1Z40A

Ama1 from plasmodium falciparum
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
331
structure length
311
Chain Sequence
NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTDRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords apical membrane antigen 1 precursor
publication title Structure of AMA1 from Plasmodium falciparum reveals a clustering of polymorphisms that surround a conserved hydrophobic pocket
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Unknown function
total genus 93
structure length 311
sequence length 331
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1z40A01
1GMNA 4R1CA 4UAOA 2F83A 5CS1A 4A5TS 1GP9A 2HGFA 2K13X 3HMTA 1YXEA 4DURA 2YIOA 3HMRA 1GMOA 4R19A 1HKYA 5CP9A 2X2ZA 4IUAA 2LL4M 4Z0DA 5EODA 2QJ4A 4Z09A 2Z8WA 4Z0FA 1I8NA 2QJ2A 2YIPA 2J8JA 2Q8BA 4R1BA 2Z8VA 2LL3A 5COEA 1BHTA 3ZWZA 5I25A 4UV6A 3HMSA 1W81A 1NK1A 3SP8A 1Z40A 5CS3A 3MKPA 5CS9A 5CT2A 4APMA 2Q8AA 3SRIA 5CT1A 2Y8RA 3HN4A 2J8LA 2YILA 5CS5A 5CT3A 5EOKA 4R1AA 3ZLEA 1W8KA 4APLA 5CSQA 3SRJA 4Z0EA
chains in the Genus database with same CATH superfamily
1GMNA 4R1CA 4UAOA 2F83A 5CS1A 4A5TS 1GP9A 2HGFA 2K13X 3HMTA 1YXEA 4DURA 2YIOA 3HMRA 1GMOA 4R19A 1HKYA 5CP9A 2X2ZA 4IUAA 2LL4M 4Z0DA 5EODA 2QJ4A 4Z09A 2Z8WA 4Z0FA 1I8NA 2QJ2A 2YIPA 2J8JA 2Q8BA 4R1BA 2Z8VA 2LL3A 5COEA 1BHTA 3ZWZA 5I25A 4UV6A 3HMSA 1W81A 1NK1A 2KL5A 1Z40A 5CS3A 3MKPA 5CS9A 5CT2A 3SP8A 4APMA 2Q8AA 3SRIA 5CT1A 4YIZA 2Y8RA 3HN4A 2J8LA 4YIVA 2YILA 5CS5A 5CT3A 5EOKA 4R1AA 3ZLEA 1W8KA 4APLA 5CSQA 3SRJA 4Z0EA
chains in the Genus database with same CATH topology
1GMNA 4R1CA 4UAOA 2F83A 5CS1A 4A5TS 1GP9A 2HGFA 2K13X 3HMTA 1YXEA 4DURA 2YIOA 3HMRA 1GMOA 4R19A 1HKYA 5CP9A 2X2ZA 4IUAA 2LL4M 4Z0DA 5EODA 2QJ4A 4Z09A 2Z8WA 4Z0FA 1I8NA 2QJ2A 2YIPA 2J8JA 2Q8BA 4R1BA 2Z8VA 2LL3A 5COEA 1BHTA 3ZWZA 5I25A 4UV6A 3HMSA 1W81A 1NK1A 2KL5A 1Z40A 5CS3A 3MKPA 5CS9A 5CT2A 3SP8A 4APMA 2Q8AA 3SRIA 5CT1A 4YIZA 2Y8RA 3HN4A 2J8LA 4YIVA 2YILA 5CS5A 5CT3A 5EOKA 4R1AA 3ZLEA 1W8KA 4APLA 5CSQA 3SRJA 4Z0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMN A;  4R1C A;  4UAO A;  2F83 A;  5CS1 A;  4A5T S;  1GP9 A;  2HGF A;  2K13 X;  3HMT A;  1YXE A;  4DUR A;  2YIO A;  3HMR A;  1GMO A;  4R19 A;  1HKY A;  5CP9 A;  2X2Z A;  4IUA A;  2LL4 M;  4Z0D A;  5EOD A;  2QJ4 A;  4Z09 A;  2Z8W A;  4Z0F A;  1I8N A;  2QJ2 A;  2YIP A;  2J8J A;  2Q8B A;  4R1B A;  2Z8V A;  2LL3 A;  5COE A;  1BHT A;  3ZWZ A;  5I25 A;  4UV6 A;  3HMS A;  1W81 A;  1NK1 A;  3SP8 A;  1Z40 A;  5CS3 A;  3MKP A;  5CS9 A;  5CT2 A;  4APM A;  2Q8A A;  3SRI A;  5CT1 A;  2Y8R A;  3HN4 A;  2J8L A;  2YIL A;  5CS5 A;  5CT3 A;  5EOK A;  4R1A A;  3ZLE A;  1W8K A;  4APL A;  5CSQ A;  3SRJ A;  4Z0E A; 
#chains in the Genus database with same CATH topology
 1GMN A;  4R1C A;  4UAO A;  2F83 A;  5CS1 A;  4A5T S;  1GP9 A;  2HGF A;  2K13 X;  3HMT A;  1YXE A;  4DUR A;  2YIO A;  3HMR A;  1GMO A;  4R19 A;  1HKY A;  5CP9 A;  2X2Z A;  4IUA A;  2LL4 M;  4Z0D A;  5EOD A;  2QJ4 A;  4Z09 A;  2Z8W A;  4Z0F A;  1I8N A;  2QJ2 A;  2YIP A;  2J8J A;  2Q8B A;  4R1B A;  2Z8V A;  2LL3 A;  5COE A;  1BHT A;  3ZWZ A;  5I25 A;  4UV6 A;  3HMS A;  1W81 A;  1NK1 A;  2KL5 A;  1Z40 A;  5CS3 A;  3MKP A;  5CS9 A;  5CT2 A;  3SP8 A;  4APM A;  2Q8A A;  3SRI A;  5CT1 A;  4YIZ A;  2Y8R A;  3HN4 A;  2J8L A;  4YIV A;  2YIL A;  5CS5 A;  5CT3 A;  5EOK A;  4R1A A;  3ZLE A;  1W8K A;  4APL A;  5CSQ A;  3SRJ A;  4Z0E A; 
#chains in the Genus database with same CATH homology
 1GMN A;  4R1C A;  4UAO A;  2F83 A;  5CS1 A;  4A5T S;  1GP9 A;  2HGF A;  2K13 X;  3HMT A;  1YXE A;  4DUR A;  2YIO A;  3HMR A;  1GMO A;  4R19 A;  1HKY A;  5CP9 A;  2X2Z A;  4IUA A;  2LL4 M;  4Z0D A;  5EOD A;  2QJ4 A;  4Z09 A;  2Z8W A;  4Z0F A;  1I8N A;  2QJ2 A;  2YIP A;  2J8J A;  2Q8B A;  4R1B A;  2Z8V A;  2LL3 A;  5COE A;  1BHT A;  3ZWZ A;  5I25 A;  4UV6 A;  3HMS A;  1W81 A;  1NK1 A;  2KL5 A;  1Z40 A;  5CS3 A;  3MKP A;  5CS9 A;  5CT2 A;  3SP8 A;  4APM A;  2Q8A A;  3SRI A;  5CT1 A;  4YIZ A;  2Y8R A;  3HN4 A;  2J8L A;  4YIV A;  2YIL A;  5CS5 A;  5CT3 A;  5EOK A;  4R1A A;  3ZLE A;  1W8K A;  4APL A;  5CSQ A;  3SRJ A;  4Z0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...