1Z4LA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with thymidine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4lA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4lA01
2GO7A 1QQ6A 2HCFA 2CFSA 3U7FB 1ZRMA 3J7TA 4KX5A 2I34A 5AVWA 1LTQA 3SLRA 5ALPA 4YCLA 4UM7A 4L57A 2PQ0A 2YMPA 3I1YA 3N8GA 4Y3UA 5AI6A 3QUTA 1J8DA 1L8LA 4QQFA 3U7HB 2FUEA 3WKAA 2B8EA 4IG4A 1SU4A 1RQLA 1X42A 4QJBA 4Y2UA 3W5DA 1RKQA 1EK1A 5AK6A 2FDRA 2HO4A 3MN1A 3FVVA 3KDPA 3OCUA 5AKKA 4Y2VA 1ZD4A 5AKJA 5AW0A 1SWWA 3KBBA 5AW7A 3HLTA 2FPSA 3SF0A 2G07A 2OA0A 4MWOA 3RF6A 3L1UA 3QUQA 3NIWA 4H1WA 3MC1A 5E0OA 3MMZA 4HGQA 4HGRA 1ZJJA 3WGVA 4UM5A 5AW8A 3AR9A 2IYEA 3FZQA 4KNVA 5AM1A 5AW6A 3WKCA 1TJ3A 4YIKA 1RQNA 2FEAA 3N28A 1T5TA 3PGLA 4BEVA 4FE3A 2FPXA 4XE5A 3GYGA 2G08A 2AUTA 3QUCA 4UMFA 3K1ZA 4UW9A 2C4NA 5ALHA 4AS3A 5ALWA 1TJ5A 3NANA 5ALJA 2ZBFA 4UMEA 3ZWDA 4I9GA 3OCXA 2NYVA 5AK3A 5T41A 5A3RA 3ZW7A 1XP5A 2HX1A 4HAIA 1YS9A 5ALYA 1QQ5A 1U7PA 4FYPA 2IA5A 2VKQA 1JUDA 2I55A 3QNMA 3NRJA 2JAOA 3U26A 2YJ3A 3WK5A 4E88A 4YIHA 3L0CA 4J03A 2BDUA 4KYTA 3U7EB 3OPXA 3P96A 5A3SA 3VAYA 3ZX4A 1RC8A 4NWIA 3QU7A 1TA0A 4G9BA 3I6BA 2X4DA 3DV9A 3N07A 5AKHA 5ALKA 1VJRA 1NF2A 4KNWA 4UAUA 2C9MA 4HGPA 5AI8A 5ALMA 1WZCA 4CNQA 3QU5A 4ZEXA 3WK9A 3B8EA 3FM9A 1PW5A 3QYPA 1Z4MA 3A3YA 5AVVA 1Q92A 4XPZA 3L8EA 4XQ0A 1RMYA 4C4SA 4NV0A 1WVIA 5AIAA 3OCVA 3ZVNA 4JDPA 1Z88A 3IB6A 3KOOA 1WR8A 3I28A 2YFYA 1Q91A 2WM8A 3PCTA 2YMQA 2HSZA 1KYTA 4AS2A 2EATA 2I33A 4CF4A 2FPUA 3UMBA 2P69A 1S2OA 2RB5A 4CE6A 4OFZA 4UU0A 3WK6A 5ALVA 1Z4OA 4F71A 1ZD5A 3UMCA 3EPRA 3ZX5A 5AVRA 2JAUA 2P11A 3NUQA 4BEWA 4Y2SA 5AI4A 2NO4A 2I6XA 2B1RA 3PDWA 3QX7A 1L6RA 3R4CA 4ZEVA 5AW2A 1RKUA 1T9ZA 2Q4RA 1U02A 1QYIA 4EZEA 2AMYA 5AM2A 1NNLA 1RLOA 3U19A 1L7OA 1VJ5A 2C8KA 2PR7A 3IRUA 4EELA 1L7MA 5AVYA 4L6AA 1Z4IA 1J97A 5ALSA 1XVIA 4BBJA 2CN1A 2YJ5A 2EARA 2C8LA 4BKMA 2HDOA 2Q4TA 3WKEA 2G80A 3NASA 3DDHA 1N9KA 1Z5UA 5ALFA 4YCMA 3M9LA 3WK4A 3L5KA 2O2XA 1Z4KA 5ALLA 2YN4A 4F72A 5AI9A 2JGAA 5AM3A 5AK5A 3U13A 4EENA 4UAVA 1ZS9A 3A1CA 5ALZA 5IT0A 3ZTWA 2W43A 2BY4A 5ALNA 3R09A 4ZEWA 2RAVA 4Y2TA 5AVTA 1RMTA 4UU1A 2I7DA 3A1DA 3SHQA 2JARA 4BNDB 3EF1A 1TJ4A 3ZTYA 5ALDA 3ONNA 3AR8A 5JJBA 3B9BA 2ZBGA 3SKXA 1LVHA 5AW4A 4B6JA 3ESRA 3IJ5A 5ALEA 2IOFK 5AKXA 4C4RA 1YV9A 2IOHA 3PGVA 5AI5A 3ET5A 1RKVA 5IS2A 2ZG6A 5ALIA 1YJ5A 2B30A 4YGYA 3WK7A 3KC2A 3D6JA 1EK2A 1RLTA 1XPJA 4J2TA 4Y2RA 3E8MA 2HHLA 4MUMA 1WPGA 2EAUA 3OTQA 1T5SA 1VFPA 2I54A 5AW5A 2R8YA 4DFDA 2GHTA 4BX0A 2YMMA 2CFTA 3BWVA 3R9KA 1FEZA 3MPOA 4EX6A 5AKIA 4I9FA 5ALGA 3UMGA 2BDEA 2G0AA 3OCYA 4UMDA 3ZUPA 3F9RA 2ZOSA 2ODAA 1NRWA 4PNHA 5AVXA 2GHQA 1ZD3A 3B9RA 3W5AA 1L7NA 2YMLA 3EWIA 5AKYA 1F5SA 3NALA 3OCWA 2WF8A 3U7GA 1K1EA 2R8EA 3RFUA 3I76A 2NO5A 3AR7A 4OCZA 3N5KA 2B82A 2IOFA 4NAVA 5AM5A 3TLMA 2MU1A 3AR4A 1L7PA 2C88A 4HYTA 3QXGA 2GFHA 2WF7A 2R8ZA 4L6CA 2D2VA 2WFAA 3ESQA 3UM9A 2WF6A 3WK8A 3E81A 1ZD2P 3W5BA 4UMVA 3WKBA 4G63A 5AKGA 3NAMA 3QU2A 2OBBA 2WHEA 4NFLA 2OM6A 5AW3A 2R8XA 4DW8A 4O8CA 4Y2YA 2WF9A 4UASA 2FPWA 2QYHA 2YBDA 2RBKA 3L8FA 4DWOA 3CZ4A 1ZOLA 3W5CA 4BYGA 5AK4A 2YJ6A 4UATA 3SKYA 2ZBEA 3DAOA 3L8GA 2DQSA 2FI1A 3N1UA 1TE2A 3QU4A 4XOUA 1U2TA 2P27A 5AKEA 2OYCA 4KN8A 1RRCA 1Y8AA 4FFDA 1Z4JA 2FUCA 3L1VA 1MH9A 5ALUA 2B0CA 3WKDA 3AR6A 2AGVA 2PKEA 3OCZA 2FPRA 3FPBA 2GMWA 2HF7A 4Y2XA 5AM0A 5AIBA 1YDFA 1S8OA 2AH5A 1Z4PX 1QQ7A 5AI0A 1ZRNA 2W11A 3FPSA 4BX2A 3ZWKA 3M1YA 1RDFA 2WF5A 1SWVA 5A3QA 2HEGA 4HGOA 2B8JA 2YJ4A 3L7YA 3L0YA 3QU9A 2P9JA 5IT4A 5AW9A 3L8HA 4AP9A 2YY6A 3ZU6A 5ALQA 4EEKA 3CNHA 4KX3A 4RESA 2HI0A 4OHFA 4JB3A 4CF3A 4Y2QA 1N8NA 2RARA 4YCNA 4Y2PA 4BNDA 3EF0A 1YNSA 3A1EA 4BX3A 1RMQA 3QLEA 4OD0A 3S6JA 2CFRA 3KD3A 1L8OA 4NABA 2MSNA 1QH9A 2HF2A 3AR2A 3WGUA 3KZXA 4HGNA 4EX7A 5ALOA 4C4TA 5AVSA 5AKLA 5AHXA 5AVZA 4Y2JA 1CR6A 1O08A 4RETA 3L0BA 1Z4NA 3ZI4A 1RLMA 2G09A 5AICA 1YMQA 3QUBA 1O03A 1U2SA 4DCCA 5AESA 1Z4QA 3SD7A 5AVQA 1RPZA 5AM4A 5ALTA 3ZVMA 3QGMA 2O9JA 4GIBA 3ED5A 2QLTA 2G1AA 1CQZA 1Z4LA 2B1QA 4GXTA 4IFTA 1IWOA 3E58A 3AR3A 3AR5A 4CF5A 4UARA 2Q5EA 5AKZA 3FGOA 2JAWA 1U7OA 2W4MA 5AW1A 2G06A 3BA6A 5ALXA 4YH1A 2ZBDA 2HOQA 3DNPA 3E84A 1AQ6A 3HYCA 2ZXEA 3ET4A 3ZVLA 5ALRA 5AVUA 5FP0A 3SMVA 1Z5GA
chains in the Genus database with same CATH superfamily
1TRKA 2NW6A 3N8NA 1KPGA 1NV9A 4ZALA 1L5QA 1L5HA 4DNQA 5B4VA 1GZHB 3E4CA 5C8YF 4BFWA 2HA0A 1VE5A 2E4VA 4ENPA 2XUPA 2HCFA 2OVBA 5I8WA 1Q0RA 4MX8A 4RTMA 5C81A 4PBTA 1IZYA 1II0A 3D6TB 2N47A 3IURA 2BKVA 1DEXA 2HK8A 2IXFA 3PUVA 5F7ZA 5AVWA 1KC3A 1YT5A 1CZNA 4O08A 1IZ7A 1GKIA 5KOHB 1S96A 1NMSA 1B15A 1JDBB 4W1QA 3MWYW 4IDPA 1FUQA 1YH3A 2C31A 2AOXA 1AUOA 3RC3A 4K9RA 1R6UA 1YRHA 3GMTA 3WRXC 5JCJA 1N3IA 3W79A 4Q9NA 1G19A 1EDDA 2C5HA 1C1YA 4JL8A 1T10A 4I19A 4Z2YA 3EISA 2CNWA 4DC9A 4N8DA 4DABA 3VTFA 3MN1A 3R41A 4PIPA 5EFOA 3QXJA 4CRWB 2QTLA 1ZD4A 4KI0A 4UBMA 4CIWA 1LKZA 5IUNC 1EFAA 1HKHA 3TAUA 3NBZC 4NBRA 2YDYA 2EKPA 3LKDA 3CUYA 4R54A 1B8PA 3V2GA 4Q1VA 5F52A 1MV5A 3RU7A 2X14A 1FTNA 3BXHA 2Z6QA 5LLSA 3F8TA 1PK7A 2G07A 2NPIA 1WUIS 3S55A 4WN9B 4D45A 3SQNA 2XF8A 3AUSA 3HPRA 4DIDA 2A7QA 1FYDA 1PS8A 1UUFA 5HMMA 1F2TB 2WE7A 4TV9A 3UIEA 1PJRA 4R2LA 1ILEA 3OH8A 5I7OA 5EP3A 4MS4A 1NN5A 5A05A 5JMTA 3ZGLA 4HS9A 3MJ4A 1C3VA 1G6KA 2QV0A 3E35A 2VZ0A 1MU0A 1VKJA 1TPYA 1T0HB 3UJBA 4B5KA 3PE4A 5D00A 5CFLA 2QN6A 4M9CA 3ZHVA 3OUZA 1NSYA 3RROA 4GU5A 2ON6A 2Q6KA 4K05A 1NR5A 5I5EA 2N0SA 3FF4A 5IX8A 5KQSA 4TTQA 1DQZA 4JXJA 2FEPA 4DCSA 3AY6A 1YIOA 5B64A 3SEFA 3WYEA 4BNUA 3F73A 4D9EA 3C0KA 3GJSA 3SU8A 4BU1A 2GZAA 4UMEA 4Q3KA 1Y7TA 2E9FA 1KK0A 3K6RA 4YYZA 5JAZA 1SCKA 3PJFA 4IVPA 3AEZA 4RVHA 4BKQA 1MV8A 2I7CA 1QFYA 3OTGA 4HEJA 2FN7A 4LDAA 4EGFA 5BWMA 1LPPA 2DRIA 1JB9A 3RFTA 3I9MA 2P9ZA 1PJ3A 1KHTA 2AKAB 4CZ2A 5CFQA 4TKZA 5A0FA 1SCUA 2JAOA 3F3YA 3FTCA 4DG9A 4LXUA 3B5JA 1H2WA 1MC4A 5HFAA 1OC2A 3OSZA 1N1DA 4XEUA 4V1CI 5CA0A 4D3YA 3Q7RA 4LFAB 1E5VA 4XIGS 4KYTA 3ZX4A 1UJMA 3P96A 4FYIA 3P5BA 4KG7A 3GZNB 4GP9A 1Y34E 5JNUA 3JRWA 4EFMA 5JPIA 2KM1A 5FLKA 1Y6ZA 2DUNA 4FX5A 3IESA 2Y1OA 1Q1EA 1QGAA 4FFVA 1INLA 2ZUUA 3P9ZA 4LK2A 4QWWA 5DJ5A 5EXEA 1J2TA 1YRAA 4GKVA 2BF4A 4HGPA 4K9KA 4MK4A 2WG1A 3OEHA 3QU5A 4CODB 3JYOA 1IY0A 4ARUA 2ODTX 1PW5A 1RJ9A 4LZAA 4PHFA 1SG9A 4O1IA 5BQPA 3ZUGA 5FWDA 1FNBA 2FN4A 1QYVA 2D3WA 2H2AA 4FHGA 5DCLA 2ILVA 2IEAA 4EHAA 3VV3A 2PLRA 4YT2A 4W5WA 2AUNA 5AIAA 4HADA 1EFCA 3NPMA 2EV9A 3D3EA 5DLPA 1P1IA 4ER3A 2DUJA 2VEDA 2ECQA 3AESB 2OCXA 4JODA 1ICEA 4CU5A 5ICFA 1N2XA 2W6MA 4HQLA 1LBSA 4BUJA 3CGGA 2VOEA 4RVGA 5FHRA 1U04A 4F6CA 2EF1A 2HSZA 5FD8A 1P4SA 3TPFA 9LDTA 3LZ6A 2PTQA 4MYRA 1J0DA 1E1DA 5D6BA 5BSRA 4ND3A 1QJCA 4N7MA 1N57A 1NAIA 3G5UA 1Y4SA 2G5TA 2WJZB 2DT8A 4HLDA 5DM4A 3RU3A 1C1XB 3ZGVA 3JVIA 3TOZA 5IJ0A 5TF0A 4B6PA 4O2BF 5AVJA 4I4NA 4TUYA 4F9FA 1HTBA 2NAFA 4MRVA 1ZUNB 1UM9A 2Y0PA 2ZDQA 1VDZA 5K3DA 3L1JA 5T4FA 3WZ2A 4A0HA 3FGPA 4YRIA 4CIYA 5DOVA 3OX3A 3EAGA 2CXTA 2Z3WA 2XXAB 1AY0A 3JVEA 1SC3A 3RD8A 2K4MA 3G2HA 4MCJA 1XQVA 4P81A 4BQRA 3GLGA 1K8QA 1RKUA 2Q50A 2V7WA 3RYCA 3QE4A 1Q0PA 9MHTA 3G5AA 5TQ2B 4KPFC 3LXMA 4ZZ0A 1TA4A 5HF8A 3RSZA 3ODGA 2OCKA 5CA1B 3GY0A 2XTNA 3QWAA 1GN9A 1JHAA 3MJVA 4DADA 4UZEA 1S2NA 3RAJA 4KHPB 1IN8A 2R751 4DDVA 3OWHA 4D0GA 2ZTSA 1D2RA 1K8YB 2JHGA 2HGZA 2C8LA 2OYSA 4PRYA 1EVKA 5BNZA 4WY8A 2BEWA 5JCOC 5A6SA 2JH8A 3OJCA 1AN0A 5IABA 4S24A 1IEQA 4B3MB 1AQIA 4XYMA 2F43B 2Q2OA 3NIFB 4ZQIA 3VDQA 3Q2OA 4QYTA 1Z5UA 3C87A 3G1UA 3L0SA 3LGAA 4IXTA 1LBHA 1LPMA 3AM5A 4RYDA 3WK4A 4AP5A 1I3NA 1KSFX 4JR2A 5J63A 2R62A 1YOVB 2QTCA 2X3FA 2VBIA 5D7BA 3RVKA 2GEKA 4DWWA 4JI2B 1UXHA 2WFMA 3T1YB 3HVRA 3M2PA 2ZQZA 1IBSA 3WWDA 1EFVA 1TC2A 3P0IA 4XVQA 1CHDA 2W2QA 4OYYA 2V97A 1P19A 3FY4A 4UU1A 3WRWA 3EIFA 1NI3A 4Y18A 3ZY3A 3CIOA 3V9AA 4BVBA 1RADA 1KA9H 5ES3A 4R4JA 4D6YA 1YASA 3L8DA 1Q0TA 4DDKA 4JFAA 1KDTA 3I2IA 2FY8A 3H5AA 4HL6A 3ANSA 5BN1A 2V45A 4MQFB 1TTPB 4PPFA 3WX0A 5ALEA 1FBNA 3R77A 1XR3A 3DQZA 1BWQA 1VSVA 1QIFA 4WOKA 3C6QA 2AG6A 2NG1A 3H6GA 2O1SA 3DKRA 2D74A 3KSDO 3NHMA 2PA0A 1RJWA 3C6XA 2M2IA 3STTA 3W90A 2VJKA 2AS0A 3U7QB 4EJ6A 5FDFA 2W8BA 1IG0A 1NFQA 2AHOA 2CUZA 4IVRA 3LWNA 4WY2A 2PZJA 2ZE5A 5M2QA 2ZS8A 4PCUA 1IW7D 2VSQA 4X7RA 3JQ9A 4YGYA 5DHPA 5JPDA 4EQ6B 1QRSA 1GNPA 3MCZA 4FWIB 4IDDA 2CV0A 1T0UA 1XZKA 4X71A 4MUMA 1IWPB 2DX7A 3WBFA 4UQLA 1P75A 1U3FA 2INGX 1BROA 3D59A 4J2HA 2PUWA 4IFBA 4X1IA 2A4MA 4GYWA 4E2ZA 1M8GA 4QOEA 1CSEE 4BX0A 3B3QA 3S70A 4CHTA 2VF5X 5H9WA 1AIPA 1KH1A 2A78A 4KU4A 4MW0A 2Y67A 1IN1A 1JDJA 5A06A 4FZ5A 4QHYA 2VL7A 3TIVA 2ZQYA 5AKIA 1DJPA 4L8VA 1DEHA 1GAEO 1ZY2A 1EQAA 1OYVA 1WABA 3RBVA 5L3SA 2WNHA 1U3CA 4M60A 1TU3A 4RJTA 1JXOA 3QFTA 5AWFC 3OCYA 1F60A 2BMVA 2HCRA 2VQ6A 2HRDA 3R5SA 4IGFA 4LXHA 5BWBA 2DFLA 1UJ4A 1I13A 3ZY4A 3IC5A 4CEIA 4R1PA 4CL2A 1UANA 1X1SA 1YFJA 1MAUA 2CUTA 1OGYA 3F6YA 2O2DA 3IHKA 1DQRA 4KGDA 1UT5A 3T35A 3VRHA 1AGYA 2VF8A 5H02A 3K6SB 3HTXA 3RK0A 4XQCA 1K5PA 2O5VA 3AVYA 2WQ7A 3SZUA 1ZIOA 3NALA 1XZQA 1KS2A 2G1JA 4JBLA 5P21A 3SK0A 3WFJA 1XMJA 3INNA 4PPYA 5TPZA 4BEJA 2RAUA 3R7LA 2HLPA 3N0RA 1SBTA 2JFFA 1C1DB 2BFNA 1YB5A 2H1WA 4FNAA 2IOFA 4H6WA 1LQTA 1H2XA 2HK7A 1SHLA 1M6HA 2PMCA 2JGDB 4JC4A 2ODNA 2R6JA 3D3NA 2FSVA 1TDJA 1Y3BE 4I1SA 3AB7A 1UKZA 4MQBA 3TQCA 1ZUD1 2C1EA 2X9QA 4N3NA 4FHZA 2E18A 1DQYA 3FVQA 2J67A 2GA8A 3CNNA 3E1GA 2BF7A 2MR5A 3HKDB 4FYYA 3GF4A 2AEJA 3I05A 4W8OA 4LOAA 2GBLA 5FOWA 4I50A 4DUZB 4C22A 1H2RS 2O20A 3IH5A 4GLJA 3QXCA 4JI6B 3JQDA 2R8XA 3ADKA 3EIXA 2FZCA 5F33A 4N47A 5IANA 2WF9A 1AT1A 1AB5A 1WKCA 3A9UA 3DZIA 3PFBA 2I4RA 3F1LA 4MWCA 2YY5A 5L4LA 2BZ1A 2WPDD 3DMTA 1N5JA 1XUOA 1OCEA 1Q7BA 3FPEA 3ITNA 4JXKA 5BOSA 1IZ9A 1MPTA 2DFNA 3NRCA 4KGZA 2FI1A 3BEOA 5T4BA 3QU4A 4RLFA 3BULA 5MN6A 4FEAA 3UJ3X 3ZU2A 4RTRA 4LF9B 3RLIA 1QP7A 1KJ9A 2IGTA 1PLLA 5ITVA 1RRCA 3MQFA 3T5AA 1NQWA 4HO1X 2EX4A 3UT0A 2YVLA 1JE1A 3F7MA 1GQYA 1Z36A 1Y4ZA 1Z4JA 1KI2A 2QT0A 3ENKA 3NYIA 2QUJA 4OV6B 1O95A 3M9XA 5TMPA 2ZXFA 1R64A 1W0KA 4WNIA 1JR3D 1PR6A 1JPVA 2Y1XA 5I4KA 4FB4A 2Q0XA 3UJAA 2CZQA 4CMEC 4EB6A 5E4TA 3HBFA 3HZHA 2P40A 3QELA 1Q95A 1EWYA 2R66A 2J41A 1KYQA 3LL7A 4EYOA 4WT7A 4RWEA 1XKQA 5KHLB 1OXUA 3TXAA 4Z3DA 1N7HA 1FFWA 3OT5A 1GZ3A 3PNVA 5CNKA 4Z5XA 5DXFA 4RTSA 1ZRNA 3M4JA 4L27A 4NQZA 4LXXA 4H17A 4PR3A 3ZWKA 1P72A 1DT3A 4BCDA 3EQ7A 3NHZA 3H0EA 4LTDA 4ENVA 4L5YA 4P4UA 4EAAA 3RTCA 2FGKA 1EEHA 2FZEA 3RVLA 4TTJA 3VHLB 4N1AA 1BGVA 3L7JA 4I66A 1PK9A 4ARAA 2W93A 2DPLA 4WK2B 5CK5A 3ZCRA 4JEIA 4GRDA 4L0QA 1G5TA 3RC1A 3PFNA 5HF5A 5CEEA 1E5QA 5EHXA 2DH6A 3L8HA 2VRBA 4EW6A 3ZJTA 4CM8B 1USWA 3WNQA 3FOEC 4EGQA 1R0RE 1RRKA 1GTZA 2PL9A 3GCWA 3CW8X 4GD3Q 4IDBA 4OHFA 1KVTA 2JI6A 4IIEA 5CLIA 5ETJA 3ZCQA 2Q1SA 3OJ0A 4C04A 2R1ZA 3QPAA 2CZCA 5E9AA 4RK1A 1B23P 4IYJA 4G6ZA 4RA9A 2WUVA 3DEFA 1M0WA 2Q49A 3P2KA 2PTGA 1X1QA 1LNZA 3QLEA 1NW3A 4OQXA 1E8NA 4WKBA 4JQSA 5EGSA 2E1RA 5IJAA 3DO5A 4FU0A 3T15A 4P0TA 2OENG 4E5VA 4EI9A 5CIWA 1LJLA 5EIBC 4M8IA 4WXEA 1ISGA 3A27A 1B6TA 2NUPB 1AA6A 4RXUA 2R7MA 4RF3A 4FE7A 4Q4AA 3CCCA 1I2DA 3TG2A 1J1UA 1XD2A 3N7TA 2WTNA 4JT8A 1RYHA 4BMSA 3C8DA 4M0UA 1R8SA 1WG8A 3I4FA 2Q7DA 4QTYA 1G98A 1NUTA 5ISMA 4L28A 2CCKA 5LZ7A 5KVSA 4MKXA 1C14A 4OK5A 5F1OA 1J8VA 2NGRA 2K5UA 2P4UA 3WNVA 3AMVA 4BP1A 3DAHA 4DDHA 3KYBA 1SHZA 1YC2A 3MELA 1FUKA 4CDGA 4D7AA 2JGKA 6PFKA 2SCUB 4ZZ3A 2QM7A 3QGMA 1XXHA 1KZ9A 1TJ7A 2DPXA 1I4OA 2WY2D 2ZSBA 1G5HA 2PWBA 4LXYA 5HIAA 3Q3GE 3S7TA 5KKCA 2DUWA 1DHRA 2QM3A 2ZJFA 3GGOA 3GLTA 3I64A 4HDMB 1A8QA 4HJXA 5L53A 1WDWB 1SA0B 4P31A 1CY2A 3E58A 5EIWA 1E5TA 1T1JA 4Z54A 3UK0A 1U8TA 4JUCA 1XVLA 4ERXA 2CLMB 3BJIC 4Q03A 3TBFA 1EUZA 4KAJA 4MZXA 4RMHA 4D9NA 1T0IA 4RTJA 4OI0A 4R8VA 3BZWA 2C3YA 5CG2A 2W0SA 4Z3KA 1YBHA 4HX9A 4MJ7A 4WBNA 3X1YA 5B30A 1DEKA 3NXSA 3H1GA 3G2MA 1G17A 2UU9B 1IH8A 3PC3A 4FBLA 4U9IS 2EJWA 2P91A 2ZKIA 4L9RA 4MWDA 1X1AA 4E14A 4ZI7A 3TLXA 2AEFA 4LJLA 3FPJA 3MRTA 1KH2A 3HYNA 3U62A 3EG9B 1JDSA 1RCFA 1SJ9A 3ETDA 4DZRA 2J5KA 3P4YA 3KKEA 3C6YA 3QVTA 5TVGA 4D4KA 1E2EA 3OZTA 1RXVA 3EGXA 3GAZA 2B4YA 1TYBE 4ITRC 4GUAA 4H3VA 1YTUA 1MFPA 4C20A 1QQ6A 1JQEA 2AXNA 5KO2A 4BQFA 2JIRA 2O3JA 3U3JA 1OU4A 1TT5B 2CNKA 4MGHA 4C6HA 4DLRA 1V0JA 2IHTA 2PXHA 4WCDA 3TQFA 4BFZA 5C18A 5LJLA 4D4GA 3BMNA 4MV8A 2FU5C 1YDHA 4AZVA 2VF7A 2B4AA 4N0EA 2PKWA 2XYHA 5IRCD 4Q02A 1RJFA 4YB8A 1QAMA 2ZIWB 3KR2A 5G41A 4YDQA 3J81A 1IHOA 2XE7A 3F4KA 2YV5A 3N86A 4XDZA 2PH5A 4QNMA 3AM4A 5FNVB 4BVLA 1R4NA 3EXHC 5DTEA 1UJ5A 4IV0A 4WQMA 4RQAA 5BSHA 2OCIA 4BHTA 2R11A 3PXEA 4TYQA 1Z12A 3L04A 4QJBA 5T3UA 3WS7A 3W5DA 1N2ZA 3V4FA 5JNSA 1J1ZA 3QKIA 5HDBB 3VV2A 3FVVA 4CKBB 2VJDA 2J9GA 3MBOA 3VPFA 3HQ4O 3TQSA 2PMEA 1G4HA 4Y6SA 2HK9A 1Y1KE 3FLMA 3M3PA 5LCXA 5BMVA 3MT9A 5JXWA 2HXGA 5AW7A 2ZKLA 1BNCA 2Q5OA 5DM0A 1QTQA 4JOBA 4MKGA 1MT0A 3TDNA 1OXSC 3PV0A 4JVOA 4EF4A 2R00A 1IN7A 3RF6A 2XDWA 3MTDA 4H31A 3FBGA 2W9XA 4IZOA 4ND1A 3JZAA 5TB5A 3NAZA 5JCPA 4EJSC 2OV4A 3D6VA 3K20A 1NUHA 2F9LA 5A9SB 4I4TA 1HL3A 2AXEA 5ER6A 5F7JA 2VQFB 3EIUA 2B5OA 3LDHA 2A9VA 2CCJA 2VDNB 1NVGA 1A0OA 4QDOA 1Y5RA 3JZDA 1D0VA 4N3AA 2COUA 1YUBA 3KZOA 4YIKA 3ZXUB 3N7AA 1USUA 1DCNA 4EECA 3L6DA 4OLBA 1RLIA 4H2DA 2YWDA 1N5KA 4M38A 3LQ2A 5GV8A 4RVOA 2VXYA 5FNZA 1E3TA 1SO8A 3M3HA 2NYUA 3DQQA 4FC6A 4RPCA 5DLEA 1T3SA 2CNDA 2V7TA 4FQ5A 4QPJC 4UMFA 3TEMA 3I83A 4PO3X 3J80A 4I5FA 5DYTA 4ZODA 4DG5A 3P94A 2IYRA 3LA8A 2B9EA 3B5IA 2VNHA 5L4NA 3U60B 3EY4A 4NNPA 3S8MA 3W5VA 3MUNA 5E6RA 5EJ8A 3AVWA 1KBOA 3HI4A 1E0DA 1IY1A 1QCZA 3KPVA 3OETA 4NCIA 3TUIC 1IDOA 1UZUA 4Q93A 4L16A 1M2OB 3BGSA 1CZUA 1KXZA 3S3TA 2UZIR 2F3RA 4II3A 4QU9A 1MJGA 3LBIA 2HRZA 1Z5VA 1C30A 2I3BA 5CW1A 5EP4A 3ZLTA 3SBDA 4RMJA 4Q1CA 4D96A 3SNHA 1JQLB 1DE0A 2QM8A 3HNPA 1GU7A 1XEWY 1VA4A 1G8SA 1P7CA 1ZGJA 1LQUA 2FETA 2XVXA 2Z2XA 3U40A 3W77A 2REOA 4E88A 4KE8A 4YP0A 4C08A 5K4GA 3VR2A 2ICAA 3EVTA 2R6AA 4Q3DA 4BVFA 4NXMB 4BB5A 1E0KA 1R2QA 2CHFA 3AF6A 1EPUA 3B82A 3REOA 1G21E 3U09A 1W88B 2FRVA 2PS9A 1FTSA 3K9LA 4Q4JA 5AKHA 2A0FA 4Z9FA 2C9MA 2WR8A 4U7PB 1T8SA 1WEKA 4X7MA 4HAZA 4JLPA 1Q77A 1B93A 5EHNA 2D7DA 2VUTA 1NM5A 3A3YA 3BREA 3QLUC 2XSZA 5KREA 3C39A 1V39A 1H4QA 3AUYA 1L5MA 4MWBA 4XPZA 5DM60 1HE8B 4JT9A 1AZTA 2QBYB 3EEFA 3CZMA 4YRRA 5B55A 2R6CA 1LLCA 1NQUA 3G79A 4Y9DA 1O6BA 1G63A 4ON9A 2C77A 2FJPA 1BQ4A 3TD9A 1TAQA 1ORHA 2AG0A 3IPAA 1IE3A 2H1RA 3KJNA 1K6JA 5LN1A 3I28A 3KAKA 2ZT5A 2OSVA 1Y9EA 2VLIA 1UINA 3U16A 3D4LA 3PCTA 3OU2A 2EATA 4MULA 1JZSA 3V2IA 4IDOA 2VDWA 3IDAA 1QFMA 2L19A 4MVJM 1XIVA 4OFZA 1KVSA 3OQOA 2VA9A 1TZBA 1XZBA 2ZR8A 3WWZA 1QVAA 3E9MA 3SP1A 3RYHB 4ZARA 3B3FA 5J2UA 1OXBB 4X65B 3HCDA 4KO3S 5DYYA 4DQ0A 3PHJA 5AVRA 4TMZA 5CT8A 2H5LA 4GM4A 3LQQA 1BWPA 2I2BA 2RHMA 2YNMA 4PC2A 4E5SA 3ZHYA 4ARBA 3O1JC 5DBEX 4IGIA 2X7HA 4JBHA 3RS0A 2JRLA 1N1GA 2B94A 3LIPA 2GSWA 2ZRHA 4MS1B 5LQAA 1RAAA 1GG8A 4HEA6 3GLGE 5KOJA 1PD1A 2X76A 4R84A 1SVSA 3RJMA 5BV1A 1I2AA 2HNKA 3U4GA 1UOOA 3R0IA 2O50A 5JADA 1YBMA 2LPMA 2YV4A 3D8TA 5BN4B 3PHBE 1APBA 1T5HX 1JJIA 1NQAO 4ND7A 1QIKA 4K1XA 4OO3A 5GQSA 3TZ6A 3EBPA 4EKNB 4J0GA 4CEHB 3BK2A 2CN1A 3G7NA 4NBVA 4S2UA 3UH1A 2XWSA 4A26A 1VL1A 4R16A 2R86A 1QKIA 3A10A 3B1WA 3LT2A 4JBWA 4TWIA 3KQOA 5D51S 4ZU3A 4BNYA 3GLIA 1UT6A 3IHLA 1N9KA 3KCNA 1BX1A 3ML1A 5BY2A 5ICCA 1HC7A 3M9LA 1Y98A 3G2QA 3I2JA 1CJMA 2A86A 4Q4HB 1P1BA 4U6QA 3OVMA 3KTDA 2M6LA 2QRZA 4GLBA 3DKKA 1SKYB 2XIQA 4X95A 2E1PA 3BKXA 3LL4A 4YJGB 3ZW9A 4ZU6X 1MO5A 1TKBA 4ZCRA 5IZCA 1AUVA 3EIHA 2YWGA 3OPQA 4JYZA 1I6KA 2ZYHA 2D4HA 5BURA 4BGDA 3NMUF 3ZXSA 2B69A 5F9MA 2WZCA 1FYVA 4AICA 1E1CB 1AKNA 1ZL0A 3PUHA 3RK1A 3UXEA 4EEXA 3JR7A 4K87A 3BAZA 1JIUA 4MUXA 2WT9A 1EVEA 3RSHA 1GDHA 4RX1A 2NXNA 1ZXLA 4WLNA 3TQHA 4BZQA 2HQSA 1G4AE 3RT1A 1KMHA 2V7PA 5E7JA 3GLFB 3CZPA 3LV8A 2JCXA 2XEXA 1LCIA 4GLOA 5TPWB 3CBQA 1KU0A 3LGXA 4CMIB 4CFYA 1FUYB 5EP1A 2A1IA 4GWKA 4N7JA 2OP1A 1ESEA 2R7AA 2WJIA 4Z9XA 3RRMA 5U4XA 3UC5A 1RKVA 4EL0A 3F4TA 3KHKA 4I1UA 3CG4A 3PLRA 1BGWA 3JARB 1EFHA 1D4OA 4JEMA 3IL2A 2JGIA 3KT8A 1QCYA 3WSVA 3DKVA 4PLCA 1RLTA 2BRUC 2VATA 2WYIA 3M6XA 4PM4A 2EQAA 2PS3A 1JYSA 1XA3A 3D7NA 3QFRA 4P7FA 1I3MA 4B4WA 1CZKA 1AKUA 3BTUA 4RCZA 5HF9A 4R2KA 5HNKA 1SZPA 3CNQS 2H1OA 1ABEA 1GQSA 2NOAA 4FNMA 3GMDA 4C0QC 1GU1A 5GADl 4GKAA 4MUBA 3UA3A 2D6FA 5IYZB 4U7TB 4W7SA 1IMOA 1FEZA 1UJ6A 3D9QX 4Z1MD 4IAOA 3ANLA 5H8WA 4ZYUA 1NW4A 4L8YA 3RO7A 1HDEA 2VQSA 3ADPA 1LV8A 1V3TA 3I4LA 1K0FA 621PA 1DZIA 4QEZA 2GJ4A 2HHAA 3Q3IA 1UFRA 1JR4A 3HB1A 3LY5A 1GIAA 4NZYA 4PZ9A 5EPOA 3X2SA 1XZ8A 1AZLA 2DTXA 3DE7X 3HDTA 1HYBA 3K4PA 3SQLA 4MVJA 4UMDA 4ENTA 5IJ9A 1W1WA 2XXJA 3IQGX 4IR7A 4AMGA 4YAUA 3OIWA 1E64A 2QUZA 2DVMA 3ENNA 1MMFB 2CYCA 3TXXA 5DLYA 3LFUA 1FJXA 1YFKA 3NVDA 4HDOB 1TYDE 1ITZA 5E4JA 2PO7A 2V55B 3AJDA 3H1FA 3VO9A 1KPHA 2PD4A 2Z83A 3AIMA 2PFMA 3Q4GA 4EG6A 1ZR4A 3PQEA 3TIGA 3TOXA 1Z6PA 1XU4A 3OM1A 4DRXB 4OP2A 2P9GA 4J7UA 3WHIA 4YAIA 4LTNA 3M34A 4NSLA 2Z9CA 4DV2B 3LXRA 1GLNA 1NX6A 1EQUA 3W8NA 5KAPA 3DW3X 2JGJA 5I3ZA 2D2IA 2NVUA 2OGUA 2Z9DA 3NHYA 3NUGA 4H77A 1YZNA 3BGIA 2XUQA 3KR1A 4AXXA 5B3KA 2IPOA 3R9WA 3EOAI 1W4RA 3GT0A 5U4QA 4BATA 4EVSA 3DV0A 2BFBB 1RYNA 2E48A 5COAA 1X7WA 1WW8A 3KKNA 1H1TA 3E81A 4URZR 3ZCVA 3K71B 3HKBA 2JFXA 1G5QA 4Q15A 4YJDA 5K0FA 4AULA 4D8YA 5JVDA 3HJRA 1U7XA 3E48A 1XNHA 3NAMA 3R9XB 1V3QE 3O2JA 4L4ZA 4XUEA 1Z0ZA 5KJCA 1FPQA 3VKVA 1T2CA 3VAZA 2J0VA 4HAUA 3UK2A 1PTJC 2OXIA 4C4PA 5IVDA 1VB3A 4BFUA 2QYHA 3GRFA 1NE2A 4C43A 1GCOA 2A3RA 2RK3A 1TQDA 1I6LA 1QHYA 1YA4A 4W5HA 5UKDA 3WAKA 4BMYA 2XCIA 1N3LA 5JG7A 1PQYA 4F2WA 4DZTA 1Q14A 1S3FA 3HA5A 5E3IA 1WZUA 3Q12A 1LS1A 1JEDA 4H4EA 6ADHA 1U9IA 4U00A 2H4ZA 1W44A 2O8FA 2BGUA 4CW7A 2GN1A 2C1ZA 1BXGB 3PNPA 2QROA 4BLWA 4R8MA 1JFVA 1BS2A 2RHCA 4JKOA 2JJ1A 2FV8A 4HDQB 3L1VA 5HKLA 1Q84A 5IMBA 1CE8B 3ZBQA 3P2YA 4EZIA 5JAHA 4C2UA 1A71A 3WKDA 3JZIA 1IFXA 2C9ZA 3GZJA 5COQA 1CUGA 2QZ9A 3FFWA 2CV2A 3WL3A 5AJWA 3N8HA 3WGQA 3D2BA 3LA6A 2WFLA 4UUQA 4UTPA 4C76A 4EARA 1RPTA 1S8OA 1DKLA 1O94C 2CK3D 2HWUA 4FLFA 2AH5A 2VWHA 4YASA 4G36A 3E3LA 1NBHA 4IDNA 3LDGA 3IAUA 1PSWA 3HL4A 3VM6A 3P5SA 2WWIA 4E13A 2JF0A 2VOJA 1WCYA 4QOFA 2P9EA 3T7DA 5IBCA 2GPWA 2DB3A 1DKOA 1K06A 3I8XA 1GTRA 4TTSA 1XRRA 5I7VA 1CV2A 2FWBA 4L3WA 4F3YA 1OT3A 4CG0A 4UM9D 1DJOA 2QAGC 2W00A 1CUSA 1KKLA 3OEWA 4BAUA 5FPKA 1VKNA 4ZVRA 4H3SA 3W6PA 3K9GA 4NMMA 2ZRJA 1DTEA 3HFSA 5FPHA 3F4LA 3BH0A 2WTAA 4YWJA 1K62A 3OJLA 5B1DA 1AC5A 3FNGA 4P8RA 1UIRA 4MJLA 4XXHA 1YZVA 3COZA 4NNJA 2HT1A 1N34B 1VBKA 2ZCUA 3OZBA 4YROA 4Q7LA 5HS6A 3N2LA 4IUCS 4P4GA 1KU6A 3EARA 1WV0A 2DETA 1U2DC 2XTMA 2B98A 1DDGA 2BONA 4KFSA 4EKEA 2IPMA 3KZMA 5JZSA 4GOOD 1M1XB 3HBLA 2HQOA 2D1YA 3KZXA 1ONPA 2BWJA 3TJZA 4P35A 2DR0A 4EX7A 2H6EA 3IILA 2G1KA 3PIIA 4CFZA 1T13A 2O8EA 1AF4A 1CUBA 1XKXA 2LV8A 1AV7A 1IAQA 1E2IA 4YA6A 1YJCA 4FZ3A 1U99A 3NC4A 4PHCA 3F67A 4DQVA 2DCUA 2GEJA 1VSQA 3UA4A 3EDRA 1E1RA 3E05A 3AVOA 3S99A 1UH5A 4TTRA 2P1RA 4CQJA 3MCTA 5CLLA 5E1OA 1R4MB 2D1QA 2YW9A 1Z6ZA 5K3OA 1ZI8A 3CF4A 1JU4A 1MJ5A 4LNHA 1FSFA 3G8CA 3P71T 4O4HB 3LWBA 4AN0A 3KJEA 4LHXA 3PDHA 3ZIUA 3QP9A 3C3WA 2HQBA 3PUZA 4C6TA 4NE2A 5K20A 2Z4RA 3C1UA 1NN0A 4MRAA 5ELLA 1MQAA 4MB6A 1QVRA 3DE4X 4BNIA 1L5SA 3KE8A 4YT5A 2J0QA 1N92A 2PZGA 5IF3A 4JVMA 3ANNA 3IJEB 3T5GA 1X7GA 4P2GA 5A0VA 2RDMA 1IJKA 1IN6A 2OO5C 2ZBDA 3DDUA 2I80A 2J6BA 3KAPA 3LP8A 3Q5GA 1JU9A 1KNXA 3A6LA 4GS5A 4GGPA 4KQKA 5G0UA 3SSNA 1FRNA 3OKAA 1F4LA 3FUVA 2P5SA 1MLDA 1MAWA 2VNIA 4FC7A 2L69A 3K8ZA 4INOA 2PDAA 4L08A 4L6IA 2ZATA 5DBFA 3KV3O 4RVUA 3SIXA 1T1GA 2PWPA 4B75A 1UQUA 5FTJA 1OFIA 3MHTA 1LPAB 4UE3S 2Y1CA 1RI4A 4YMHA 4F3RA 2EERA 2QP3A 2ZUDA 2XQJA 5AHWA 5JNLA 2YHUA 4TMYA 4DJJA 5F1YA 4EG0A 1G2OA 2DKOA 1WZEA 2PUHA 4I14A 1NE7A 4LZNA 3CZRA 2FMUA 3VBEA 1X7XB 4XR9A 4BE4A 2DLNA 2AT1A 2WOJA 4FFBA 3TFWA 1IZ8A 2R2GA 2ZRGA 3KR0A 1I36A 4YDSA 5E8RA 4MEJA 2X8WA 3CSDA 3LWDA 4RD3A 3P9SA 3TM4A 1PGQA 3E70C 4YCLA 1FZQA 2IK8A 3IE1A 4F21A 4DLUA 1C5KA 1WBJB 4A8JB 5JAOA 2ZLBA 5E6SB 4C7JA 2A4KA 1FFXA 4J0EA 4DLTA 3FOBA 3L41A 3X1DA 2Q6LA 2HUPA 4LBZA 4BMVA 4DY6A 1DLIA 3G0CA 2IKQA 2LE0A 1U8ZA 4BDTA 4C3OB 4O4LB 3FTPA 4I7EA 2NNLD 1RQLA 3LYLA 3WQBA 5LDHA 2I3ZA 5D8DA 2AJ8A 4CLRB 3WAJA 3M1LA 4DLYA 2AYYA 4AJOA 2D06A 5BNWA 2LTAA 3VDMA 4LE2A 2QB5A 1IUKA 3B12A 4Y30A 2QTVB 1H23A 1OI7A 2G76A 1R37A 2HXYA 2YWEA 1WP4A 5ESRA 4KW7A 4DNOA 3DB2A 4UHFA 2D5IA 4IMRA 2MINB 5JT1A 5KTTA 4G5XA 4DEYA 1JDNA 3LX8A 4E5DA 2N1MA 3BH7A 1CU1A 5LP6A 2VF2A 3SVTA 2EWMA 2OCYC 3HMKA 1NY5A 3SFTA 4MMYB 2IHBA 2XYRA 1DJNA 4DEXA 3ZEAA 5EI5A 4HNAB 5ESDA 3KTAB 3MMZA 2DGDA 4MS3B 3ELYA 1C50A 4Z86A 3WGVA 2QJOA 3R3ZA 2HFJA 4DVJA 2Z9BA 4H08A 3PEWA 1EFKA 2Q28A 1RKBA 2DY1A 5AW6A 4FGLA 1TJ3A 4I1PA 4RTQA 3AOEA 1RQNA 3LX5A 3MUEA 1KDZA 4DMCA 4KBGA 3R3YA 2KBEA 2C54A 4BEVA 5K8LA 3V3TA 2NYRA 1W52X 2FPXA 3ROZA 4BQPA 4H4DA 2P5YA 4A8PA 4LJ8A 3GRPA 4ZYTA 4EG7A 1CQIA 2AW3A 2C5SA 5EZ6B 5JMOA 2TYSB 1NYLA 4WV3A 2EIXA 1OF1A 1TJ5A 5IP5A 1A69A 2BFDB 5C3UA 3E7DA 4YRGA 5CFRA 2EFHB 2IE0A 2VT2A 4TVKA 3FB4A 4Y67A 4M1EA 4Z9AA 4D8WA 3DFUA 3GN2A 1FJHA 1SBHA 4IIJA 4DKJA 2B1GA 2FP4B 4Q00A 3SXUB 4XTCS 5A3RA 2OY0A 2YXNA 2PGLA 3TRJA 1MORA 1FOEB 3M83A 5KX5A 1TQHA 1P17A 1IHYA 5A3VA 2QAJA 2ILTA 3M49A 3MSXA 2RE8A 5T7BA 3FFAA 1PR5A 3VNSA 5BQ3A 3NJ4A 4IICA 4F6RA 2PX6A 2FSFA 3AP1A 4J0DA 2BFCA 2QPAA 5GONB 1GV1A 4FFSA 5FNVF 3IP5A 1R5JA 2VJMB 2DWPA 3BL6A 4I08A 5BN3A 3T9CA 1E1NA 2YOGA 4M7WA 3BGOS 1NL3A 5JYCA 4QDKA 3D7LA 2I9PA 4QBHA 3ZQJA 1EUQA 5CU7A 1DARA 2J7KA 2C98A 2NSDA 1KARA 5GJCA 3W6NA 2R1VB 3W8RA 2CBXA 3FI9A 3R0QA 4NYMQ 3AFGA 2EDCA 3OHSX 2DKNA 1QF7A 1UOQA 1P7WA 5EJIA 4GLLA 3I30X 4MUGA 5H80A 5ALKA 5HHTA 4ZT5A 4M0CA 1RSZA 2HPZA 2IFTA 5SICE 3DP9A 2O8DB 5LZ8A 3DDZX 1OFVA 4Y1RB 1M1UA 3PTAA 2ZJZA 4ATNA 4IQ4A 2OHIA 1U0JA 2ZB3A 3WWEA 5FWXB 4LHYA 4NBTA 4XWKA 3WADA 3M33A 1R50A 1K89A 1E61A 4XQ0A 2LKCA 2G6TA 4X91A 1O4WA 4PHGA 1Z6AA 1XVVA 1ZRHA 2R60A 3PEVA 4M4SA 2XYPA 4P34A 3VC2A 3VO8A 4DF3A 2FJ0A 4P0QB 2PEYA 4L5IA 3L9XA 4FBGA 2B2XA 4PLVA 3O8BA 2P9HA 1WMEA 3ZV7A 3GFVA 2CY0A 2GKOA 3TZLA 3ES9A 4BLPA 2W6ZA 1XMOB 1N6LA 1ATZA 1X7HA 2IDKA 3H4VA 4LV5B 4NEGA 5AO9A 5CDFA 4BNLA 4EPYA 2BSQA 3HB4X 4HYQA 1Z9BA 1I5RA 4WN3A 3SS9X 4ZHQF 2P69A 1MG0A 1P1RA 2DSNA 4CE6A 4H3HB 3DGFC 4MQEB 2FSUA 4TQGA 3I6QA 3WYNA 1PJ4A 4LRSB 1YK1A 2C2MA 1TF7A 1UR5A 1U0SY 3LE8A 4LNUB 1OX6A 3C7KA 1JR2A 4QD3A 1BFUA 2UUBB 1JNYA 2B37A 5TQJA 2GBIA 1T0PA 4TKUB 1CJSA 1O9HA 3KUXA 3WGGA 3EW7A 4XB6B 1TXGA 2AX4A 2AI1A 3FMFA 3L1HA 2XVAA 4FMPA 1K7CA 1CVRA 3LF2A 3PDJA 1I3KA 1QDUA 1L1EA 2Y3IA 3FMPB 5DT9A 4ZT3A 5BUSA 3SIWA 3DMFA 1JLKA 1AS2A 1JAXA 3MRSA 5I8ZA 3G7SA 4GKBA 3F6EX 3MJSA 3IUJA 4KIGA 5HW2A 1P7VA 3K5WA 3W6ZA 3QOWA 1HT3A 3DLTA 3LCVB 3O3MB 4B6QA 3A1SA 4Z0TA 2PX3A 1Q1AA 5K7SA 4OU4A 3IRUA 2PR7A 1L7MA 1O6GA 1ZUNA 4JLOA 4ZD6A 4AZ0A 3LQYA 3A4LA 2QMZA 3JQAD 3LRPA 1QBKC 4EHNA 2IZ7A 1EZZA 2O23A 5EQFA 3A9RA 1MGPA 3C45A 1E6KA 4MNTA 1E1MA 1VHTA 5A1JA 4FYVA 3BDVA 4IDHA 5ITZA 1F8GA 1IU9A 1IUPA 2DBQA 5G3YA 3M5CA 1YS2X 3FRJA 2C94A 5JQGF 4PNPA 3CRMA 1GTL1 4LE0A 1ZK3A 3GLIE 2FG6C 2HREA 4AY6A 1NWHA 1R8QA 1RRGA 2O2IA 4QRHA 4DE5A 3DE2X 4PLWA 4F72A 5CA1A 3CRNA 1T1EA 1SKMA 4KIFA 1N8KA 2P67A 2UDPA 4ECEA 4QKQA 3EC7A 2JA1A 4UAVA 3A4NA 4CM1A 1DXOA 3DMNA 1ZH8A 1KZYC 1MDBA 3BIJA 3JU3A 4WWHA 1CD5A 1CY7A 1JHMA 1W85A 3SJ7A 4YQZA 2OXTA 2XRZA 3WIBA 3RV3A 1F20A 1BWRA 1L4BA 2WWXA 3DW1X 3DYVA 1X7ZB 2XWPA 3PWZA 3QWFA 4JR0A 4KXLA 4L1KA 4MV9A 4K2AA 2JARA 3BE8A 3SHQA 2GBPA 3H5IA 4BNDB 1OSNA 3FKSA 2C59A 1RXIA 3ZTYA 3VBCA 3WV5A 3A6HA 4DLSA 1W87A 3WSTA 2QXYA 3CRW1 4ZT4A 3GH3A 3KKLA 2R85A 4CMBA 3EDOA 5H59A 7REQA 1E1LA 1ZKMA 4H7FA 1BAPA 4RORA 2QORA 5FV7A 1AUQA 5DNUA 5JO0A 1LZLA 2X8AA 3OIGA 4C4RA 1MT3A 3ZDQA 1YV9A 2PZBA 3I5AA 1Z0AA 3JSAA 4ND4A 1DIHA 1WXHA 2QKYA 3AU9A 1REQB 1NYTA 1NGSA 3ZGZA 1JDBC 4Q3AA 4KBFA 1XWOA 1ZIXA 2ZDGA 2J0EA 4WFJA 4C4AA 2ECOA 2CJWB 5BSWA 4AJPA 4R98A 4QAQA 4S35A 4HFRA 2JKYA 5HKAA 1Q3HA 1P18A 3GAFA 2HQRA 3PHHA 4YAWA 1IN5A 1XPJA 5FIUA 3EAQA 2WUFA 1D4FA 2F1KA 3NT5A 2G4VA 2A0XA 4F7WA 5EHQA 1R0WA 1NBMA 1Y9JA 3GFBA 4JYMA 4MUHA 2E3JA 1OBFO 5KYKA 2R0QC 1BW9B 2HCJB 3IQEA 3H83A 4QE3A 3VH3A 3INYA 1RI5A 2FR1A 3DLIA 4QJ4A 3OZEA 4PFSA 2WAXA 2C9CA 2FF5A 4O4JB 4RJJA 3DTTA 4WE3A 3GARA 5CM8B 1E94E 4LKOA 3BSFA 1D2AA 1SVMA 4Q5IA 2QW0X 2GD0A 4RZUA 3W7AA 3S1AB 2F8TA 3T4PA 1WU8A 1M6NA 2VN8A 1G3RA 3R7AA 1DAGA 3T52A 5A2GA 4QATA 1SM4A 4JQYA 2XT6A 1YR7A 1NLYA 1OI3A 2A7XA 1IXZA 1WHTB 3VC1A 4MVJE 3T38A 1WNFA 2C2ZA 2LWIA 1W0JA 3NWJA 3I6ZA 1PE0A 4OAQA 3SS7X 3UYKA 3I1JA 5KJFA 2JJMA 3O4GA 2QQFA 3R5HA 2WWYA 4CTMA 4ZK6A 4D9KA 3FPCA 3PPXA 2TRSB 1GUDA 1P0MA 1F3LA 3HCWA 1GRVA 3JYPA 3W9YA 5KNCD 4RF4A 4A0QA 4F38A 2NO5A 1HI9A 4WLOA 5HF6A 3N5KA 4RD0A 1UC4B 3OFVA 5CXUA 3UBTA 4FCVA 2LRHA 2XRFA 3E0QA 4KSYA 2JD1A 1L7PA 5HUHA 2EDAA 2C88A 4XPIB 1PNRA 4HVLA 1X8JA 4HZGA 7ADHA 4KFTA 2IY8A 3TNJA 4BCCA 2ZTHA 3QIAA 2J9FB 4I1YA 4C7XA 1ZCFA 1GCIA 1I33A 2QRNA 3ESQA 1DC5A 3H99A 3LHDA 4YMLA 5K8JB 3CR3C 1RVDA 3RIYA 2O7NA 3AK4A 4IH9A 3GT7A 1TO6A 3RYFA 4J0CA 1JR3A 3WKBA 4WOPA 2RH9B 5FUWA 1FNMA 3IEVA 2VAWA 5K8IA 4HEQA 4LJSA 1CEEA 2H11A 3HZOA 3H9UA 5C4IA 4CF6A 3R6TA 3VOTA 1PYOA 2Q3HA 3BC1A 1CP2A 2O3QA 2VJCA 2ZUEA 1Y3AA 1OYOA 1OX4A 1YK0A 4TTTS 1V35A 3RM3A 5IFKA 2RAPA 2X0JA 5K3BA 3U3XA 3CZ4A 5KYTA 1J2JA 3C1OA 3GH1A 4IBOA 3ZDRA 1R16A 2ZBEA 2C78A 3OZRA 3TZEA 1AG9A 2BCEA 4EYSA 5IYZF 5BW8A 5CBPA 1JAYA 3C3JA 2ZB4A 3HWSA 5I47A 3DCJA 3FPAA 1YOBA 2ORYA 1A9TA 3TGPA 1TGVA 2HY7A 3F9CA 1N8SA 2HLNA 2HZ7A 2YY7A 3NORA 5JBNA 1DKRA 2UV8A 3QK7A 1QXSA 5J59A 1D2NA 4JHLA 2DUUA 1T4BA 3OFSA 2NWQA 4KXQA 4UEJA 3RK4A 2QTTA 5D6NA 1NUQA 1GYPA 2J7PA 1E3EA 1P2GA 2Q4BA 3F5QA 3WLPA 1CR0A 2BKEA 1TUBB 4BL5A 5ALUA 1DXYA 1KQPA 1DSSG 4ESHA 1EAMA 2WEKA 3OAAA 3T3PB 1S7CA 5FO0A 5IVKA 3EA4A 4RNDB 1HYHA 1T0BA 2XE4A 3K32A 4QNNA 5T57A 3ST7A 3DH0A 2QZ4A 2HJVA 4GPIB 2BH2A 1EDBA 1MQ9A 1L7DA 1QOPB 3QI7A 5LQNA 2I4MA 3ADOA 1LJUA 3RC9A 4YJ2A 3K09A 4LA4A 4A1FA 4BZXA 1PL7A 3UAOA 3TLBA 2YHIB 1TYCA 4HOYA 3NCTA 2XYQA 4NEQA 1E6WA 1PNVA 3EA0A 2NT4A 3L7YA 4FT4A 4ZQBA 5T8KC 3TSZA 5K03A 1U2RA 3M81A 4LIPD 3VDXA 1VSUA 4PG5A 4UU8A 3W3AD 3D6UA 3M89A 3BQNB 3PNLA 2H5EA 1Y8QB 1KKMA 3VHRA 5DHAA 4BNVA 1WL8A 4NZMA 2HJSA 3CEMA 4ZV7A 4CCYA 2IQIA 3JD2A 4D56A 2VCEA 1CRLA 3EZXA 4XB2A 1Z28A 4AROA 5JMWA 1YIAA 2DWQA 1KI6A 3RKSA 4GVLA 3E7FA 1BA3A 4CKCB 1OXTA 4MW4A 2IUEA 4RMNA 3RVPA 3SBEA 4DCNA 2IV7A 3AY0A 4RHFA 2LBPA 4KSBA 4RADA 4QC2A 2VT6A 1NZFA 5ERYA 3THWB 4N12A 3EUFA 2Q99A 4QYSA 1HTWA 1GKKA 3NS7A 1P3DA 3CRVA 2HWYA 2H4FA 1G7SA 3LUAA 4FJ1A 5KTSA 2ZYVX 2HT6A 4G8CA 1CCWA 3OOSA 3ZQUA 3JQGB 4K6CA 4J4BA 2OHJA 4XI9A 1LFAA 2IU6A 4TXJA 5AHXA 4D9MA 1WW3A 1TTHA 3COSA 3T9FA 4EG3A 2O5RA 5F9HA 3I3OA 3Q0IA 4WNAA 2X86A 3DL4A 2Z5GA 4PFKA 3KJHA 4TXLA 1X1CA 1ZYUA 2WKQA 1F1BA 4KMSA 5G40A 4D9BA 1CNFA 4HUTA 4ZYLA 5HRCA 2P9CA 2ZYDA 4EUEA 1NZJA 3ZDCA 1Z6GA 1U3DA 2GARA 3HV2A 4J7CA 4Q9IA 3BERA 4QPPA 4PO1A 1B6SA 5AM4A 5IC5A 2WI8A 1YRLA 2C5EA 4DA9A 2WK1A 4KN5A 2GPSA 1O96B 4LC9A 1L5KA 3MTJA 3W7VA 4BMXA 4DR7B 4N03A 4WXPA 1ADYA 4P82A 1TO1E 1ZSVA 5IHXA 4ZVNA 4GYJA 1DBWA 3PQCA 3K35A 3EXG2 4UUBA 3V33A 4O4IA 2C84A 1GPAA 2NPOA 3G0BA 2QD3A 3HN6A 1Y6JA 2BGKA 1USGA 5E6UA 2C58A 2W4MA 4D8UA 5AXDA 3PQ3A 4RV9A 1XEXB 3FBTA 4JC8A 3RUDA 3UTDA 4B45A 5JASA 3I01M 3UWOA 4XDYA 1NW5A 2GEFA 2PSJA 3PQ6A 4XJXA 5F3DA 3HYCA 3VR1A 3DM9B 1VLQA 4A5OA 1WCWA 2J3EA 4C30A 2BELA 4NICA 5B2FA 4RA6A 3R40A 4B2LA 2NTJA 4LFCB 3RYHA 4LXIA 1TVKA 1MX5A 1G3UA 1G0OA 1B26A 3IQXA 4HNGA 5E7IA 4EG4A 5CDHA 4J7AA 3OQPA 2OTCA 4OSOA 4QVKA 1CLEA 3EAFA 5TV2A 3RARA 1UQRA 3ZVRA 3ZJVA 4AC9A 3IOMA 3A2NA 2VHXA 1KSHA 2Z8ZA 3IB3A 1E32A 5IFLA 1L8AA 2OMEA 2I8AA 2XRYA 3FYCA 4WL0A 4M36A 3WLJA 1VE3A 4TL7A 1NHWA 3MGKA 2J33A 4C88A 4TYNA 1O0CA 1XDGA 4TT8A 3TCKA 1SCDA 2VYVD 1N2IA 3BA1A 2ID4A 2DTEA 3KPYA 3BEDA 4OMDA 5DM1A 1H8EA 1K66A 2FEXA 1Y9AA 3PENA 3V32A 2B8TA 3RIHA 2XBMA 1YJAA 1NJ2A 4U7HA 4P9NA 2X6RA 2Z8YA 1NKTA 3N6VA 3UTCA 2SKDA 3IVXA 3N70A 1W29A 4MKIA 2FR0A 421PA 3PUWA 1XPUA 4RHUA 2EKLA 1TX4B 2F9FA 2ABWA 2ZYSA 3GG9A 4K5QA 1WSAA 3QKUA 3HJCA 1OKKD 3TRHA 2W2NA 4C3UA 2UYCA 1BU8A 1RRFA 5KVVA 4P4SA 4DIUA 1RJGA 3G8YA 5ICMA 4LRWA 5BWNA 5T5QA 5KSYA 5KYWA 3R2JA 3L4BC 3ETGA 4YHHB 3COJA 4TXMA 2QZSA 1T4CB 4LHWA 4BZWA 5LOVA 3UICA 5FBKA 1KORA 3QKWA 4FDVA 1QR6A 3C3XA 5KTRA 1OAOA 4U5QA 3O1HB 3UOAB 1AUXA 2GCNA 3NC1C 3NIWA 4H1UA 4KXWA 1N75A 3VYWA 1POWA 1I4TD 2V6MA 4JQOA 3EXFA 3H75A 4M9ZA 2GPNA 3FZQA 4BGIA 1JLSA 2CGEA 4G1EB 4GBGA 4MSUA 4YAGA 3GYBA 3LFHA 4KSCA 2XIJA 1WXQA 2XAAA 4KYIB 3EK2A 4HQ6A 3E7XA 1LK7A 2QVLA 4FT2A 1XX6A 3Q8LA 1K88A 3P97A 1FP4B 3JAWB 4BFYA 4M7PA 4IEIA 4PX2A 4RCVA 4B6RA 2JGEA 4IW3B 4TWJA 4CI0B 1FLDA 4TS4A 3AGQA 1L5GB 5CLJA 4PR0A 1RAIA 2J9RA 3W5JA 3W8FA 1LBQA 3K1ZA 4LYFA 4RTOA 4Y98A 4AS3A 2ZRLA 1J56A 1E5DA 1H1LA 4IV8A 3A3PA 5K3FB 3TZKA 2P9YA 4Y1EA 3DOJA 3RRBA 2UYGA 3T9EA 2LNDA 1EGQA 3K6KA 3WNBA 3HCEA 1MJHA 4KZPA 4PC6A 3E3OA 5ARDA 3L77A 2BEUA 1EVIA 2A9OA 5I7FA 1MDFA 1QQ5A 1ZNWA 3QJ5A 3A6PC 2GTIA 4ZREA 4YX9A 1ZIDA 2I55A 5AJXA 2FFJA 1QP4A 2D0DA 4FZVA 5K51A 1U4OA 1X0VA 4Y6OA 3JYLA 3UMFA 2IYFA 4HQFA 5ARCA 3ZOZA 1BMQA 1H9BA 1MEJA 1PP4A 3WK5A 2RI1A 1TCUA 3A6GA 4B6GA 4F91B 1ZOPA 4DYHA 3UJPA 3PGXA 1JFRA 1KQOA 1SCBA 1WO8A 4PBRA 4O2LA 3TECE 2NUAB 1BIFA 1D1TA 4JFRA 4BDSA 3JVVA 1NLMA 4BRZA 4CIBA 8ADHA 2OO7A 3I62A 2J48A 4NWIA 1OH6A 1NF3A 1E6EA 4AZ3A 2WJHA 3GD7A 2VRCD 1QTRA 1V8DA 2HBQA 4G9BA 4IUDS 5IARA 3VKWA 1KY2A 1T9GS 4DQKA 3O8QB 2C4UA 2RB4A 3B3JA 3DKIA 3ESCA 3I01A 3DL0A 4OQPA 4O0LA 1Z6QA 4NG5A 1VLZA 2OB1A 2P6UA 5I01A 3P26A 1FPMA 3EXHA 4URHA 1E0JA 3VJMA 5IMSA 2OM2A 4JI0B 2VHWA 3KU1A 1FJGB 1XDSA 4W5NA 2NZ8A 1RMYA 3RKRA 4E4TA 3GGGA 1GPH1 5HR5A 3C3BA 5DYNA 2W6IA 2VPIA 1JSXA 3PXUA 4JUBA 2IXDA 1ZXXA 1I7LA 3H9BA 3GOHA 3SICE 2ANCA 3OZSA 3D7MA 1CQJB 1FMJA 4IUBS 3VDRA 1W88A 1KXJA 4HLUC 2OZPA 3IDSA 4X8MA 2W6JD 2CDAA 1D6JA 1FYEA 2I33A 3EIOA 5A7HA 1ORRA 2BUCA 1HT0A 4HC4A 4J6FA 4EHLA 3KT6A 4DLWA 5HOEA 3EGWA 1NQOA 2QVYX 5L7TA 1ATIA 3A1TA 5LBTA 1LSOA 2ZI4A 2QP9X 4DYVA 4L4RA 4M76B 3ZK7A 3D7KA 4JL5A 2PZKA 2IHYA 4YC7A 4AUKA 4L8WB 3OQ6A 3ICCA 4JU9A 3AH8A 4IUYA 5FEMA 1U16A 3OD5A 2FPPA 2ZIXB 3Q11A 2QNBA 1M67A 1YE5A 2W98A 2NADA 2BSAA 3GDFA 3QEMA 1EP2B 1J00A 1RWOA 2PGNA 1O6CA 2CB0A 2J4CA 2XTZA 3DG9A 3K96A 2DECA 4BJHB 2ZTVA 1GPUA 3EY9A 4OYRA 4AKIA 1I2BA 1KERA 1LTKA 1PNTA 1VM6A 2BJWA 4M53A 4F06A 4CQMB 5IXSA 3EXEA 4RJIA 4W5RA 4AJKA 3G5TA 2ZI6A 3OPYI 3U9LA 2PTSA 3K3PA 4KNYA 1TB4A 1Z0DA 1N5IA 4V38A 2GPBA 1XJ5A 2PMFA 2J32A 3C15C 3DVAA 3MBKA 4GI3A 4RYLA 4EHDA 2EQBA 3V80A 3I53A 4J7XA 4QODA 2C2YA 3HRKA 4NBUA 2IELA 2GB4A 5KPJA 5KWJA 4FFOA 3F4SA 1RHQA 4H6PA 5CDSA 3UV7A 3R6DA 3OCFA 5I8PA 2PV7A 4B0OA 4LF6B 4X8LA 3SJZA 3UWKA 1TJPB 4E09A 2WABA 1HZZA 2WSSD 3N6XA 1CUJA 4LKRA 2II6A 1SVKA 2WD9A 3LW8A 5AHOA 5KYYB 5CVUA 2LIVA 3T3MB 4F4HA 1Q44A 3ZBUA 1KH3A 4YP9A 5AUQA 5JIBA 3SYRA 1I7SB 1ECGA 2D7CA 4HUQB 3F6BX 2DQKA 2WDPA 4KL8S 4PRLA 4IHAA 1BX3A 1TYEB 5LDGA 3SYMA 3TW8B 4DA6A 1B14A 5AHRA 3O83A 5AK5A 2XMCA 1I24A 1NR7A 1WMSA 2P5TB 1C4KA 4WMLA 4APBA 2KI5A 2QN3A 3LJKA 3JAKA 2QRLA 4DM3A 3A1CA 3M6VA 4U7GA 2DT5A 1Q20A 1I32A 1AQYA 1ZISA 2ZYWX 4YAJA 1DRVA 3NX4A 4OXQA 4MQUA 1RMTA 3QLUA 2R44A 4HWOA 3ZK9A 4DUYB 1TJ4A 4ZYXA 1C81A 1YUNA 1YR8A 1XJCA 4PCLA 4W1RA 3ONNA 3MXOA 5KUTA 4ZPJA 3USZA 1F2UB 3GJXC 4L0MA 2QJWA 5CHEA 4EO7A 4PW0A 3OQ1A 2WWVD 4F46A 10MHA 4JP1A 1KPIA 3KZKA 4GWLA 1VFNA 3QY0A 4Z1MA 4MVCA 2IOHA 1ZN2A 2OZLA 2H1IA 3KXKA 3RFCA 3ILVA 3EBOA 3TBKA 1AS0A 3DT9A 4A91A 3IQHX 3BMOA 4E4YA 4EO9A 1J5XA 5DRTA 3BF7A 3HP4A 2IIPA 3LVFO 4Z6KA 4M7OA 5THQA 1N2SA 2PGAA 3DWFA 4MVYA 4MWGA 3TIIA 4TLCA 4JK3A 4YFYA 4JYAB 3VSCA 1XF1A 1MF7A 1DC4A 3TKLA 1WPGA 4DLVA 4QARA 4RQTA 1YS1X 1U6JA 4B44A 1JFSA 2IOQA 1SXJC 4DA8A 2PZ8A 2EP8A 4NL4H 4QBTA 3QF4A 3SHTA 3AG6A 4CL8A 5A5DA 3TQQA 4D9IA 1NBME 1RTTA 2C7OA 3JQ7B 1SZJG 4YJHB 2GZHA 3U7IA 2R47A 5DTJA 2YWRA 4KUHA 1E7SA 1R0YA 2VHTA 4DQDA 4P7JA 3L1IA 1YZGA 4KITB 3ASYA 4REMA 2R97A 5DH9A 1G7CA 2G5CA 5JPCA 1OBHA 1L5LA 2Y76A 2P9TA 1O9GA 1YQEA 2BI8A 4OXYA 3O4JA 6CHYA 1M1YB 5TSDA 1QF6A 1PZGA 1ODFA 2BOVA 2OAGA 3CE9A 4RULA 3CW2A 3ROKA 5LBIA 1U6KA 2NNWB 5IZ4A 3NNDA 4IMPA 1OHHD 1SIBE 2VDJA 1BE1A 2X8JB 2Y9PB 3Q9SA 4ZCLA 3S7ZA 5K4HA 1VCOA 5AKYA 1R0SA 1EIZA 2V7GA 4FR0A 2IYQA 4FI3F 4D0RA 1E9AA 4FNGA 3OLQA 3SJBA 1YRYE 4R2MA 3AR7A 3SZGA 3KJQA 4FONA 5C4MA 1DCKA 2MU1A 4J16C 1DCTA 3T0GA 5GINE 1OLXA 3MCVA 13PKA 1H94A 3AETB 5KNCH 5H9VA 1R10A 1CS0A 1AO0A 4B76A 1UBHS 4UQOA 3SFZA 2H17A 1NYQA 1UXGA 3CW9A 3FAKA 2OFWA 2E5FA 4MCAA 4R2JA 1BTOA 2FFHA 1Z07A 1RC1A 1DV1A 2E4AA 4NBWA 5KWSA 4YACA 2OV6A 2X9VA 2OK7A 3GBPA 3LAWA 4DRXA 3PFFA 1GXSB 5E1MA 1PCXA 3O2NA 4X1YB 1W49A 5JRZA 1NT4A 4IL5A 4DMMA 1JR3E 4KDCA 2GXQA 4TVSA 5KWEA 5LC1A 4ESEA 4RPLA 1A27A 5JS2A 1GVHA 4BB6A 1GM5A 1SKQA 1H6CA 5IKPA 4QYIB 2BGLA 5NLLA 2HQ1A 1PQPA 1DU4A 2ANBA 2VJAA 4URFA 4DXAA 1YZHA 3DDOA 5MGNA 3DAOA 3K0FA 2VBFA 1VQ1A 1OXXK 4XOUA 1U2TA 2JBWA 3L01A 2OV8A 2R8PA 3ZHXA 1A8UA 1A72A 2OYCA 2BRUA 3DSRA 4NPHA 1WPRA 2BEVB 1Y8AA 1GGEA 1QR2A 2H48A 3H0KA 2LP4Y 4UJ5A 1PJCA 4UTOA 3D8SA 3H5WA 5H68A 4BGVA 2JRCA 2FUCA 1QC5B 1UT8A 3PRYA 4PSCA 1R0CA 3CVVA 2UAGA 5EG5A 5HUQA 1XZMA 3GJTA 3AW8A 4F4IA 2JCSA 1P5HA 4MQ5A 2A0YA 3GLVA 4JB8A 1FCJA 3PDIA 1Z2OX 3PPIA 4MPJA 2V6IA 3P9IA 1Z2NX 4IHJA 5E4YA 4UPEA 4QZVA 2P3LA 1KGDA 3ZY6A 3D43A 2BH9A 3B89A 3PR3A 1L1FA 3CWZA 4BX2A 3Q15C 3Q1KA 2OXRA 1R18A 2QR2A 4MUAA 4X00A 3UVEA 1UBTS 4UQPA 5HQTA 4JJEA 3MF4A 3ND8A 3UCEA 4PZ0A 3VHXB 1UBCA 4J49A 3NU1A 1JTEA 4ZIRA 2JIDA 1C3LA 2P2DA 1XJWA 3ROQA 3EYWA 2OLKA 4LBWA 4MUJA 3UUFA 1M7BA 2H9AA 5I7HA 5JZBA 1PFVA 3QKRA 4AP9A 1H9AA 3O91A 2NU6B 3LNTA 4OP1A 4FFRA 4FJ2A 4EPTA 4NCJA 2IVZA 3O9MA 1Q16A 1OB5A 1FQOA 1SXJD 3PNKA 2I76A 4Y2PA 5CTAA 3ZZMA 2E5WA 1JIKA 3GCXA 1R4AA 4NTZA 3H97A 2QPOA 4N39A 2PL5A 3ZLBA 3A1EA 5I9LA 1Y8RB 3P9XA 4R5HA 1MNAA 1ZOSA 3COPA 3DTVD 2AC4A 4ZV9A 1FJ2A 1NDUA 5F3RA 1FUOA 3QENA 1UDWA 3TPZA 8LDHA 2X22A 3V55A 3HUEA 1TCBA 1ZN9A 2MSNA 3M6MD 4Q3EA 5EIEA 4ZHSA 4PQFA 2IIBA 2JFHA 1RWWA 1D0SA 2OR3A 5ALOA 2V7XA 3OQMA 4XGKA 3PHGA 3K1JA 4NDNE 5SZKB 4CIVA 4BNXA 1PKEA 4D41A 4E31A 5EJ9A 5KTOA 1M6YA 1XVAA 2PX8A 4TMXA 5LZ5A 4UOZA 4P38A 4V3BA 1YMQA 4NQRA 4DC0A 4DR1B 3FMVA 4JELA 3UG7A 2V3CC 2HN9A 1BFDA 4LGCA 3X1JA 3NTQA 2DBZA 2P30A 3GUYA 3H2GA 3DOEA 4X1KB 3UMVA 4YK7A 4R83A 3ZCXA 3FFBA 4HXEB 2XYGA 5ALTA 1EUDA 1N3YA 2ZTMA 4G4GA 4RPKA 1RZVA 3L84A 1OR8A 3DBVO 3ED5A 4GWGA 4QREA 2ZK7A 1U5BB 3IELA 3ZGNA 1JAHA 2Z1MA 3G9XA 3EZGA 2PS0A 3FWHA 4IOKA 4LYAA 3A6KA 2EQ5A 4Y9SA 1IWOA 5I9NA 5LQUA 3M1IA 1UPCA 3B9PA 5KC9A 2A94A 4ALLA 1SG0A 4H9GA 5IKEA 1LPOA 1VHWA 1GILA 1DG1G 1HDYA 2Q5EA 3G9ZA 1FSZA 3KPWA 3LQ1A 4EB3A 1JYEA 1UBSB 1N9GB 1NNI1 1QH0A 3BDIA 5D1HA 1MAVA 4G4JA 5H4GA 5K5EA 3WE7A 1O5OA 3KEQA 3V1TC 3Q8XB 1FQWA 1T4DA 5AH0A 1ZMBA 1B1CA 2ZW9A 1MB4A 2QPTA 3JWGA 1JZQA 3THXB 2ENWA 2I8LA 5I7EA 4BZZA 5EE0A 2X1MA 3ZU5A 5KWIA 3K0HA 3E3NA 3RUFA 2GRUA 4M8NE 1L4EA 3T1NA 3P20A 2GS9A 4E3WA 3K2IA 4KQIA 2PUCA 2JZCA 3UXMA 2GO7A 2EFDB 5KNLA 2VPXA 5FAXA 1GG5A 4D4LA 1U8CB 4W5TA 4I5EA 1NJ6A 1YZLA 3PSAA 5C35A 1GLVA 1A9QA 2OWEA 3NC0C 1QRTA 4D0NA 4QLBA 2MSDB 2JLVA 1KAHA 2B5WA 1LB1B 2I6UA 5CVEA 5FXMA 4P1ZA 2EKDA 4Q9DA 3VZCA 3SLRA 1JA1A 4XD7D 1DFHA 2ZJ6A 1Z18A 5BYJA 4L57A 2EHJA 3LYUA 2IU4A 2PRYA 3PUKA 5DTRA 1NXWA 2QU8A 1IB6A 1IPFA 4ZGGA 4QGGA 2B8EA 1Z62A 1JJAA 2NTYC 3O0DA 1SU4A 1H5NA 4ZQHA 4WI1A 3RAPR 2W2XA 1UMDB 3D4IA 4EW1A 1RIFA 2FDRA 4G8JA 2CVOA 1L7RA 5F35A 4KUEA 4RD4A 4HTFB 3C1AA 3U3KA 1I10A 2DOKA 3ZQKA 5FWAA 4TT3A 4YRKA 5KMGA 4D02A 3P19A 1DHTA 3IEMA 3CUSA 2GAFA 4B3TB 1QMGA 3WG9A 4MAFA 2UYQA 2PRSA 1J39A 3HO1A 2D8MA 1C8KA 1GGJA 1OFUA 4MRMA 2OVFA 2J85A 1T9AA 5DCWA 1WXGA 2H63A 4PWZA 5E0OA 5CYGA 3I5YA 4HGRA 3WGHA 4PYKA 4RJKA 3ABIA 4WCFC 2QN8A 5A3QA 2FCAA 2IYEA 2YXPX 4H7KA 5HFJA 1PFYA 2XDQB 4HPWA 1ONOA 1ZM7A 2HLHA 1YAHA 5EWJB 3ROPA 4EF5A 2HHHB 1W94A 1V5GA 2F3UA 4RKQA 5KJ6A 1IM2A 1CWUA 1PR1A 1GHTA 1GRCA 2FPKA 3OZDA 2IXEA 3UY4A 2AUTA 2QUHA 3CNEA 2BM8A 1NLUA 3FOWA 2NN3C 2C4NA 2JIOA 2WPNA 3K8YA 2OBMA 4FD2A 4H16A 5EQDA 2CLFB 1PBTA 5CH3A 1PT8A 2CL7X 2J6HA 2ZJBA 2HA2A 4I9GA 1D2CA 3QE2A 3OCXA 4Q7JB 1OUMA 4L5JA 2XECA 1KS9A 5C5EA 5IASA 1XBTA 5TIIA 1OTYA 2Z2KA 1MXHA 1J8FA 1PUIA 1JAIA 1I5EA 4OSPA 1X7DA 1UF9A 4ZXFA 4C0LA 3G6WA 4B2YA 4TLEA 5K0JA 4HQRA 221PA 3P9NA 2EL9A 5K2MA 3O21A 3LLMA 2JC3A 2V9ZA 3GLUA 2I1QA 4MUEA 2IU3A 5E2IA 3PFIA 4PYRA 2VWQA 1KK3A 3T8YA 4X62B 1FFCA 3WLIA 5DVZA 2PVSA 2PJRA 3LCUA 4JEHA 1WW2A 2F9MA 2GZDA 4FMDF 5AOVA 5BQOA 1Z0IA 5AR1A 3SXJA 3QNWA 4OGFA 4HDKB 3ZVKA 1T9BA 2FP4A 3TE7A 1A88A 1W5SA 2ENUA 4GOXA 4U63A 1PJZA 2X4DA 4BO2A 1XROA 4AKHA 1H3FA 4REQB 1R9MA 4PSUA 2NXEA 3AHIA 4TQUS 1I7QB 5TR9A 3AXSA 3CB2A 2YQ4A 3DWGA 4TSKA 2W37A 4KEAA 4FGWA 3L0IB 4ILEA 3G2KA 5FH9A 5K3AA 3HDYA 2PA3A 4ZICA 1N3BA 4WKOA 1QE3A 4FDTA 2QS9A 2H00A 1H3EA 1LLFA 2V7QD 3GCDA 3B48A 3DXZA 3NTOA 4I5IA 1Q57A 3HYRA 5F4ZA 2J31A 4J75A 4V3CA 1ZGBA 3EHDA 1SXPA 1C1HA 5I9IA 1UMCA 2IYYA 4B4VA 2G82A 3C6ZA 4BO4A 1WD5A 3S2ZA 2FHPA 4IIVA 4DV4B 5MDHA 3W6OA 2YMQA 5BVGA 1YU6A 4W8HA 1SG6A 1CRPA 1GR0A 1DIRA 3C7DB 3F9IA 3NP9A 5IJWA 4FEYA 1Z56C 2PAAA 2O8DA 5EIOA 1Y6RA 2PX4A 4OJYA 5G2OA 1PR9A 2AJTA 4X41A 2FGJA 2XNHA 2JVKA 4UVEA 3JQAA 3SVZA 1TZ2A 2JGMA 4XRGA 3VFDA 1NF9A 1F4PA 3IP8A 2Q7XA 2XMSA 1JXQA 1AK1A 2WM9B 3RFXA 1U4SA 1XRNA 3DONA 3Q87B 1T5OA 3W5UA 1YE8A 3HGTA 4CV0A 2UXBB 2GFQA 4NOJA 4AU1A 1EAYA 1V43A 2H7XA 1CDZA 4WNCA 4RS3A 1Z33A 5LQDA 1QVVA 1E63A 2H92A 4CGYA 3PDWA 3QX7A 1SVOA 1L6RA 2ZRQA 4TWBA 1VBNA 1IY2A 2PKQP 5A2QA 4RF2A 3JW8A 3JQPA 3ZE7A 1CZRA 1BXKA 1E2GA 1RI2A 2NX2A 2HF8A 2CKMA 1J0XO 2B34A 2R4UA 3E61A 4KWTA 3PTZA 1E2LA 1NMEA 1H8HD 1SU7A 3ZJYA 1Z22A 1UDBA 3OMLA 2QRKA 2ZBRA 3OE4A 4OP3A 3MWDB 5HP4A 3QBPA 2V6FA 1QG2A 2FRDA 4TKUA 2PEZA 2R1TB 4G07A 4BFLA 2Z5LA 2CLIB 3KQLA 1M72A 4E6EA 3U56A 2JB9A 4ZRMA 2IT1A 2B83A 3JWPA 1FQKA 2Q21A 2AK3A 2JBAB 2RC5A 4DQUA 4I0WB 2HDOA 2WLTA 2VZ9A 3NBXX 5B1YA 5EMMA 1VG8A 3VR3A 4YV7A 1VDKA 3DJFA 5C7OO 1SHTX 1DAPA 2CLKB 4G41A 1XVTA 1XLTC 2P35A 2VUSA 4LSWA 5BN5B 4AMZA 5A7FA 5A5GA 1MB0A 3S8YA 2ORWA 3VZQA 3PLNA 3NNNA 4K9DA 2JGAA 3RVRA 5AM3A 1F48A 1GA4A 1TM1E 1I0IA 1WX1A 3RRXA 2OUKA 3COVA 3V7FA 4L0DA 1I3CA 3IT1A 1DAFA 5CDGA 4HNSA 1PVOA 2F3QA 1RABA 2BY4A 1ABBA 4ZEWA 4Y9UA 1U7HA 2ZSHA 1DAMA 4B46A 4EFNA 2PR2A 3OOYA 4JUIA 3RWMB 2EZ4A 3EX7C 3SEZA 4Y1GA 1ESDA 3EF1A 3ESAA 2V6BA 3N2KA 4YR7A 4K26A 5BR8B 2HYIC 4WLUA 1S2IA 5ALDA 1E3LA 2AFIE 2P7HA 2Z30A 3AR8A 3PKZA 1P4AA 3FCAA 2C82A 3GJ0A 1QWOA 4TMTA 4YPFA 2OSBA 4PTYA 5GZ6A 3IJ5A 4ER7A 1SQ6A 2I99A 5IVIA 4XIJA 1GCGA 1O5TA 5C7LO 2IOFK 3HYLA 4YDHB 4Z7NB 2Y1LA 4RD6A 4RPHA 4INAA 4KODA 2BD0A 1PR0A 3T4UA 3WOVA 4NU0A 4IXDA 5D3ZA 2HHJA 1SQ0A 2PZLA 2RGYA 5AI5A 4RVDA 2JFYA 1I0AA 4RKWA 4REOA 1TOAA 5BW6B 3OFKA 1XRMA 2M9MA 1MFZA 1OZ0A 2VR1A 3TB6A 3JAMA 3BQMB 4G09A 4YXFA 4TV8B 4XB1A 4RANA 3LKVA 1JLRA 4A8JC 1P5ZB 1Y5MA 4M22A 3CGWA 4LPSA 4GICA 4BP9A 4C2TA 4ZKEA 5EESA 1O54A 1E3QA 3FDFA 3SHVA 2XH8A 8AT1A 1RWKA 1M6VA 3E3AA 3IVRA 2VPQA 4YMIA 1T5SA 1HT2E 3FYTA 4O5AA 2ODWA 4HNTA 4TYYA 4OREX 4PAOA 4RIFA 2GHTA 1PSDA 1JEQB 5KNCA 1G8JA 3B9QA 4V0ME 2XNKA 1KE1A 1CF4A 3PRKE 4YUZA 4WDQA 4F5ZA 4FS3A 1USKA 2F90A 5HA5A 2ALJA 3L7OA 3RVJA 5T64A 3WL4A 1NRXA 3FPHA 4GC9A 3OKFA 1POXA 2UVQA 2CHUA 1MUUA 5DFAA 3KEFA 4M1SA 4QFDA 4BBPA 5JQWA 1ONSA 2CJWA 2WHYA 4GRIA 5ALGA 2IYPA 5IT5A 3K8QA 4BQSA 3SBOA 1QPZA 2BGMA 2XX3A 1E2FA 1NOKA 3H9JA 1VJCA 4RACA 4G0PA 2QDKA 1E2BA 1VHQA 2J3QA 3OOEA 1MH1A 3KYIB 1NRIA 1I2ZA 3TXYA 4ZZ1A 1LBIA 2ZDHA 4U6SA 1OWPA 3P9QA 3K70D 2F1RA 1LEHA 2O8CB 5ESWA 3VPGA 2D1FA 1ZMOA 2P6PA 3NETA 4HGYA 4C01A 4DSZA 1HWYA 3BD6A 1B3RA 3QVSA 1LDMA 3H5VA 1O0BA 2ZWAA 3I9FA 4FFNA 1L5HB 3E2IA 1XQWA 3GRAA 4QBIA 4YALA 1T35A 3DEIA 2MTBA 3UV6A 1NW9B 1IQ0A 3CTMA 1K1EA 2HO5A 1EWKA 5DCUA 4G1UC 2CE2X 4PAMA 4NAVA 2AX3A 2JDID 3GEIA 3HRHA 4MRSA 4PCAA 5KPDA 1P2DA 1DL5A 1XZNA 4EUKA 1I9CA 2XZDA 3VR4H 3VVBA 2H1CA 5IH7A 1HE1C 5JRDS 3MXTA 3QXGA 3S2SA 3BCUA 2GFHA 5DYWA 2F8LA 2RKBA 2HF9A 2R68A 2XITA 4GE3A 4IQ0A 2I6SA 5DNCA 1DIGA 1KE2A 1EVZA 3IT0A 1Q0QA 2O1EA 1N6KA 2X5NA 1NN3A 1Z26A 4NJEA 4Z51A 4HAXA 2B0JA 2PT7A 2REQA 1ESMA 1XLUA 3MJFA 3MUOA 4M37A 4EJFA 4B43A 1P81A 2BLNA 3ZDDA 1SUFA 1XELA 2NXCA 1Y6QA 1EWTA 4YRNA 1GNTA 4HN9A 2N3ZA 4KJXA 2OM6A 4PSVA 4N48A 4TL9A 4D42A 2ZAGA 4E2FA 3CWCA 2ODBA 3SLKA 3ADCA 4FFPA 4ESOA 1ZJZA 4FGUA 4LC0A 4C06A 1WPQA 3WLSA 5CLFA 1J21A 2BUAA 5EE9A 2HYDA 1QAOA 2XOXA 3GUVA 4EJMA 2H8GA 4QOHA 3KZVA 1WP9A 2O2JA 4DDWA 1ECJA 1WWKA 3BSSA 3LY8A 4G89A 4TROA 4UATA 5F1KA 4UDNA 4I6JA 2G5PA 4L7QA 2IF2A 4MW1A 1U1FA 1UBRS 1WXFA 1ZP6A 1NDHA 2Y71A 4TV9B 1XTRA 1NXTA 3ZCTA 1GO2A 3TQTA 2ZE8A 1HEIA 4WKGA 4MS4B 1V6SA 5BUCA 2G7MC 4BUZA 3EZ6A 2YN0A