5BA 1BXGA 5T64A 1RAIA 1JNXX 3H0KA 3H42B 3RRBA 1B14A 3E22B 4FGWA 2X77A 1FLAA 2ZAYA 1T2UA 3WL6A 4QOFA 5AVQA 1CU1A 2V0CA 4YQZA 2W4IA 3HGTA 4YPFA 4LCJA 3RHFA 5HZKA 5AJUA 4PFSA 5E4FA 4DMGA 5ALTA 2GZ3A 1QZXA 3WISA 1SIWA 3OLVA 2H2IA 2NSLA 4N7RA 1QQ5A 4YAEA 4BVJA 4F3NA 2PKCA 1YC5A 2E4VA 2GVNA 2QLFA 1KGDA 2AFRA 4EB6B 5LU9A 4GBED 4IIJA 4UTXA 4MR9B 1A2KC 2C31A 4R8SA 3PCXA 1TB4A 1WZIA 1XPOA 1G18A 1XF9A 3Q72A 2ZUEA 2YZ7A 3A04A 1ECLA 4WZ6A 3D4PA 3CY6A 3CO5A 4A91A 1V1RA 3CF0A 1QF9A 2DPGA 1WDWB 4HLNA 1V25A 4EJSA 3LKVA 1C9EA 1ECGA 1Z5UA 4H35A 4RGYA 4L8GA 3TAXA 2ATVA 3DBVO 3IEMA 3K16A 5L3SB 1RD4A 5DHQA 3E9DA 4H6VA 2VIIA 1V8BA 4JLSA 2QMEA 4N6NA 3J80A 5A7HA 2I3DA 3KBOA 4CQLA 4ZI7F 3IKVA 4TL7A 3O2NA 5TPZA 4BAUA 5F73A 3GLTA 1PGQA 3ENQA 4MP3A 2JGEA 3IS3A 3MGBA 1Q6YA 1OVMA 1UDXA 1DVRA 2P9EA 3P52A 2ZSUA 3WRYA 1SBTA 1ZRNA 4JA2A 1WMAA 3SR0A 2KQUA 2D8AA 4I4IA 3HXOA 5TNXA 2OBLA 5FL7D 1SM4A 4A0GA 1AKMA 4EKNB 4K2HA 3FCXA 5IJWA 1K3FA 2IKQA 3P2KA 2PSHA 1EGQA 1KIAA 4X91A 5JYBA 4K3VA 3U60B 1LS6A 1AKRA 2WILA 3K35A 1PJSA 1M66A 4HK4A 4NQZA 5ITWA 1EBFA 2FSIA 1BRMA 1CVRA 2BFMA 3W1WA 4YJKA 4L5JA 2IZ1A 3ET4A 2H18A 3V4PB 4Q3DA 5KTNA 1PF7E 1V6CA 4D44A 4HRAA 2FPOA 3QLVA 1GZ3A 5JISA 1S96A 1ULHA 2DUUA 3I64A 1TM7E 2IRWA 4ZOAA 1LPAB 1P2TA 2LTAA 3T4PA 4MAAA 1J7JA 1U7ZA 1UQUA 4W1PA 3NALA 1EUYA 4EPVA 1FDOA 4UD6A 3A0UA 3WOHA 1MPXA 3QM1A 3CURA 2QVGA 3K6SA 2A4KA 4WCFA 3RK0A 3WQQA 2DPLA 5TC4A 1U31A 1GCIA 3CH4B 1R8YA 3K9QO 3SKVA 3JPWA 1Z5WA 2RARA 1INLA 1L5ZA 2I4MA 3Q3IA 3KB2A 3EPPA 2EEZA 2OZKA 1EVEA 1NBAA 5B5SA 2IYRA 3R74A 2XCRB 2VQEB 3MC1A 4I4LA 1G8PA 1CR0A 4LY0A 3KQSA 2DBVO 5JZSA 1HZZC 4D43A 3EA0A 4MUXA 4QD3A 1NXOA 2TSYB 5ARCA 3LBNA 2GKSA 2DQZA 1CK4A 4ARAA 1CG6A 1TO2E 3COWA 1KDYA 2I7XA 1EP3B 3AOEC 4XGRA 1A50B 5C80A 4EA6A 3M5WA 1FUKA 1TYAE 2QRQA 5KTOA 3P9SA 3T4UA 4MWGA 4IP0A 5BN4B 1QO9A 1YDHA 4IINA 4BFCA 4H1HA 1P19A 5IZ4A 2FQWA 4C4TA 2I3BA 3HZRA 5K8CA 4FMDB 4BLTA 1CUXA 4OLBA 3ORHA 3IAXA 1MVOA 3NBAA 1E89A 1F14A 3QUBA 2VWGA 1WMSA 4BUZA 1TYCA 2MHCA 1ZGCA 1A9RA 1KS2A 2E55A 4N7BA 1RC0A 4GS5A 1X1TA 1QF7A 5D87A 3T7JA 4IJKA 4W1SA 2OXCA 4UUMA 1CEXA 1MORA 2YICA 4JYCA 2W6PA 3GRYA 1HT3A 3CW8X 1UINA 3RV3A 2IXBA 1N2CE 1ZWKA 1SVSA 3PWZA 2CKDA 3UT0A 4Z0PA 4YQEA 3GVXA 3GH1A 4Q9LA 1NBME 5JMOA 2ZR9A 3FAKA 3EE6A 1JBEA 4KNVA 2PO5A 2PZLA 4AZWA 4RZXA 1UPXA 4ON9A 4XIYA 5SZHB 3WYDA 1OHHD 2I3AA 4MQBA 4M1SA 4II2A 1LBQA 1WD5A 2Q3MA 4ZZ1A 1G7RA 2OA0A 1OBVA 4R1SA 1S6YA 2AXPA 3OU7A 1BCRB 4UAVA 3JYNA 3HJFA 4MNTA 4ZCIA 1UOOA 1T9CA 3C14C 3GPDG 3Q3HA 3RNLA 3TKYA 1TAUA 4QT4A 4Y8VA 3AR9A 3SY8A 1M74A 4B6JA 1VE6A 1E2EA 4MJ3A 3X1WA 1A4UA 5GONA 1V8ZA 3QNWA 5ICSA 3RSHA 1B1CA 1HXHA 4I99A 3AB3A 1N0WA 2OWEA 2OESA 3DYIA 2GLXA 1LLQA 4MPJA 3LOPA 1Y7PA 4Z9FA 3CWCA 1DRKA 5HE9A 4B7CA 1V48A 2XCOA 2BZSA 1O95C 4ZDIA 5FLEX 3CNBA 3RO7A 4XH9B 3F73A 2N75A 2OO5C 3DM5A 2B20A 1N2ZA 4E94A 3R7DA 4RJKA 3OT4A 3HB0A 3HVUA 4LRWA 3BRCA 2VHUA 3FB4A 3D7NA 5LQJA 1DI0A 2IU6A 3AILA 4BNJA 1MFPA 4FHGA 4DLSA 4V0OA 3IELA 1JT2A 2EZUA 3VNQA 2IUFA 2CXQA 1CB7A 3B6KA 4EFDA 4F9EA 5IZCA 1R6XA 2PUDA 2N9UA 1D1PA 1J99A 3PPXA 4POAA 4XEUA 4OO3A 5DLPA 3E58A 3ND8A 3P9PA 4OVKA 1CJTC 2BKAA 2O7NA 3OICA 1MMFB 4EKGA 4EEKA 5CFZA 3ZIAD 3TFQA 4I5FA 1CVIA 5DHSA 4H7IA 5IUNC 2CN1A 3SHVA 2D00A 2WUVA 4MYHA 1EJBA 4NU5A 5TQ0A 4QOEA 4FWIB 1ZOOA 4R05A 2C83A 2H52A 4TWZA 3X2FA 1KVUA 3PDIB 4PC3A 5CD1A 1EZ1A 1F5NA 5ADVA 3U7FB 1VG9B 3P2JA 4TV9A 4MWCA 2QG9A 1K7EB 3WB9A 3KPYA 5IAOA 2MYNA 4DA4A 4HFRA 3TXXA 1OWOA 1Z82A 1NBWB 1Z0ZA 5CVTA 3Q6MA 1QHNA 5GPBA 3NXKA 4F8JA 3LY7A 5HPYB 4RCYA 2QMQA 1R0ZA 2BD0A 1JJAA 2IDMA 4R9UC 3GDHA 5DO9A 1KWGA 3SM9A 2JBAA 3DMFA 2XUAA 1YZFA 2YN0A 4N6GA 3JTEA 3IMCA 1A1VA 1ZRSA 2DTEA 3ITDA 3N2KB 4QGHA 3EISA 2WP0A 5AUQA 1HOTA 2F90A 4F46A 1I7SB 3NORA 5HFJA 2WWVD 5B1IA 1GPDG 2ZT6A 2MSKA 1V5WA 2VDJA 4KYVA 4L3WA 3G2JA 1UOQA 1JHMA 1F8FA 3SMVA 3UXMA 4QYWA 2C7GA 2V9CA 4TTPA 2AYZA 2IYUA 2OG1A 3P32A 1H0HA 1Z06A 4RIEA 2R7NA 3VHRA 5JVDA 2PMWB 3ND9A 4TVBA 3CUKA 4LJ8A 1Z6GA 4Y7CA 1NL3A 1U3VA 2VH5R 2H07A 3IDQA 5AI6A 5F33A 3RASA 5JCOA 3TW4A 3UWMA 1GO2A 4LC0A 2C96A 2DKOA 3ASUA 1K9VF 2XGSA 3WYNA 1OD6A 2BELA 3WXBA 2XOKD 2II6A 5EHZA 2DERA 2JKZA 1C3JA 3L8HA 4DJ5X 3Q5EA 3BCRA 4RUKA 1YU9A 1OPRA 2FRXA 2PWZA 5EUCA 3VJLA 3W1VA 2HHCA 3RIYA 3CN7A 3CPJB 3Q6IA 4J2OA 1RM5A 4DVGA 2AA3A 2WFLB 4NHEA 2I62A 4CU5A 4FDLA 8LDHA 2YL2A 3MTDA 2EBHX 1JHRA 2F1RA 3OO1A 5D5PA 1EHCA 1W0JD 4HPJB 4OBWA 3WLAA 4C08A 1TJNA 1JX6A 2O8NA 3E9QA 4IIHA 5BNFA 1XD2A 3WP1B 1P4RA 2NU8B 4BU1A 2QK4A 2QN6A 3O92A 2J6BA 2JFQA 4KLAA 1G9XA 1YVDA 3IURA 3PNQA 3TVTA 4BUJA 4OHUA 2FPIB 2VWQA 4B79A 3L7LA 4PZ9A 2V7BA 3G8CA 4BRZA 5BWBA 4HZIA 4GZ6A 2V6MA 5BRAA 5AVJA 3KC2A 4IMRA 2CW5A 4IEIA 4M0KA 4MS3A 4UTZA 2VUIB 5IUJC 1ODCA 5ARDA 2WYHA 3O83A 2EKPA 3NCHA 4RADA 3S1SA 1QB8A 1NG9A 4D9CA 3ADOA 2R2AA 2DY0A 2FFHA 1E1LA 1JPUA 3QE0A 1XQ1A 4G9GA 5CH5A 3TB4A 5BXQC 4BEVA 1IHXA 1QOPB 3QGMA 3OQOA 1SU6A 2IOFK 2EGHA 3QVJA 1MBZA 4YUVA 5TQ2B 4LVOA 3WQHA 4KZKA 3JQ7A 3SZUA 2G76A 4XOIA 4ATNA 4QKQA 5CIQA 5CX1B 1UOEA 3N05A 5E9WA 3P9XA 3I9JA 2GH1A 3ZGOA 1VCIA 4F60A 4JQOA 2WPDA 4RKQA 3AVPA 3KTAB 1IIBA 1X6VA 4RTLA 3I52A 3GCGA 4LOAA 4MLDA 3V46A 3RJ5A 4AZ0A 3EVDA 3N53A 3NBMA 2YHAA 2JHGA 5AOAA 5AQ1A 2Z3ZA 3R0IA 1IL0A 4HEHA 1N5RA 2CJWA 2R65A 4LYFA 1JQJC 4WQMA 1YOVA 1VFPA 4KWIA 2HPVA 2Y0DA 5REQB 4K9MA 3V5NA 3PDHA 1VP3A 3JY6A 3GPLA 3H8WA 4YRDA 5JNVA 4KAXA 2XE8A 3NAMA 1RQRA 4I08A 4XQ9A 2A35A 2N42A 3OY7A 3QXHA 4R5MA 2X0JA 3HR4A 3JQAB 4GZ3A 3TLCA 1GU0A 5B1YA 4C21A 1SIOA 2W2PA 3OEHD 1RLIA 3IESA 1JFFA 5JCPA 1YRYE 4DABA 3IUSA 4ZOQI 1NVTA 4TRMA 1BD4A 3B1JA 4KH0A 4Q4AB 4Y1RB 4XZ3A 3FR8A 1PNTA 1WVGA 3WNVA 2WWFA 5AD1A 5KEIA 5FP0A 1FDRA 4A36A 2CLHB 3ORRA 4PLVA 4MQ5A 2AF3C 5DGCA 1MC5A 3TUJC 4CCWA 4ZV4A 3MBKA 3T06B 4XB6B 4GX5A 4I1SA 3F6SA 3I8OA 4BRSA 1JR3E 1L7BA 2ZU6A 4U5QA 1NJSA 2HADA 1PTJA 2B4RO 1XZCA 2FXIA 3B78A 3FLEA 2IHVA 1K8XB 2IYTA 3HBJA 4XGNA 3E3LA 4G65A 2HLNA 3CRQA 4ARSA 4X90A 4LVNA 1Z28A 4C88A 2ZTLA 2L69A 4IHJF 4ENTA 2EJUA 2D0DA 4H60A 4V0QA 2A58A 3F6BX 3G2NA 1L3IA 4ETMA 3QXXA 2XMSA 4RZIA 3J7AC 4QO8A 3A4VA 3G8YA 4UDYX 5FH9A 1KY5A 2I6SA 1I24A 3VPGA 1N5KA 1F4LA 4FZRA 4HBZA 1NONA 1YNOA 4HRYA 4NOLA 4ZPJA 5IKMA 5F21A 1RP1A 4GW3A 3VTFA 2C5FA 3OECA 2EF1A 4KN6A 2Z5VA 4YAFA 3IHWA 1A71A 4N5LA 4RQAA 4XDHA 4Y6RA 2X0FA 3TPCA 3VQTA 3NRBA 1RLJA 2B2XA 2NACA 2R4QA 3VR4D 4I5IA 4UNQA 2AB0A 4NS1A 4CLRA 4U2DA 5C1PA 1T25A 5U9CA 4DMFA 4PLGA 1L5KA 1W35A 2OL4A 4D9FA 4N5DA 2BSQA 2EYUA 2ZBVA 3LCMA 3CRW1 4RACA 3RAGA 2PUCA 5CEFA 3EZGA 1U11A 5TIIA 1I3NA 1KJYA 3W7VA 5H70A 4Z4GA 3BH7A 1UJNA 2Z09A 4TT3D 4BXOA 4CT5A 3MMNA 4JT9A 4RX1A 2NSYA 4HDSB 3RHTA 1YBHA 1N6NA 3IL2A 3DMTC 2ZXFA 3K8ZA 4JUIA 3WLNA 2CMFA 1XZPA 5ER6A 1HE2A 4CLEA 1M8GA 3RYHB 1GTRA 4XX0A 1GL6A 2ZUVA 2VJAA 3N59A 4NAHA 1PFKA 4I66A 4RZUA 4FJ0A 1C3XA 1D1QA 1FTSA 4DQDA 3TRKA 3AX6A 1QIKA 4YPOA 5ARBA 3C8HA 1QNLA 4DTCA 5IH3A 4XJXA 3U4IA 4KQ2A 2A67A 2X9VA 3KVRA 4LI0A 2B8JA 2Q6OA 3A06A 4X24A 1AS0A 5BRNA 3RVSA 2ZANA 1DX4A 1QR6A 1RLMA 4MRNA 1GYRA 4QYSA 3WYEA 1QGED 5KQRA 5KOHB 1YB4A 3Q7QA 4PE5B 4P4LA 2YZGA 3EOBI 3G2LA 4QXMA 1MPTA 2XJ9A 5JZOA 2F43B 4PC6A 4E12A 3C4QA 2I7DA 2PGIA 4UU8A 1WR8A 2Z43A 4CM3A 1JL3A 2GK4A 1PK7A 1C50A 4Q7KA 4BUCA 4G63A 5JIBA 3EH1A 3D8RA 2DQ4A 4OQXA 1YIOA 3B53X 1Z4PX 2CDRA 3BIWA 2MSDB 1GTVA 1OAOC 3C8MA 3H65A 1Z4JA 2PKQP 4N76A 1NVDA 1DZIA 1E18A 4QXAA 1C14A 1KF0A 1YS1X 4QBTA 4EP1A 1I7DA 2PLRA 4GOMD 3GZTB 4PQFA 4CDMA 4LE1A 1W76A 4CGZA 1FUYB 3FRJA 3NDRA 1E61A 2GO1A 2A1UB 3FTFA 2HO5A 4DV0B 1NP7A 4QFDA 3EZNA 4BJ6A 2Q1TA 2B9EA 3C3AA 3DDSA 3LT5A 3TECE 3L8FA 1DQYA 1X1DA 1J0EA 4JZYA 4RPIA 1IBKB 2IIVA 1V3TA 4PZEA 1DKNA 4WE3A 4RKYA 2FG5A 2B2NA 3FSJX 1H4QA 2YJ4A 2Q3CA 3HE3A 4ZOBA 3HBAA 4FKMA 5COBA 2RI0A 2O5CA 3UAOA 2HF9A 2FR8A 3DCJA 4QECA 4DCJA 1EFPA 5EPOA 3MJRA 1JQLB 5LZ4A 2P2SA 2R1ZA 3ZW8A 1XEFA 1UBNA 3KEGA 3MM4A 1YK0A 2J07A 4LMPA 1B2LA 1LBTA 4HADA 3R7LA 3N2GB 4ZEWA 4BFSA 3ZWPA 2NYVA 1T6ZA 3ANSA 2JI9A 4HWSA 4D9NA 1F9AA 3Q7TA 3EIEA 2QENA 1ZVKA 3UAWA 1H22A 2VDPB 4P98A 1WBDA 4Z99A 2PH7A 1U0RA 1HYBA 1BE0A 2P6NA 5EESA 5F78A 4HB3A 4BNUA 1FFHA 3KS9A 3V8BA 4NU0A 5A62A 4HCJA 1PWHA 3ZKAA 4JGGA 1BHQ1 3DT9A 4GR5A 1OX5A 8MHTA 4F71A 2BGMA 4H7PA 3DE3X 2IODA 5TEVA 1DJQA 3U2QA 2OAP1 2JAOA 3IHTA 1VHJA 4PZCA 2OBMA 3M4XA 2G5CA 4XASA 5TMBA 1A9XA 4HGQA 1U4NA 3JVUA 2AG0A 5B2FA 3K2QA 3QY0A 2WTUA 3KETA 3RYIB 4PG7A 1I6WA 2Q28A 3R3VA 3AI2A 1CF9A 3T1HB 2I2CA 1G5RA 2C61A 1USIA 2QXTA 4PZAA 4KRYA 4AFNA 1TK3A 1Z22A 4QREA 3VNSA 4EY4A 3SBEA 1JBKA 1I2BA 1TZKA 3TTXA 5EZYB 4ZAVA 5AW7A 1P2BA 1YBFA 3AL0C 2R6AA 2CXSA 5A5FA 1J4AA 4DG5A 2JGRA 2RHWA 4I9GA 4UBIA 1ZPDA 3K8OE 2NPFA 3H2ZA 4ZQFA 3DKPA 1Z8DA 2ZYTX 2R11A 2RHJA 2D62A 5AKJA 3D6JA 1EM8A 3H86A 3K9WA 4IDPA 4MLCA 1SPXA 1QC5A 3LX8A 3MF4A 3PUVA 1JU9A 1NBIA 1Q0PA 4WLOA 2HWYA 5KYWB 4CQNA 3R5FA 4D4HA 4IJ5A 3RC2A 1K6JA 1J25A 1XCOA 1ONSA 3C3WA 1NVUQ 2ZPTX 2F9MA 2BV3A 4TLLB 1ISPA 5CVCA 3LIIA 3SCZA 2V3VA 3EUFA 1YSCA 4UBJA 4CKWA 2PUHA 2EW1A 3OF3A 3V2UA 3F5FA 3TUIC 3GEGA 1OFGA 2W11A 4LHSA 3H4TA 4Y1GA 1NT4A 1VMKA 2J4CA 3DHNA 4TN1A 1RAEA 4RHCA 4W7IA 3RIEA 1PV2A 2IPOA 1XCLA 5C32A 1B00A 2HQ1A 2WAOA 3A3YA 3EIHA 1N2HA 5U4XA 3W5IA 1N57A 3DLIA 1WDMA 3NPMA 3ZBQA 5HVNA 3K70B 1QORA 3LHSA 1C2YA 2YJNA 5E6SB 2PSSA 3BFJA 3IIEA 2RGDA 2B4QA 3ZDDA 2C97A 2B4TO 4UNNA 2BYTA 4RD6A 1T0UA 3Q11A 4DA9A 3FMFA 3MD9A 4KKXB 1Y1PA 1Z6QA 4OKSA 2B5VA 2INGX 3OC6A 1R0YA 1KEKA 2ZUWA 4E14A 3WNZA 1T1EA 1GM5A 3H2KA 3MTIA 4NY1A 3AR5A 3CRVA 3WWZA 1JFSA 3U31A 4ZT4A 3CIFA 3SJBA 3PX3A 3UY4A 3SC4A 3TBHA 4MVJE 3B3AA 1U6JA 5K0SA 2EX4A 2JARA 1GA4A 1U1CA 1F3LA 3FCOA 3PFBA 4ITUA 1HFJA 3LSTA 3M5DA 5TY0A 4ARVA 3FHJA 5BV8A 4IDDA 2EHJA 4YROA 1K2VN 4NZPA 1GRRA 1VMDA 5E8JA 5K8LA 4F06A 4DUGA 4QRDA 1U5AA 1FDWA 3TTVA 1KR2A 4L0QA 4PLYA 4W8OA 4EGCB 4QUDA 1X1EA 2C4NA 4HWPA 4GZMA 1T9DA 4MUJA 4R9NA 3C3CA 3RDPA 1XN4A 1PSWA 3DAFA 1P4AA 2HF2A 1ZL0A 2YH2A 5FOTA 2JANA 2YMMA 3CCFA 3C6KA 4RMHA 4J94A 1IQ0A 4QQKA 9MHTA 1VE5A 3OKPA 1KPHA 5JRJA 1NE2A 4BMNA 3L40A 4NYMQ 4ZVOA 5JPIA 2EL9A 4FFBB 4CMIA 3LVFO 5GTDA 1MXFA 3FOWA 4LY9A 5FFFA 4L27A 1ZRHA 4G0NA 3KKKA 4OREX 1PJLA 2QLJA 2XVZA 2G9NA 1XRSB 3DG9A 1PR6A 4QELA 1SURA 2R00A 3LS2A 4URUR 1LBHA 1MA0A 3AXTA 2H2GA 5E38A 2C4UA 3K09C 3PFGA 3VH1A 1T1JA 1E32A 1NWHA 1Q7RA 3HA7A 1LLUA 1F7VA 2AUTA 2JZNA 4Q47A 3KJGA 4KQJA 2OFXA 1U2PA 2VS1A 4ND8A 5L6MB 1USKA 2JCSA 3CA8A 3H3JA 4BBZA 3LQ1A 1DBQA 1FL9A 1BIFA 3DE4X 4P4GA 3U4GA 4CM4A 2X4IA 5FAXA 1PU2A 2A5JA 2VQ3A 2ZYVX 3IQZA 1JKJB 2PMBA 1CKEA 1L7NA 1OASA 2Q29A 3E5MA 3GCXA 1LB1B 4R2WA 1I0ZA 2AGVA 2CVFA 3OZSA 1PQYA 1A88A 4E5VA 1IB0A 1V41E 1O94A 1ULUA 4M9SA 1BCSA 1MOSA 1NW6A 1PG2A 1QV7A 1E5VA 1WY7A 2ARKA 2GN9A 4HNRA 3VYVA 1N75A 1YQWA 4LW8A 1AQYA 4EY3A 2YW2A 4BMYA 1ML3A 1E0DA 1JHXA 2K7ZA 2X8JB 2QRNA 4BNNA 5C81A 1C0EA 2YZ2A 3AESA 3JQQA 4JC5A 2V97A 3CUUA 2ASVA 3MIZA 4O4HF 2HQSA 5ENVA 1YA8A 3N8IA 3SBXA 2AD5A 3AY7A 4RYLA 1PS9A 2B7BA 2BVNA 2D4HA 3ESZA 3GLHA 2YBEA 1UAAA 3Q1LA 4IHKA 4BLUA 2OENG 3HJAA 2O8VA 3QF4B 4I6JA 3DFZA 3E9EA 4CEHA 3QPBA 2BI7A 3UMSA 4Q1VA 1YZLA 1NP3A 3EWNA 3KZMA 4P22A 3SXPA 1GN8A 4DDUA 5KOJB 5EG5A 3QEJA 3FFBA 4P58A 2V1XA 5LZ9A 5KSOA 1SWVA 1BDBA 4INZA 3LQ2A 1BE1A 3FVTA 3M70A 3ZGYA 3ND6A 1JAXA 3ROGA 3QKSB 3U3ZA 1C1XB 3DKKA 1JZTA 2ZQZA 5AHOA 1DQZA 5AHRA 4MUKA 2D7DA 1PSDA 1F2TB 2X8LA 4Q4HB 3ZIUA 3H11A 4B8YA 4U4AA 4DPMA 3MHTA 1N5IA 2PANA 3Q3JB 1W581 1II0A 1SUIA 2FAXA 2JJ1D 3I45A 4TSFD 5KREA 3K71B 4D42A 1LI5A 1Q7CA 3K72B 3NU1A 3OOYA 4MUBA 3EVZA 4XUDA 5C8YA 2I0FA 4GRDA 1A7AA 4FDTA 2W6IA 4R1LA 3C7KA 4LJSA 5JSFA 3NBZC 5AJVB 4E15A 1K92A 1K8ZB 1XZGA 3QYFA 5CDTA 1OXBB 3RUHA 1J0AA 3IQFA 1QYWA 1T1RA 4KC0A 2I8CA 4OGWA 3AF5A 1ODKA 4R01A 4RQTA 5DLDA 4DRXA 1NDQA 2IHNA 2IY7A 4O4JF 5B1HA 3UV6A 1JQBA 1N6LA 4EUFA 3WMFA 1TTPB 1LV8A 3LWNA 2HZBA 4I9UA 4OJMX 4RFSA 1ESCA 1Y0BA 4DYDA 1QOQB 1NQOA 2PVPA 4YP5A 5F9FA 3IUEA 3WJAA 2X19A 3VDRA 4LZJA 2E4XA 4R8LA 2ZJ2A 2MMGA 1S2DA 4EW3A 3T9DA 2D5BA 3M1AA 2QQ5A 3EVGA 3LQQA 4L51A 1DHTA 2BEVB 5SICE 3RFCA 3PDJA 4OLFA 3UQYS 2C5SA 2AMFA 4RTRA 2JEYA 2ZPUA 3V4OA 2A5YB 1N36B 3VPDA 1A9YA 4OI2A 5AJXA 3RRXA 4ZFNA 4FBGA 3VSCA 2XIQA 1LSUA 4RF5A 1IXSB 1M9NA 1JEYA 1QIJA 2YJ5A 5DGIA 1PKXA 4LSZA 3WYBA 4AMVA 5HX7A 2X1HA 3IALA 4UHDA 1CYEA 4U2KA 5HIIA 1N1EA 2Q1WA 5J4LA 1A3CA 1SHUX 1A82A 4OV6B 3STUA 4N5MA 7ABPA 3FHTA 4JBWA 4OX9Y 2EFHB 5JPCA 1J24A 2AFIE 2PRKA 2QAJA 1C5KA 2G09A 2NO7A 4R71A 1G42A 2EOAA 4OA5A 2QRUA 5JHHB 3AHHA 1JSZA 2JFZA 1XRLA 2ZBQA 3L49A 4K6OA 4DBZA 1SC3A 3COJA 4WKCA 4QUEA 2XQKA 2JJMA 1Y89A 2CVPA 3A1UA 3O84A 3INYA 3R5JA 4JP1A 4NNPA 3U7EB 4YN3A 3HWX1 1V95A 5DP1A 1KI7A 2F1HA 3PCRB 3RFVA 1T5IA 1HI9A 4V1CA 2VT6A 1JDPA 2BBSA 2CBZA 4LDQA 5KHAA 5KINB 4KXXA 2MWMA 2PBZA 5ALHA 3A1FA 1Y3IA 4D4KA 2IZ7A 2WVHA 1KDPA 3T0FA 1VGQA 2ZSIA 4BTEA 5BV2P 4FMPA 2O3RA 2IU4A 2QGNA 5A7GA 2JBHA 3K9FC 3ZGXA 2A92A 3BFVA 1QCYA 1A5ZA 4JOQA 3P19A 3ZY6A 4N3NA 1U1DA 5CLIA 5M3BA 3RTGA 1PV4A 3HKEA 3LQKA 1E4EB 1VI6A 3ZHXA 4R8VA 4E32A 1DIRA 3O3OB 2VI5A 2WHXA 3SMQA 1YE5A 3RS7A 1FSZA 2X0NA 4JODA 2H2FA 4MKIA 1JKIA 1E1CB 1GP2A 4HKTA 4URFA 4FCVA 4D9HA 3W5DA 3IUYA 4FPXA 3L1HA 4NENA 4P34A 2XQVA 4QQ8A 5NULA 4ED9A 5A6VA 5IAGA 3V55A 4DV2B 4A8JC 5DYYA 4KTTE 3BVPA 1PYDA 2AHOA 1W44A 1DT5A 2CVQA 3ROPA 2P1DA 5SY6A 3A4NA 1N6KA 1TA4A 1NDHA 3DZGA 1TL7C 3CKYA 2I7CA 3FLMA 3OLXA 4KPUB 3FX2A 1N9GB 1EEXB 2CFCA 3M2TA 4PVDA 3R7SA 4XLTA 1UBKS 4I19A 1VSVA 1TK2A 2H8GA 3PWKA 3UG6A 4W5TA 1FJGB 2ZI6A 4E21A 4AK9A 2VQSA 4LBZA 3JVEA 4PR0A 3FFXA 5DYNA 4OXRA 5JDIA 1Y1KE 1PEYA 2H00A 3CNHA 3FYDA 3N74A 1LNZA 2OYSA 5G1NA 2V4MA 1KAMA 1ZN7A 5CUQA 5B37A 4L75A 1KQNA 2AF4C 1DWPA 1U2QA 2HJHA 2DGDA 3LBAA 1QE5A 1P8AA 1XKQA 1QP0A 3RUIA 4L85A 2YWEA 2OB2A 3N0XA 3VU8A 3A36A 4BMPB 4U7DA 2A1TS 1BE6A 3F3SA 3H16A 2J32A 3K1YA 4ND4A 1AGYA 1U7UA 3WL5A 2EZ9A 1N3BA 2Q7XA 3L4JA 5LYJA 3S44A 2ZYGA 2ZB2A 3EXHB 5TR9A 1SVOA 2F59A 2PUEA 3N3AC 1AKVA 4Q05A 2B83A 4AROA 1RSZA 3OX2A 5KU1A 1NZDA 5ALZA 4RK5A 3CZMA 4WADA 1D5WA 4X7BA 1M1NB 4A8HA 4R84A 3SIXA 4KIGA 3DE7X 4J3FA 3W6PA 3ZU2A 4P81A 1FYEA 3NP9A 3AOEA 1XCMA 2CVHA 2J9YB 3KOYA 4GP7A 4QAJA 4DCUA 2ZREA 4YJFA 5ECWA 4A6XA 4LF6B 3B6MA 5CDFA 3M3DA 1Z6ZA 3ULKA 4K03A 3MTAA 3FOAA 1B7GO 2P7HA 3BHMA 3N0RA 1RQ7A 2RHTA 4QDJA 1T4CA 3R6WA 4FHZA 5ERGB 3F3MA 1TECE 4KWTA 5JTUA 3C6QA 3G0DA 3ME5A 4YYZA 2OSVA 1SU7A 1U3CA 3KQLA 1SCUA 1UH5A 3IIKA 1M2OB 1B16A 2YY6A 2ZXEA 4ZODA 4RIHA 5EPUA 5HF8A 3S2UA 4JT4A 4B8ZA 5EKDA 4CMKA 3SAJA 1C4XA 4H31A 4CF6A 5A9TA 4IQGA 1U6KA 1R9MA 2J0UA 1VECA 2R1TB 2WYUA 2O5VA 3FYTA 2FEMA 3HPQA 3KFVA 2HIHA 2C5LA 2WNHA 4FCCA 4OSEA 3UHOA 3ISJA 2WI8A 3W2GA 4GDFA 2HCTA 2YV2A 13PKA 4WVLA 3G49A 1EP2B 1TQHA 4UVEA 1ZI6A 2XUKA 5G0UA 4Q4CA 4HN2A 1GGFA 1HLDA 3CEMA 3DAOA 1WCYA 3FROA 4RGBA 3VU1A 3GJXC 1DAOA 3AKZA 4BQPA 3R40A 5F5XA 1T3SA 3S2YA 3GVPA 3FI0A 3DZ8A 3W5VA 1YL7A 3KZVA 4HD8A 4WASA 1Y7HA 3TW8B 1V4BA 2PUJA 3DVAB 3J7TA 3R20A 3S55A 1VPEA 4Z3KA 3C3JA 5K2OA 3CSDA 3P0IA 3WWYA 2OCAA 2AJTA 1L5QA 1T24A 4X6YA 1U3UA 3GFFA 5AXDA 3MJSA 2IS4A 3GFPA 3E48A 3JRWA 1ZONA 5KSZA 2D2EA 5FWDA 4A2WA 2QJWA 3JATA 2OO5A 3E1KA 5CPFA 1NUQA 4I46A 4TROA 5ILQA 5IWAB 2XHEA 3T1NA 1GUYA 1QV6A 1KDTA 3QA3E 1VQ1A 3OF5A 3WIEA 1CUUA 2P2CA 4KLZA 4HWKA 3SQOA 1XWFA 3IAUA 2QMUA 3GA5A 3S7ZA 1TKBA 1ECCA 1UJ4A