1Z4LA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with thymidine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4lA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4lA01
3IB6A 4UMVA 5AW2A 1CQZA 3AR9A 3WGUA 2YJ4A 4UMDA 2B82A 4QJBA 5AK5A 5FP0A 4B6JA 2B1RA 3U13A 1L8OA 5AW7A 1WR8A 5ALJA 1RDFA 2FUCA 5AKXA 2I6XA 3DNPA 3DDHA 3AR6A 1L7NA 2FPXA 1SWWA 3F9RA 4FFDA 1L7OA 1YV9A 4I9FA 4GIBA 3ET4A 3ESQA 3ESRA 3EWIA 3QNMA 2HO4A 4UMEA 1RLTA 3UMGA 4CNQA 2RBKA 3N28A 2BDUA 1SWVA 3QU9A 3NALA 3QUTA 1WZCA 2RB5A 3ED5A 2WF5A 4UM5A 2IYEA 2MU1A 4OD0A 4ZEWA 3E81A 2YMLA 1Q91A 4UASA 1U02A 2AGVA 2EATA 3GYGA 5AW1A 5AK4A 3E84A 4DWOA 3K1ZA 1Z4JA 3W5BA 1RLMA 2FPUA 4C4SA 3B9RA 3M1YA 4HGPA 3WKDA 2YY6A 4UU0A 4YIHA 2HI0A 4NV0A 4UATA 1Z88A 1VJRA 2I33A 3MN1A 3WKEA 5IT0A 2FDRA 2B1QA 3EPRA 2G07A 1RQLA 2G0AA 2RAVA 5AKZA 3PCTA 5ALGA 4XQ0A 3L0YA 3L7YA 1NF2A 3L8GA 2X4DA 2JAWA 3PGVA 2AH5A 2G08A 4L6CA 2R8XA 1QQ6A 3MPOA 3WK7A 1L7PA 3SMVA 5AKYA 4HGRA 3MC1A 2I34A 3AR2A 5ALQA 3ZI4A 4ZEXA 2FI1A 2Q4TA 2PR7A 3KC2A 2ZBDA 2GFHA 1MH9A 3BA6A 5ALEA 2CN1A 4YCLA 5AKHA 4DCCA 3U19A 5AW5A 2P69A 5AVZA 1YS9A 2G1AA 5ALNA 3DAOA 1N9KA 1YJ5A 2JARA 2ZBGA 5ALKA 4BNDA 4BX3A 3SHQA 4C4RA 2YFYA 2O9JA 2YJ5A 4UAVA 3NUQA 2C8LA 1U7PA 1RMQA 2RARA 2ZBEA 1XVIA 4CF5A 5ALHA 2IOHA 3QGMA 3A1CA 5AM3A 4IG4A 1RMYA 3UMBA 4DFDA 1F5SA 1O08A 5AVQA 1X42A 4YCNA 3U7FB 1VJ5A 2R8YA 4HGQA 3ZWDA 1TJ5A 1QYIA 3B8EA 3FM9A 4G9BA 3QUCA 3WKCA 1J8DA 1ZRNA 5ALIA 3VAYA 5AVSA 2WF6A 1Z4KA 2IOFK 1Z4OA 4O8CA 4UARA 3A3YA 1YMQA 1ZJJA 1L7MA 2YBDA 1NNLA 3L1VA 2R8EA 5AI8A 3WK8A 2OYCA 4L57A 4BX2A 5AVTA 3CNHA 3N8GA 3ZVLA 1KYTA 1K1EA 2EARA 4KX3A 3KZXA 5AKIA 5ALRA 1EK1A 3DV9A 3FPSA 3QUQA 2CFSA 1T5SA 4UW9A 2FPRA 4BYGA 2YMMA 3ZWKA 5AW9A 2FUEA 2B30A 1FEZA 5IS2A 3L0BA 5ALWA 2VKQA 3OPXA 3B9BA 4FYPA 4Y2TA 3S6JA 4EEKA 5AW3A 3OCWA 3QLEA 5AI0A 2NO5A 2G09A 4HGOA 2MSNA 4CF3A 3SF0A 1T5TA 4AS2A 2NO4A 3AR7A 5JJBA 4OCZA 4NFLA 5AW8A 2HCFA 3W5AA 4BEVA 3L0CA 4Y2XA 5AI6A 4BEWA 4UMFA 3NRJA 5AM1A 2FPWA 1RKQA 4Y2QA 2YJ6A 3QU4A 2EAUA 4GXTA 1Z4PX 5AI9A 5AVXA 3U7GA 2HDOA 1LTQA 1Z4MA 1U2TA 2W11A 2B8EA 4RETA 5AHXA 1RC8A 2P9JA 3ZVMA 4JB3A 3U7HB 3NAMA 5ALOA 3ZX4A 5ALLA 5A3RA 3QU7A 3HYCA 3QYPA 2ZBFA 1S8OA 3FZQA 3N1UA 2QYHA 3KOOA 1YDFA 2O2XA 2I55A 3U7EB 3ZW7A 2C8KA 3I1YA 3AR4A 2DQSA 5A3QA 3PGLA 4Y2JA 3D6JA 2D2VA 2HHLA 3E58A 3EF1A 2I54A 3QX7A 3OCVA 3KBBA 4AP9A 1T9ZA 4NWIA 2OA0A 2YJ3A 2G80A 5ALFA 1RPZA 1AQ6A 3EF0A 3BWVA 4XPZA 4YGYA 1N8NA 1CR6A 2C9MA 2HSZA 3NANA 4NAVA 2I7DA 4MWOA 2WM8A 4E88A 3ZVNA 3AR5A 4UAUA 1QQ5A 5AM4A 2PKEA 4OFZA 5AVVA 2HOQA 4Y2UA 4YH1A 2WFAA 3A1DA 5AM2A 2G06A 4XE5A 1ZOLA 4C4TA 4PNHA 5AW6A 4L6AA 3FGOA 4EELA 3ZUPA 2FPSA 2GMWA 3KD3A 3ONNA 2P27A 5AKEA 2W43A 5E0OA 3SKYA 5AW0A 3PDWA 2JAOA 4HGNA 2GO7A 4OHFA 1JUDA 1EK2A 3QU5A 1Y8AA 3P96A 4AS3A 3IJ5A 4BBJA 3QXGA 3HLTA 3U26A 3ZX5A 5ALXA 3OTQA 1ZD2P 4HYTA 3E8MA 2NYVA 3KDPA 1TE2A 3A1EA 1Q92A 5ALZA 1WVIA 4YIKA 4YCMA 1Z5GA 3SLRA 1PW5A 5AI4A 1ZD4A 2YMQA 3CZ4A 2OBBA 2WF8A 3L1UA 3I76A 1XPJA 3NASA 3WK4A 3L8EA 5ALMA 1XP5A 2P11A 2BY4A 4BNDB 4Y2RA 3FVVA 4Y3UA 1RKVA 2YMPA 1L8LA 2C4NA 4CE6A 1L6RA 1TJ3A 3UM9A 4G63A 4BX0A 4EENA 3W5CA 5ALUA 3N5KA 4Y2PA 3TLMA 1Z4IA 3WK5A 1J97A 5AKKA 2C88A 1U7OA 4Y2YA 1YNSA 2WF7A 1RKUA 4EZEA 1Z4LA 5AW4A 2JGAA 2ZG6A 5AKGA 5ALYA 5IT4A 2B8JA 4J2TA 4KNVA 4I9GA 4JDPA 3AR8A 1WPGA 5ALPA 2IA5A 3ET5A 4Y2SA 4UM7A 3UMCA 3OCYA 3WK6A 2GHTA 5AVYA 4KN8A 2PQ0A 4FE3A 5T41A 1S2OA 3MMZA 3OCXA 5AESA 3QUBA 4UU1A 4MUMA 1NRWA 2BDEA 5AIAA 5ALTA 1LVHA 2AUTA 1ZS9A 3ZTWA 3WGVA 3R9KA 3WKAA 5AKJA 2Q5EA 2ZOSA 3W5DA 3FPBA 2WHEA 3RF6A 4KX5A 3L5KA 1TA0A 2WF9A 4XOUA 3QU2A 3RFUA 1QH9A 5ALVA 1RMTA 2OM6A 3J7TA 3I28A 2YN4A 1ZD5A 4J03A 1U2SA 3ZU6A 3AR3A 2AMYA 4CF4A 2HX1A 2W4MA 4EX7A 1TJ4A 3OCUA 2HF7A 2CFTA 5AVRA 3WK9A 1ZD3A 4NABA 4F72A 1VFPA 3R4CA 3I6BA 5A3SA 5ALDA 3ZTYA 3SKXA 2B0CA 5AI5A 2ODAA 4H1WA 5AK3A 5AM0A 2QLTA 1Z4NA 1RLOA 4Y2VA 4HAIA 5AIBA 2GHQA 5AKLA 4QQFA 3OCZA 3SD7A 1QQ7A 4F71A 4EX6A 3R09A 1O03A 2Q4RA 4KNWA 1RRCA 4KYTA 5AVUA 3NIWA 2JAUA 4IFTA 3IRUA 3M9LA 1RQNA 2IOFA 5AVWA 4RESA 5AK6A 5ALSA 4ZEVA 2CFRA 4DW8A 1IWOA 2HEGA 1Z5UA 1ZRMA 2R8ZA 4BKMA 5AICA 2HF2A 5AM5A 1Z4QA 3L8HA 3WKBA 3N07A 3L8FA 2FEAA 1SU4A 2ZXEA
chains in the Genus database with same CATH superfamily
2VPIA 4DT1B 3N8NA 1NVVR 2D06A 1AZLA 3B5JA 1Q22A 1UPFA 3M2TA 1O4VA 3O82A 3CT4A 4QA9A 5KYYA 5LMCA 3E04A 2W4IA 3K9LA 4GPEA 5H9VA 1B8NA 1ST2A 2NTEA 2Y8EA 1YULA 3KZNA 3SQDA 3HYNA 3RU2A 3TVDA 3RFTA 1L8OA 1M5RA 1XB2A 4R1SA 5GINE 4DCJA 1NP6A 1IZYA 2VS1A 1HFJA 1YQQA 1T10A 2H2DA 2HJHA 3ZLBA 5HKOA 4TL6A 2XIQA 3GEDA 3O8OB 1X9HA 1KFKB 4KVAA 1XZDA 5FXMA 5JUWA 5LMZA 2H7YA 2ZIXB 1L7OA 5E2BA 4AJ9A 4JJ6A 1WY5A 3O4HA 3IFSA 4K9NA 1IBRA 6REQB 4I9FA 5BUSA 1MB2A 1O6CA 3ESZA 1TCAA 1YVRA 2HQ1A 2OV4A 5AXCA 5LKRA 2D0PB 1FRZA 1A76A 4BFUA 3BK7A 3ZBQA 4B83A 3S1AA 1P7CA 1Q2UA 3I04M 1MAHA 3Q9LA 2WR8A 1PX0A 1R8XA 4NKRA 4PYIA 5E9QA 3HJRA 3WXBA 4CEJB 4LE1A 2GILA 1J9EA 3H17A 4ZQHA 3DDNA 1Z28A 5E6UA 2PBZA 2XX3A 5FPKA 3QX3A 1KFBB 5GZ6A 5BWMA 1F3OA 4RUKA 4DLKA 3HSKA 1LNSA 3L5OA 1NR7A 2ZREA 2R60A 4WZZA 1QB8A 2YVAA 4LQLA 4QYXA 2PKQP 2IYQA 2A7QA 3R3YA 3MMXA 3EIWA 2YMLA 4M7OA 1S5PA 1YFKA 4IPTA 2Q0XA 3TKLA 4MDFA 3RROA 2XD4A 2ZIEA 3PC3A 4UVDA 3DJYA 3JYQA 4DWOA 1H93A 1T15A 1V7QA 1UFKA 2C7GA 5TF0A 4EHHA 5C7YA 4DXDA 4HH1A 2GERA 2PRKA 3HWSA 1UBCA 5EEHA 4GM0A 3PGJA 4HX2A 2W71A 1J2RA 2W5UA 4KPYA 4E4RA 2QAGC 1Y1QA 4KH0A 4LYGA 2AG6A 4UU0A 3S2YA 3CF4A 4NV0A 2HCRA 2GJKA 1E3EA 4GMKA 3UBTA 5EA2A 1ZL0A 1PWZA 4CLHA 1CJCA 3WKEA 2ZBRA 8LDHA 2NIPA 2XDQA 4AJ1A 3HVRA 2DSTA 5DNDA 3JZFA 3WX0A 1NR1A 3UMRA 4JI5B 1PI3A 3RF7A 5C31A 3ZQUA 1HDZA 5AKZA 1ZQ9A 4AKSA 5KOJB 3IBGA 1VLZA 2JHFA 2OG2A 4FHEA 1J2JA 2W2PA 4JL8A 5J2UB 1PK8A 1UKCA 2YN2A 4BY9E 4LDZA 3SDBA 3FVWA 3OE5A 1XMOB 1D9ZA 4H77A 5EE0A 1M74A 2CHUA 2G83A 2IRWA 3G13A 4EL0A 1V9CA 5B6PA 1YJQA 2NVOA 2CYCA 3WLJA 3GEIA 3GZNA 4KGZA 3RIMA 2QD3A 3KVRA 2A9RA 2QGFA 4TX1A 5IBRA 1GAWA 4KLZA 4EAQA 4IIEA 3O4IA 2QTBA 4JP5A 1WHSA 3G0OA 4KPGA 5IXJA 2Y93A 5BVGA 1YE5A 1ZEJA 3DWGA 3TYXA 3FA2A 2F64A 1CUDA 2ZBDA 1NDQA 3DV2A 4BATA 3DAGA 2BEUB 3IBSA 3L7MA 4FMBB 1IOZA 4QFBA 3U9TA 3VRHA 4EGQA 1KJYA 4B9AA 5AKHA 1EX6A 1P3DA 5IRCD 2XOEA 2LCQA 4DQ0A 5DM2A 2Y05A 3OURA 2EF0A 2CUNA 4I4IA 1L4KA 3QELA 3ZQ6A 4EMTA 5C46F 2G7MC 2I6UA 1OBCA 1W59A 4B6QA 3GN1A 3OPYI 2NT4A 3ANNA 4J9UE 1FSGA 2PZMA 1TA9A 5DV9A 2FSVA 1D4OA 4RZXA 1J9GA 3MLEA 1HORA 4JH0A 1FZTA 1MQAA 5IK2D 2VTBA 1RJ9B 2EKQA 1CUJA 2MTBA 2VJDA 2QTCA 3IP7A 3Q1KA 4H18A 1LUAA 4AWAA 1T1IA 2OO5A 4BO5A 2PJUA 3I04A 2EX4A 4AX8A 3KTAA 4WFIA 4IG4A 2GOYA 4D5EA 4FFSA 2W2LA 3NUGA 1NT2A 5DI3B 5LLSA 3UKDA 1QYRA 3QA9A 5C37A 3ZJTA 2AV6A 2P9QA 1M2OB 4KB5A 3HCWA 1X42A 4BLPA 1BWQA 2DWPA 1TKBA 2ZBUA 4QHYA 4BVFA 3OZRA 3H9BA 3L7OA 1Q95A 2XVZA 4G5QA 4NYIR 2AUMA 3GFGA 5IULC 2RONA 5EZYF 1VYTA 2IW3A 3A31A 3B8EA 3LUCA 4JLPA 3Q41A 3RUDA 2QWXA 3WKCA 4CYMA 4BJ3A 2OPHA 1G55A 3TFOA 3DGEC 1ITZA 1AURA 4PLVA 4B8WA 1R9MA 4CMEC 3F3YA 2VDOB 3AW9A 3OAAA 3NM6B 2DHQA 3GD7A 2R5WA 4U7HA 4XSHA 3OQ1A 4D9NA 3MJCA 4TN5A 3AUJB 3UUEA 2R8EA 2B94A 2OYCA 2I4RA 5A4IS 2OV8A 3KAPA 3OPQA 1B6TA 4OQLA 4QQ8A 3D31A 2XTAA 2GN0A 3U3ZA 2JAHA 1HTWA 1PK7A 2CDRA 5E4TA 3NHJA 5CFLA 4WHMA 1G3MA 1LK7A 4PZPA 2LUOA 2VAWA 1KL7A 3SS9X 3PI7A 1F17A 1DIRA 4YPOA 1LPPA 3P0EA 5EXSA 6ADHA 1KAHA 3OCJA 3FPSA 3R8XA 1XFDA 2BGKA 1JG3A 5ULLA 3LL4A 2FPRA 2P0YA 4X85A 3VAAA 3VTAA 4I55B 1VBNA 3NWJA 1QHGA 2FE4A 3RKSA 3OJCA 3PD0A 1X1EA 2YYYA 1BE6A 3OECA 4EI9A 4DG8A 1QWOA 1Q12A 5B1YA 3NBQA 3RRZA 5A7FA 4UNRA 2ORVA 1UZMA 4URHA 2ZUCA 3DOFA 1TT5A 1VPEA 1E4OA 3CF4G 5A4KA 7ADHA 3IP5A 3KVNA 1E5VA 2DHDA 3ESDA 3O47A 3P9IA 4UCWA 2OXTA 4DMUB 3HGQA 4LYAA 2C7PA 4HL6A 4K9OA 4PR0A 4JXZA 3R2JA 4NPCA 5K8VA 3SYTA 4W5OA 2A59A 4F0JA 4F4UA 2CNWD 3OJ0A 1H05A 1KYQA 3GAFA 1OH5A 2CNNA 4QD3A 1ESDA 3Q3VA 2GBIA 3DBHB 3FTNA 4S0XA 4L9RA 9ABPA 1BDHA 3HA7A 2JFOA 5IPFA 5FI5A 5H16A 3SAJA 4DR5B 3I62A 1UBFA 5F33A 3DKPA 4CUKA 4G1FA 5TX7A 2R86A 1EBUA 1ULZA 3UO8B 3SWWA 1I2CA 5B5SA 1Y3HA 2FPWA 5BWOA 5IANA 5E9AA 3P0FA 3RM3A 4WADA 2OM2A 2QQ0A 1CZLA 2YWBA 2XUPA 2P7HA 3L3BA 3NPAA 4RETA 3SI7A 2OVFA 3E3LA 3HN6A 2PV0A 4UBOA 2WQZA 2CEAA 4M83A 2EYQA 2A4KA 4BMOB 2VF8A 5H0IA 1GAQA 2WQ6A 3AUKA 1EVJA 4G37A 1ZA2A 4G8BA 1O54A 4FBGA 1CR0A 1SZJG 1Y7IA 1Y48E 1V3UA 2ETVA 4TYYA 3W3AA 1A9TA 3WP0A 2HHAA 2C4WA 2ZIZA 4DXHA 3EFOB 5HGJA 4DJAA 1H2YA 1DEAA 5DOVA 4B4OA 1Q3KA 2G8NA 1L2TA 1WUJS 2FZKA 4TOIA 421PA 4W5NA 1E2QA 3GLKA 4ND8B 5I9IA 4L74A 1AGPA 1UBHS 4J1QA 1H6CA 3T3MB 1Q19A 3BMCB 3RNOA 3F97A 5F73A 2EVWX 3A6FA 5EWJA 5JQGB 4FFBB 2ODBA 3DTVB 3LC0A 3CUKA 4C0LA 3P32A 2Y1XA 4V0ME 1DBRA 3Q3JB 4YGYA 5BMVB 5J47A 1WMSA 2DBQA 2UZ4A 2A5FA 5DLDA 4NICA 3PT9A 3RYHB 2IHNA 5JJ5A 5BVHB 4Y67A 3MYRA 4Q18A 4BP3A 3VZCA 2PKEA 5HG0A 5AVVA 3ILSA 1DZIA 1COWA 1I7PA 1VJDA 3LX4A 4ACAA 5L3VA 5I7VA 4QXRA 2XWBF 4OU4A 2DPGA 3PDCA 5BPHA 5KU1A 2GXQA 2Y71A 4LDQA 4C4TA 4AN0A 4L6AA 1L7QA 1WNFA 4O4HB 2Z30A 1QE3A 1Q57A 2KSQA 2BJWA 5IYZB 1AN9A 2H4ZA 2UVPB 3FIUA 4CR8A 1TNDA 3BJMA 2G5PA 1OTYA 1GUFA 1ZM7A 3PL1A 4B3XA 2ZZNA 1P19A 2HIHA 5HUHA 1W52X 3QFSA 4P7JA 3VHXA 3TV2A 1J2UA 3C14C 3DO5A 4DMLA 1NXSA 2FA9A 3SYLA 5GJWC 2OV1A 2YCBA 4EFDA 1UPBA 4R01A 3ERCA 2PQMA 1YZKA 1V5FA 4Y7CA 2MMGA 4ZPXA 1T2AA 1R0YA 3EXEA 1Z0AA 3BERA 3I9MA 1VIMA 3DMNA 4U7PB 1TE2A 4V0KA 2M6SA 3A6DA 4Q4LA 3KL4A 5B36A 2V74B 1FXWF 3P0RA 4B4WA 4X6UA 2JI8A 5LXTA 2XNDA 4NLEA 3L1JA 3ZDRA 3I76A 4CEIA 2CWDA 1ZOIA 3JY6A 5ALMA 1KBOA 3DR5A 4AZSA 5IKXA 3QITA 1XP5A 3OD1A 3OJLA 1Z34A 4QUEA 1Q6ZA 4X1YB 5FH9A 3CLRC 1YOVA 4WZAB 4QUHA 4KRYA 3F5FA 3KOUA 3OQVA 4GMDA 4UFNA 3VJMA 3Q40A 4CTJA 3AUTA 4EENA 3ILHA 2CLFB 2OVBA 1DC3A 1TCCA 4YFVA 4ALMA 4PQYA 3DVRX 2DHRA 1W7AA 3IJEB 3L0SA 2C96A 5C0OE 1IK6A 3OSUA 4D46A 4HCJA 3HV2A 4JUIA 4RSMA 2UUPA 2CY0A 1MHTA 1UUFA 3GT3A 4MUJA 3UWSA 4UQLA 1PQWA 2A67A 3CW9A 4PCVA 3UA3A 5CB4B 4Q7JB 3KXLA 1KP3A 4LPKA 4AYWA 5KCMA 4X94A 2JCGA 1YMVA 3BF7A 1XZBA 2WF7A 1ESNA 4UFOA 5TT1A 1DIGA 3RT7A 1KEEA 4M60A 5CLHA 4JQSA 1QFSA 5MF6A 5A4MS 1EFAA 1L8QA 1V9SA 1PO7A 1X7XA 2Z6AA 1SPXA 2IE0A 4D97A 1BEUB 2ZBQA 4UM7A 2XUIA 1C3XA 4LDRA 2HPZA 4W5TA 1AKWA 3A2KA 4Y98A 2GHTA 2HA3A 1NUHA 1KDYA 1YRHA 2HJVA 1MPXA 1DMRA 1IEWA 1ZUHA 1LQUA 2X0EA 4EA9A 5AW3A 5JXWA 4MUMA 3SEFA 3VKUA 3KFVA 1D1SA 3V4OA 4JZKA 2WKPA 2QXYA 2VYVD 2W8ZA 1NE2A 3CEAA 5HVNA 4II3A 3EIQA 2QTNA 1KFEB 4ER0A 1KBQA 4IJWA 1K6JA 4G4SO 4N3BA 4BNKA 1EKXA 3BL8A 1KVUA 3GLHA 4ND7A 4EUNA 2JK0A 3I9LA 5KSPA 4U02A 4CKWB 3MTGA 3Q3GE 2CSUA 4NHEA 1ECGA 4L16A 4XDYA 2BTQA 1YKSA 2O3TA 2JC3A 3BXGA 2FMHA 1ORTA 2JI7A 1MQ8B 2OK8A 3N2KB 4R3WA 4TGLA 3VR0A 3R9XB 3VNUA 1C7JA 2OBLA 3QF4A 4L4YA 1P5JA 1YBHA 2I3DA 3FGPA 5HDQA 5TPWA 4AY4A 5BSFA 4TQ9A 2EBUA 1JVNA 3OE1A 2QJFA 1T2CA 1G18A 2RH5A 2XZLA 5LN1A 1G3UA 1W35A 2YZMA 1JU9A 4KDFA 4B5KA 4ZIRB 2B6NA 3FRIA 5CJPA 2VQFB 2J0QA 1ZJ4A 3EXG2 1AT1A 4J1NA 5KS2A 1K92A 1WWKA 2P9ZA 1BVUA 1WO8A 1X3LA 1QF9A 2WA2A 3HEAA 2XEDA 5JH7B 4I3GA 3V1MA 3MJRA 3JQ7A 2ODAA 2AVDA 3QWFA 2NPFA 5KQSA 3IUJA 2VK1A 3EG9A 5A5EA 4TV9F 5J1SB 4FYJA 4BNLA 1W30A 1TF2A 3CSSA 3CZRA 3JWEA 4BGIA 1GIAA 2Y2UA 2XUFA 1HLFA 3OU6A 5HFAA 3T9EA 1XC7A 2Z0MA 2ZYHA 3FVTA 2C83A 2H1FA 3E9CA 3T5CA 4CIYA 1D5CA 1QIDA 3RUCA 2CCJA 2NOAA 3A7EA 3D0RA 3Q7PA 5B12A 1AUOA 1Z38A 1LPNA 4PCAA 1N3YA 3U37A 4P1ZA 5KAMA 4FU0A 5LMNB 1CUSA 1UP7A 4TMFA 4ZVOA 4B4DA 2PTSA 2DT8A 2YC2C 1BYUA 4LOHA 3NIWA 1P0MA 4YI3A 1VC2A 3M9LA 3SS7X 2PTQA 2B25A 2CNBA 3HFRA 4PLCA 2R7MA 2W6JA 5ALSA 1ADJA 1K88A 2GAIA 3TQFA 2VK4A 4JI8B 3IEVA 2QAIA 5K0ZA 4F3RA 4PPFA 1FFBA 1EAMA 3A2NA 3E3AA 5T5QA 1PYOA 1ETHA 1IZ8A 1A7KA 5F52A 2A9JA 3N6RA 4CCAA 1PR6A 1WXHA 4INPA 3ISJA 5ICFA 2VF5X 4WNAB 2VRNA 4F60A 2XXJA 3L8FA 5J2TF 5CA0B 4G0NA 4TRMA 1B15A 4Z0HO 2ACKA 1QG0A 1NG9A 2QENA 1Z0ZA 2CLHB 4IDCA 1VBMA 2GZ1A 2D74A 1PDWA 2J9RA 1XKLA 2PL5A 4EJ6A 4NJMA 1TA4A 2ZW9A 4JXXA 4M9UA 4PICA 4NR0A 3UCFA 5IEJA 1ZMXA 4BKRA 4WUVA 2FOIA 1W19A 4ND5A 4BV2A 3U16A 2GEUA 3FTPA 4BMPB 4OB6A 1MJ5A 3VR3D 2AOUA 4F45A 2IU0A 1QS0B 1U5CA 2AE1A 3HY4A 3F8WA 3LZDA 2CVHA 1H2EA 2Z2IA 4X64B 5ADWA 2MMCA 5AHKA 2YWGA 4HFJA 4KK3A 4DLAA 3HZRA 2PKQO 2PLAA 4MR8B 1JJIA 2BFAA 2GKSA 1OXXK 4KXMA 4YK7A 1X1CA 2XHZA 1UK9A 3JX9A 1D4ZA 1DAKA 4C3UA 2OENG 1U2DA 2HH9A 2IIBA 2HPAA 1LRLA 2A7XA 4WVFA 3KVYA 4YP7A 5G0UA 2RHJA 3NBXX 4LUCA 3EWIA 1NF3A 5E6SA 3B70A 1RWOA 3BIXA 4LQ4A 2ZULA 3WSWA 1V5IA 2C3YA 4JVOA 3ZE6A 4MPDA 4X7MA 5HQJA 1MP0A 1G4HA 1KQ7A 1PFWA 1T26A 2F6RA 3DSRA 3HU5A 3NYWA 4HTAA 4IXDA 5F98A 4KQXA 1G8MA 1J4AA 2W58A 4JN6B 3U6BA 1Y37A 1U0RA 3CH7A 3O8QB 4YALA 5K05A 3N74A 4V0LA 1XVTA 1Y82A 2E4WA 3CTPA 4PG7A 1XX6A 3N0RA 4ZYYA 2QVCA 2P6MA 1EE9A 3OTIA 4M88A 4RAQA 5LU9A 2COUA 3AVTA 1USVA 5K3OA 4C7BA 5F9HA 2C07A 1Q91A 4NCJA 3PHBE 3BGVA 3VC1A 5JZBA 3PFIA 1PQPA 5A6VA 4WA7A 1JPVA 4YLGA 5DYWA 4P3XA 2ZCUA 5CCBA 2GEDA 4K86A 5B1DA 2PZLA 3DQQA 3TIVA 3C4VA 3P19A 1V39A 1NUQA 1GHTA 3WL6A 1CP3A 1TRKA 2GCOA 2NM0A 2PFKA 3B9RA 3U4CA 5BYKA 1WBBA 5K0JA 4EY5A 4RD2A 1I0LA 2A1IA 5CYFA 2EW8A 2WZQA 1WCXA 3PQFA 4YR7A 3HACA 3EVEA 3ZCRA 5DLPA 3BT7A 3G2HA 3TQSA 3P0HA 4MVJM 4BPBA 3SP1A 2ZRJA 2E5FA 1WS6A 2DUJA 1RAEA 4IJ6A 4UDXX 5TQVA 4HNAA 3SR3A 3HEMA 2TS1A 4RH0A 4H4CA 4WEOA 1IWPB 1PZGA 4Z6KA 2Y1FA 5BN4B 2XWSA 3EPRA 3TF5A 1FDUA 3BRWA 2B4YA 3EMVA 1P91A 1SMKA 4MVYA 1VG8A 2CW5A 2W48A 3AF4A 4IHAA 3UA4A 5A4DA 5IVHA 4OLHA 3ZDDA 1E3DA 5G02A 2IPMA 5IMSA 1SXIA 3S5JA 1NYQA 4EFNA 5MFZA 1CY2A 1BJTA 2R4QA 5EAIA 2YN0A 4MUXA 1N9GA 4ROTA 1W85A 4O3MA 1TUIA 2HGZA 2I1QA 4MP6A 2RGAA 4L78A 4OPMA 5HE8A 1GGEA 3IELA 2AEJA 4MYTA 3F7OA 4D3DA 1NV8A 1U8AA 2VLIA 5E6RA 4OXNA 5MDHA 2VDKB 1H1TA 2OGTA 4MQUA 1PT7A 1TC2A 3FLAA 2I1VB 3M7IA 4YJ2F 5CVDA 3ZDAA 5DIZA 4ZVMA 3ICEA 1KA9H 1I5RA 1P4JA 3REGA 4F4JA 5JMPA 4QYMA 4EY3A 1RLUA 1VI2A 3GH1A 5ALNA 4OGWA 4ZT4A 1L0BA 4AO8A 1QMPA 3IP3A 3RGGA 1EFRD 2WJGA 3ACBA 1VSQA 1K7CA 5A5FA 3I2HA 3EGOA 3L4JA 1RYEA 3A10A 1QGDA 2NU7B 5IH3A 5KHAA 1SOAA 4BN0A 4EI2A 2CFCA 3MWEA 4MOWA 3QRWA 5THKA 3W2GA 4HQNA 5ERGB 4AROA 1XHEA 3DL4A 2UDPA 4DIEA 2K7ZA 1NJ5A 1M2VA 1RWPA 2RH9B 4ZK2A 4CF5A 3BWYA 2RGBA 4N3NA 3OCEA 5DNEA 4RD0A 1L7RA 2E1PA 2EP7A 3KWFA 4M53A 1KYWA 1DMSA 5TGTA 1W4LA 3W2EA 3HJFA 4YCDA 1L5LA 2R66A 3QBTA 4YLYA 2BEKA 2ASEA 4PLTA 3UK7A 4I8IA 4N4AA 3DEAA 3MG9A 1GL3A 1GR0A 1GITA 1DOZA 5K0NA 3T99A 4BLTA 3AVQA 3GWZA 1K8QA 3GFQA 4N40A 3VAZA 3VHQA 4YCNA 2ZVQX 4BX8A 3T1OA 1E6EA 1PYDA 2IOQA 4F1WA 1K4YA 1XVAA 4RGBA 3TRJA 4BP1A 3AP1A 4BS9A 5C80A 4XR4A 1ISPA 1MVLA 1TJ5A 1ULHA 2ZB7A 4RKYA 1H2XA 3WRYC 1CPYA 1UCFA 5KYWA 2V9ZA 3KQMA 2IUEA 4JVMA 4KIWA 1RAGA 1IW7D 3NPMA 3FHOA 1DQYA 2JBAA 1L7XA 3K20A 1JFFB 2BSAA 3L02A 4GUDA 4MCAA 1YMQA 1PX2A 3TJMA 4F06A 2A84A 4XVCA 5JAUA 3ROTA 1TQDA 1Z2DA 4KXUA 2PXCA 3HU2A 4PHHA 3TWOA 3T94A 1K3TA 3P26A 5DB4A 3ZY3A 1L7MA 1T34A 5HX7A 4DV7B 1U3WA 1H4QA 1OB2A 3QFTA 4J8PA 1T2FA 3LK6A 1GGMA 1X94A 2X19A 2V4MA 3C5VA 3K05A 5AVTA 3CG0A 4QUIA 2W2MA 4WH0A 1ZICA 3D3WB 1EJ2A 3EDQA 4XDGA 4YV1A 2JJ8A 4IJMA 3RIEA 3ELUA 3R9WA 2BKAA 2Q29A 5K0FA 4LW8A 2C03A 3NHLA 1F8FA 3R3ZA 5LYJF 3ZU4A 4EY4A 3U40A 3I73A 2PUCA 3EA4A 1J1UA 3QSYA 4DUGD 3DE2X 1SQFA 2N46A 3ZWQA 5FWYA 4JR1A 2V5AA 1C8KA 3DR3A 3MRTA 4XCXA 1EFVA 4C4XA 3ONWA 4EG6A 4GYJA 1ECLA 1FEZA 3HO6A 4H7FA 4JBYA 4Y6PA 1W5EA 5EWLA 4C7OB 5KJCA 5IAGA 1CX9B 4ZQIA 5EKUA 1GZ5A 3UT5A 4W1RA 1Q14A 4JBXA 2WHXA 5TEWA 4B35A 3RS0A 4R71A 3VOTA 1Y0BA 2W6MA 3NRBA 5JJBA 2FDXA 4FB4A 1MX3A 4JOCA 5DKFA 3IUSA 3JSXA 4KO3S 5KOYA 4OQZA 1B0PA 2HCFA 1M76A 2QP4A 3EG5A 3CF2A 1XEFA 3FOWA 4GRAA 2C2GA 2VIIA 3BHMA 3O4FA 4EY8A 2P9TA 3LS2A 2OFXA 2HBQA 3E18A 3V6MA 3VUEA 4AZTA 3NTQA 4DA0A 1O94D 4LQCA 3VPDA 5FBLB 3W1WA 1V5EA 5L45A 4L15A 4F86A 3GUHA 2QQ5A 4NPAA 3RUFA 4DV3B 4Y2QA 4GLLA 1NURA 1C41A 3RS8A 5I4IA 4A2WA 1AA6A 3BHJA 3NB0A 2GWHA 3WGIA 4HRAA 4AKHA 1DJNA 4I4TF 2YZ7A 3DDWA 3SMQA 3U7HB 4Q7MB 4EKDA 2DUNA 2ZIUB 2Q8QA 2QI9C 2H65A 2JLZA 1GZ6A 3PWTA 2DAPA 4IXWA 5ALOA 1NPDA 5F78A 3VH1A 5AM3A 1B1CA 3JQDA 5I8ZA 1T4GA 3RS4A 4KK4A 3NNNA 3S99A 2GGSA 4M89A 4YBZA 5GIOE 1KQGA 4YAGA 3PA6A 4MR9A 2FF5A 4WXHA 2WU4A 3WIBA 4ME6A 3KIPA 2HIMA 4R2XA 3ZW7A 3AR4A 4RELA 4PC2A 2IDZA 2AR7A 1NVDA 4S1NA 3F67A 1QNLA 2C00A 4WK4B 5CHYA 5LZ5A 5E3JA 2EHDA 2NT3A 1IZ9A 1GG8A 3C6BA 3JU3A 1YS1X 2JIZD 1HNXB 1G1MA 2DR2A 2WSLA 3ZJVA 1D2GA 1SKYB 2JA1A 4BGDA 1P1CA 2BGUA 2PQ2A 2VDMB 4K81B 3H3XA 1AQ6A 4A0GA 1AE1A 3FETA 3BULA 4HJXA 4N5LA 5JDIA 2C78A 2P41A 4IXNA 1ECCA 3IPCA 1DTEA 1CR6A 1GV1A 1RAHA 4RNDB 4A27A 3O93A 2GPYA 3INNA 5CD9A 1HEIA 4E88A 1I01A 1TIPA 2ZIXA 3HM2A 3HRIA 3KUXA 1R0SA 4HWRA 4NYMQ 4HDNA 4UAUA 4X95A 4CUZA 4AJIA 4UHKA 3DMYA 5KBYA 4PSDA 1WKVA 4Y6QA 5A5DA 4UXJA 3HJUA 1JDSA 1RAIA 4O3FA 1PDOA 1IY2A 3RYTC 3RSCA 3WLFA 2ZRFA 3IL2A 2ON6A 4MPTA 1UZAA 5DNAA 1MB0A 1UBEA 1R0CA 4CEJA 1QCYA 3LQ2A 3FJOA 2HXSA 2Y3IA 2AHRA 3PDWA 1V7ZA 4O5OA 3RRFA 3UOGA 4XVUA 5HF9A 4LZLA 4BECA 4IUBS 4MW1A 1BE1A 3KHSA 5H82A 4PS0A 4JBHA 1MZVA 2X9LA 4MVJG 5CX1A 3UWPA 3ZX5A 4AUMA 4MW6A 5EIOA 2BEVA 2FFRA 3EBPA 1TVKA 4FQ5A 1RZVA 2IF2A 3RB8A 3A1EA 4LFAB 1X13A 5DSZA 1RPJA 4RZHA 4L08A 4XM1A 3KYJB 5BSUA 1K89A 3AETB 3JQ9A 4WZBA 2F3TA 1RIFA 2V7QA 3O4JA 4MAFA 4HH3C 1XPJA 4CODB 3PEEA 1AD2A 4RS3A 4TWAA 1QUFA 1GG2A 2IPOA 1UANA 3OZAA 4GF5A 1UJBA 4S1WA 1PTKA 1XDUA 2VF7A 3DPIA 2FJPA 5UKDA 2X14A 1YZYA 4GGOA 5DN9A 2OZPA 4LVUA 2QUHA 2VT3A 4QXQA 5IAOA 1I14A 3B52X 5I9BA 1M6HA 1MJFA 1XZGA 2NNLD 3A2MA 2A88A 4G67A 4CE6A 2CZQA 2IIQA 3FAZA 4WCFA 2AA3A 3PICA 3OLWA 4K0KB 3SQWA 1NW9B 3GJQA 5CPFA 3P2OA 4FN5A 1FRQA 1ZIPA 3QVWA 1GILA 1KVQA 1MD9A 1J97A 2I2CA 1SPBS 4QECA 1OFGA 1PSZA 3LWNA 3WFJA 5J2UA 1YI1A 1OX6A 4OFXA 5K01A 3AHIA 1KI1A 5PNTA 3VVBA 3TCNA 3EXAA 1ZJWA 4YASA 2Z1MA 2QHXA 3VVCA 4KFCA 2O2GA 2X5NA 1UBJS 3AESA 1I9CA 3VDMA 1K3UB 2HMVA 3N2NA 4KMMA 1T8WA 1JLSA 2DQYA 3L92A 1A8SA 1B7GO 2IA5A 1T0BA 2R751 1NDUA 3N39C 4J16A 1SXJE 1BVRA 3V80A 1DC7A 3KWLA 1L5YA 4X44A 2HKIA 1H4TA 2CDAA 2Z1NA 1UJCA 3JD1A 2IHVA 4OIFA 3S8MA 4MPPA 3ZGNA 4AP5A 3H18A 1SUEA 4C6RA 3BQ9A 1DKNA 3RBXA 2PRJA 1JQAA 3GLFE 2X8JB 3QUBA 4JI4B 4BUCA 1DARA 1P0IA 2DBZA 2GBFA 3OBBA 2GEKA 2IZ6A 3DEIA 2A33A 4QDOA 5IAJA 5JBQA 1Z0IA 2J4DA 1EFPB 1KY3A 1P9NA 1VGRA 4TXJA 4J0IA 4LOIA 3NOXA 3M6UA 1OPRA 3OOSA 1Y5LA 2QZ9A 3QTTA 4RXUA 1KRXA 1GCIA 2P0EA 3UEOA 3EIEA 1XTQA 4KXWA 4QBIA 4NCAA 1NJ6A 1QX3A 1GTRA 3GP3A 5FCDA 4CR7A 4FDMA 4KX5A 1L3BA 1KQNA 3QYAA 1FNNA 4NBLA 2INGX 3QKSB 3JRNA 1YTLA 1OREA 2PUDA 4F5WA 4LXXA 1ICEA 2VJBA 1RJ9A 2AEMA 2Y1KA 3H4TA 3QUSA 2B36A 2C57A 3C45A 3KJFA 4RA9B 4FR0A 4YACA 1SUCA 3MWLA 2REOA 3K6KA 4TT3D 1QFXA 2ATXA 4CWAA 2XSZD 1RFLA 2W83A 1S1MA 4M9CA 4JUAA 4L5YA 3HCAA 2WOOA 2R6FA 3EZ7A 3EFHA 3QMPA 4HS4A 4KO4S 2BE7A 4AN1A 2CLKB 5BY2A 5AVRA 1VHLA 1JYFA 2ATIA 1CJTC 4PC7A 3WK9A 5D5HA 1V45E 4R8RA 4XD2A 3LU1A 3R4CA 2V0GA 2GUWA 4FGKA 2IYZA 5C81A 1D2RA 4R84A 2YIMA 4DR2B 2QDKA 4LBWA 3JWJA 1IVSA 1DV1A 2OFWA 2VATA 5CNMA 1SVSA 3V97A 3LKBA 4G9GA 2Q2WA 3PQ7A 2KPOA 3M4JA 3ZIDA 1AKNA 2Z56A 1Q1QA 7GPBA 4CEHB 1D2HA 4RXTA 4TTJA 1XZNA 1A27A 3UMJA 1UK6A 2QMOA 1I7NA 1P0CA 1QZZA 3ND6A 3RYFB 1E60A 4IM7A 1B0ZA 4YN3A 4LV6A 3SYNA 1ZK1A 1TJYA 4RVCA 5CDSA 3ST7A 2X0JA 2AE2A 3D6HA 5FD8A 2D13A 3UHFA 4D99A 4F71A 1G8KA 1O03A 5LPNA 1IXZA 1ZCFA 1B42A 4I4CA 5HK9A 2IL1A 2DHCA 2VRCA 1ISMA 3LLUA 2QMZA 2C2YA 3BN3A 4MQLA 4W1QA 5AK6A 3RK4A 4BRUA 1Z56C 4LF9B 1NVGA 3BWXA 3H8JA 4FWBA 5A62A 3IIJA 2A0YA 2VDVE 1P3Y1 1RP1A 2G76A 3UKJA 2ZAYA 1TCUA 4DDWA 1EHYA 2J07A 5ENDA 3W90A 1XAJA 4FR5A 3H9QA 1T1GA 1TQ8A 2QV7A 1XRJA 2QMYA 8ATCA 3H87A 2R9VA 4M76B 3RTCA 1T25A 3S2FA 2IYOA 1O6FA 2ZSAA 4L0QA 3V4LA 3IDAA 2IBTA 1IWBB 2FEAA 2ZXEA 1OH7A 2BKEA 2G8LA 5G0TA 4M4SA 4QUAA 4WKBA 3UXHA 1NBMD 3BPSA 5HR5A 3OZEA 4BQSA 5KQRA 2A35A 3ZGXA 1Z7YA 1NBIA 2B82A 2IHBA 4PO3X 2QT0A 1CUAA 1PFUA 1Y1LA 3RSSA 3Q3CA 2ADFA 2Q5FA 3LG2A 4YV0A 3PRKE 2BFNA 4YV2A 1TI7A 4CIXA 4DLYA 5ALJA 2OGWA 2JLRA 3ADPA 3IJPA 1NQUA 2XKAA 1BQEA 4INZA 3JRXA 3QQ5A 4BP8A 3UMMA 2UZ1B 4EYSA 4HQRA 1JHQA 4BC1A 4MAMA 1GO2A 1ACMA 2G4CA 3F9RA 1P1JA 3MGBA 3DV0B 4KVGA 4RSHA 3KQLA 1K6MA 3E1KA 4UM9D 3UW1A 3RIGA 4NZ9A 1PGJA 3IMKA 1WF3A 5CW2A 2CV0A 1C7EA 1MKYA 2J0UA 4HYQA 3SHFA 2FWBA 2JFFA 2K6GA 5KYUB 1KQOA 2UYCA 1BDIA 1ODCA 2HO4A 2ZCJA 1J2EA 5AUQA 2C5AA 1BGWA 2PZFA 1GQ2A 3QFHA 4G5FA 4JJZA 4CFZA 2C7BA 5EE3A 1T6NA 2VP4A 2BEJA 2DECA 2GSDA 3VPSA 2RHBA 2PKYX 4CL3A 5JD4A 2KHZA 3HKDB 3A28A 4FKMA 3IBFA 4B76A 4YXFA 5IM4F 2DUUA 4B3GA 4EECA 1ZJ6A 1AQUA 1YXMA 3C4JA 3LLMA 4X3PA 1R0KA 2Q45A 2XE4A 6GPBA 1SBTA 1E2GA 1T1SA 2IITA 3BDAA 3H97A 4GPAA 2ZT5A 4WK0B 2MU1A 3EFOA 8AT1A 2R5FA 3RUPA 4YR9A 3C4QA 2GCEA 2VO1A 3I30X 1F2UB 2Z8YA 2QGNA 4IIFA 4IY1A 4TQUS 4DWVA 3UUWA 1ISRA 1IHDA 1U02A 3QKRA 2VEDA 1Q7TA 2FN7A 3BD8A 3SHOA 1UPXA 2AXPA 4RC9A 5B4UA 1R5JA 1ZM9A 1Q0SA 1YE3A 3BMCA 2WUVA 5JQGA 1CQPA 2XQVA 1RI1A 3PE6A 1C7IA 4RJKA 1GZ4A 1ZH6A 5CTAA 2QLMA 1T4DA 5KQMA 4YIHA 3O8CA 3F71A 5LDGA 1P62B 5C7LO 5G41A 4H15A 5BMVA 4JVNA 5HFJA 1P0QA 3AI3A 4KMSA 4YY3B 1JIIA 2B34A 3LC7O 3R0ZA 2FDRA 3RYHA 4UUAA 3T0FA 3I58A 3D4IA 1EVKA 3K31A 4HRXA 4NF2A 1GEGA 4FNOA 5ARDA 2W6QA 5B2ZA 4ZAZA 1WL8A 2D27A 5A0FA 4AULA 4GGMX 1WTCA 2AYXA 3BYZA 1DBQA 4BQNA 2EJWA 5JY1A 2LBPA 3BMXA 1IVNA 3KQKA 1ZIDA 1E6WA 3JWHA 1ABFA 1PFYA 4PAOA 5CHEA 3SDSA 3UUGA 2D28C 2H7CA 1QPBA 5IYZA 1XP8A 1TLTA 1ZRSA 2F7SA 2UVPA 3LDFA 2CHFA 4YRCA 2ALJA 4UDOA 4IFEA 1QSGA 4HEHA 4G89A 3QBJA 1R6UA 4LC0A 4LVNA 3W05A 4N0QA 1UPCA 2R1TB 5B3AA 2PNJA 4F6LA 4UQOA 4HGRA 1A2OA 1II9A 5K8IA 2ZYRA 3TOVA 1T2VA 1Y4DE 1C14A 1U04A 3K7EA 4S1PA 1C1HA 3OY2A 4NAUA 3AJDA 4NU8X 1PBNA 3CR3C 5FBQB 2FN3A 4A36A 1R64A 3ESAA 4QOHA 3RPEA 1ZK0A 2VRWA 3QLTA 4KE6A 3VPCA 3WISA 1CKEA 3BFKA 3DEHA 4MA0A 1QQBA 5AW5A 5GJBA 3L1KA 4LISA 3FX2A 4FFMA 3L7JA 5JS2A 4TV9B 2XMBA 2EFYA 4LOJA 3D7NA 4P4UA 4H3KB 2BFCB 4NZMA 4FWTA 1NA5A 4HUJA 4NDNE 1OCEA 2HF8A 2J09A 4IJVA 3G0IA 4P3OA 3K70D 2XJ9A 3LBYA 4CI9A 4ZI5A 3RHFA 4P34A 3TTXA 4WZAA 5FQOA 2V7PA 1KH3A 1PQ4A 2QN1A 3LP5A 3LUPA 1G5PA 4CL0A 2X5OA 1RMQA 3UQYS 1GLVA 1HV8A 3LY9A 3U1TA 4XX0A 1G38A 2ZUSA 3ZBPA 2PWBA 4DLTA 1E0AA 1I2MA 1PWYE 1XRRA 4A16A 1UKYA 5EQJB 4MSUA 3FSGA 5E1MA 4C4OA 4D0NA 3WYGA 4W6ZA 3TLAA 2O0MA 1NI3A 4ZCQA 1O95D 3DPUA 4LSGA 3D0KA 1A4IA 2ZT7A 3D8SA 2XWQA 4LRQA 4XGIA 4LZOA 3E1GA 5CM9C 2B8NA 2YZ2A 5B3KA 2RH8A 3QBPA 4LRXA 1AOXA 3N7TA 3UPDA 5HKBA 3PVCA 4Q3CA 5DGCA 3AM3A 2AYYA 3BGIA 3I45A 5J2TB 1PKEA 4AX4A 1QYIA 2DR3A 1TEXA 2IFTA 4ENUA 4XVRA 2H07A 4OHOA 3H5RA 2BFOA 4PLFA 4KPEC 1MOQA 2GXSA 3FOBA 1Z4KA 5A2GA 1C9MA 1E2FA 3F8TA 2WIBA 3NGXA 1V41E 2XCUA 4RQAA 3W6PA 3ZE8A 2HTEA 4HEA6 4DBLC 4JQZA 5C8ZA 2RI0A 5MGNA 1M0SA 4ZT2A 1AKTA 2VAVA 2NO0A 5U4QA 2IIPA 4Q39A 1F1JA 3NAZA 1YJ8A 5DHSA 4D57A 2VPYA 5T64A 4YMTA 2F4VB 1WW8A 2C5GA 5F2OA 1IY9A 4LV8B 3SHTA 5L3QB 3C2QA 1XZJA 2VF4X 1SBCA 3B1WA 4KIUA 4A8TA 2E89A 3HR4A 5JLJA 4HWSA 1V7PC 4MR7A 1T29A 1WPXA 1SEPA 1U3DA 4YJHA 3A9SA 3CLSD 3CCFA 3WJ1A 4OHWA 1T6ZA 2JB9A 3DMHA 4X6XA 2NUTA 1E79A 3N2YA 2XGSA 3VR5A 4BTLA 3FCAA 5K9ZA 5KUTA 1S1CA 1U0GA 1I13A 4WDRA 4GZMA 3L0BA 4F4IA 2JGNA 3KKNA 4ZIRA 3W5AA 4RF4A 3RTGA 4MUNA 5LQUA 1NMZA 3CTMA 1ULUA 4JUBA 1VSVA 1A8HA 1WABA 4ICIA 4IKEA 4EEKA 3GFSA 1R00A 4QQNA 3U7QB 1JBQA 1GUAA 2G09A 2J7PD 5HMLA 5BYJA 3TNFA 4BNFA 1ID1A 3SF0A 4GKKB 1OMOA 1MOZA 3FIJA 1IOWA 5AYVA 4OJYA 2JGKA 2WJAA 1OI2A 3AFGA 3AB3A 1GTZA 2IYFA 4FC7A 2IZ0A 1Z6ZA 2JHPA 3E9ZA 4LJ9A 3H1BA 3P2YA 2BHTA 1PZMA 2EDCA 4EO7A 2PUVA 3BH7A 3TG2A 4Z53A 1PL0A 1Q7EA 4IQ4A 1K4MA 3LT2A 1BS1A 4LXUA 3WGJA 3WQHA 2HTFA 5FL7A 3OEHD 3DLHA 1JIUA 2GR9A 1JKXA 2GCIA 3B2EA 5EJ6A 1PG5A 3E61A 4B4UA 3ZCVA 3HJTA 4Z7JA 4BMDA 5K8UA 1ONBA 4JY7A 1UBOS 5F7JA 5G4LA 1B6GA 4M98A 2D3WA 3ICPA 5JSYA 4MKFA 4RK5A 3AVYA 4Q47A 4GP7A 3SXJA 1DB3A 5BNWA 1GZ7A 3GAAA 1YZHA 2VCHA 3TLEA 4EB6B 1M2FA 1ADBA 5C5EA 2XB8A 4M0FA 1GUBA 1G21E 1Y80A 4RFVA 1XAHA 3CWZA 3ZXYA 1JR6A 2QZJA 2VP6A 2NYRA 4AICA 4ZQEA 2HYIC 1NXOA 4EJSC 4GLBA 2F48A 4U9HS 1PVVA 2MCFA 3BZBA 2PSJA 3Q88A 2XMRA 3NBZC 5D3KA 3QVGB 2WTBA 4XYEA 4B4KA 3IP6A 1S2IA 4I99A 4TRJA 5CA0A 2HAEA 1U9YA 2AMLA 1FQJA 2G88A 1M75A 2QZ4A 2DPMA 4DLZA 1FLVA 1EE2A 3AU8A 4OBWA 4ZVQA 3A26A 4F8JA 1X7ZB 1J6UA 3IT1A 4P33A 3NWEA 4ODIA 2D1TA 1JIXA 1ULAA 4PU0A 4UHEA 1PWEA 1XU4A 1DRKA 4EI7A 3OLQA 3X1JA 1ONPA 1PLKA 1XZCA 4LXGA 4RLSA 2OV3A 3HGMA 2RI6A 4YJ2B 4S0ZA 5KYTA 1SXHA 4Z4HA 1JKJA 1QS0A 2NPIA 2VNHA 3D7SA 4YCJA 1OZHA 5CT8A 3FRJA 5M7EA 2EJUA 1DGQA 1JB9A 1JAYA 1GT6A 4HGZA 4R2JA 5GM1A 1CDEA 3LUJA 4B7UA 2ONYA 2QR3A 3DB1A 2HV9A 5SY9A 2XY4A 4A8JB 1DEKA 1ATIA 1Z25A 3HN2A 2DQZA 3TLYA 4I4LA 3G9TA 1RBZA 1C8BA 2BBOA 3FFWA 2JHCA 2ZJ7A 1SH7A 1HFKA 2V97A 3A4YA 2ZRIA 4KL8S 1OROA 2WWXA 1TM2A 2RGNC 3IUNA 3OIGA 4JU9A 5CFMA 2QLJA 5LQSA 5AW0A 3DNFA 4E22A 4OHFA 1RABA 1T8TA 1XZ8A 2YC4C 4O4JA 1PYGA 5F7OA 1EK2A 3QU5A 5JNLA 4F9FA 1ZWKA 2FW6A 2OBXA 3E9NA 3O8QA 3WGTA 5GTDA 1BXZA 1RBQA 3MGGA 3H6HA 4XGQA 1ISSA 1V8OA 5FPSA 2H1HA 3RSOA 4F5DA 4KO2S 3VZQA 3QY0A 4JQOA 4IHQA 5KWIA 5L6LB 3WO0A 3QEMB 3IQIX 3DMDA 4UEWA 2BRUC 3PDIA 2KBEA 1RJWA 1NXXA 4MV1A 5EJIA 4D26A 2QTWB 3DFIA 2DQKA 5DU2A 5DI3A 2RGUA 2W6ZA 2Q5CA 4F4FA 2NZUG 3DAYA 4N54A 2ZYIA 1KYIA 5FWDA 2YWCA 2O2ZA 4WN9A 1WZEA 1X8LA 1TJUA 3TECE 4E11A 4HKTA 5JATA 4BDTA 2VTKA 3K9QO 1G3RA 2VHZA 2X6QA 1OTHA 2Q7OE 4IDHA 3TTWA 1D1PA 5KX5A 4A4DA 5G40A 3PGMA 1CB0A 5HUQA 5JXJA 3W5CA 1Z0SA 4RK1A 3OZDA 4M38A 2VQEB 4ND2A 1E58A 2WILA 1ORWA 3H2HA 2BZ0A 4EM6A 1IG3A 3H0CA 5K0GA 5LYJB 4ZQBA 2ACEA 2C1XA 3QH4A 3K2IA 1RHQA 3BFXA 2CF6A 2EL7A 1FTGA 2JIMA 1A71A 3PPXA 3C70A 5CAEB 2XQFA 3BGOS 4BWYA 1MABB 4WBNF 4NBUA 2EYUA 3FWKA 2Q3BA 4HQ6A 1XWWA 3PQEA 1VECA 4FOSA 1SQ0A 3C3JA 3CPHA 1BYIA 5ESWA 4O6VA 5BRNA 4ZI7F 3O3CA 3U4MA 1PJTA 2VHUA 3KQPA 4KN8A 3K70C 3F4TA 3SE7A 4AJKA 4EO4A 3IHWA 1S2OA 2VR1A 5JWHA 5AESA 2COEA 1IXRC 3K0SA 3GGOA 2CD7A 4PZYA 4AWXA 1VCMA 4KUEA 4IMRA 3IXLA 3HP4A 1XEWX 4K3UA 4KQEA 1ZZEA 4EG1A 3V4SA 3LPMA 4NLLA 4U5QA 3C1TA 3BFJA 3DMTC 3P9ZA 4R8MA 1HUQA 4QFMA 1D09A 1HL3A 1KJ9A 1QV6A 3CKYA 1Y9ZA 4OJMX 1OWLA 1UBLS 2Y27A 1HDYA 2Q5EA 4PYJA 3L77A 1P1HA 3IEXA 3QVOA 4LWPA 2WHEA 3H86A 4DZTA 2MYTA 4M7RA 1TQ6A 5JZOA 1JNYA 3LXRA 3U3MA 1HTTA 4D9CA 1UMCB 3BIFA 3DHEA 3RFUA 3V7FA 3EAQA 3I2KA 3ZCXA 1Y6QA 2WNHA 4UNSA 3UFXA 2ZSJA 3HBMA 3FNFA 2GPWA 2PANA 4I4TB 3GRAA 3NBMA 3IV7A 4MQBA 1DJOA 1AUWA 2C59A 3LXMA 1ELOA 1KI2A 4R0MA 3O1JC 3PK0A 1Q1GA 3O03A 4XWGA 1XJCA 1BDJA 3LRXA 4YRIA 1PR3A 4X66B 1E6UA 3FMOB 4LMRA 1KMCA 1D4FA 2GJSA 4RGVA 3RR2A 4BLSA 5B3JA 2XLBA 4UTVA 4Z86A 4DNQA 2YV1A 1M8GA 1JQ5A 4H59A 4NABA 1Q0ZA 3CJRA 2WDZA 3FMPB 4TWRA 1E3TA 1MRZA 5T8KA 5BT8A 3EPKA 3WMXA 4DCGA 4PYOA 5EE1A 1N5JA 1I0IA 4DLVA 3Q0IA 3GEBA 2CKDA 4U1RA 1QHYA 2HRCA 1YRAA 2WHQA 4JUFA 5EVCA 4MV7A 3VPHA 5C52B 2F1KA 4RKFA 3N0WA 4KWHA 4QQFA 2H4YA 4EKGA 4OK5A 3O3MB 2VJPA 3SZUA 2H9AA 2V96A 1TQHA 4ANFA 3AZOA 2XR1A 2DGDA 1P2DA 3LBFA 3JQAD 3TPFA 1C7RA 2QD2A 5DASA 1VHWA 4YAWA 1K8RA 2QJWA 1A7AA 4DMCA 5E9WA 1ZW1A 3ADCA 4K88A 1S4QA 1PF7E 2BBSA 3AI2A 1P5FA 3O94A 1JHPA 3EBOA 3CUTA 2Z3VA 1QPGA 3Q15C 4KNWA 2AOVA 2WG1A 1WB6A 2XMSA 3IRUA 3DMPA 3GP5A 5FA6A 2JH3A 2CMDA 4Q16A 3BMOA 2DPHA 3WMFA 4LZNA 2BUAA 3LZCA 1JWAB 3FBTA 5DX1A 3VNAA 3Q9SA 3UBMA 3CZCA 2XOKA 1Y4AE 4LDJA 5FJIA 3RJ5A 3LIIA 1X7WB 1C1DB 2EJTA 2C9ZA 5EXDA 4ZVTA 4Z1MD 5IF9A 2X2EA 4WXRA 2R8ZA 3WV4A 1L1RA 5D6OA 3DOCA 4OGFA 2WI8A 4BO8A 1K86A 2F17A 2QRQA 2CXUA 2JF0A 3JD4A 2WSMA 4DTCA 4YRSA 3X1KA 1P7YA 3SGLA 1RHRA 2C9DA 4BJ6A 3QE2A 4RJLA 1JLRA 1EM6A 1P2UA 5J4KA 2RGRA 3IVXA 2JLAA 4PNZA 2IXTA 3EXHB 4Y7DA 4L5AA 3SC2B 4PSVA 5B58C 2OYSA 5IDYA 1SXQA 1Y1PA 2CD9A 3FLEA 1U2PA 3BKXA 2Z08A 1Y34E 3AWIA 1F20A 3GHYA 4UTZA 3WBFA 5AW7A 4FZRA 3TKAA 2GTIA 3K2EA 4L6IA 3UC5A 3W1VA 4PONA 4COKA 4RE5A 4D4LA 3KFXA 2PU7A 1E2KA 1NP7A 4R7GA 3EMKA 3MJDA 4B7XA 1NIPA 2WJ4A 2XYQA 4KBGA 1IN8A 2WABA 2X1MA 4AURA 4PG6A 2HPHA 1NIJA 3DE1X 1HA3A 4DNFA 4JENA 3GMIA 3PFCA 3ESQA 4DJDC 1QHEA 3UC9A 1SHUX 4E12A 4FM9A 1ZMTA 2VOJA 5ELMA 3AMVA 1YHNA 3COSA 3HDGA 2DFNA 4QJIA 1M7HA 1LB1B 4XRRA 1BC5A 4GL2A 3LHKA 1AKVA 2RBKA 5LA6F 5AQEA 3ENWA 2X42A 3OP4A 1RCTE 3KKEA 5IABA 3LBAA 2ETXA 3Q2KA 4LHWA 4HUQB 1XQWA 1WDLA 5JAQA 3BRQA 1MXFA 1TAUA 2J7KA 1L8XA 2A5YB 1VSBA 4BOYA 1XXLA 3FSRA 3I53A 1HRDA 2BF7A 3QLVA 4JP1A 2P77A 1CF4A 2R11A 3PFWO 1X7YB 3FYSA 5REQB 1R0RE 4CQJA 5HNKA 1NN0A 1N2IA 2VPXA 4CQMB 3P0IA 4D98A 1AX9A 3VHLB 3K0CC 4DXAA 1M8JA 1H8HD 2FWMX 2G36A 2HJSA 3HRHA 3K96A 4U39A 3PDUA 4YRGA 5LU8A 4EJMA 2XRZA 1OHHA 2EKPA 3JQ8A 1F5NA 1VA5A 2DUWA 3G2OA 4O29A 2TMKA 3OOEA 3JQEA 2AZ4A 2X15A 4KWEA 3THYB 4B82A 2QAGA 1L9KA 2FFQA 2WP0A 1Z0DA 1QRAA 4RHEA 5BV1A 1Y1RA 3A1WA 3PIDA 4WLFA 4B46A 5A9SA 4Z51A 2BCEA 2G17A 2GZAA 2IW1A 2V4ZA 4X5OA 5ALGA 4EJFA 1J5PA 5JEDA 4GPD1 3GFPA 1U99A 2EU8A 4LC9A 4YROA 3SSMA 4QOGA 1W5FA 1M8KA 1DP4A 1FRFS 1MMFB 3CLTD 4LHXA 5F64A 2ZWMA 2XJ4A 1ZG3A 3LOQA 3X2SA 3I4FA 1V47A 1V1RA 1TK3A 3FFXA 4IIUA 5TJ9A 1OXMA 1UFOA 1XZLA 5MN6A 4B6GA 2NSJA 4QODA 5ILQA 2D8AA 1CUBA 3ZQ4A 3MQFA 4F1JA 3P9SA 4BN4A 2FMKA 4WOJA 2L82A 5HS6A 4YRPA 3GVHA 2M9MA 2P3QA 3OZFA 1AIPA 4GE0A 3KHUA 4N5NA 4PO9A 4RULA 1IPEA 4YJKA 1ZEMA 4RTMA 1NVFA 2AG1A 4GR5A 3DJFA 2V7EA 3IBCA 4HQLA 4LZJA 1RCFA 3H2IA 3AETA 4GX0A 4N3AA 5B1IA 1EXNA 4UCQA 4DLWA 4GRDA 2HEIA 3R0XA 2Q5OA 2LR0A 3C6MA 1B8VA 1BRTA 3KYBA 1KPGA 4GICA 1FFCA 4L1KA 4U6NA 2ISCA 3VOSA 1ZSNA 3L9XA 2DWOA 4OXQA 2EL9A 2VCYA 1KI3A 3DAOA 1NVXQ 4J7AA 1VL0A 3B5IA 1YB2A 4K0RA 5CT9A 4OQQA 3OX1A 4WJZA 3VYWA 3ZHZA 4B45A 5EJ5A 1QYDA 3DVLA 4FFRA 4KZPA 2PMBA 1XHLA 1RAFA 1FXSA 1QHHB 3M6FA 3ETJA 2O23A 2XMGA 2Q4BA 1Y5NA 2RARA 4Q02A 4F38A 4N01A 4L4UA 1HGXA 2I4MA 1EB8A 4J90A 1Z8FA 2BMVA 4U8HA 3RRJA 3W4IA 1DKLA 3HMQA 1ZDMA 1CVIA 3PENA 1GQOA 4KXVA 1L5HB 1JGTA 4UXHA 2R6AA 3C39A 4RF2A 3EDRA 3W78A 2G63A 4OB7A 1AGXA 3DCIA 4M9RA 3W6ZA 4KFTA 4LE2A 1NMEA 2V6FA 2CL5A 4LIPD 4FXOA 1I7QB 3A4IA 1PU2A 3I01M 2ZIWB 3TPCA 2C5LA 5C1BA 3UW3A 2VJNA 3JYHA 4BGVA 1MW8X 4NCKA 4NFSA 3UWDA 3UH0A 1REQB 2Z9DA 1QGOA 3EC2A 1Q1ZA 1Z37A 1X8XA 1OF1A 2PFGA 5DSXA 1MC1A 2WTMA 4TXMA 2UUCB 2UU9B 1M9NA 2NV0A 2ZJ0A 1IULA 4LFBB 2WJ3A 4UARA 3A3YA 4E5KA 1T3ZA 1OKKA 2J5KA 2Q0QA 3B6IA 4CMEA 1RXVA 2GM3A 4CMKA 4FOOA 4U7WA 5AR1A 1G7CA 3CJTA 4DA4A 1C30B 1WULS 4BDSA 3IHKA 1Z12A 1QG2A 1VDMA 5EP1A 4PANA 4GZ6A 4NZOA 5FOVA 1N3IA 4RK6A 4DMMA 3ZNNA 5K45A 2GB4A 3WGNA 4MW4A 1FFDA 2OY0A 3D3QA 2WHPB 3F7TA 3NDRA 1GARA 4JJGA 3CISA 2HMTA 4X1OA 3UFBA 5DDIP 2FN8A 5BSEA 2XBMA 1AK9A 2PUFA 4KX3A 1E4EA 121PA 1KMQA 2HU8A 4DMHA 5LZ2A 3QKSA 5KNCA 5ALRA 4LVOA 3L4SO 3PXBA 3MERA 3ELBA 2WSBA 1OUMA 2XCQA 2YHUA 4R2KA 1TO2E 1W46A 3NV9A 5DLEA 3TK1A 4OLFA 3B36A 3NVKI 3A1VA 5KJFA 1WQ1R 3D3NA 1KU6A 1WW3A 5KJEA 3FJYA 1B43A 4HO1X 4YT5A 3ZYCA 1LDEA 4BWFB 1L1EA 2BMJA 1A50B 3KLPX 1J1ZA 1K9SA 2X0IA 3L0IB 4KP7A 4IZHA 2NSLA 5D01A 5EXTA 2IP1A 1SCIA 2XYPA 4U6SA 4E5MA 5ICGA 2JDID 4EZIA 5I5GA 4M0MA 4X90A 2Y1LA 3N8IA 2Z9CA 1VIAA 2V9CA 2FEXA 3N5CA 4CIDA 2O4UX 2C95A 2I9KA 1QORA 2DTDA 1O8CA 2VHTA 5AW8A 5EOVA 3DUFB 4MYHA 3ZWVA 4CEHA 1TYZA 4EW3A 3RRPA 1JEDA 2GJ9A 2JIBA 4MMXB 5GADl 1O58A 4XWYA 4CIVA 1VI6A 3Q5DA 4WASA 3FMIA 3RYFA 5HP4A 1YHZA 3DO6A 4JBGA 4RF5A 2AN3A 3OOJA 3VSAA 2YTZA 3KZKA 2BGIA 2YNMC 2HM7A 4RW0A 3SEQA 4DNPA 1XMVA 3MJSA 3KSBC 3KEQA 3O2NA 1O6BA 5J40A 1EI9A 2ZSBA 2JGEA 3D1LA 4GX5A 4KFRA 4KXNA 3HGTA 1OAOC 2FRDA 5B1EA 2BUCA 2DT5A 1XF9A 2HREA 2OHHA 1BDBA 4YDQA 4DKXA 3B1KA 2V7TA 4IP0A 2NTYC 2B1IA 4GM1A 1B8PA 2X13A 3V8QA 4H1VA 1WQ3A 3DOEA 2OGUA 3WYBA 1EINA 3RRBA 4CQLB 1Z29A 3FZQA 2W2OA 5CW1A 1UPUA 2B2CA 2NYAA 1NJSA 3GCWA 3LT5A 4M21A 4PNPA 3QE0A 1U4NA 3CEJA 4L0MA 4GVLA 2PU5A 1E1DA 2R4UA 5LM3A 1SQGA 1C2TA 3N3AC 4EJ0A 1RQPA 5FLEX 2XCLA 1P6XA 1SZDA 5IFKA 3K0KA 5GONF 2PTHA 3R7LA 1AMUA 2IE8A 2V3CC 2XUQA 2DE0X 4POOA 2QZSA 5ALFA 3X44A 1U8UA 1U98A 3GXBA 4EHIA 1P81A 4XPZA 4FOPA 1OBHA 2UZ1A 2FETA 2FFHA 3CO0S 2Y4OA 3LL7A 1GPNA 2W98A 1H2WA 5I9MA 1SBQA 2W00A 4UVIA 5H3CA 5JS1A 4JLAA 5KTSA 2Q3CA 2ZUBA 4ZOAA 1SG6A 1W34A 2Q6LA 1NNUA 4CZ2A 3UPTA 3FMGA 4JHLA 1USKA 2OHJA 1P1BA 4W9NA 1YQGA 4ZVSA 5KQLA 3JCZA 3WRWA 1XAIA 3K9NA 3PIRA 4Q37A 4CM4B 1QG4A 3V8VA 3MYYA 3VR4H 4BVEA 3I6YA 4PNHA 3VQTA 5F92A 4OQMA 3WHLA 1XZQA 3MTBA 3WXMA 3R1IA 4QYIB 5EC8A 5AVOA 3GLGE 4AF6A 3IIMA 5EJFA 1UC5B 5TXGA 3ODGA 4RCYA 3G2PA 2O3UA 3H5VA 4A0RA 5JS7A 4IDAA 4UXIA 1JUDA 2A9QA 1PQYA 1NJ8A 5P21A 3MUOA 3QVXA 1SCDA 3UMSA 4BLUA 5D3QA 1HM5A 2ZSFA 4P81A 2JG3A 3DHWC 4QBTA 4IZOA 3KUKA 4N0EA 4HYTA 4XQ9A 2M1ZA 3VH2A 1CUUA 4XGNA 1FTYA 1UWCA 2Q6VA 1F2UA 1RM3A 1DQRA 1KO5A 3M9WA 4MVJP 4R68A 5JCOC 4OAOA 4F3NA 4YIKA 4V1CI 3PYLA 4E1BA 1PW5A 2CE7A 3ZNPA 3C3PA 4F8YA 1M2EA 2EGHA 2ZJ8A 3P7MA 4FJ2A 4ETWA 2IS1A 1KFCB 1PV1A 1HQCA 2Z4RA 2IYLD 4IJUA 1F4LA 3CNOA 2YWRA 3L8EA 1VJGA 2EDAA 3GEGA 2P11A 2F2TA 2ZR9A 2BI8A 2Z5FA 4AY3A 5B64A 2DLDA 4EF5A 4MIOA 1VL8A 3LBNA 2P91A 2H59A 3W4JA 5BSVA 1QONA 1AU9A 1O96A 1KHHA 3ETGA 3K53A 3CLTC 3K6SB 2C0QA 4LWZA 2J33A 4BV8A 5CDTA 1G21B 1M66A 3ND8A 1QIFA 4P7GA 3KPJA 3ZLVA 4ITUA 3S40A 1WCV1 2UUOA 4A2PA 4BKUA 4M1TA 1Q15A 1A2BA 1E2MA 3GWGA 1U9IA 4LDAA 3N6VA 4TSFD 1JLHA 1QYVA 2B99A 1KSJA 2BFDB 2C4VA 4PGAA 5AOCA 2RJNA 7MDHA 4WLNA 1E99A 1N0VC 5F91A 1K3FA 3IJRA 4HNGA 4HWKA 3FPHA 1RJDA 2DTXA 2I3BA 3GGGA 2DG2A 1BFKA 1YUNA 1YU9A 5CU7A 3B6ZA 4IUYA 2P4HX 3ND5A 1FYDA 1Z0FA 3OZSA 3OIWA 2ERXA 5J5AA 1C3VA 3ABIA 3PFGA 2OZLB 2PY6A 2R1TA 4MLCA 4Y2SA 3UJCA 5AHWA 1RKBA 4A6XA 5CD1A 1MRSA 3OCYA 3TTSA 2Q5HA 3WYNA 3VZBA 3NJ4A 4R2HA 1ZH0A 4GWKA 3DZJA 5T41A 5FA5A 4EGJA 5JWRA 4PX9A 3HXMA 2P9BA 2RBGA 1ONOA 4TL8A 2WHRA 4EI8A 1H2ZA 1FDWA 3BAZA 3G8CA 3KAKA 3UT0A 4DVJA 4I2NA 2JJQA 4TV9A 2V3VA 2QTVB 5IK2A 5BQPA 3I2IA 4I1PA 1ZS9A 3TM5A 4ZEMA 2IVFA 3U7RA 1G8GA 2ATVA 3AL0C 2CFOA 2ZJYA 2ZSUA 2ZIVB 1RI2A 1NW3A 2VNAA 2C3MA 1BCRB 3EWNA 3L6DA 2ESRA 3UUFA 1JDZA 1M2KA 1SQ5A 4FEEA 4FFVA 4HQOA 4IOMA 2CL6X 1TQ2A 2BR3A 1Z36A 2H4WA 4XOUA 4PE5B 3CWQA 4WVLA 2BI7A 2JD1A 2H48A 3I28A 4IIJA 2FOLA 2PAFA 2JH9A 4FYXA 2GBLA 2X4GA 1SU7A 1NBOA 3IAS6 3U6KA 1NSYA 1NU6A 1IOLA 1K0UA 2I4NA 1LLDA 1U6JA 4W8HA 4NZNA 4YRFA 4E2WA 4CCYA 3NBFA 4QFCA 5EIFA 3KV3O 5ENVA 1G41A 2HF7A 5J3JA 3KQYA 2O3JA 4D4JA 2P5YA 1D0SA 2WRZA 2VJOA 4F72A 4KJZA 4ZJYA 3KT8A 1GADO 1VYVA 5FPTA 1BOOA 1YR8A 1ZI8A 4J1SA 1C2YA 1JR2A 4MROA 1G60A 1XDDA 3W6UA 1FMFA 4ZPJA 4BC0A 1WMDA 2ODEA 4MV5A 3BRCA 4MV6A 4JYAB 4OJTA 4OQPA 1D2CA 2QSJA 3MTDA 3NIDB 3I1IA 3KYCA 4L75A 4Y2VA 3PSAA 2YDYA 1KVSA 1W96A 3HY6A 1W1IA 4J7UA 3B51X 2R47A 5TY0A 4M8KA 4ZOLF 3BJZA 1ONNA 4OXYA 1NNSA 2IQ5A 2N75A 2H92A 5BSMA 3D81A 2X1LA 3RVRA 4YT8A 4ZCMA 3G9QA 5SV2A 5BXQC 3FTQA 5HDBB 5K6AC 1BU8A 3O3NB 1R0BA 4D3ZA 1JMYA 3DZIA 4NBVA 1H3FA 1P72A 2CWWA 3EFBA 5L3QA 4OHCA 2C54A 2HIAA 2WSSD 1XYYA 3AFNA 3N7UA 4P6VF 4DCVA 4DQDA 1IMOA 3IE1A 1P80A 4B1FA 1EDBA 1MAAA 3WNBA 1U0BB 1GPDG 4RPJA 5CMLA 1JVBA 2JVKA 4X7PA 3HXQA 3F90A 4BO4A 4X00A 3GN2A 4W4TA 4ZEVA 2CFRA 3C5WP 5JCJD 3RAEC 2MYPA 3HJGA 4FX2A 3IQWA 2EZ9A 5LSAA 1ODIA 2JGFA 2UVQA 2JAXA 3RRYA 4D9JA 2DRIA 5E2AA 5KDOA 2CNWA 2O8BB 3BJIC 2HK7A 3I6MA 4TL7A 2OCKA 2V7GA 3DAPA 2D6FA 1E7SA 1PJSA 1RI5A 5HUJA 3KT3A 4XXHA 2VTDA 3M89A 2GRUA 2V65A 3L84A 3WBBA 4EYKA 3N3BC 1E61A 2PKRA 4C0BA 1G63A 4TWJA 2FSFA 3MOGA 3BH0A 3MINA 3AWDA 3SQMA 3ULKA 3G2IA 5EYPA 3SYMA 3LCJA 1HETA 3FYUC 1TKCA 1B6RA 3UT6A 2A3RA 4BFSA 3R0IA 4O2LA 1DBVO 4M6WB 3HADA 4FMDF 4ZCPA 4AJEA 4BQOA 3TQHA 1NMYA 3O21A 3ETCA 1WXEA 4U7FA 3REQB 1VDZA 3OO1A 5F77A 1ZUWA 4JJ8A 3RRXA 3OTOB 1W93A 1LSOA 2AJBA 2EOAA 1Z7GA 2OTCA 2PX5A 2H2GA 2HD4A 4FFDA 4EKEA 3PJRA 3KQWA 4RKWA 2WBLC 3H42B 3UOAB 3UWOA 4WK2B 1QOQB 5G0VA 3FUCA 2J1LA 1FTQA 1CTQA 3AG6A 4JEIA 1JKIA 4UMEA 5CVVA 1HT1E 4L72A 4CT5A 1HFEL 3RAPR 4YMGA 1KY4A 4EB6A 4M8IA 4W5JA 4B43A 3TG8A 2D2EA 2I6TA 4Q4CA 5ELXA 5HK8A 4D4GA 3K35A 1SWVA 3W7AA 4WY8A 1EFHA 3T7CA 5K4AA 4E7PA 2NXNA 4AJHA 3W7VA 2V5UA 2E87A 1F0KA 1T2UA 3A4NA 4C78A 3TAXA 3ESXA 2HXGA 2IYEA 2E6KA 3PRJA 3CIFA 1OYVA 4UM5A 4AB1A 3EMDA 5KREA 4OGLA 4WPGA 4WBNB 5TLSA 4Y18A 4PCUA 3X3HA 4UJ5A 1JI3A 1FDIA 3C24A 3FH0A 3LJKA 2I4OA 2ZWPA 2AGVA 2EG5A 2KMLA 2VEOA 2PUWA 4R1MA 1C3EA 1V7CA 2H7VA 4ZI7B 1NF9A 4RH3A 4G5HA 1CHDA 3THSA 4EDFA 5LBUA 3ROPA 2PG3A 2XRYA 1VJ1A 5EFZA 3FI9A 2SCUB 4C89A 4YUAA 5FUYA 2HFKA 3LQYA 4N9WA 1WVMA 5EWMA 4YEDA 3JATB 1II8B 2YY6A 3M1IA 1T5LA 2FWJA 1FURA 4M7PA 5A9TA 3GMDA 1YZLA 3TH5A 2PWZA 2HI0A 2ZDQA 4LXQA 2D62A 2IEGA 2FJUA 4Q5IA 5IARA 2F9FA 4LVCA 1VJRA 4Y0NA 1J1IA 2Q62A 1TVEA 2Q3HA 4CMHA 5FQNA 1SXJC 2D2XA 4GQAA 3V9PA 1PVDA 5JLAA 4KQ9A 4A8JA 2GEJA 2VHQA 1Y9AA 2RHDA 3JZMA 1MG5A 3PJDA 2EJVA 3L8GA 1ZPDA 2GO1A 2IGTA 3ZD9A 4YRTA 2X3YA 1KZYC 1ZQ1A 1NF8A 1Z26A 3FNQA 3FPAA 1SRRA 3OP1A 4HXEB 4KQ6A 5GOZA 3V7UA 5BXYA 3NTLA 3STUA 1KEZA 3TLBA 4V1CB 1L4MA 3U5ZB 2YZKA 2FH5B 4DILA 4MX8A 2XWJI 4HQ0A 5AKYA 3UB2A 5K0SA 3H9EO 3H11B 2WT9A 3CXUA 3KC2A 5BUCA 1MVNA 3MQ4A 5CCXA 1R0LA 5SYAA 1OX5A 2PX2A 3LWZA 2O48X 2VT7A 4DCCA 3DOHA 1T5DX 3OFVA 4R1PA 1C9KA 5CH3A 1XMPA 3O4VA 1TJVA 5I7OA 3JPWA 1XVUA 2IQIA 1E6MA 1J06A 4PGFA 2H5IA 3UJ6A 1LI7A 4TUYA 4A91A 4ASUD 2V59A 3VSDA 1X87A 3KWJA 3MFYA 2LKDA 3N0VA 1K5DA 3AUFA 4BGEA 4CDGA 2VBGA 1R5BA 1Y9DA 5JRDS 4RX1A 1EUCB 3I9V6 1U2GC 5ELLA 3TDMA 3G23A 4GNKA 3K4HA 4WJKB 5K0LA 4D41A 5HQTA 2YFYA 1XTRA 1KTVA 3BSYA 3V6LA 3LQKA 1XK6A 4HN2A 2WOJA 3K92A 4RYLA 1ZR2A 3FYHA 1V43A 1GA1A 2IYRA 2PA0A 3E7XA 4ZWNA 3SBOA 2P35A 2J5BA 1JIQA 2AIRA 4G81A 1HE4A 3DH0A 3QGMA 2BW0A 2RGXA 5LYJA 4L5BA 3PPWA 1RC1A 2JHAA 2ZU6A 4LRSB 2JKZA 3OH8A 3Q87B 1H5UA 2IV3A 4BCDA 2RH4A 3DBRA 4MVWA 1U3UA 2YYSA 1MABA 3G68A 4BVBA 3MWDB 4UEOA 2ZYAA 4QG3A 4BEBA 1C0IA 1YK0A 1R16A 3PHCA 1AO0A 2VYVA 3KEOA 1X6VA 1ATZA 2N0SA 3T9BA 3TLGB 1X9IA 3ZHYA 3QUCA 4PSCA 1NI4A 5DEIA 5J9FA 2OFOA 3GCXA 4URWR 4DLXA 1T1JA 3IV9A 1E8DA 1CQJB 4CHGA 4DSTA 5IVPA 3SSNA 4I50F 5AOBA 2R6DA 1HL7A 1Y1TA 2PUAA 3M6AA 3PC8A 4ENSA 4PN7A 4DCOA 3BJRA 2J0SA 5BV8A 2MWMA 4YRKA 3F4BA 3CQ9A 2H4JA 2K4MA 2LZ0A 2QU7A 2VN8A 2BGGA 3SS8A 3MB8A 4A26A 2KI5A 1UH5A 3C3WA 3KVOA 4FBLA 3NAGA 3MUEA 3I8SA 2G28A 2YUTA 3IMFA 2AL7A 2Z5GA 3AV0B 5AKIA 4JBNA 1AGRA 1BWPA 5FJJA 1F9EA 3DHYA 2VDLB 3LX5A 1IPFA 3SIPA 1TW2A 3RSQA 4BYGA 1B76A 1PJ4A 2XNSA 1XR3A 2C4TA 4A0HA 4I4TA 1QRSA 1SUIA 2ODTX 1L5RA 3GQBB 4PRYA 3TZBA 1MQ9A 2VJAA 4BX9A 4JEHA 1DL5A 3JPYA 1NZDA 1VSUA 1WM1A 3EGVA 1G7TA 5LA6B 1R1DA 3QHPA 3ZXXA 1XTKA 4FYPA 1NHWA 4HLDA 4EG0A 2OHVA 1FTWA 3FN4A 3ECAA 2OWDA 4Q00A 2BWJA 2OAEA 2XMCA 4A1OA 5T4BA 3URKA 4OKIA 2YFHA 5CG1A 1HURA 2EJBA 2O05A 3EIXA 1TAGA 4DDHA 4J0DA 4KWTA 1TADA 3A3OA 5EQFA 2I1WA 5C1IA 2VSXA 3D6TB 5LXTF 1PGPA 1QE5A 4R8VA 2J3EA 1PT6A 3JS5A 1WU8A 2F9MA 3L0CA 4NZPA 4ATNA 3HJAA 4J49A 3ZZNA 3BEDA 5AI6A 2PX3A 1T1EA 4B47A 5TMPA 2N1BA 1ACJA 3WSVA 4PTYA 3HG7A 1U1EA 1NKVA 3D3JA 3ZHTA 1O5TA 1ZH8A 1PJ3A 3FFAA 3K3PA 3R77A 2OE2A 3AJEA 4F9TA 2PUGA 1XPUA 1G3QA 1UL1X 2I8LA 5DPMA 1W6RA 1QWSA 2P9YA 4GXRA 2GEBA 2HIGA 3F46A 4OHUA 3HJBA 1FA9A 2RBEA 4FFLA 3Q9UA 2QP3A 1HQYE 4G09A 4YCBA 4DE5A 4BV9A 5K5EA 4JT9A 3ED1A 5LUBA 4ZAFA 3ZX4A 3B1XA 2WIGA 4RIEA 3IGFA 4WWHA 3S44A 4AECA 3GO4A 3FNEA 2GZDA 3OEED 1Z82A 1N9ZA 2VSYA 2CHGA 3TRHA 5I7HA 2OD9A 3LUBA 3NVAA 3IC5A 1W9HA 3L79A 3IDSA 3UYLA 5FFFA 2BSXA 5TE9A 2CFIA 3TR5A 3VR3A 1DG1G 3EGXB 1Z62A 4NBRA 1RYDA 3GROA 4KN5A 1ZM4A 3H0EA 3U49A 5EHXA 3LC1O 2O14A 3WTBA 1L5WA 4H7JA 4M9XA 3V4PB 3UTCA 4MTCA 3B1ZA 3EVBA 3SC2A 3PWKA 1WCWA 2OLEA 2LDBA 1E9RA 4IDDA 4JB8A 2ZJOA 4E5NA 1RM4A 1GL6A 1HDRA 1JXOA 1FMJA 5CG2A 3MTQA 4WOBA 5TSDA 4L8FA 4MCJA 1LY1A 3JSAA 3AF5A 3KT0A 3BWVA 2HJ9A 1N0WA 3ZE1B 3G2LA 4IVPA 2XMZA 1V8BA 3DEZA 1YU6A 3E9DA 4F9EA 2PTRA 2LXNA 3LF1A 4QTYA 5JWOA 1UXJA 1QQ5A 4ARIA 4OFZA 3AEZA 4DEVA 2QB5A 2ZI3A 4Y2UA 4EBFA 4CXMA 2H4FA 2C2MA 3L7NA 4EHJA 2G06A 2QVZX 5DWQA 4E5SA 1WSAA 2VJKA 5AW6A 3T12A 3LZ6A 3HEBA 3FGOA 3IEMA 4IX9A 2FPSA 1XCGB 1PD0A 3C6YA 1HSOA 3E5MA 4DPKA 2QS9A 3HDTA 4M86A 3ZIAA 3S70A 4HGNA 1YQDA 3WADA 5EIHA 1Q0RA 1VRVA 1OFHA 1IZ0A 4LEIA 3F74A 3DAFA 5AHRA 2BOVA 4HUQA 4ARAA 3HXTA 3P8ZA 2II6A 2MSKA 3NW9A 5IVKA 3WYEA 3TAHA 1SY7A 4FJ0A 5D3ZA 4MWSA 3W5SA 3P2JA 5EIEA 1T5IA 3DZGA 3CPEA 1DSSG 4V03A 3HUUA 3K9WA 1X7YA 2HK8A 1NUPA 1WVIA 3ZGVA 4CQMA 3OF5A 2ZSIA 1ZMOA 4QVKA 5KIAA 2ZJ5A 3KKZA 3OPVA 4NZZA 5JCZA 2ID7A 4F2WA 3ASZA 1RJGA 3L7LA 1C8LA 4HDMA 5LNK6 3EGEA 1VHQA 1ISJA 2VAMA 3K0BA 4ZO6A 4AUEA 3ROXA 5BOSB 3DDOA 5L51A 4J03A 2BTOA 4FYWA 1SQSA 1ACLA 4TTQA 2HA4A 3QKIA 4HWGA 1TAQA 4S1OA 4Y3UA 1DUIA 3L7IA 2YJNA 3OCCA 2XQGA 1QZXA 1E32A 2NZ2A 3EMBA 2P62A 3G85A 1GPUA 3GDHA 4K46A 1J0EA 2IXEA 3CUSA 1JDNA 3M5WA 3PDHA 4B6SA 3B3AA 4XIGS 4Y2PA 3OU2A 1UP4A 5AOAA 4YCCA 1KEUA 1Z4IA 1LA2A 4P4GA 1DRWA 3D6NB 1WCYA 2AJDA 3GLHE 4K6GA 4TWZA 3NHBA 5DBEX 5BP7A 5BUQA 1JZQA 1IY8A 1CUZA 3PWSA 1S01A 3ZEAA 1N4DA 1R3DA 5FAKA 4M9ZA 1UK7A 3VSBA 1BA3A 4HI0E 4YJDA 5JDCA 4QGGA 1C7FA 4PO8A 4GFDA 1J09A 3GF4A 3GJ7A 3IILA 3IP8A 2W42A 1ZZGA