1Z36A

Crystal structure of trichomonas vaginalis purine nucleoside phosphorylase complexed with formycin a
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
235
structure length
230
Chain Sequence
ATPHNSAQVGDFAETVLMCGDPLRAKLIAETYLENPKLVNNVRGIQGYTGTYKGKPISVMGHGMGLPSICIYAEELYSTYKVKTIIRVGTCGAIDMDIHTRDIVIFTSAGTNSKINRIRFMDHDYPATASFDVVCALVDAAKELNIPAKVGKGFSTDLFYNPQTELAQLMNKFHFLAVEMESAGLFPIADLYGARAGCICTVSDHILHHEERQNSFQNMMKIALEAAIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords purine nucleoside phosphorylase
publication title Identification of a subversive substrate of Trichomonas vaginalis purine nucleoside phosphorylase and the crystal structure of the enzyme-substrate complex.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transferase
total genus 81
structure length 230
sequence length 235
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z36A00
4IP0A 1Y1QA 4D9HA 3P0EA 4DARA 4NS1A 1OUMA 1RXSA 1V45E 1RYZA 1Y1TA 1YQQA 2HWUA 3ODGA 4TXHA 5ETJA 1T8WA 1V3QE 3ONVA 1RFGE 2RJ3A 4DAEA 4L6IA 3KVVA 1QE5A 4QASA 1ECPA 4GLJA 4QARA 1C3XA 2AI2A 5EPUA 3KHSA 2OECA 1Z36A 4FFSA 3NBQA 3FUCA 1U1EA 1ODLA 4G89A 5F7JA 3EEIA 2OC9A 3INYA 5CXSA 1TGVA 4D8XA 1Z35A 1Z39A 1A69A 1RT9A 4M7WA 1VMKA 4JWTA 1I80A 3FOWA 4MARA 5B7QA 1CB0A 3GB9A 1SQ6A 5IU6A 1PR4A 1LVUA 3NM4A 3NM6B 3IOMA 1SD1A 1PR2A 4ECEA 3BSFA 3LBAA 4D8YA 1V2HE 3SCZA 1JDVA 1B8OA 4OJTA 1LX7A 5B7PA 4DA7A 1OU4A 1V41E 2ISCA 1NW4A 3ENZA 2AC7A 1T8SA 1A9PA 4MCIA 5IFKA 5F76A 3P0FA 3F8WA 4QEZA 5F7OA 1T8YA 1SD2A 1M73E 4EB8A 1RCTE 3EUFA 1TD1A 3LGSA 3FWPA 3DDOA 5EUBA 1Z38A 1U1CA 3PHBE 4DABA 2HSWA 4TTJA 4OGLA 4JP5A 3NM5A 2OXFA 1OV6A 3TL6A 3QPBA 1TCUA 3E0QA 1VFNA 3KVRA 1N3IA 5CXQA 1PWYE 4L0MA 1CG6A 1Y6QA 3D1VA 4BN0A 1JP7A 2H8GA 4PNPA 5KB3A 4YJKA 3KU4A 1ODJA 4YMLA 1PK9A 4MCHA 5F77A 3DPSA 1PK7A 2QTGA 4UC0A 3PNSA 3EMVA 2PGAA 1OTYA 4L5CA 4QAQA 1RSZA 2QPLA 1PR1A 4WKOA 5CCEA 4BMXA 1PR6A 1B8NA 4I2VA 1U1DA 2AI3A 4DA8A 3OZCA 5FAKA 1PF7E 4G41A 1K9SA 3OF3A 4OEHA 4R31A 1TCVA 4RJ2A 4TTAA 1RXCA 4DA0A 1NC1A 1ULAA 5B7GA 1Z33A 4R2WA 3BL6A 5F7XA 4DA6A 3E9ZA 5K1ZA 4GKAA 4X24A 1YBFA 2XRFA 1Q1GA 3PNPA 3FAZA 3UAXA 4YO8A 1PW7A 1K27A 1JYSA 3UAVA 2A8YA 4H1TA 1FXUA 1Y1RA 1SJ9A 1Z34A 4QATA 4TTIA 1TGYA 4GMHA 1JE0A 3OZDA 4R2XA 1Z5OA 1Z5NA 4TS9A 1G2OA 1ULBA 1JPVA 1V48A 1Z5PA 4OGKA 4NY1A 1ZOSA 2I8AA 3FB1A 1PKEA 3DF9A 1JDSA 1VHWA 3GGSA 2B94A 3OPVA 4WKCA 4D98A 5C80A 1YR3A 1OVGA 4LZWA 3OCCA 3U40A 5F7ZA 4EARA 1RR6A 2Q7OE 3O6VA 4LDNA 4F1WA 4NSNA 4F3KA 3UAYA 2A0YA 1Y1SA 1JE1A 4LKRA 1YRYE 3FNQA 4OF4A 2ON6A 1U1FA 3O4VA 1JDUA 4K6OA 4KN5A 3UAWA 3MB8A 3OZBA 4L5YA 2BSXA 3T94A 1U1GA 4LNAA 2HN9A 5CYFA 3C74A 4WKPA 1RXUA 3DJFA 4TYMA 5F78A 3MMSA 2GUWA 1A9QA 4D8VA 4WKBA 1ZL2A 3UAZA 4WKNA 4JOSA 1VHJA 1JDZA 4F2WA 1YQUA 5CYGA 4DANA 5CCDA 1PBNA 3OOEA 5JPCA 3LA8A 4TXNA 1JDTA 4F2PA 4LNHA 2QDKA 4BMYA 1V4NA 1PR5A 4GLFA 2QTTA 3IEXA 4M1EA 1XE3A 4YNBA 1A9TA 1Z37A 1T0UA 2AI1A 2IQ5A 5EFOA 1OTXA 3E9RA 3OOHA 3KVYA 4E1VA 1A9RA 3PHCA 4F3CA 1ODKA 1A9SA 4DAOA 5B7NA 3KUKA 4PR3A 3BJEA 1NC3A 5F73A 1T8RA 4TXJA 5DK6A 3UT6A 2A0XA 1Y6RA 3K8QA 3OZEA 3DP9A 1WTAA 3K8OE 2A0WA 5I3CA 2OC4A 4BMZA 1RXYA 4P54A 1A9OA 4M3NA 1LV8A 3BGSA 4L5AA 2QSUA 4QFBA 4U2KA 2HRDA 4TXLA 4TS3A 2I4TA 2P4SA 4G8JA 4OY3A 4TXMA 1PR0A 1K3FA 1ODIA 3EUEA
chains in the Genus database with same CATH superfamily
3TCKA 4UD6A 4AWXA 4J1SA 4O02B 4QLBA 1YRHA 2ZS9A 5EJ9A 3AVVA 2Q5FA 1TC2A 3P0EA 1WHTA 4KWHA 2JI9A 1DHTA 2QRKA 3R23A 2CDCA 2GASA 1UOEA 4LRSB 4OCZA 4WLFA 3VC3A 1OXKB 5BP7A 1BXRA 1G21A 3SJAA 1MQ8B 3ZE2B 4ZCIA 1QK5A 3R3SA 5BV8A 3PS9A 2MJLA 1W94A 1SXJA 1XAIA 1AHPA 4QM6A 2G72A 1Z74A 3PDHA 3PPWA 2L19A 1N2CA 1C8BA 1NBME 2C88A 3I73A 5THXA 3TSZA 3W6OA 3MYRA 5AHWA 3ZYZA 1V3QE 3NLLA 1U4SA 2FSUA 3B60A 4I9UA 1WY7A 3AG5A 4UOZA 3LP5A 5CAEA 2X2PA 5CCBA 3MXOA 2G71A 2X9NA 5EMJA 4ES6A 2QJOA 1I5EA 1WDMA 3GFTA 1XVTA 3KVVA 1LK0A 4BFVA 1LLQA 3BMCB 3LCRA 4BNDA 2FZGA 4ZGWA 1K9VF 3MUNA 3UJNA 3CS3A 4AMUA 3E3LA 5I51A 4QARA 3JW8A 1YHZA 3UJ3X 2P6PA 3N0XA 5JRZA 2NO6A 4Q1AA 2FW8A 4QYSA 1QRRA 2OVBA 3AU9A 4M6WA 4PG4A 4DYDA 3B2QA 3O8BA 4FFNA 4YRPA 4AICA 4NBKA 1JU9A 3U37A 2JLXA 3FUCA 4ZHSA 1U1EA 1YB1A 1ODLA 4Z9YA 4JLAA 3LKVA 1QTNA 5JXJA 5C46F 4RV9A 4ZVKA 3W79A 4TSKA 1XJQA 5A03A 2CV0A 3DDHA 3JD2A 4KU4A 1CFJA 1XTJA 4XPIA 2YWXA 3K9HA 2UZ0A 2REOA 4X7RA 3W3AD 5K3AA 3LE8A 4N7RA 3UATA 2ZR8A 4Z6KA 1KQPA 1NPDA 1OI7A 1QS0A 1V7PC 2J4FA 3JARB 4NK4A 2ZUCA 1TF2A 1JT2A 9MHTA 2QTAA 1KNQA 1X9IA 1DCMA 1I80A 2GCIA 2AG0A 1FP7A 3DZIA 5EJFA 4OHCA 2VTBB 3HY6A 2C1ZA 2FW6A 2PGOA 1RW4A 4RGQA 1XEWY 4JV5B 5IEJA 1CB0A 3DFMA 3PQ5A 4ZVUA 2H31A 1E1QA 3M6UA 4KXNA 4US2R 4CIYA 1FFAA 1XCPA 4HB0A 2YY7A 1R6AA 1ESNA 2XBMA 4X97A 3GUVA 3HJTA 4NBTA 1IB6A 1DDGA 1ZR2A 2BD0A 4XX0B 4DFDA 4DLVA 4R7ZA 3LG2A 5L3SB 1GGJA 2Q5JA 3H4MA 5LYYA 1P45A 4PPQA 3KS9A 1V9LA 1DFIA 5HWSA 2XE4A 1SVUA 3DVQX 3FRHA 2G04A 4ECAA 1A77A 1IBLB 1Q3KA 2WWHA 4IKPA 2UYHA 1PR2A 3V1KA 5ADUS 5KKNB 2G25A 2P5SA 3ISVA 3DCJA 4FDTA 5F9FA 3QVMA 4JIGA 1TU3A 3UGQA 1SHTX 3F78A 3ZNPA 1R66A 1EEHA 4G0PA 1WCV1 4MO2A 2Q3DA 4MAAA 5DHRA 2WKQA 3U17A 3ZCVA 4Q6BA 1JXMA 1TTPB 3OMLA 4OB8A 2FW9A 1OFUA 1OU4A 5H4GA 5PGMA 2PMCA 2PU5A 5ELXA 1LLDA 1Q19A 2FLKA 3T41A 4G0UA 2PD6A 1OA1A 3WZLA 4DC0A 2NOAA 1SUBA 2Z09A 4ER6A 4O4IF 3JQAB 3S5UA 2NZWA 3P0IA 4NZ9A 5GM2A 3WK6A 3ZHUA 5CLJA 3V7YA 1QBGA 4AJ1A 5H81A 3FGOA 2LIVA 1OGIA 1VMIA 2O57A 4LFBB 1YFKA 1XCOA 2WUFA 4CFZA 9ATCA 4EB8A 3B36A 5BWBA 2WSMA 2GLXA 4OHRA 3PFWO 1LLFA 4KLZA 2OBBA 1H65A 1SBQA 2DBYA 2PAAA 5AW8A 1I4TD 2G9UA 3L7JA 4N3NA 1IPHA 3UK1A 3F47A 3FPCA 1JDBB 2GEDA 5AWFC 3VU3A 5KJ1A 4B9EA 2I67A 1B93A 2AZTA 2Y9PB 2IY7A 4Y1EA 5K4GA 3IXMA 4URWR 5C5CA 4DR5B 1Y5MA 1U9CA 3L8HA 4FYXA 2ZJAA 3EOZA 2JI6A 4R3WA 5DI3A 3UQYS 4F85A 3AR3A 4KACA 1GUZA 2FPRA 2B1RA 4G81A 5JO0A 2BZ0A 3CTPA 1AXRA 2I6UA 4FYIA 1GSHA 2W6ID 3H84A 3DHEA 3MJCA 1Q7GA 2CLCX 4IH4A 1EB8A 2AFVA 2VOEA 5FJJA 3QUQA 3F73A 2H3EA 3H0EA 1DG9A 4D92A 2C2GA 1ACJA 4MWGA 4INJA 4G0NA 3GLHA 1XZCA 1M34A 5KB3A 3SMVA 1PQ4A 4BUZA 1VZ2A 4PWYA 4MR8B 4R9UC 3NAQA 4ZEWA 5DYNA 2JIQA 4WOPA 3FNRA 3DVRX 3IKVA 4AZ3A 3TVYA 1C8VB 1JR2A 3FX2A 1OWPA 3WDKA 2YOHA 2SBTA 3IDQA 3RABA 4DRXB 1NWHA 4JFRA 1QE3A 2HCRA 3PNSA 3RUFA 3KIPA 4BZQA 2NTJA 2NU6B 2J6CA 4FNMA 4MV7A 4K6CA 4G0QA 1LZLA 5T6BA 3DGEC 3PC6A 1ZDMA 5IX8A 1KJWA 1QH0A 2X1MA 2A67A 4KFSA 4QAQA 4O1MA 2NU9A 4L85A 2CWDA 1Y1LA 1DG1G 2MSDB 4HAYA 5ERYA 1R10A 1PR6A 1TLLA 4EATA 1WBDA 5CEJA 1P4AA 1I3CA 5CVUA 4LJYA 1QV7A 5LZ4A 1XRMA 5DN9A 1RPNA 4U0KA 5FAKA 4NU6A 4OFXA 4J1TC 1SVMA 4UREA 4CE6A 2F4VB 2NU8A 4JEIA 1E2NA 2P9GA 1I8TA 1YBVA 4HUTA 3ZQ6A 1FLVA 3RKUA 4X8OA 1KZYC 2FFRA 1Z7BA 4UBIA 3C6ZA 1Q95A 4AS3A 7MHTA 1EGVB 4KNYA 2N9UA 3ILVA 1U1IA 4OOEA 5EKTA 2OA0A 4KO1S 4REMA 2FQXA 1IZ7A 3WBKA 3D3NA 2OP0A 3JX9A 5ARCA 1VG8A 2HT6A 4G4JA 1CQJA 1YASA 3CRVA 4UE6A 1B3BA 1TO6A 3AB7A 1UPTA 2G08A 3MJVA 1IBMB 4TKUB 1T1SA 1X1SA 3WA6A 4AX4A 1WCYA 5HS4A 1RZVA 1ULAA 3UJDA 1AK1A 3ETDA 4N4AA 1OIVA 1XFAA 1Z33A 2D8MA 1CUYA 3PUHA 3I9JA 1G1AA 3D2LA 3VKGA 3D4IA 1KOFA 1LSOA 3ANNA 1OMOA 4NATA 3ZDRA 1R0CA 4GMFA 4NCBA 3H9JA 1ZW6A 3HKEA 1NY6A 4BE4A 1WCIA 2J0EA 2JLBA 3D6HA 1JDNA 3FTPA 4FDMA 4L2IA 3VXKA 2V45A 4XPZA 1B2RA 1ECBA 2ZTLA 3N2YA 4IIVA 3V4RA 3UAXA 2P2CA 4IDOA 4EY7A 3EOAI 2YV1A 1Z8NA 4CLOA 4HQLA 3TIVA 1H3EA 4LQDA 3QF4A 3ZE7A 4F92B 4EHDA 5DOVA 2A8YA 2WWGA 3MWJA 1L4GA 2VNJA 1WV1A 4H1TA 3TKAA 4EMSA 3CRNA 3IA2A 5J4LA 1MIOA 5A4KA 1F20A 3QVUA 4CT5A 1NKVA 3ZVRA 4CLXA 2XUIA 4XAQA 5BMVF 2NUAB 1DAKA 3BBPA 4ZI5A 4DV3B 4UZSA 2ZB2A 1HE2A 1GUDA 1J33A 4RACA 2XVMA 2GF0A 3MWEA 3ESYA 3HFJA 4IDAA 1SCUA 4EX7A 2GRUA 3P9ZA 1KY2A 3HA2A 4R05A 2B30A 3IILA 1KDPA 4JLBA 1GZ3A 4TS9A 1ONOA 2AS0A 5KJEA 3AI7A 1F38A 2V7GA 3AR6A 1UC5B 4W8HA 3M3DA 5DXFA 5B12A 1QTQA 3H4TA 4R8RA 4W6QA 3TGWA 4HUJA 4KZPA 5JDIA 4BRUA 2ZJFA 2R5WA 3X1JA 4FR0A 1F0PA 5JY1A 4OKNA 3ED1A 3ELYA 5CNIA 3FLBA 1ATIA 5JCPA 1THGA 1RXIA 4AMBA 3U3KA 2VPYA 4FKMA 1EVEA 4J90A 4WT7A 1XVIA 4ZU6X 5SY9A 4YRBA 3CEMA 4CCYB 2QKYA 3PJGA 5FUMA 1E9RA 1F3LA 1QWOA 1O5IA 2Q6TA 3HO6A 2IY9A 2Y76A 5FRDA 3ZZ0A 4INPA 1ZMRA 3ZNNA 5CM9C 1RJEA 3CUUA 4LBZA 3LUCA 4KFUA 1CDZA 4JGIA 4R83A 4MP8A 3LVFO 1WUJS 4U7HA 1QFJA 2Y0BA 1ZVMA 2ZKIA 2WT8A 3IO3A 4CXMA 2G4CA 3H3XA 4FD3A 3VDXA 4AP5A 1PJZA 4MVJG 1SEPA 3DL4A 3QKTA 3O1HB 4FYKA 2EAUA 2ATXA 1GPLA 3IR5A 2V9CA 3O5AA 2WINI 2Z8ZA 4JN6B 2OV1A 4FZRA 3DMYA 2RGWA 4Z9FA 4M83A 2Q7OE 3K0BA 3F7MA 4DUPA 3TQIA 3JASB 5EGSA 3O8LA 5IBPA 1KO4A 3QMWA 3U31A 4LNUA 1E7RA 1N5IA 1KYXA 3WADA 1YR6A 3VV2A 5DHTA 4HNAB 5GY7A 2IVZA 5KYUB 5LIRA 2H1VA 4B73A 3N2KB 1Y8QB 4LKRA 4OXQA 3W0LB 1D2CA 2JGFA 5DBHX 3WRXC 5THQA 2FSHA 4DUZB 2Z98A 2G5GX 4UD2A 2OVFA 2C00A 3JYNA 5EGNA 1OPXA 3E15A 3FPGA 4I5IA 4XYBA 2CLFB 4OB7A 1XZBA 3N59A 2FSIA 4J29A 4KQIA 4LXXA 3UAWA 2HV9A 4KSCA 3HB9A 1JVBA 4UASA 6CHYA 2V0NA 1GQOA 1FU8A 3ABSB 3N0TA 3QM1A 4LYAA 1TQ6A 2CE2X 3BULA 1OIXA 1RXEA 1Y6ZA 2Z4SA 3QQ5A 3NDRA 1N2IA 4OSOA 1Y1PA 3CY6A 4A27A 4MWDA 1JG2A 3FGZA 3EFHA 3G0OA 1H6DA 1VSBA 1X39A 4LJ4A 1Z5VA 3TLGA 4BYMA 1AV6A 2ZQZA 4KSBA 4D4HA 5F1OA 1PUXA 4AKIA 1YJAA 4YUAA 3AHCA 1ODFA 4KXFB 1FP4A 4M98A 2AOTA 3P20A 5HM8A 3CLUD 2WWWA 4KQ2A 4Y2RA 5F78A 3ZHZA 4EQ6A 5JC8A 1TTHA 1I10A 1N7JA 3IAFA 1A9QA 2WUDA 4QGGA 1H0HA 1ZNQO 5BN4B 4D3YA 4DSNA 3GLRA 5I7FA 3Q8MA 3JWPA 1E20A 1QHHA 1PT8A 4AYWA 5J2UF 2Z2YA 5CK5A 5C7OO 3EXHB 4DA9A 1V16A 3NOVA 4J7XA 4UDOA 4UQPA 3RU9A 3ZTYA 2R6R1 4MIEA 1OI4A 2YKGA 2QS9A 4OMUA 1PCXA 2ZJ8A 3KLNA 3CZQA 5C0OE 3QX3A 1NZDA 2VO1A 2NN3C 4J3FA 3BWDD 3DLAA 3MWDA 4AT1A 2HXYA 1D2MA 1GDHA 1OJLA 2DQSA 5DHFA 2DJIA 1MABA 4RKRA 3Q2KA 1U8XX 3H04A 5ALRA 2OV4A 4QWMA 5IDWA 3H1AA 3KSBC 1W1IA 1A7UA 2CF6A 3KB1A 3KKZA 5DBFA 4CM5A 4RL4A 5JPCA 4AKTA 3HDYA 2O2JA 2V5VA 1W29A 3SHVA 1XAHA 2GTPA 4KQFA 2IUSA 3RIXA 3S7ZA 1BGVA 3RFCA 2UVPB 1N5MA 4TUYF 2IOFK 4BECA 1WPXA 3QV2A 4FHCA 4H9GA 2V4UA 3TTWA 3CINA 1CVLA 1WJGA 2RONA 4Y0AA 5I8WA 2AYZA 3EY4A 2VAWA 3HKBB 3RIEA 1ISPA 1YQGA 1ZIXA 1SA0B 1PD0A 2FR0A 3E9RA 4HXGA 1VCIA 2IYTA 2RGEA 1SUIA 4RTSA 2P9HA 2VJAA 1CY0A 1YDFA 1Z6GA 4J0CA 2W00A 4EYEA 2O0LA 5G0UA 1PD1A 3X43A 2H4YA 4ZCQA 4C3UA 2GNAA 1USWA 5AKIA 3AETB 1OA0A 2HAEA 2OORA 2VHEA 4HDKA 4HWGA 2D6FA 1U3GA 2VHUA 5JNSA 1FNDA 5D51S 2QG4A 4KV9A 5KYKA 2VJMB 3CR3C 3SBXA 3V48A 3AUKA 1Z0FA 2FSSA 2XZTA 1XRNA 3JPWA 4ZOQI 3FHJA 1PJBA 4HMQA 2QWXA 1KO8A 4LE2A 4Z1OA 5BSGA 5L95A 2EGUA 1F2TB 1KSJA 3Q5DA 1US8A 3NXSA 5LUAA 3LSTA 1P9OA 3QE0A 2RHLA 5K3DA 3D0RA 4BNHA 5BPHA 2PV0A 3G59A 2E21A 3COVA 2QQEA 4I1VA 4OYHA 1KSHA 1XELA 1V5WA 3EVAA 2ECQA 4M21A 4N82A 2V9PA 2HT1A 2O3JA 1N7IA 4YACA 3ONDA 2A1IA 2XDYA 2NYUA 3K0CC 3PR3A 1FNSA 3AVUA 3SHQA 1Y34E 1WSAA 1ZMBA 1G9SA 1VP9A 2H54A 1Q0HA 4RH3A 2OFFA 3L04A 3ZDAA 3BGSA 3IV7A 3L6RA 2IYEA 3CIFA 4H7JA 1RM5A 2QYTA 2Y1GA 4D8TA 4RS3A 4HVLA 3NHFA 2W8ZA 4Q02A 5G4KB 1XPRA 2WU4A 4OHXA 3ZKWA 4UUBA 1UPAA 1AC5A 2DCMA 1NUQA 1OLUA 4Y6GB 3WNQA 4AC9A 4BWGA 3FGPA 1A5ZA 1ZL0A 1QGZA 3QELB 5EXDA 2D62A 3NHYA 4CG3A 4AY3A 1P72A 2F8TA 4JYCA 3UGJA 2Q1TA 2IXAA 2E4UA 3Q3EA 1G3QA 5CJJA 5DTEA 3EUEA 4MEJA 5E9WA 2LD4A 2AMLA 4QM7A 2IDKA 1ADFA 5JDCA 1V11A 3ETCA 2H65A 3DBLA 5EA2A 1YV9A 5EIWA 3WGIA 3RJZA 1R8XA 2OP1A 2I66A 2ORYA 1MVOA 1L7VC 1P62B 4HGNA 4A3SA 4CCAA 4BLQA 5SYAA 2VQFB 2ZJYA 3G2MA 3A9WA 5KTNA 3MTQA 4DJ5X 3TLXA 3GH1A 3EGXB 1RYZA 5TF0A 2XJ4A 2R65A 4FSXA 5BOVA 1CY4A 2JCVA 4ARZB 5B6JA 1FA9A 4NXNB 4MV1A 3ABRB 2QDXA 5JCJA 3OZVA 5ETJA 2HZ7A 5KNDD 1AGPA 2H0RA 2XUHA 4YYEA 1MU0A 2H7YA 1G3UA 3BMNB 3BHIA 3H2SA 3KPYA 4R9SA 4X1YB 1ESZA 1F0NA 5DF1A 2ZIXB 3HB1A 5TIIA 2OEPA 2N3ZA 4L6IA 3BMOA 2FPXA 2PTGA 2V6GA 1QIEA 4JVLA 1ZNXA 4M53A 1J20A 4N5MA 4X92A 4ZOAA 3SIWA 4M0EA 1YI1A 3IOYA 3RIYA 3COYA 3GFPA 2OCPA 4WSOA 4Q1DA 5BV7A 1I3OA 4CLDA 1F6BA 1IJKA 1JHXA 1YZKA 4XCVA 1X0VA 1DEOA 4DV1B 2WZQA 4W6ZA 4YALA 2PWPA 4RTPA 2ONZA 1NI4A 1XD2A 4P4SA 1NJFA 1HFEL 2H08A 3A7EA 4QYWA 5LMUB 4HUQA 1HTTA 3RAPR 4AJ4A 2P75A 2C59A 2A5JA 3MELA 4CKCB 2QRZA 4YRGA 3GEBA 1KARA 3INYA 4YLGA 3MOIA 3E3NA 3JTEA 4F93B 4U3JA 1IFXA 3UJ7A 4ZDWA 2EJTA 2LIPA 2PR2A 1DWQA 5JS2A 5IBCA 2VR1A 5P8WA 2IC5A 1R0LA 1P2BA 2BF7A 2P27A 1RT9A 5KNBH 4Q3OA 1YACA 3FLMA 1WEKA 3KSMA 4NHEA 5K3CA 5LOVA 4RESA 1OKKD 3QBJA 3R9IA 3TD9A 4C88A 1OTHA 1PSZA 4F4DA 1F9AA 1T6NA 5JAQA 2H4JA 4W4TA 2G9VA 4BFCA 4EFDA 1GILA 2JAXA 5GP1A 5MN6A 5DRTA 4XOIA 5LQNA 4HC4A 2G40A 1HLPA 3E3AA 3K92A 4FK8A 4R1NA 4LHSA 3Q3VA 3UXMA 5HZGA 4OFZA 4RZUA 4ZCMA 5LBIA 3AUAA 5CT5A 1D8AA 4PAOA 2DUUA 3ID6C 1ELOA 1WMBA 1VLMA 4O4LA 5BORA 3QX8A 3RVNA 5IJWA 3VX3A 2II6A 3NX4A 4BEWA 1JQ3A 2X4IA 2D5AA 2JLQA 1JR6A 4PAWA 4HDRA 2C84A 4G5SA 4AJNA 5A3JA 4G5GA 2AN4A 4D9FA 2WJGA 3U16A 3RU3A 1XMQB 4RA6A 5CT6A 2JZCA 3LBAA 3P9NA 3VAZA 2RG1A 2JCXA 2VTVA 3F3KA 4HZIA 4N65A 1Y89A 4DBZA 3BHNA 1MFPA 2BEWB 3L4EA 4KMSA 4NX2A 1A72A 2OXRA 2UVDA 2AYXA 5JH7F 3NFRA 3I9V1 3G89A 4Q9DA 2FRVA 2ASEA 1QFYA 1V41E 5FNZA 1B7GO 5A2QA 3U62A 3BYZA 3JVUA 3KEGA 1HDOA 4RO0A 1J00A 1ZH0A 3QEAZ 4Q7MB 1ZCFA 2ZRIA 3J7TA 5F12A 3T4UA 4F4IA 3EC1A 1DJNA 2WT4A 3HCCA 2WLSA 3HA3A 3FMFA 1A9PA 3HJBA 1UQRA 1L9XA 3GJ8A 4OH7A 3UTCA 2IS4A 1N92A 2C4TA 5F7OA 4IUDS 2VK8A 3M89A 2RI0A 1JHVA 2Q4DA 5HMMA 3TTYA 3L8EA 4EHFA 1GNRA 1JT9A 4RADA 1KVQA 3CVVA 1B14A 1BE6A 1FSFA 2QUAA 5IVKA 3AKEA 1YVRA 2CLLB 1U5BB 1DX4A 2CLDX 2XR1A 3C7KA 3U3DA 3CFYA 3GGPA 2Z57A 2J5QA 5EESA 2FFQA 2FWNA 4UPDA 4RDHA 2W2KA 5K6AC 2ZBVA 2ZSDA 4KX5A 1UEXC 4CNQA 4XDZA 1BE0A 2P5TB 1N1EA 2X0RA 4TQ9A 5KSPA 3UNXA 4ZMBA 2JEZA 2PEZA 3M83A 4W9MC 4WJKB 1ISJA 1HYEA 1OV6A 1UQUA 3BWMA 1SCKA 1XMPA 3FSRA 3PG5A 1C8KA 3OT1B 1L1RA 3HEBA 4IZHA 1UMBB 5LUBA 3W6UA 1JI0A 1DQSA 4RK5A 4V0RA 3T5DA 1GG2A 2FG7C 2O8BB 4YIKA 5LQUA 1N3YA 1KU0A 1OAOA 2HIGA 1ISRA 1TT7A 1UK6A 5CXQA 4O8CA 1SG9A 2GCPA 2W6PA 4J1NA 4KGZA 2P4UA 2OCBA 3I2YX 2O7QA 1XQ1A 5FBKA 8GPBA 4P36A 1P4GA 1HYBA 2H1RA 4DR7B 5FUVA 4XGNA 1L5HA 2O1EA 3O3OB 1DQZA 5K20A 1NXXA 4YMLA 5EWLB 2QLLA 4LK3A 3B1ZA 1E3WB 4MQUA 4G0XA 1Y4UA 4RY8A 5F77A 2CBGA 3DAGA 1RLMA 5AW5A 2UUBB 2BGGA 3C7DB 5FWYB 1LV7A 1NW7A 3F5SA 1SVSA 3PPVA 2CKMA 2YDYA 4NDZA 1FB5A 4HWSA 1NVXQ 2QLFA 4Y6LA 2ZITA 4TV8B 3Q4GA 1H6AA 2AXEA 2ZRQA 4ZVRA 3G8DA 4YC7A 5EYPA 4AY5A 4MXDA 5DNUA 3GMDA 4Z86A 4LDZA 3W90A 4MQFB 1RSZA 4FFMA 2QPLA 1GL3A 5KIAA 1H42A 4MYCA 1MAAA 2BEUB 2JFPA 1PW5A 1X9HA 2RFLA 2FQWA 3VZSA 3LUGA 3MBIA 1LBEA 3KEFA 3BGVA 3CT6A 2H4HA 1OAKA 4GX2A 3E9EA 1HFWA 4ZMRA 4K87A 1X7XB 5FHRA 1UXGA 2BW0A 3NBXX 5CA0F 4X62B 1OWOA 1JIQA 3BIFA 4NBLA 2EBFX 2NPIA 4HQRA 4NU5A 4QOJA 4X66B 1IAQA 2FPIB 1MDFA 2EATA 2OOSA 3GC6A 4K9RA 3SDSA 3SE7A 3HYTA 3GZNA 4Y1RB 3RTAA 1GU1A 4GXTA 5K0TA 1KEKA 3AK4A 5LZ2A 4ZALA 4DA4A 4QODA 1XZFA 4Y9SA 2QOEA 3EZGA 3L8YA 1SQSA 2Y1KA 4KODA 1SRRA 5BN5B 3VPHA 3WB9A 3A1DA 5A2GA 3T7JA 3BMXA 5F51A 4PC1A 3AGPA 3MWYW 3KPJA 5HBRA 1MC4A 4W5HA 4EF4A 2JIRA 3ELBA 3W1EA 2WFAA 2CYAA 3IJRA 4UM5A 3ZJ4A 3FOZA 1EDDA 2GPTA 4KPUA 1H85A 3BK7A 2UUPA 4D43A 3EVGA 5FYDA 4HNUA 5AW3A 1EEXB 2B3TA 4A8PA 4E5VA 2F1RA 5JAPA 4Z4FA 2A0UA 2I9PA 5EXPA 3IMGA 3BWEA 5I8ZA 2RBGA 4D8WA 3SMQA 4NFYA 3BGIA 3STWA 3QVTA 1BROA 1KFJB 1TLTA 4FHGA 4KQEA 4BDTA 3ZCUA 2YWHA 1M83A 2Z9CA 2HNAA 2UZ1A 1Y5NA 3WG9A 4WEQA 2IPOA 4IO0A 1TA4A 1WOYA 1CU1A 2FZWA 3B89A 1E60A 3TOCA 1PW7A 4CG0A 1LJ8A 3A05A 2F9FA 3KQUA 5EHQA 3A6FA 2IS1A 4JX9A 1C7FA 2NTNA 4CF7A 3S2SA 2A78A 3PC3A 5ED0A 1CY1A 4WFKA 3B6IA 3EMBA 3KV3O 3MT8A 4FI3C 4PYKA 4Y2GA 4COKA 2JLYA 1N77A 4DCCA 3CGWA 2QVLA 3RF6A 3AXTA 4JI8B 3R5SA 1SUCA 1QVWA 3OCYA 5I7AA 4UVIA 3K2BA 3PKIA 4MVJA 2ZRFA 4TMKA 3VPGA 3VV3A 2DPXA 4TTIA 4MRMB 1CVIA 2XMBA 2Q6IA 5AESA 1UEIA 3BQMB 3GA7A 3V55A 4EVQA 1IJEA 1G8JA 2BMFA 2G80A 3KRTA 4WA8A 4YS6A 2Y8EA 4P35A 5AJVB 5EKSA 1XXLA 1QONA 2CB0A 2H18A 3EWSA 4XCXA 4QJ5A 1Z0SA 2O5RA 3C5HA 5GV8A 3M8KA 1K2VN 1E89A 2QT9A 5KI6A 1WZIA 1XEXA 5DX8A 1YQXA 3FKSD 3LQ1A 1Q3TA 3CW2A 1CSEE 3ORRA 3TZCA 1ZOLA 4DQUA 3B1YA 2H9YA 4TYQA 3PGVA 4GMDA 4UHCA 1MEOA 4WPGA 2WHPB 1KAOA 2QQFA 5AH0A 1KDYA 4ZZ1A 2ARKA 4EGFA 3QLVA 2NPFA 4LJAA 3SZGA 1M8PA 4I4CA 5CIYA 4I4TA 2PK3A 3RVQA 5KZMB 2HHHB 4G4SO 2I3AA 2HRZA 1LSJA 2WD7B 3O1LA 4V03A 4WKCA 2V96A 3ZH9B 4DR2B 1H2ZA 2A14A 4US1R 4BB9A 1UL1X 2CXPA 3KUCA 4LUCA 5IT9A 1U0GA 4RK7A 3L7BA 3J7AC 5KNCD 5FFNA 3A2KA 1JHUA 1DLIA 3RYIB 4DMKA 3HDQA 4EI9A 4OYLA 4RK6A 1SHLA 3OIYA 3DMTA 4M76B 2R86A 3HG7A 1PWEA 3AFHA 3ND9A 3KVOA 4NOLA 1KI6A 3EQ6A 1CXZA 5BW6B 2BHRA 2WIGA 2QZZA 4QTZA 3C15C 3EXIA 3OQBA 5ILOA 2J3MA 2RDMA 5IVPA 1Y1SA 3Q5EA 3KLBA 5JROA 4XRGA 3CH6A 2BFAA 3ZGVA 2Q5HA 2O14A 1C1XB 4J3JA 4BP8A 3ZV5A 4R1SA 2FX2A 2RHMA 3DKRA 3SEFA 6REQA 3B6KA 2EJBA 1XDGA 4F46A 1S01A 3OIUA 1NJ5A 4GR4A 2WIAA 2REQB 4CT0A 3DB2A 4ZEOA 5IAEA 4I55A 3CKLA 1GTG1 3FTDA 2AKAB 3M1LA 5MHTA 3BK1A 2ODWA 1D1TA 1UK9A 3ZGZA 3COZA 3CLRD 4US0R 3NBAA 3FE2A 4QYTA 1JS1X 3VR5A 3AUSA 4CMEC 4G8CA 9GPBA 4KWCA 5DHUA 2ZJ3A 4ALMA 2W7TA 4X6YA 1G4UR 1GL9B 2VWQA 3E9MA 4PU0A 5JBIA 1ABBA 1IRXA 1K68A 2H9IA 5B1EA 4IF6A 3AJ8A 1KY3A 2RAVA 2QW0X 5LA6A 1G5IA 3F5FA 4ZOBA 2WJWA 3T12A 3DPUA 3ZN2A 1O08A 3QV1A 4RF5A 4P92A 1TK2A 2XLCA 5GAJA 4DDKA 4F06A 2Z2ZA 1FMTA 2WIFA 5FPHA 3RTGA 1VE7A 4CJXA 4M22A 1DDIA 1JDBC 1OBFO 1RMQA 3GROA 3W8NA 4QYMA 4CFYA 1S2GA 5JJ5A 4K2HA 1C1YA 2Q6LA 3PFGA 4JBYA 1HC7A 2YQ5A 1DZ3A 1LS1A 3ND5A 2ADMA 3PDIB 4H1HA 2WA2A 3AKYA 2AD5A 2CNBA 3LDHA 2VPXA 4KNVA 3ZEAA 1WXHA 4K6FA 3IQFA 3VSEA 3GV0A 3VPAA 2HDNB 4XLZA 5E8RA 1U65A 1S8NA 4Z1MA 5IAOA 3EPJA 1IY8A 3SF0A 1K66A 2JIDA 3ADDA 3EDCA 4GGMX 4D9GA 1EVIA 4AJKA 5GIOE 1Y3IA 2GEKA 2D0DA 2OD2A 1EZZA 4M0LA 2B99A 5GADl 1VPWA 2OCGA 4I99A 4RSHA 1X7HA 5E7IA 1X1BA 1Z4OA 2GK6A 1JDTA 1I32A 1R88A 5A06A 1MH9A 2RH4A 2PUAA 3GCGA 3ITDA 5BR7A 3O9VA 2BAGA 3IUBA 3EE6A 2NACA 3E8XA 3GLKA 1FXSA 4M0CA 3DVSX 3M9LA 5IANA 1UFVA 2BKLA 2XDAA 4Y3UA 1EKXA 4BXOA 1GUYA 1HYHA 1NURA 3AY0A 3CNBA 1ORHA 4YXFA 3GVPA 3EVFA 1A9TA 4LYDA 4ZJZA 2CNOA 3PXXA 4PTYA 5DM1A 3MC1A 3UCEA 4H4DA 1XNJA 3CZ9A 3ZU4A 2ZB7A 3G2OA 4P9NA 4DR6B 1K4YA 5H16A 2BJVA 1BW9A 3EYAA 2O20A 3LLVA 3X1MA 2G06A 1TYDE 3PP8A 4P53A 3HRIA 3KVYA 5FA8A 4BQNA 2DBQA 4RJTA 1B76A 1M0WA 1T0HB 3GPBA 1A9YA 4ID9A 5FD8A 1FX1A 1YVPA 1S6YA 3SVZA 2O0HA 4UZEA 3M5DA 1M2GA 4FCTA 1T2AA 2PUVA 2VNAA 4TROA 4WOJA 5DO9A 1C3OA 2UYCA 3CLVA 3FUUA 3K1AB 4EW3A 3UUGA 2EHDA 4CKWA 3ANYB 4UAUA 1DAGA 2HQOA 1OXUA 1VI6A 4FMBB 4PLFA 2GBIA 4ZVSA 2Q6OA 3RYHA 3TAUA 5BXYA 1N78A 2BFEB 1V1JA 4WZ6A 5E6RB 1E7MA 4RM3A 2CXTA 3H8WA 5B1SA 3LHIA 5TGTA 3WV4A 3WYDA 4CM8A 4D3XA 5IFLA 5FPSA 5DK6A 5H02A 1I7PA 3UUEA 3AZQA 3K8QA 3LXUX 2QMEA 3OZEA 1CQPA 3ZCRA 2R7AA 3B6MA 2AOUB 3D3KA 4BTVA 5JAUA 5K0JA 1SZDA 2DCUA 2F17A 4N40A 3OURA 3PFBA 4RFSA 4YFYA 5EUQB 4BMZA 4DT1A 2VSYA 4LA4A 2I8LA 4X9XA 1F4PA 1A9OA 2MSCB 3DB1A 2CL7X 2CVPA 3B82A 1B74A 4W5RA 2I22A 2M1XA 1RWQA 3EVNA 1UC8A 5K0ZA 4IIYA 2HBQA 4U5XA 1LC0A 4BEBA 4CWAA 4G1UC 4Q93A 4XYEA 4QO8A 5HIKA 1MKYA 4ZQFA 2JB9A 3UJ6A 4S1VA 5KOHA 1VPEA 4JYZA 2WUWE 1JHZA 4G26A 2FUG6 2BT4A 1E1CA 2J9YB 2EWVA 3EPPA 1O96B 1WLSA 2P9ZA 2XTZA 1J9GA 4HNHA 4Q66C 1YJ5A 2YC2C 3LCUA 5JSHA 3NTQA 2E89A 3CH4B 1V5FA 2X22A 4GP6A 2R85A 4JU9A 1G63A 2P40A 3FFTA 2C97A 4B6EA 1FJHA 2LCIA 1XZQA 4X64B 4YP9A 5ALMA 1A4XA 2P5UA 5LQSA 3LY8A 2VZ9A 1PR9A 2GAAA 1HX7A 3QXSA 4HN4B 1E5TA 4BYGA 2LXNA 5T7BA 4PM4A 1ZAKA 5GOZA 2JLZA 1CPYA 1KYTA 4XVRA 3KDAA 4Y9DA 4NYIQ 3MIZA 2J67A 1LI5A 4REQA 3OCZA 3WLEA 3LM8A 3K35A 1GRCA 3KTAA 5WRFA 3R3JA 4EWLA 1S7CA 3F1KA 4O59O 1UOPA 5E0KB 3KLOA 1XDZA 5AJYA 3IGFA 3GLQA 3LD9A 4CTOA 1XN1A 1HNWB 1C0IA 2DFKB 4Q47A 2Z4RA 2INGX 3JQ7B 3WDSA 3WSTA 5CK4A 1XMVA 1WW8A 3VPXA 1QRSA 1HL3A 2WUVA 4BC0A 3UAGA 5IT4A 4DBLC 4M9SA 1YOVB 4ZHQB 1XCMA 5DM60 2R96A 4E5NA 1MEJA 2Q9BA 5GZ1A 4RK4A 2G09A 4K9MA 4Q4DA 3VVMA 4NENB 2P41A 1Q44A 2RCYA 1XF9A 3HSYA 3LX6A 1XD9A 1R0ZA 3N7TA 3OJXA 1TL7C 1HTBA 4MW4A 3T4XA 5JCXA 4LV6A 1L4YA 1IOLA 3HCPA 3K16A 1UBJS 3PXCX 1KJYA 3TDMA 5GTDA 2XKBA 1IZYA 4QWWA 2AZDA 2ILTA 4JR0A 1MPXA 2WJPA 1OGJA 3C45A 3I23A 1M1YE 1GZ4A 4FP9A 3GT3A 4B2LA 4DYHA 2EJWA 1REQB 3PYMA 1JXQA 1ZMTA 1KJQA 2LNDA 5MFZA 2D74A 2J7KA 2P5YA 3EW9A 3PNBA 3R9WA 2JLVA 1Z39A 1IMJA 4Q4JA 3OTWA 4KQJA 4ITUA 4M8KA 3IAAA 2GLTA 2QBYA 2G9ZA 3IVAA 1EFVA 1U7WA 1T15A 3AYXB 3NGMA 1X74A 5BQ5A 4JLWA 4IYJA 4BX8A 2NUTB 2IPXA 5I7VA 3RJTA 3S40A 5HF9A 5J43A 4AVYA 2XHEA 2Y2VA 4NJEA 5JQGF 3TI9A 1Z7YA 5CEEA 5FO1A 4HNRA 4JJKA 2HA7A 2RHDA 3MD9A 1C14A 3L7DA 2JBAA 3OU6A 3PQFA 3O3MB 3RB8A 1SH7A 4AJ9A 5DI9A 2IYQA 2W71A 4B0OA 2BEVB 3HJAA 2YX1A 2ZSAA 3ZR4B 5IVDA 4AFNA 3R20A 4B3CA 6ADHA 1R15A 4FDLA 4FX5A 4QO7A 5I5GA 3UT5A 2XA9A 3HVJA 4PLWA 4MCJA 1XMOB 1SXPA 5JJIA 2EX4A 4CGYA 3JQ8B 1UJ6A 3UG6A 4Q9NA 1KYYA 4D42A 2H59A 2YXBA 4H35A 2P4QA 2Z43A 2IH5A 1AA6A 1PX0A 1H4VB 5EHGA 1U2TA 1JDVA 4HLUC 2AN5A 4IL5A 3PA6A 2DFVA 5EIOA 2H9AA 2MR6A 3ZG6A 2BBOA 3Q8KA 4TS4A 3GJ5A 2JKVA 3RBXA 4JMPA 2VUTA 1ESMA 4MHSA 1K7XB 2CVFA 4XIYA 5TE9A 3W8RA 2C2BA 5KDLA 3U26A 1YS2X 1Z47A 3D8HA 1ZXLA 1DAOA 1BD4A 1FS5A 3GBVA 1P3JA 2VP4A 4QRHA 4BFUA 1O9HA 2X7HA 3EZFA 3QU5A 1P5FA 3R5XA 4GMKA 4TMFA 4WJZA 3RIHA 1E9DA 1K75A 5F21A 1W4CA 4MRAA 4NZPA 2O8DB 4AX8A 4B9AA 4TMXA 1N6OA 3EXHC 3CW8X 4LOLA 1HE5A 1FXWF 2VP5A 3LA6A 3S4YA 3RBAA 4BFTA 3UUWA 1X14A 2VZ0A 5IN4A 1RCTE 4FHEA 1TD1A 2PXXA 3OKAA 4FOLA 1NYQA 2DPLA 2PH1A 3W77A 4P84A 1WUKS 1TJNA 5EJIA 1WMFA 5JCZA 3DDOA 1FJXA 4D26A 2D0PB 4GPD1 1QIDA 3MGAA 3ZD9A 5A0VA 4YCMA 3FNBA 1RRCA 2OGWA 1U99A 4YCSA 4KLRA 3L6OO 4NZNA 1TNDA 4KXWA 3BB4A 3LOPA 1YA6A 4BMCA 3Q9LA 3K72B 1YZVA 1HRKA 1H5NA 1GKLA 1V8PA 13PKA 4RWZA 1N2BA 3FDIA 4BVHA 4F96A 4E1AA 1U7OA 1QZUA 4KN6A 4HVCA 4K6GA 3N58A 1DC6A 1PWYE 2QSYA 3KZNA 3ZIUA 4YHHB 3Q7SA 5TGZA 1N1DA 3G79A 5K6RA 1FYFA 4LXHA 1YCDA 3DLCA 3ZDDA 3HTXA 4QHYA 5JTTA 1EFRA 4I50B 3PEFA 1E1YA 1ML4A 1UBCA 1VBNA 4Z2YA 4Q3KA 4FQ7A 2ZI5A 3WWZA 4Y2PA 1R5OA 3G1WA 4PF1A 1II8B 2QLJA 3I4LA 2OXTA 3RUAA 3TECE 2AKYA 2HWYA 3DPSA 3H1BA 1H05A 3FYHA 3GD5A 4K6MA 3RVDA 3ZGYA 4V2IA 1MGPA 1NXOA 1DRUA 1YZFA 3H8SA 4QBIA 5EQTA 5IZCA 4FS8A 3TN7A 1Q1AA 3IAXA 3NAGA 4HGOA 5DE3A 3DZBA 2OM6A 4DJEC 3L92A 2I2XB 2NSDA 2PGAA 1U7DA 2BKAA 4FJ2A 4I46A 4EW2A 3E2PA 1ESCA 1KP3A 5CB0A 1QGOA 2I6XA 4HZUA 6Q21A 3CPHA 4M7PA 2WG2A 3VMMA 4RLSA 1R9MA 1RCFA 4BNLA 1WDKA 1ZJ6A 2YZGA 2ZBPA 2QJWA 4UTXA 5FBRB 3BIJA 3SX0A 3L41A 3HZOA 4WUVA 2H5EA 4IHJF 2JGMA 1LF0A 2HREA 3E7DA 3Q85A 5K0GA 1XMXA 2BZGA 1CZKA 1XCBA 3KEMA 4BNYA 3AY6A 1D1PA 1UMCA 1EFUA 3OC0A 4YVFA 3ZV4A 4ZYLA 5CYOA 2XDQB 2HHCA 1SO8A 3KE8A 2EKBA 1U2DC 3QEJA 2I7CA 1EXMA 5KX5B 3L9WA 5E7JA 1M5RA 4LF9B 3AWIA 5AI6A 3FDZA 4B83A 2PFSA 1HQYE 4O4JB 3UKOA 4ZQHA 3KZXA 2ZVPX 4WVLA 3AG6A 4I19A 2WLTA 5JVDB 3I37X 2CD9A 4EK9A 1RQ7A 3CLTD 2OHGA 5F3WB 1CY6A 1P91A 2QTZA 4JT4A 1XZ8A 3L79A 5IABA 1BAPA 2Q4RA 4HTFA 2XCRB 3GIDA 4EPYA 1UDCA 2I6SA 3L0SA 5C2JB 2R8ZA 3KXIA 1J2JA 3KWMA 2P2ZA 4DSUA 4JL6A 1U94A 2ZS7A 3QK7A 1RZRD 1TYEB 1XZDA 4J1TA 2ACVA 3PNOA 4FWIB 4OAOA 2C7OA 1UBRS 1MW8X 1MBZA 4YRCA 2FA9A 1D07A 2NVBA 4WZBB 3JWEA 2HC9A 4DR4B 1WCXA 1N1MA 4U2GA 4RU1A 3RJMA 2FJUA 3VR2A 2VBGA 5DYWA 3AVQA 2XUKA 2AFIB 4DLUA 3SLGA 1DJLA 2GESA 2Q62A 2GWRA 5CX1B 2QR2A 4N18A 1G3RA 1A7KA 4MK4A 4C5BA 3FHTA 1TEHA 1AHNA 4QBGB 1FXUA 3TG2A 3E5RA 4B4DA 2E5FA 1BEEA 3E8MA 3TNYA 1GPNA 1NQOA 4JD5A 5IK2D 1SN7A 1T0IA 4CKYA 1V96A 5AW4A 5IJ9B 2XCUA 1L7OA 3GRCA 3SM3A 4A7PA 5BRJA 3H5LA 3WYFA 1LWOA 2PXCA 4A9AA 4DCOA 2GO1A 5TQ0A 1X8XA 4IY1A 2GHTA 3HU5A 3QSYA 4MUGA 1GVNB 1VHDA 2C4VA 4GX1A 4QJ4A 4HNQA 1MJNA 2D5BA 1UWVA 2RJOA 4PSAA 4GIBA 4PO1A 3U1TA 3WK8A 3L4KA 2Y1LA 1P9NA 5C1IA 3GLGB 1GU7A 3INRA 1NOJA 2JKZA 3OY2A 5JNWA 1E96A 3SFZA 4Q12A 1PFKA 1YA4A 2X7JA 2EFJA 4A0FA 5CB8A 4YXWD 2WC1A 3R6LA 4Z4CA 5AUOB 2VNSA 3ZHYA 2XMRA 3SFTA 4P6VF 2HADA 3HA7A 3FB1A 4LJ5A 4LN1A 5AMXA 1Y7LA 1X3SA 4XE5A 2SICE 4OI1A 1CJBA 3RC3A 3C2QA 1XHEA 4UMFA 4DWJA 3ITKA 1NN3A 3H13A 5TDHA 2J9XB 4MV6A 1ZKMA 2MWMA 1KEEA 2VUSA 2B94A 3BIOA 3G2QA 3FWKA 1IJFA 1JIJA 2Q5LA 3KJZA 2XYVA 4OBWA 4EENA 2WKPA 2O5VA 4TLCA 2JHAA 1GKIA 2QX8A 1GG9A 2BDEA 1QB8A 3DBVO 2DPHA 3R6TA 3WL5A 1ZITA 1GAQA 3BTVA 5FTLA 4XGKA 1G20A 2C0PA 2PBZA 1RWKA 3O1IC 2PKCA 1RKQA 3FZGA 5CXXA 3DOHA 1D5CA 5GJWC 1SPXA 3SICE 4BAZA 4BFZA 4P81A 3B48A 3C16C 4J0EA 4C4ZA 4E2YA 1HRDA 2PM8A 2XKJE 4KPEC 4IM7A 3CUWA 3O2SB 3WHIA 2WPDD 3I2IA 1XT6A 1SQGA 3ESBA 2AR7A 5REQA 3AEKB 2JFGA 2ZE5A 4ZAYA 4CLHA 2O2GA 3UMVA 1E7SA 4DIMA 3ZWVA 4GWLA 3R7DA 5AKKA 3BREA 1ZOOA 4ZT5A 2V74B 5LYJA 2PH3A 1T0JB 1XDBA 4PWZA 3QZUA 4E5KA 4CG2A 1K3TA 1MENA 4TLDA 1EX9A 4E13A 1WV0A 2WE8A 2RBKA 4RIFA 5KYXA 3T94A 4DIEA 1LB1B 1T9KA 3NDPA 3QPAA 2QJRA 5FNVB 3HV0A 4IXMA 4V24A 2A5DA 5JZOA 1T13A 4ALLA 3FPEA 2HN9A 4JBHA 4NMHA 5DBIA 2ZDQA 3ZW7A 5E1BA 2XD9A 3HWRA 5DM4A 2HCTA 5FTMA 1G8MA 3HNRA 2CMKA 5ALZA 1DAPA 1W4LA 1MOSA 1UM8A 2IU6A 2OCYC 4MVJM 2BFCB 4WWHA 3IR6A 1RU3A 1WQ3A 3I2JA 5IBQA 5EIEA 1IXYA 2DFNA 2BGNA 3BMQB 3ADKA 2HIHA 1HK7A 1XTBA 3VO9A 1G5PA 2VPWA 3HHEA 3L7IA 4ZJYA 1EVKA 2V1UA 1H5UA 1ZFNA 1H2EA 2P3OA 4MB0A 1RD4A 2G63A 4IBOA 4GP9A 1MX5A 3U4MA 3NHKA 2I34A 5CH5A 3LGXA 1EGAA 2YW2A 2A3NA 1JQLB 3HBNA 1E2PA 4FILA 1Z18A 3PXEA 1I7NA 3LFUA 5I9MA 4P4NA 1HDXA 1VIMA 3FPSA 5B58C 1VLQA 4U00A 2FGKA 4J03A 4X3OA 2OOKA 4R2KA 3DDCA 1ISHA 2WWRA 2IV3A 1DARA 3IBSA 4Z7QB 5BSWA 2IV7A 3WY9A 1SVLA 2BM8A 2PX8A 2EFDB 4JP3A 4EJSB 4RTMA 2GEUA 5JUWA 4MGKR 1FS4A 1UXIA 1DC3A 1H5QA 1ZSNA 5SY4A 3W4IA 2XV1A 2Z5VA 3AM3A 5DGXA 1WVMA 2XT0A 2QMHA 2P9YA 2ZJ2A 3ZE0B 5JZMA 2IUYA 1J8FA 1NMZA 1OZGA 1MO2A 1R12A 2W2TA 3GN1A 3VSBA 3KHKA 4FMCB 4GX0A 5FOQA 5DNDA 2EJVA 2BMEA 1Q3HA 1NF3A 1SCQA 3PE6A 1O8CA 1RLTA 2KE5A 4ZXPA 1J0CA 1GPAA 2QG9A 3F71A 5JNTA 4M1EA 3MMZA 1G7RA 4KKXB 1I4WA 1UPFA 2WFLA 5FOWA 3VKUA 4GOMD 4FPXA 3SS8A 1AVTA 3B6EA 3NYWA 1P1KA 1XHFA 3DOFA 3H9GA 4A16A 3V80A 3QNWA 2JDID 3IT0A 4PC7A 5BQ3A 4GO1A 2NTEA 3VTKA 1SVOA 2PX6A 2HR1A 1UJMA 3B3GA 4EVIA 4NI5A 2IEYA 3C5VA 3G2HA 2FQ1A 1TIPA 4WZBE 3CHYA 4BZPA 4IJ6A 4TV9B 3AIMA 1B4DA 1SBIA 2DT5A 1UT8A 3WHPA 1QKKA 3OCJA 4MR9B 3AEZA 4MQ6A 5E4JA 4DAOA 3OTQA 3QIAA 1E8NA 3CR7A 1UWKA 5LB2A 4IILA 1O6BA 1XKQA 3TQFA 3VR4H 2VNKA 1ACMA 5ICMA 1MF7A 2YYAA 3KUDA 4EPVA 1EPUA 5KPDA 2MMCA 3BQ9A 3UKJA 1CR6A 1RQPA 2AX4A 3OIDA 4CLRB 2A0XA 4KSYA 1V43A 3GBPA 2IHZA 3BDIA 4W1PA 4WY5A 3V2HA 4FEYA 2PRZA 1WKVA 4ENQA 5MN5A 3CF4G 3M1IA 5L3QB 3LFHA 2QAJA 4OL9A 1FFHA 3R7FA 1FC0A 2Q4BA 3ZQKA 4R69A 1FX0A 4DCGA 2EYUA 4TT3D 4MWBA 2J8ZA 3WZ2A 3K15A 3EIEA 3GLGE 4HX5A 3DEKA 4BLTA 3T0IA 2EFGA 3A0RB 1AMOA 1XLVA 3Q9SA 5DCLA 3WAKA 3B52X 3PDJA 2XGMA 4C2AA 2GZDA 4PAMA 1UUFA 3KT0A 1D5WA 1ZP6A 2Y92A 2EFEB 1YOBA 2H85A 5IN5A 3LPAA 2V3CC 2FPGA 2XT6A 3PD7A 5CHEA 3JQBA 1ODIA 4MP6A 2PCJA 1C9EA 4P4LA 1EK6A 1A98A 3ZU2A 4J3NA 5TJ9A 1XQXA 3BKWA 3KQTA 2H51A 3I6MA 3WTBA 3FCAA 1DBQA 4LYGA 4L9RA 5JS8A 3U5ZB 2PWYA 1RXSA 3K0CA 5KYWB 5BSTA 5K8UA 1L4MA 2WB2A 4OHMA 3G49A 1Y1TA 1E0JA 2OBLA 3EFEA 5AO9A 3BD9A 3PRKE 3RTDA 1AKQA 4O2AF 4YP6A 1AT1A 1B0PA 2H1LA 2VT3A 2NAFA 4ABYA 5F4ZA 2FH5B 5L4NA 1JMYA 3GVIA 3W2GA 3FWHA 2D1QA 4FIZA 1GFSA 3L40A 2B4TO 4CFSA 3OLQA 4DMUB 4V0LA 1YONA 2CHVA 2CK3A 4C7BA 1PQPA 4YCAA 1U0TA 2GI4A 3AR2A 3D43A 4LCJA 4OREX 5P21A 821PA 2VQEB 1CRPA 5EHNA 1L5FA 1A88A 1AG9A 1AKYA 1TPZA 2EVWX 4OI2A 3FDJA 4MV3A 1O95D 1CERA 3OO1A 1YZGA 3SK0A 4TPKA 1ODSA 3M6MD 4ZTBA 1UBKS 2JEOA 3TG8A 4HRVA 3GYBA 4RAOA 4EMTA 5KWEA 2IBSA 4A8JB 2PANA 3PU6A 3CWCA 3NBQA 2RGUA 1Z7GA 1K5GA 5B37A 2ZBFA 3WDMA 1RS0A 4XD2A 1TCBA 1A2BA 3KHUA 2OC9A 16PKA 4K3UA 1RYNA 2XB6A 2P79A 4MW1A 4RVDA 3W1WA 3ZEIA 4BP9A 5TT1A 2QD5A 3H83A 3NHPA 2NTYC 3G8BA 4MUMA 2X8JA 1JEOA 1QYXA 5GVSA 3PQDA 2BUCA 3AEQB 4Z7JA 3H1GA 3E81A 3KQQA 4O2RA 5BNWA 1JHYA 2A9QA 3RVBA 1WSBA 4NYIR 3GT4A 1V6AA 3DUWA 1GNQA 1ENZA 3MWKA 4P8RA 1KKMA 4RNCA 1M2KA 5ISMA 4RLQA 1WHTB 3O4RA 1KFEB 5DP1A 4DCNA 1FP6A 2EARA 1E3QA 3AY3A 4ZI7F 1S5PA 4FDUA 2CLMB 4JIMA 4MARA 1A8SA 1VXRA 5KVSA 1BXRB 1G21B 3F98A 3CX3A 2G0NA 5HK8A 4PIPA 1TU0A 1SXJB 3IDFA 2ZBRA 4YRTA 2R1ZA 4GE3A 2PRYA 2QENA 1NNUA 3BCSA 3OQVA 1E2MA 1LVUA 3H9CA 4N9QA 2BFMA 5AD1A 4FHFA 3M5PA 4H6XA 3CTMA 1GYQA 2AHOA 4QGBA 2EERA 4Q7JB 3DUFA 4BJ5A 3NM6B 1B73A 3IV6A 2QT0A 1QCCA 4KL8S 1G2PA 2YJGA 3KL4A 1JR3E 3DOJA 2TMKA 3PCRB 5BWMA 4BNDB 1F8UA 1HT2E 3U61B 4NL4H 5D3QA 1TZMA 2X2FA 1II9A 4S1PA 5C34B 4A73A 1NNLA 4YRIA 5KUTA 4NH4A 4PBSA 2C4WA 2HQSA 2X8WA 1Y8AA 2Y1DA 4M6WB 1J0DA 3W1VA 1R4MA 5KJFA 4DA7A 3D1LA 3OUZA 4E3WA 1GR0A 1FNMA 1YR1A 3ZXSA 4WXRA 5ENVA 4AKEA 2P69A 5FX2A 3QFSA 4LWQA 3WNBA 2ID4A 2DH5A 5IMSA 4XPIB 4GPTA 1L1QA 1YR7A 4DLKA 4I6EA 2WBLC 3DAPA 2I76A 4EHBA 2CVZA 3TQTA 5SY6A 1XWFA 2B1GA 4UNNA 1QS0B 3RVLA 5J5VA 3WGMA 3T52A 3MFYA 1DXOA 3W5HA 3ZNOA 1TUEA 1KI8A 3R2JA 3BILA 1PJ3A 5BNTA 4U2BA 2YVKA 5TF4A 5EERA 1FFWA 2I1VB 3SOPA 4NONA 1E1RD 1GV0A 3D2AA 3HCNA 4MVYA 3K0FA 4V3BA 1U1CA 5EUBA 5B1HA 3U09A 1PN3A 5JSZA 3QOYA 5B4TA 1ZI8A 2XZDA 2YVUA 4Q6WA 2Q5IA 3T7KA 2PUDA 1KC3A 4OGLA 5E7QA 4CIDA 3L7AA 1B6RA 1JILA 3I5MA 3DEIA 3FG9A 3NHRA 2QPOA 3F4BA 1DB3A 1Z8FA 2IOQA 3FNGA 1NQ5A 3GVCA 2PL1A 4KQCA 8OHMA 3SI7A 1TCUA 5FI0B 1I3MA 3PZBA 1BMQA 4CV2A 5MN4A 1T3SA 3HXOA 1N3IA 2CE7A 2FPPA 2QRHA 3T9AA 1EQ2A 2J48A 4TTVA 1WMDA 1EBFA 1TZCA 2C2KA 4J16C 1QQAA 3REQB 1UCFA 1T1RA 4UHDA 2EKPA 2H16A 2H8GA 4ARAA 2BV3A 4G5OA 1FQKA 3LOQA 3DGFC 4L0DA 1JA9A 1G16A 1NBAA 3CEJA 4CEIA 1CETA 1J06A 1JBQA 3FBTA 4ZO7A 5DZSA 1X6VA 1UDRA 1AQUA 1N57A 2JBWA 1MV5A 3EEBA 3PBKA 3Q98A 3DV2A 5JMWA 1QH1B 3NHAA 4N5LA 3IKLA 3UJAA 5TQJA 1FP1D 4MUNA 3NV7A 1RHMA 2YMQA 4OKSA 2BBWA 3OFVA 2OBYA 1PVOA 3F1LA 4HPWA 1N7GA 1WB6A 3FBGA 3S3TA 4EPWA 3R74A 2VI5A 1AS0A 3B13B 3NBZC 3OFSA 4GVXA 4I2NA 4J2OA 4ETNA 5HQ3B 3TD6A 4B71A 4QOEA 3RNOA 2RI6A 3WBBA 3IP3A 4L3VA 3UHAA 2JJYA 4R0MA 2I0FA 4XQEA 4JNCA 2GHRA 5FUQA 5AOCA 3NBYC 1WVIA 4PRKA 2WP0A 1NR1A 3WGOA 1DX9A 4B3DA 4BFSA 2XNHA 5K01A 3ROEA 2W2LD 1I9CA 2AMJA 2HQRA 1USVA 3CU5A 3HDGA 4L8WB 5DI3B 4DQKA 3MG9A 5HTOA 4DG8A 2HHLA 1FMJA 4TLBA 1JA1A 3HEAA 2QL9A 1KVTA 3PXGA 2QMUA 1H1TA 4NLLA 4QICA 3W2IA 3GOQA 4I4IA 1Q1BA 4RVSA 2D1SA 4I6GA 3L43A 4MIYA 4XRRA 4X54A 3QPDA 3AC0A 5AI4A 2IEAA 3ANXA 3W5VA 5B5SA 1EWRA 5BVHA 2C4MA 4LGYA 3D6FA 3EBPA 1GRVA 3TE6A 3RBZA 3SE0A 1OASA 2OCDA 1J2TA 2V8BA 3CF2A 3PSAA 3Q3IA 1ENYA 3UB3A 3EHDA 2M2IA 1Q7TA 2O2HA 3FCXA 4RHFA 1ZI9A 4GBJA 4AZ3B 3HUEA 3HUFA 5ENZA 1DKMA 1UPUA 1JJBA 3OE4A 1E94E 4FXOA 1U80A 3N9IA 4HGZA 4UXIA 3PVCA 4B4KA 2X5KO 1LTKA 4RIIA 1ZX1A 5CITA 5BUSA 1QP7A 2YYZA 2GN1A 3JVEA 1XCGB 4ZAFA 5JASA 1OHHD 3OZSA 5CLFA 1XTQA 4QTYA 1AN9A 4QDZA 3CE9A 4AK9A 3S0JA 1XALA 1Y1KE 2WPNA 1G21E 4JB2A 4OD0A 5HIIA 1DRKA 4ON9A 1RHKA 1VIDA 4X0EA 1SXJE 4Z9AA 2O2XA 1XLTA 4RZXA 1ZEJA 1N2CE 1XFDA 3TZHA 4DIOA 3A9RA 2ZBGA 1G41A 1WW3A 1N6RA 2L0XA 2VLIA 3GA5A 5CLQA 4ALKA 2EIXA 3D4BA 3EDMA 3LY5A 3LDUA 4PN7A 3SYRA 3L0BA 2YDXA 5JJBA 2EG9A 4FIDA 2PKRA 3RHTA 4N01A 1LBIA 4URHA 1H0KA 1N8TA 2VF2A 2NU8B 4R2XA 2F3TA 3JD1A 1QOQB 3R6GA 3VO2A 4DJJA 3ERCA 3QOXA 4D0NA 1CTQA 4KTVE 2Q27A 2IYRA 2ROQA 4HKTA 5EJGA 4LFAB 1T9BA 1DMSA 1COZA 2JJQA 1XA4A 2H07A 2MYPA 4NZZA 3ORHA 1JJIA 4KR0A 3GF4A 2HPHA 4WNIA 4JQSA 5AK6A 4H60A 1U7XA 1XTKA 1JPVA 3BN3A 4J6EA 4UW9A 5TY0A 1ZBQA 1CQJB 2FUNB 2VNIA 4JI5B 4B6RA 5LIPA 4LF7B 1B0UA 5A04A 2R5FA 3KSDO 2QU7A 2E2WA 3Q12A 1ZOSA 5TMDA 2OV8A 2PRIA 3TIFA 1N0HA 5EJEA 4ASUA 2COUA 2X4DA 2ZWOA 3QU4A 2YXEA 3FLAA 1PX2A 4NYJQ 3EVEA 5F3RA 4J0KA 1DL5A 3LSYA 2P35A 3HKEB 4YJFB 4L2IB 1O94C 4F7WA 1XPJA 3N0RA 1E92A 3IKJA 3S1SA 4R0NA 5DW3A 3T3IA 3WLRA 5A4IS 2G1PA 1SKYE 1JGTA 1O7JA 2R1VA 2MU1A 5FCDA 1U63A 2W6JD 3CZMA 3L1UA 4IDPA 4AMYA 5HCNA 4CLOB 1DBPA 3MILA 3O4FA 3MPOA 2HJWA 1VDMA 3Q11A 4F71A 4LC1A 1VPDA 2PDAA 3PITA 1EXDA 2NNLD 1KFCB 4OK6A 2XVYA 2P65A 2HHJA 3V7UA 7GPBA 1IHPA 1HXHA 2ZAIA 3AFGA 3TBFA 4ZKDA 4B3SB 3A26A 5K3OA 1R18A 3CUEF 1MIOB 3K9GA 3LW7A 3M81A 4NSNA 1OB5A 4W8OA 4LTMA 3L07A 1ADJA 2V98A 3KOYA 3T7AA 1ZD8A 3C7TA 2C8JA 4E4YA 4AM8A 1AQ6A 2OG1A 2WVJA 3CKKA 4D81A 3VFDA 3HB0A 3GGDA 3NTOA 3EBOA 2QB5A 3TKYA 3MWEB 2O7RA 1SCUB 1LW7A 1NL3A 2C9OA 2YV5A 4BQPA 4NESA 1FW8A 2PA0A 3ORQA 5F5XA 4DLWA 1SQ0A 3O4VA 2V5UA 3CEHA 1PP4A 2FMKA 3CVJA 3D31A 4IIJF 2QJFA 4LX0A 2H4ZA 1NYRA 1P4RA 4PO9A 4TLAA 4PN3A 2ISSD 2J0QA 3HP7A 4ALJA 1JDJA 1AQIA 3H9BA 2X6TA 1P0MA 4MH0R 4TN1A 4FB4A 2AE2A 4EFMA 4DSZA 2FN7A 5L8VA 2VH2A 4YRJA 3K1JA 1AXEA 3L7KA 3NAMA 5JMTA 1IH8A 1PEAA 2ZPTX 3QLEA 3QHPA 4UBKA 5KMGA 4UZFA 5TEVA 2ZG6A 3CLSC 4OBXA 4UE2A 4MTCA 1D2RA 1FSZA 4BX0A 4CBVA 4XKJA 1HTWA 5T6MA 1DOHA 1DBWA 3K1TA 2GUWA 3OMWA 5DVZA 2ST1A 3V8NA 4IAOA 2P2SA 1XR3A 4R1QA 1FW6A 1MD9A 3BTSA 2XOEA 2QRVA 2GHIA 2VXCA 2ATVA 2ZJOA 4PLZA 1F5SA 4E14A 3M4NA 4FXPA 4F4UA 3TVDA 2WHRA 4PXAA 1YKGA 2Z5LA 1V8FA 1T0PA 1WQ1R 1GT91 3MCUA 1YGPA 4KEAA 1YE3A 2IEZA 3CO0S 2V0GA 3DL0A 4CMEA 1UANA 1TQ2A 1XVAA 4CCSA 4NZYA 1R4AA 4LNUB 1XX6A 1FYWA 2I2FA 1JBEA 1AN0A 1E2FA 1SB8A 2Q41A 2ZR0A 3BDAA 4OXXA 1PQWA 5JMOA 2ATEA 2JEYA 1F14A 1CUDA 3MTAA 4FYJA 4KRFA 1OKKA 3BEOA 3CF4A 2FNAA 4GUDA 2BMDA 5B53A 3QFHA 4BB6A 2I62A 1EFAA 2PUCA 4GZ5A 2GXAA 5DH9A 4EHHA 3UMMA 1WXEA 5ALJA 4TKZA 4XIGS 4QD3A 3SHWA 1NMXA 4YNBA 3GLHE 3OM0A 4LZAA 1M34E 2XQVA 5EE0A 4B4WA 4B5KA 5J1SB 2AI1A 3RS3A 4ZJUA 3P19A 2BH2A 3DKVA 2DFTA 3BZBA 3C3DA 3DR3A 4UVDA 5AI0A 1F06A 4PLGA 4EHJA 1YB5A 4JB0A 3S27A 1BMFA 1RJDA 4MQEB 2DTDA 4Q3BA 2NP6A 3FM9A 1AM4D 1QYIA 1JHOA 1Z82A 4XQCA 2PMBA 4UE3S 4EAAA 1T5TA 4NNOA 5TARA 4CMGA 1MN6A 2AV6A 1QR6A 2VDNB 3EGWA 4OGFA 3H16A 3E9DA 1FP4B 2ZE8A 3VC2A 5IDXA 2AOTB 1S4MA 4DMCA 4EQ6B 4YWHA 4Q3AA 4RL6A 1G7TA 2R00A 1N6NA 2NQ2C 2QX7A 1MA3A 2JF0A 4IKEA 2ODTX 4QQ8A 3AVOA 4FT4A 2V7WA 3N5KA 2DVMA 4H1VA 3IUSA 4MR8A 4F0JA 1AGRA 1QHHB 2X6RA 4ZZIA 3D0QA 1NVEA 3AY7A 5ED4A 1DLJA 3UJHA 1CCWA 2FG5A 1V16B 4QFMA 1AUPA 1F48A 4DRXA 4DXHA 3OUTA 1GGEA 5ALFA 3HYSA 1T8TA 2DLDA 3U7IA 1X7GA 3MJSA 4DE5A 4H31A 2BGLA 3PJFA 1C8LA 1W34A 4RPGA 1MABB 3MWGA 3E7PA 2ZYAA 1FTYA 2QTWB 4QT4A 1TYCA 2F90A 4XB1A 5LLSA 1EP3B 1XWIA 3U80A 1P74A 1VCHA 1ONNA 2HEGA 1OLSA 3M9WA 4DDHA 4FKZA 3W4KA 3FKJA 3HJHA 3KBBA 3ESAA 3EH1A 3WLJA 4U2KA 4FLEA 1RE0A 1THTA 1T35A 2V65A 2FOXA 1XQYA 3PZRA 2VP3A 3C7AA 1T2DA 4A8HA 2I29A 5JQGA 3PWTA 1L2TA 4IIGA 2V5AA 3OJ0A 4HH0A 1ZISA 4LMAA 1S9DA 5IJAA 1PR0A 1UBOS 1T9ZA 1X86B 4PANA 4LG1A 5ADVA 1IRIA 3E18A 5D3ZA 2CKDA 4N0QA 1YZUA 2O2YA 4UFNA 5I9SA 3FYUA 3U3OA 5BO5A 3U48A 3NKVA 4KUGA 1U04A 2C9MA 4C4OA 3LS2A 2HJVA 4HDKB 1K8YB 4JSRA 2EZUA 1MAWA 2Q21A 2YCBA 4PQFA 3ZDBA 4H15A 4A0RA 5FTKA 1SBYA 2Z5GA 1B0ZA 1WY5A 1L4EA 3ODGA 2XMGA 4V0NA 5FBQB 1KKLA 1JFLA 2MSWA 5D01A 1IE3A 2PYDA 5DCWA 1T8WA 3SYMA 4RXUA 4CMBA 3H1PA 5SICE 4R71A 1US8B 2B36A 4EZBA 3EXEB 3UK0A 4IIEA 4QTXA 2XQGA 1LC3A 2PKEA 1B6GA 2N1MA 3N3BC 4YJGB 2VYND 1ZIDA 4YMWA 5SYNA 4EFLA 2DECA 3NVAA 3AFIA 3SS9X 1JZQA 1C0LA 2BDUA 3HJNA 5CB6A 5JY6A 3AIOA 1QFSA 1C3XA 5EWJB 2FW0A 3ES9A 4KR9A 2OXCA 4L16A 2JI8A 3LP8A 4AAYA 1FXWA 2GBCA 5KWSA 2FWMX 2OECA 1FP2A 3M6AA 4EI2A 1L7AA 3EODA 3IXLA 1L7RA 2HW8A 3FPFA 1OH5A 3PL1A 4IW3B 1RIFA 5BT8A 4UHHA 5F7JA 1EIZA 3O4GA 3C4QA 2DLCX 2CZQA 1RXVA 4CRWB 3T61A 4LQCA 3E3OA 1XNHA 5DTIA 2IJGX 2CEAA 3MQFA 3D5QA 1XJWA 4GLLA 3L8CA 4FYMA 5BWLA 2HUPA 5I01A 5DM70 2OPHA 4GYJA 2PCLA 1KK3A 3DXZA 3H7IA 3ZVKA 4PQYA 4NYMQ 1P9LA 1DQNA 2P2LA 2KMLA 1V11B 4ILEA 4PQGA 3DBLB 3R75A 4DDWA 1NXQA 1A3CA 4ALIA 6GPBA 1PGOA 2ZREA 3CRRA 2XOKD 2BM9A 4PG7A 3DKIA 3VPSA 1U2EA 1E3LA 4CEHA 2YXNA 1WF6A 2J5KA 2DTXA 3SZRA 1TIBA 3UCXA 3CISA 2XTNA 4A6PA 1W0JA 3ZV7A 1AH2A 3T1NA 2RGAA 3KQHA 4WOCA 4WZAB 1MJ5A 1CVRA 3B5JA 3CRZA 3D8SA 3E35A 3IDSA 2QT1A 4C30A 3VGPA 2PSJA 1J0EA 4JT9A 4LGMA 4EG8A 1Q7CA 1W0KD 5KWJA 3AHJA 4RPIA 2C7BA 1JXOA 4XYMA 3W6NA 2FQYA 3VHQA 1JB9A 3LQ4A 4UEOA 1H0RA 1QORA 4XVQA 5GONB 1ENPA 3ZWMA 2B7BA 2PGXA 1XUOA 4M9XA 3SOZA 1HOXA 3UWOA 3DCNA 4XWTA 3GR6A 2WU1A 4DQDA 3BSFA 1NV8A 4KB5A 1P1HA 5HOQA 3HMQA 2V97A 5HR5A 1KDOA 2PFKA 1GPBA 4PY2A 2BHSA 1ISGA 1P75A 4Q9JA 2BCGY 3WL4A 1I24A 3K9WA 5CFRA 3JRNA 1XD2B 3OPYB 4P4SB 1Y9EA 4FQ8A 4R6WA 4RMHA 3VI3B 1H3FA 3ROMA 2YZ7A 1RABA 3A31A 1XRSB 2WF7A 5DFAA 4IHJA 1RAAA 2J3LA 3WJ7A 4CQLA 4C07A 1E1NA 3O4HA 3VKFA 4WBNB 3F5QA 4P5DA 4RGYA 4MCIA 3D6JA 2OILA 3TW8B 3HABA 1TVEA 3AHGA 3PE4A 3F8WA 5HA5A 3GRUA 2P7IA 1XNQB 4XGQA 4HT3B 3CB4A 2HQ1A 5LOVB 3H2JA 3NDJA 1CIVA 4UJ5A 1YFZA 2BZ1A 3E6AA 3ANTA 3IVRA 4LY0A 4P98A 4JEHA 3H5NA 1KC1A 1YQEA 3LO8A 2JH8A 1WVGA 3C8ZA 3FKSA 2LUOA 2QP3A 4AF6A 4EJSC 4F8JA 4D4KA 5M2QA 5HNKA 3WE7A 2WM3A 1PLLA 3IKTA 1O6GA 2ZYTX 3UWSA 4FS3A 5ICCA 3P9SA 3I6IA 1TM1E 2EP7A 4EA6A 3RYCA 3OIVA 3HJFA 2XUDA 4ND2A 3AR8A 1AK2A 5HZKA 2JGJA 4FZJA 4R4JA 2VSXA 3GJZA 4RHCA 1RLJA 3B3JA 2HF8A 3C43A 1PSDA 4S0ZA 5EJ6A 1U2QA 1X8LA 4IMPA 1U90A 1W581 3IOCA 3PNLA 4O4LB 4TSFD 5ABPA 4YCLA 2J0SA 1W46A 3T0FA 3J80A 2JIZD 1FDSA 4HDRB 3W6PA 3T5TA 2K2QB 3TLBA 4TVSA 5C5IA 3AUJB 3EXHA 2M9MA 1P2SA 4E30A 5KNCA 2IPAB 4HTAA 5AW9A 1XPOA 2W58A 1T9HA 1VI2A 1FFCA 4LPKA 1D9XA 1DNPA 4M1QA 3QUTA 4GVPA 3VDQA 5A5VA 2Z9DA 3A28A 3BWXA 1BHQ1 1QYRA 4OHVA 1JFFB 1MO4A 2J5BA 1GAWA 1IM8A 1CUGA 2JL1A 3OCWA 5JPDA 2OE2A 1WBBA 1FCJA 1WCWA 3LT5A 4UHEA 4G24A 1Z13A 4ZZ0A 3HP1A 4W7IA 3FMGA 1GGHA 1A76A 1P0IA 3EMVA 5EEHA 4BFXA 1E9VA 5FDFA 1Y9AA 5LLTA 4ZVTA 1SKQA 1TJ4A 4IDDA 1FUKA 1NVWQ 3ROFA 1BE1A 3EAGA 1B26A 1CD5A 5AHOA 5LP6F 2XTJA 3NANA 1ZU4A 3AOEC 4JELA 1J39A 5LU8A 1UXHA 2VH5R 2XY4A 3HKBA 4JBIA 1SBZA 2WJHA 3REFA 4C08A 1EVJA 2HF7A 1GCOA 1NASA 2JGDA 4LVNA 1B8NA 2ZWIA 4EY6A 4C0WA 1A5TA 2VHVA 3IUEA 3KBOA 3SX4A 1Y82A 2W42A 4BVFA 1OXBB 2V7UA 3SR0A 1T2EA 2C54A 4QXPA 5FA5A 3E70C 5DNVA 1K9SA 3ON5A 2W2KB 3QA3E 3RS5A 2G77B 3DR5A 3SIRA 1KH2A 3DV0B 3KCNA 4KQGA 1YRQA 3AETA 3MUFA 4WI1A 3ABIA 2VYCA 3OF2A 3FF4A 3U6BA 3VOSA 3MUEA 2DE0X 4J0FA 5AUPB 3MTBA 1M9NA 1VG1A 2I1QA 1P80A 2ZRAA 3U7RA 1JHMA 4CN8A 4KXUA 4OATA 4TRJA 1U0NA 2A9VA 3LQKA 4INAA 3MMXA 2B8EA 2XNCA 3GAFA 5CLHA 3KKOA 5U9CA 1L5YA 3QVSA 2LDXA 2GAOA 1VBMA 5EPOA 1JHPA 2ODEA 2TYSB 4ZT7A 2QZJA 1JZSA 3JZAA 4WHMA 4UHKA 2Q0HA 3UW3A 4I8XA 2H00A 2J3EA 5EJ2A 4M1YA 1TJYA 5T4HA 3EA5A 3G85A 1DBSA 3L1JA 1G4HA 3PD1A 5EIAA 5BWNA 5AVRA 2ECOA 1UKEA 1VYVA 3TFQA 2R2AA 5DN6D 2HK9A 2PX0A 5A3VA 3PFNA 1OT3A 4OM7A 2VSOA 3PEYA 1HEUA 5A0TA 4FONA 4YB8A 3KPWA 2FFJA 1IHOA 5TMBA 3OG9A 3TM5A 3VR0A 4RSMA 4R2HA 1H1DA 2UZAA 3ZK8A 1JJVA 4KAFA 2AK2A 4DMLA 3IVXA 5A02A 1ND5A 2GN9A 3RKRA 1G5QA 4G8DA 1LK5A 3F6BX 2O7NA 4C5CA 3EXAA 1XHLA 1GGMA 3IESA 1VKNA 3PUJA 1A8UA 4NBUA 4WDQA 4DG5A 2O1XA 3WP0A 2C9YA 3DAFA 5IG2A 4GOXA 1VTKA 5DOZA 2DBRA 4MGIR 3TZKA 2EP8A 4ZVLA 1IPEA 2AHRA 1IK4A 1L5VA 3K2QA 2XNDA 4ROTA 3WMEA 3P2MA 1P7VA 1M1ZA 5AJHA 1OI3A 5JISA 1CV2A 5SZIA 2GJKA 3ZHQA 1JE0A 2XYRA 4I1RA 2VK2A 5DBEX 3AF1A 3H2BA 3TOVA 4EO9A 2I99A 4R51A 4A8JC 2VDQB 2ZI9A 4DCPA 1JHDA 1GGFA 1H8HA 2FN8A 3GZNB 1WXQA 3SKVA 5DEOA 4B82A 1E98A 3TDKA 4Z4QA 1V3VA 2BM0A 2FR8C 1AS3A 1T4BA 2WIDA 4ARZA 1FRFS 2KM1A 3QU7A 4C4YA 3UQZA 3LWBA 5CVCA 4HX9A 2GPWA 3GJ0A 1ZCJA 2C20A 5AKJA 1WU7A 1WE2A 3BMNA 3O2QB 1INLA 4R5MA 2IYZA 4X1YA 3S8EA 2JHFA 1RVV1 2GH1A 3KFLA 4KPUB 4TN5A 1JLMA 1L5WA 3HXMA 1A95A 4PCUA 5D85A 2O59A 3GG9A 3AIKA 4JQZA 3ZE1B 1IHYA 3WRYA 4UOQA 4A0SA 4CL2A 1NAHA 1P61B 2B34A 5JE8A 4D98A 2QN2A 4DNXA 2HMTA 4PFQA 1S8OA 3URKA 5F1YA 4ENWA 3C3PA 1ZGJA 2BMWA 1SXJC 2UZ1B 2W90A 1XI2A 1VKHA 1JYEA 2QIOA 3IEUA 2JRLA 2WNHA 3P94A 2OHFA 1W5AA 3U40A 2HJSA 1RYHA 3TSAA 4KLAA 1JLSA 1TAHA 3RGGA 1RR6A 3QMMA 3BL8A 1F0YA 4BQSA 4RY2A 3HYNA 4KNWA 1ZUD1 3H2ZA 4G9GA 4JL5A 3ZWOA 4LDJA 4FINA 4OXIA 1C4KA 2PAFA 1XRRA 3L01A 1XZAA 3PNKA 1RQRA 4IZIA 1JF8A 2A0YA 1EJBA 4HLNA 3D4OA 1DEHA 2P3QA 3I9MA 4X3CA 4JQOA 4CKEA 4KIWA 1RIIA 3AI3A 1E2IA 2R25B 3CNLA 3FNQA 3OOSA 3S5JA 4JLOA 2QZ4A 4WCDA 1ZGCA 2VAMA 3VVCA 4FGUA 2HK7A 4DPLA 2XODA 1A8IA 3K71B 4K6OA 4YEDA 2BISA 3HJUA 1GZSA 1GA1A 3HNOA 5H3CA 5KQMA 2BHTA 1S96A 1VJRA 3GQBA 3MINA 1XEXB 2G07A 4NYJR 1K63A 1QP4A 3HSKA 1U1GA 3C3WA 3NWEA 5I9TA 1PJRA 2RGRA 4JLUA 2OXIA 2WWIA 4CUJA 2GDZA 1SUFA 4O1HA 1D2EA 5A71A 1G8GA 5KHLB 5EHXA 1RXUA 3K5HA 1D7AA 2OSBA 2R4UA 3CZRA 3OTIA 1U8FO 4Y1GA 2NV6A 2JIOA 2OAQ1 5JD4A 2JC3A 5E9AA 3O2JA 4W5JA 2YZ2A 1UWCA 3KYIB 4L4ZA 4NDAA 3S2UA 3NMUF 1L1EA 2WM2A 3JZFA 1FYXA 3ZGNA 1MB4A 2NZVG 4JBGA 1EK0A 2VJBA 2W4QA 1GKYA 2GR9A 3RSGA 1IK6A 4HNTA 4IXDA 1TOAA 3CV3A 5KTTA 2QVZX 3BX1A 2HSJA 4TX1A 4Q7LA 2QP9X 5FWNA 2QLTA 1IXRC 4LJLA 4IDCA 4NE9A 1KSFX 3U3JA 2YW9A 1HT3A 3LYAA 4QVKA 1QYCA 3KJNA 3OCVA 5EWMA 2R60A 2CUNA 1AGNA 1KI6B 2DWCA 2EQBA 3BORA 1D2HA 3IVMA 3JYLA 4G5YA 4PLPA 4U6QA 4XXHA 3IDAA 3ZPXA 2F7SA 2WAXA 4UDYX 2BBSA 2PQMA 1O0SA 4A5SA 3EXIB 1CQIA 2YIDA 2A0KA 3K3PA 4BBJA 4II3A 1U7PA 3NBFA 2DMRA 1M72A 2HBRA 1P77A 4TMVA 5JANA 1QCZA 2WABA 1W4RA 2XI4A 3Q0TA 1CZHA 3EFBA 1V4NA 5EJAA 2ACEA 1R8QA 3QYFA 5EY5B 6REQB 1ZD5A 2IZOA 3QH4A 3GGCA 2FPOA 3IEXA 3ZDQA 1I3KA 3K1YA 1RKBA 2V55B 4I55B 4DHWA 5A5EA 1FTGA 2WJJA 2P2GA 3ECSA 4AO8A 3AYZB 3OQIA 1QG0A 1NJSA 4RS4A 2EL7A 5DHAA 3K70B 3NYIA 4PZ0A 4OG2A 1TMKA 3ICVA 3T54A 2W93A 1V7QA 2O8BA 4DSTA 2QK4A 4EY8A 3PHCA 4JKOA 3D6VA 5LA6B 1D9ZA 2XAAA 1U3TA 2YJ5A 1I6WA 4DWOA 2AE1A 2QRUA 4NCIA 1HL7A 5B7NA 3H11A 4U63A 1EZ1A 2ZWAA 2ZYRA 1DC5A 4MQMA 4AWBA 1DBRA 1EXNA 1TKAA 1JSLA 1PJSA 3PHLA 4HWPA 3WLLA 2QEQA 4DLRA 2R6JA 4DNFA 1PG5A 1IN8A 2HJ9A 3PC7A 2E1RA 5JNVA 4K9QA 1ISIA 1DCTA 2PZ8A 1F9EA 1RRVA 2XUQA 3LZ6A 4JT2A 3SQDA 4BC1A 4CDNA 3R9KA 4KFCA 1B41A 4KN8A 4AZ0A 3HGTA 5A9TA 1CKEA 3TYXA 3TZ6A 2I2CA 4EKNB 4D5EA 4UTVA 5HZHA 2C9DA 1NY5A 2GJAA 1A4RA 1IMOA 1CK4A 2ZYGA 3H65A 3MTEA 4XD7A 4XFJA 2C7QA 1H2FA 2D54A 2VQSA 1PLJA 2BN4A 2H7XA 1ORRA 4RMJA 5FIUA 2B5WA 3Q7QA 4HNGA 3THSA 4WXHA 4KOEC 2BEUA 2WD9A 3D7MA 3GEIA 1MT3A 1CR4A 3L02A 4NKRA 5TPZA 2J9ZB 5BWCA 4M0FA 4JLNA 1HBJA 4R68A 4ZANA 4Q00A 3EB9A 3CO5A 4B79A 4YFVA 4EEKA 1Q0UA