1Z40A

Ama1 from plasmodium falciparum
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
331
structure length
311
Chain Sequence
b'NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKDKKCHILYIAAQENNGPRYCFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLWVDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTDRYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords apical membrane antigen 1 precursor
publication title Structure of AMA1 from Plasmodium falciparum reveals a clustering of polymorphisms that surround a conserved hydrophobic pocket
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Unknown function
total genus 93
structure length 311
sequence length 331
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1z40A01
1HKYA 2Y8RA 2QJ2A 5EODA 3HMTA 3HMRA 4Z0DA 4R1BA 4Z0FA 4R1CA 2LL4M 2Q8BA 4APLA 2Q8AA 5CT1A 5CSQA 4R1AA 2YILA 5CS5A 1BHTA 2J8JA 4APMA 3HN4A 2YIOA 2Z8WA 5EOKA 3SRIA 3HMSA 1W8KA 2LL3A 2K13X 2Z8VA 4DURA 3ZLEA 1YXEA 4R19A 3SRJA 5I25A 5CS3A 2HGFA 2F83A 2QJ4A 5CP9A 1GP9A 1NK1A 3ZWZA 4Z09A 2YIPA 4Z0EA 2X2ZA 4UV6A 5CT2A 1GMNA 5CT3A 5CS1A 1W81A 1Z40A 3MKPA 5CS9A 4A5TS 1GMOA 1I8NA 2J8LA 4IUAA 3SP8A 4UAOA 5COEA
chains in the Genus database with same CATH superfamily
1HKYA 2Y8RA 2QJ2A 5EODA 3HMTA 3HMRA 4Z0DA 4R1BA 4Z0FA 4R1CA 2LL4M 2Q8BA 4APLA 2Q8AA 5CT1A 5CSQA 4R1AA 2YILA 4YIZA 5CS5A 1BHTA 2J8JA 4APMA 3HN4A 2YIOA 2Z8WA 5EOKA 3SRIA 3HMSA 1W8KA 2LL3A 2K13X 2Z8VA 4DURA 3ZLEA 1YXEA 4R19A 3SRJA 5I25A 5CS3A 2HGFA 2F83A 2QJ4A 5CP9A 1GP9A 1NK1A 4YIVA 3ZWZA 4Z09A 2YIPA 4Z0EA 2X2ZA 4UV6A 5CT2A 1GMNA 5CT3A 5CS1A 1W81A 1Z40A 3MKPA 5CS9A 4A5TS 1GMOA 1I8NA 2J8LA 4IUAA 3SP8A 2KL5A 4UAOA 5COEA
chains in the Genus database with same CATH topology
1HKYA 2Y8RA 2QJ2A 5EODA 3HMTA 3HMRA 4Z0DA 4R1BA 4Z0FA 4R1CA 2LL4M 2Q8BA 4APLA 2Q8AA 5CT1A 5CSQA 4R1AA 2YILA 4YIZA 5CS5A 1BHTA 2J8JA 4APMA 3HN4A 2YIOA 2Z8WA 5EOKA 3SRIA 3HMSA 1W8KA 2LL3A 2K13X 2Z8VA 4DURA 3ZLEA 1YXEA 4R19A 3SRJA 5I25A 5CS3A 2HGFA 2F83A 2QJ4A 5CP9A 1GP9A 1NK1A 4YIVA 3ZWZA 4Z09A 2YIPA 4Z0EA 2X2ZA 4UV6A 5CT2A 1GMNA 5CT3A 5CS1A 1W81A 1Z40A 3MKPA 5CS9A 4A5TS 1GMOA 1I8NA 2J8LA 4IUAA 3SP8A 2KL5A 4UAOA 5COEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKY A;  2Y8R A;  2QJ2 A;  5EOD A;  3HMT A;  3HMR A;  4Z0D A;  4R1B A;  4Z0F A;  4R1C A;  2LL4 M;  2Q8B A;  4APL A;  2Q8A A;  5CT1 A;  5CSQ A;  4R1A A;  2YIL A;  5CS5 A;  1BHT A;  2J8J A;  4APM A;  3HN4 A;  2YIO A;  2Z8W A;  5EOK A;  3SRI A;  3HMS A;  1W8K A;  2LL3 A;  2K13 X;  2Z8V A;  4DUR A;  3ZLE A;  1YXE A;  4R19 A;  3SRJ A;  5I25 A;  5CS3 A;  2HGF A;  2F83 A;  2QJ4 A;  5CP9 A;  1GP9 A;  1NK1 A;  3ZWZ A;  4Z09 A;  2YIP A;  4Z0E A;  2X2Z A;  4UV6 A;  5CT2 A;  1GMN A;  5CT3 A;  5CS1 A;  1W81 A;  1Z40 A;  3MKP A;  5CS9 A;  4A5T S;  1GMO A;  1I8N A;  2J8L A;  4IUA A;  3SP8 A;  4UAO A;  5COE A; 
#chains in the Genus database with same CATH topology
 1HKY A;  2Y8R A;  2QJ2 A;  5EOD A;  3HMT A;  3HMR A;  4Z0D A;  4R1B A;  4Z0F A;  4R1C A;  2LL4 M;  2Q8B A;  4APL A;  2Q8A A;  5CT1 A;  5CSQ A;  4R1A A;  2YIL A;  4YIZ A;  5CS5 A;  1BHT A;  2J8J A;  4APM A;  3HN4 A;  2YIO A;  2Z8W A;  5EOK A;  3SRI A;  3HMS A;  1W8K A;  2LL3 A;  2K13 X;  2Z8V A;  4DUR A;  3ZLE A;  1YXE A;  4R19 A;  3SRJ A;  5I25 A;  5CS3 A;  2HGF A;  2F83 A;  2QJ4 A;  5CP9 A;  1GP9 A;  1NK1 A;  4YIV A;  3ZWZ A;  4Z09 A;  2YIP A;  4Z0E A;  2X2Z A;  4UV6 A;  5CT2 A;  1GMN A;  5CT3 A;  5CS1 A;  1W81 A;  1Z40 A;  3MKP A;  5CS9 A;  4A5T S;  1GMO A;  1I8N A;  2J8L A;  4IUA A;  3SP8 A;  2KL5 A;  4UAO A;  5COE A; 
#chains in the Genus database with same CATH homology
 1HKY A;  2Y8R A;  2QJ2 A;  5EOD A;  3HMT A;  3HMR A;  4Z0D A;  4R1B A;  4Z0F A;  4R1C A;  2LL4 M;  2Q8B A;  4APL A;  2Q8A A;  5CT1 A;  5CSQ A;  4R1A A;  2YIL A;  4YIZ A;  5CS5 A;  1BHT A;  2J8J A;  4APM A;  3HN4 A;  2YIO A;  2Z8W A;  5EOK A;  3SRI A;  3HMS A;  1W8K A;  2LL3 A;  2K13 X;  2Z8V A;  4DUR A;  3ZLE A;  1YXE A;  4R19 A;  3SRJ A;  5I25 A;  5CS3 A;  2HGF A;  2F83 A;  2QJ4 A;  5CP9 A;  1GP9 A;  1NK1 A;  4YIV A;  3ZWZ A;  4Z09 A;  2YIP A;  4Z0E A;  2X2Z A;  4UV6 A;  5CT2 A;  1GMN A;  5CT3 A;  5CS1 A;  1W81 A;  1Z40 A;  3MKP A;  5CS9 A;  4A5T S;  1GMO A;  1I8N A;  2J8L A;  4IUA A;  3SP8 A;  2KL5 A;  4UAO A;  5COE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...