1Z4LA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with thymidine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4lA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4lA01
1RMYA 1Z4IA 3AR5A 5ALJA 3R9KA 1ZOLA 2I7DA 5AICA 2W11A 5IT0A 3E8MA 3ZI4A 1VJRA 4EX7A 1ZJJA 1U2TA 4JDPA 3DNPA 3L0CA 3DAOA 2I6XA 3OTQA 2JARA 1L8LA 1RQLA 1RC8A 3FPBA 3AR6A 3ONNA 2IOFK 2P11A 4BYGA 3NASA 1X42A 2YJ5A 4NV0A 3WK9A 1J8DA 2BY4A 3QU4A 5AKJA 1Y8AA 2YMMA 1QQ6A 2WHEA 1Z4MA 3CNHA 3WK7A 4DFDA 5AW0A 4MWOA 2D2VA 2Q4RA 4GIBA 2HSZA 5ALOA 2R8EA 3WK4A 4ZEXA 4DCCA 2B30A 3D6JA 1QQ7A 5AM4A 1YJ5A 1U2SA 2C8LA 2NYVA 3KZXA 1WR8A 4EEKA 5AW4A 3PDWA 5AK5A 5AKXA 5AVUA 1ZRNA 4XOUA 4UARA 4HGNA 5AW9A 2QYHA 2FDRA 1S2OA 5ALFA 2P9JA 1RLTA 3BWVA 2JGAA 1LVHA 3ZW7A 5ALGA 1NF2A 5T41A 2MU1A 4UM5A 2FPXA 4IFTA 3N28A 5AW6A 5ALQA 4GXTA 2DQSA 2FPWA 2OYCA 2OBBA 1TJ5A 2FEAA 1ZD3A 3ZWDA 3DV9A 2GHTA 3EWIA 5AKLA 5AESA 2GFHA 3J7TA 3A1EA 1YDFA 3SF0A 4NFLA 3B9RA 3L7YA 4BX0A 3L5KA 4Y2QA 3NUQA 5AI9A 2C8KA 3OCWA 3A1DA 3VAYA 3U7FB 2BDUA 5ALZA 3N07A 5AVTA 5ALKA 4Y3UA 3RF6A 4BX2A 3MMZA 3EF0A 1MH9A 2ZBDA 2B1RA 2YN4A 4KYTA 5AKYA 2HHLA 2C9MA 1Q92A 1AQ6A 3AR8A 3IRUA 4C4TA 1Z4QA 5AKIA 2HF2A 2YJ4A 3DDHA 1RDFA 2GHQA 3EPRA 1L6RA 4DWOA 5ALPA 1SWVA 4L6CA 2YJ6A 5AM5A 4C4RA 4G63A 2RARA 3OCZA 3QUTA 4YIHA 4I9FA 1XPJA 4KX5A 4UU1A 4F71A 4Y2YA 3U7HB 3SKXA 3AR4A 4UMEA 5AVVA 2ZG6A 1U02A 3ZU6A 3I76A 3ZTYA 4BEWA 4L57A 5AVRA 1L7PA 4YIKA 5FP0A 1CR6A 1TA0A 1U7PA 1N8NA 1Z4LA 3A1CA 4XPZA 1JUDA 3N8GA 5AVZA 2AMYA 3F9RA 1SWWA 3L0YA 3OCYA 1YV9A 5ALIA 4ZEWA 2GMWA 5AVXA 2ZBEA 4H1WA 2I55A 2AUTA 1SU4A 2AGVA 4OCZA 4RETA 3SHQA 2YMPA 5AVQA 3MPOA 3NRJA 3N5KA 3OPXA 3ZVNA 3CZ4A 5AI5A 4NABA 3L1UA 3QYPA 3WKDA 3ED5A 4RESA 3W5BA 1RRCA 2EARA 1TE2A 3QNMA 4JB3A 1Z5GA 2FUCA 4EX6A 3WK8A 2B8JA 2JAWA 1NNLA 2G06A 3WGVA 2FI1A 2P69A 5ALYA 5ALWA 3ET5A 1Q91A 2HCFA 4J03A 5AVWA 2OM6A 1EK2A 1RQNA 3NANA 4QQFA 1Z4OA 2NO4A 2B8EA 2WF6A 4ZEVA 1L8OA 2HX1A 2WF5A 2BDEA 3ESRA 1L7OA 4HAIA 3N1UA 1RKQA 3L8HA 1WPGA 5AM2A 2Q5EA 1Z4PX 2ZBGA 4UMFA 1S8OA 2R8YA 1K1EA 3QU5A 2JAUA 4KN8A 3WKCA 3QUCA 2IA5A 5ALEA 2PQ0A 5E0OA 5ALNA 1VJ5A 2HOQA 3AR9A 3ZVMA 1WZCA 2YBDA 5AW1A 3E58A 3KOOA 5AKEA 4CF3A 3E81A 3ESQA 2I34A 4BEVA 5AW3A 1RMQA 3WK6A 2G0AA 1YNSA 3OCUA 3QUBA 1RPZA 3W5CA 4UMDA 5AW5A 4BNDB 1ZD4A 5AI8A 5AK6A 4XQ0A 3UMBA 3KBBA 5AM3A 2G80A 4CE6A 5JJBA 2G1AA 4I9GA 2O2XA 4YH1A 5ALMA 2EAUA 4HGQA 4F72A 5AW7A 2C4NA 3QU7A 4PNHA 4CF4A 2CN1A 2HO4A 3SKYA 1RLOA 3UMGA 2ODAA 4IG4A 2AH5A 3MN1A 3ZX4A 5AK3A 4NAVA 3HLTA 3U7EB 4Y2XA 3MC1A 5ALDA 1XP5A 5AKKA 4EZEA 4HYTA 5AIBA 1FEZA 2RBKA 2B1QA 3U13A 1T9ZA 2FPSA 4L6AA 1Z4KA 5ALTA 1ZRMA 4MUMA 4HGOA 4Y2PA 3FGOA 1CQZA 4CNQA 1J97A 1LTQA 2I54A 3I28A 3QU9A 4Y2RA 2HF7A 3I1YA 1RKVA 5ALVA 3PCTA 3QX7A 1ZS9A 2CFSA 1VFPA 3U7GA 5AVSA 1ZD2P 2Q4TA 5AI6A 3PGVA 3L8GA 5AIAA 2FPUA 2YFYA 2IYEA 1QYIA 2IOFA 5AKGA 4OFZA 4OD0A 2WFAA 3ET4A 1WVIA 4XE5A 2GO7A 3R4CA 5AKHA 2I33A 3L8FA 3HYCA 1RKUA 4QJBA 4Y2JA 5ALHA 3UMCA 1IWOA 3QXGA 3KDPA 3B9BA 4YGYA 5AW2A 3M1YA 2YMQA 3GYGA 4UM7A 3FZQA 3ZWKA 1YS9A 5IS2A 2G08A 3E84A 3L8EA 1N9KA 3KD3A 3BA6A 1TJ3A 4YCNA 3QUQA 1YMQA 3U19A 2HEGA 2JAOA 4YCMA 3SLRA 4FFDA 3FVVA 2G09A 2CFTA 5A3SA 2X4DA 2MSNA 2O9JA 4O8CA 4UW9A 3EF1A 4OHFA 1L7MA 3SD7A 2G07A 2IOHA 1XVIA 3NIWA 1NRWA 4AS3A 3AR2A 4Y2UA 3ZX5A 2C88A 4KX3A 3PGLA 3ZVLA 3R09A 3TLMA 2P27A 4HGRA 4UAUA 5AM0A 3QU2A 3WKEA 1F5SA 3W5DA 1EK1A 3M9LA 3AR3A 1Z5UA 2PKEA 3L1VA 5A3QA 4Y2SA 1T5SA 1L7NA 3WGUA 5IT4A 4BNDA 3ZUPA 2QLTA 1ZD5A 1T5TA 3WK5A 3W5AA 4G9BA 2WF8A 2HDOA 1PW5A 2ZBFA 4UASA 1U7OA 4BBJA 4DW8A 2CFRA 3IB6A 2ZOSA 3FM9A 3NALA 4CF5A 4KNVA 2YY6A 3QGMA 3IJ5A 3ZTWA 1QH9A 1Z4NA 2RB5A 2WM8A 3WKBA 3WKAA 4NWIA 4HGPA 4UATA 4KNWA 5AW8A 4Y2VA 4EENA 4AP9A 5ALLA 3FPSA 4FE3A 3KC2A 5ALRA 3B8EA 5AI0A 5AM1A 2YMLA 3OCVA 3A3YA 2FUEA 1TJ4A 2WF7A 5ALUA 2HI0A 2RAVA 1QQ5A 4UAVA 2PR7A 2YJ3A 3L0BA 4B6JA 4EELA 1RMTA 4E88A 2W43A 2ZXEA 4BKMA 4FYPA 3OCXA 5AI4A 3K1ZA 3AR7A 4J2TA 4UU0A 2R8ZA 2FPRA 1O03A 2W4MA 4Y2TA 1Z4JA 2B82A 3I6BA 4AS2A 1Z88A 3NAMA 5A3RA 5ALXA 2NO5A 2EATA 3P96A 3QLEA 4YCLA 2OA0A 3S6JA 3SMVA 5AK4A 5ALSA 2WF9A 3RFUA 5AHXA 3UM9A 2R8XA 1RLMA 4BX3A 2VKQA 5AVYA 1O08A 2B0CA 4C4SA 1KYTA 4UMVA 5AKZA 3U26A
chains in the Genus database with same CATH superfamily
3NVDA 3KE8A 1E1NA 1FX0A 1QJCA 3GLTA 1J23A 3SNHA 1YAHA 2C4TA 3KZ1E 1K86A 1PJ8A 2P6PA 4J90A 4M6WB 2HQRA 1I0ZA 1O6BA 5AICA 3KEMA 4HLUC 4FXPA 3WQBA 1GL9B 4LC0A 3ZI4A 2WHPA 5I5EA 1NF8A 2WOJA 1G7CA 2DHEA 3IUSA 3MD9A 4JBLA 4Q66C 4JDPA 4B40A 5B36A 2IXDA 4AKEA 3OU7A 2BEWB 3WGIA 1LF0A 4IYRA 2ZBPA 3ST7A 1CRPA 5LL6P 1BX3A 2C5BA 1MV8A 1Q95A 3DAOA 3DM9B 1RQLA 1DU4A 1XDUA 1LSUA 3FPBA 3ZGYA 3UOWA 1Y6JA 4DIFA 1KQFA 1LRKA 1KPIA 2G71A 4G4GA 4JBNA 4WBNB 4B32A 2FPKA 4BX8A 5KYKA 1BVHA 1N6IA 2NU7B 1U31A 2BELA 2BFEB 2V0CA 4PWZA 3V7YA 3CEMA 1HOXA 2CNOA 2GPTA 4HWRA 1KR5A 3BA1A 1Y3BE 4FMDF 4FSDA 2R8EA 4BMOB 4QGSA 2GESA 3KOXA 2V59A 3NVAA 3EY9A 3PCRB 2YJZA 3SOPA 1LTKA 1TJ7A 1UH5A 5DEOA 4FYKA 2C8LA 4TWAA 4PTLA 4BJ3A 3NT4A 2YINC 1H2YA 3P9SA 4V1CB 4GZ5A 2F43A 1TZKA 5SZIA 4YAUA 4HGNA 3FRIA 4YRZA 1F0YA 4P33A 1G42A 4CEHA 4GMGA 5L40A 5F64A 4WZZA 3R3WA 2VSFA 3L7IA 4L4YA 2NU6B 4MYCA 4MUNA 1E66A 4GI2A 4YP0A 4Q02A 5CYFA 4LF9B 5AW6A 2ZYUX 3CCCA 4US0R 3Q6MA 2CDRA 3AUTA 2BFMA 3I5UA 4NU0A 2OYCA 1XQVA 1KXJA 4HNVA 1TJ5A 4ZYWA 3OEED 1D3AA 3LMKA 4KDEA 5TDHA 1OLSB 3H5LA 5C7IO 1ORIA 4OI0A 1NKSA 2IYTA 2FP4B 5E3JA 1OQAA 3GPDG 3L04A 5CX4A 4PIPA 1YUNA 3KR1A 4QBHA 5F1KA 2NP7A 2HIAA 2JI7A 3L0DA 1CVRA 2CJWA 2VEDA 4PLPA 4EVQA 1IXZA 1QRRA 2Y67A 4MULA 2BDTA 3COYA 1E1RA 2OMKA 4R0NA 2G77B 3KOYA 1Q22A 3AIKA 1O54A 2EG9A 1N3BA 1FP1D 5I6DA 1MGOA 3P0RA 3BMCB 4IQFA 1TZ2A 2LP4Y 3TN7A 4N8SA 1NJ1A 3PZRA 1WMDA 4DA0A 1C3UA 3QOYA 3VYVA 1HT1E 2IYFA 3WHIA 2O5CA 4NXMB 1FTQA 4CM6A 5E2IA 3LBYA 1XA0A 2OB1A 3PEUA 5DISB 5IC5A 1O4WA 4YWJA 1EDZA 4ZGGA 3OZUA 5FI1B 1D6JA 1MT0A 2AR9A 3VPBA 4CT4B 3E27A 5CA0F 2GSWA 3IBFA 1N5DA 4PSVA 5JANA 1Z5VA 4BFUA 3GRVA 4OHYA 2YHSA 1EUCA 2B1RA 3EXFB 1QVWA 4JJ4A 2Q50A 1UM8A 2W6IA 5JC1A 2AF3C 2VHJA 2R1TB 2MSLA 2WQ7A 1KQ7A 1L5WA 3PXEA 2POQX 3TZEA 3SJCA 2OUKA 4MA4A 4C4TA 5AQEA 1K08A 5L4SA 5TLSA 1SIWA 2AI1A 2MJLA 1JFSA 3W2EA 1VIAA 3LYUA 4CEHB 1J2UA 1DS6A 4P1ZA 1FS4A 3CB2A 4YAIA 5F9FA 3EPRA 5HIKA 2XGOA 3BH7A 4WY5A 1EXDA 2FP3A 3H2HA 3VV3A 5DCLA 2ZJ1A 4FZJA 2OXFA 4ML3A 1RJDA 3QUTA 2H2HA 1XD2A 1XZDA 2GEKA 2OAEA 5D8DA 2X5XA 2GK3A 3DT8A 2BT4A 5HM6A 3DCNA 3O94A 5L8VA 4E4TA 2ADFA 2AQIA 2ES4A 3IDAA 5KNDH 3HVRA 3GBSA 4ZO8A 4D6YA 2YBEA 4Z7OB 1FRVA 3INNA 5CM8B 3ZD8A 3IO3A 3TNFA 4DMHA 3BREA 4G4JA 2ECOA 1M34B 2VPIA 1E2QA 2ZRJA 3LA6A 4B7UA 1L7PA 3WGQA 1X8KA 1CBUA 2FLVA 4K3UA 5L7WA 3KQKA 2DHDA 4FFLA 2ZBRA 3ONFA 3WYGA 5KWVA 4MQEB 1T8PA 1G64A 2GJ9A 3MWKA 2AMYA 3OCYA 2H48A 3FMPB 4BATA 1A8IA 2Q7XA 3ORHA 2JLRA 2H7YA 4JC4A 4UZSA 2OBMA 3CLUC 4HOYA 4JXKA 1NMQA 3AJAA 1ISJA 3W9BA 1P72A 2WUWE 1MG5A 2H9IA 3KV3O 1NLUA 4XVQA 4Y9TA 3ED5A 3TAHA 1KYXA 1IZ9A 1JXAA 1L7VC 3OJWA 4KU4A 3U9SA 2Z6AA 5HFJA 1MGPA 2X4GA 4Q9DA 3LVBA 3QX8A 4FR0A 1E61A 4Y6PA 5FFMA 1CIJA 1GNRA 1ZVKA 2AXQA 1RBQA 3GQBB 4XPIB 3ANXA 5DYTA 4QGFA 5B64A 3MCWA 5ETJA 5CLLA 2C4VA 3G0HA 3QFCA 3OT4A 2FI1A 1DKRA 1YBMA 3B6IA 1AMUA 3JAKA 2Z6VA 3EGIA 2HCFA 3PGJA 5AVWA 2FX2A 2PMWB 1H1LA 1SJ9A 4HDNB 4TLDA 2PBZA 3G79A 4XUDA 5JQWA 3LBHA 5FO1A 3FAKA 2QRMA 2DUMA 1RYMA 3ZS8A 1QCYA 2G70A 1UT8A 3GFRA 5JTUA 3WE7A 4M0DA 3A6PC 1E1YA 1L5FA 3DC7A 4J0DA 4AN1A 3RSLA 3N1UA 4MUEA 5B5SA 1M2OB 1LW7A 4URFA 3W6ZA 2PX4A 2ZT6A 4ACBA 1MT3A 1QVVA 5EUQB 1G291 1E77A 1UWCA 1XGKA 3EZXA 2G5GX 4E2FA 3HA7A 2PJDA 4RTOA 1T2NA 1ETUA 1RCUA 2E4XA 3PQEA 3NHUA 4R69A 3ZJ4A 4BPBA 4HFRA 3QU5A 4R41A 2SKEA 5COQA 4G97A 1W36B 5H3CA 1ISFA 1ZCZA 2OM2A 5F78A 3S8MA 4B73A 3M0EA 1FDRA 2DPHA 5KVQA 2R47A 2WKWA 3IILA 5JSZA 1YJXA 3T4PA 2IPMA 4OJMX 1CRZA 3WNZA 4ECEA 1NJSA 4O4IA 1XZBA 2BHSA 3G2QA 1LWOA 4BP8A 3ORFA 2DE0X 1OH8A 3Q5EA 3FKQA 3K8QA 2PL9A 2IT1A 1DPFA 3E48A 3G2OA 1KAEA 3ZR4B 1IG3A 3BTSA 3TSYA 1RMQA 2F1HA 4LF5B 3W05A 1DJQA 2IZZA 1VG0B 2PBFA 4O2BA 3FF1A 3KQYA 4B3XA 3H2YA 3O26A 3IH5A 5LCXA 4DPMA 4OBEA 3L4KA 2GN8A 3ZQ4A 2HSEA 5JJBA 1NHGA 3BMQB 5D00A 3TO5A 2WLSA 3ZWCA 3HBFA 5KJCA 2BOVA 5ALMA 5JCOA 1W88A 5JSHA 3RAEC 3PIDA 3ZDFA 2QX4A 2WD7A 3AI1A 3TDMA 4EYOA 1R9JA 2YXBA 1LPPA 1IYZA 3P8ZA 1S6YA 2AOTA 1NBHA 1VYUA 3C41J 1YHYA 3MGAA 3NZEA 4H0CA 3RI3A 3RNLA 5MDHA 4PF1A 4FILA 3HP4A 2IH4A 1ZSNA 1TOAA 2QLLA 3BEDA 4JLBA 1ZEMA 4L8YA 2Q46A 4RGVA 3C48A 3DCIA 3IT0A 3N39C 1EUYA 2GN2A 2H4WA 1I33A 2QG4A 1T8RA 3GC6A 2LIVA 2X9GA 2OLEA 3PFKA 4INPA 1F4PA 1ADYA 1GU0A 1Z0IA 1ECJA 1JDTA 2B1QA 1K62A 2X5KO 2Y0BA 3BRWA 4GXNA 1POWA 4IDFA 4ZVOA 1NBAA 4A1FA 4HRVA 4HKTA 4XYLA 4EGSA 2FX3A 3AI2A 3B7PA 2QV0A 3GP5A 2LW7A 2HZBA 1RI1A 1PFQA 4AJOA 1P39A 2FWPA 3VNAA 3CZCA 2OR3A 2HF7A 1KP2A 1W73A 2OEPA 3H2JA 3IXMA 2W0MA 5H80A 3ZKAA 2X6RA 3QX7A 1XKXA 4YMHA 1RABA 5A06A 1WXXA 2HZ7A 2WSYB 2Q1YA 3D0KA 3M6VA 3U7GA 5AVSA 4M37A 4NRDA 4PLTA 2CHFA 1ILEA 1HNNA 2DFDA 2VPQA 1NY5A 2AL7A 4NV3A 2INGX 4ABTA 3NWBA 1SOMA 2UZ0A 3RBZA 4YV7A 4HMOA 1IBMB 3P9YA 4F91B 4FBMA 4QICA 5BWMA 1KJYA 3E70C 1QRSA 4GZLA 3WMXA 1JIQA 4R2MA 3RTCA 3R4CA 3QBJA 2XYQA 3H65A 5CH3A 5A9SB 1Z8NA 3AESB 4EHKA 2QTVB 1FURA 3FW1A 1XHEA 2IP2A 4PPGA 3UHAA 4TWBA 3WJ1A 3SLGA 1NT4A 1PJBA 5EQDA 3RRYA 3FYSA 3KDPA 1FJXA 4WZ6A 2SKDA 2EEPA 2XUQA 4IIJB 4LGVA 4REOA 1IIBA 5JG7A 3OJEA 1OI2A 2QYOA 1BNCA 2Y93A 5EJ5A 1E3QA 2WM9B 3KYDA 4Z53A 3JZMA 4I4NA 2P7IA 1S0UA 4RYLA 1KL7A 4UNRA 1U7UA 4GO1A 1Z5ZA 3L92A 2HMTA 4W8GA 3T9BA 5BVHB 3RUDA 4CMGA 5KTSA 2QWXA 2ZE8A 4X7MA 2O9JA 1J39A 2XWBF 3NAGA 3RD5A 4AECA 4JUFA 1FC0A 1M8GA 4ZQGA 3B3FA 3RS2A 2FMKA 4CM4A 1EVIA 2PBRA 4YFVA 1NA5A 3T7DA 3KQUA 3ICQB 2F8TA 2OCAA 2H1VA 5HRAA 4RJIA 4S04A 2I5PO 2B78A 5HJ5A 5JCPA 1U99A 3RU7A 2EJCA 1NMSA 1CLUA 1Q7CA 2NU6A 1YC2A 5H8WA 1ECGA 4JFRA 1JG4A 1MAVA 1SC6A 1TQ4A 1UK8A 1V7QA 2D2FA 1KBZA 3GEMA 1VSTA 3DE5X 3TLMA 2H7XA 3EIQA 4BKRA 1M9NA 3D5QA 4DLTA 4Z4FA 1P31A 1NNSA 4ZMSA 3PQCA 3DL0A 3SM9A 3AF1A 3G89A 5MN4A 4KWCA 2GI4A 3SZOA 3IAS1 3AFGA 4QOIA 1FDTA 2CNDA 3I2YX 4M9ZA 4QDKA 4C2TA 1S4MA 2FEPA 4BB6A 3ZBUA 3HCOA 1OSNA 1R5OA 3UUGA 4Y1GA 2K7ZA 2DG2A 5B53A 1HOTA 3K9GA 3QP9A 1GADO 1ZW1A 1WHTB 2IYUA 3W6NA 1YI0A 1YQUA 1NVXQ 1Z36A 2BFCB 1XYGA 3B1VA 2K5UA 4RM2A 4WDRA 1E0JA 4DANA 5I9NA 2J0SA 1Z8FA 4I99A 2G8LA 2BVNA 2F8MA 5E6UB 5LDHA 1E3WB 3W5AA 4FW9A 3TR6A 5CCBA 2ZULA 4MRMA 3QYJA 2PQ6A 2ZBFA 3NCHA 3STHA 4CV0A 1QPZA 1WVGA 1HFKA 3M6XA 5EFOA 4EY5A 4KSCA 1VCNA 4IDAA 1VSVA 4HLQB 4RA9B 4RPIA 5HK8A 1IEQA 3GGDA 3IB6A 4M8NE 5J3JA 2QMYA 2VT6A 3RG2A 1CDDA 4LXYA 3H42B 3V4LA 5BR7A 2EL7A 3FNQA 4B6QA 5CUQA 4ZCLA 3FD8A 3L77A 4FGKA 1ZSVA 2IZ7A 3T4UA 2R9VA 4MHOA 1OFHA 1Z4NA 4EGFA 3L6DA 2UZ4A 4ZQCB 3AO0B 3IOEA 5JLJA 3NVMB 5EG5A 3EEQA 4TTPA 1XBTA 5J43A 1S96A 4MAMA 4D3DA 1GVHA 3VMFA 4ZHQF 3GNLA 3I8SA 4DB4A 5ALLA 2HSWA 1ZHOA 4NH0A 2OHHA 1ZNQO 4PCAA 4NOJA 5IH3A 3VNBA 4NLEA 3E2IA 2RC5A 3TZLA 1P8JA 2DFPA 3IQHX 1EJ2A 2AC2A 2GCGA 2IPNA 3IURA 3GV0A 3IP7A 5LU8A 1CVLA 4NE7A 4LXUA 3JARA 2DXIA 4GOND 4MUFA 2DB3A 2WE7A 1Y6ZA 3TK1A 2RBEA 4UC0A 4JY7A 1M73E 2QIOA 3KE9A 4PINA 3MEQA 4GLBA 2I7TA 3WGKA 3D59A 3MTEA 2R7AA 4O2LA 1RSZA 4A2PA 2LXNA 3H05A 3NV9A 4UHJA 3DOIA 4LJKA 3KHKA 1DRKA 2FZWA 1VE1A 1W19A 2BR5A 5EHNA 1D2CA 2IYAA 4WKCA 3C8TA 2VNIA 5JWOA 3Q4GA 4O08A 1EFDN 1APBA 1U0SY 3I39X 1E4YA 2X2FA 3ICWA 3KAJA 3T54A 3DR3A 3RANA 1G8JA 1RCTE 2QTRA 3IAUA 3OC6A 3ANTA 1H2AS 2ISSD 1WDMA 1NN0A 1DAEA 1SVUA 5KUTA 2C84A 1OI7A 4L16A 1VA4A 3JWHA 4OKNA 1PT8A 3A0UA 3UB2A 3QM1A 2QAGA 3TUIC 1OROA 4PAOA 5TB5A 4ZZ0A 3JD3A 3UO8B 1VKHA 1QHSA 1Z25A 2WEKA 3R4VA 4L07A 5CT5A 5F3WB 2OA0A 4WBSA 3JWJA 1NFQA 1VKJA 1VLHA 1ABBA 1UKEA 3NTLA 4QYWA 4ZKEA 1JXOA 1DI0A 2ALJA 5EC8A 1Y7LA 5JY6A 1U8FO 2NYAA 1E2IA 1DWPA 1H0SA 4JOQA 5FOUA 3COSA 3GG2A 3LV8A 3QXSA 1P0IA 2GXUA 3EIUA 2JG3A 1JLKA 3Q1KA 1EINA 1GQFA 4I4TA 4XAQA 5B1IA 4JXXA 1YS1X 2VQDA 1KSJA 1R0ZA 3R9WA 1VL1A 4U1RA 4PNEA 2QZ9A 3VGJA 2P3LA 4GICA 1C7JA 4QASA 1JHDA 3AB7A 4S2EA 2MSEB 3DVRX 3A1VA 4O59O 3T5BA 4BFTA 2JGNA 3K5IA 4G0QA 1RBYA 5SYAA 1M6VB 1U6KA 1YVPA 2I1LA 1CUDA 1R4ZA 3M1IA 1U2TA 4EZBA 2RGAA 5EIWA 1DIOB 1RQPA 2W2LA 1OLXB 2GKGA 2Y2UA 1NYLA 4BVJA 5AD1A 3LT0A 1DC6A 2J87A 1OH6A 1QYWA 2JARA 1X1SA 1KRHA 2PT6A 3CN7A 3NP7A 3QKRA 3QFRA 3LTEA 1RC8A 5FI5A 4FGLA 5GJWC 4EHBA 1YFZA 1NBMA 3VRHA 3RC8A 1WZEA 3FCOA 4XUEA 4X6LA 1BE8A 1NX9A 2QX6A 2J6BA 2OBYA 3MXOA 3QTTA 1H93A 3UWSA 3ORQA 1ISIA 2XSZA 4AJIA 1PV1A 1Z4MA 2D2VA 3FGZA 3P9XA 1TK9A 1UJ6A 2FWJA 3MGBA 3NBZC 3BMNA 3LRXA 4GIBA 3SJAA 3IVXA 4BP9A 2I2CA 2QX7A 3D6JA 1WG8A 3M8KA 4LOLA 3A4MA 4UTOA 1KSGA 4X65B 3V00A 3KZXA 1LLFA 1Z83A 3BAFA 3EK2A 3PDWA 5G4KA 3VR6D 4M3NA 4UEOA 4HAOA 1BD4A 1XZLA 2P6NA 3H83A 1HDRA 4JIMA 4ZIRA 5KYWA 5LPNA 2GCNA 3OPNA 4MWGA 4WK4B 1D09A 3GZ4A 4GOLD 4IJ6A 4J0KA 3FYUA 1JIKA 1HSZA 3F47A 1C7IA 1QE5A 3HXMA 4KXWA 3LW7A 4N76A 3OC0A 5DWVA 2O5EA 2B98A 1ZUD1 5EKXA 3SHWA 1E59A 1P6UA 4XJVA 3EA0A 3D7SA 4HWGA 1RXUA 3EIOA 1SKYE 4ETNA 5ADVA 2FRDC 1Q7RA 2Z1DA 3LHIA 2H8GA 3WXBA 2JBHA 3GUYA 4PYKA 2IS1A 1Y1TA 1YONA 1E60A 1H22A 2D3WA 3D7MA 1QO0A 1M0WA 2QL5A 1W0JD 3ZV6A 1ZMOA 3IBGA 3LUPA 3OX3A 3U81A 1SG9A 1NVBA 1CF4A 1S1MA 3GOHA 3MS2A 1XTPA 2YQ4A 2G1KA 4QUHA 3TB6A 4BFYA 1FX1A 4PZEA 2IF0A 3A1EA 5EMKA 1QRAA 3DH0A 3GPLA 4CKBB 3O2QB 2YZKA 3PWKA 3GLFB 2I1WA 1XDSA 3BL6A 4S05A 3AFHA 1AGNA 1XZEA 2WPDD 2GB4A 3E61A 3E3LA 5D86A 1KFCB 4ONEA 3L7YA 3DKPA 1VPTA 1E2LA 3OP1A 2VP2A 2V3VA 2ZJBA 2C8KA 3K15A 3M2PA 3NUQA 4MUBA 4N03A 4OLFA 2V6FA 4C6TB 1GT6A 3DVLA 5LZ4A 2H1OA 4M9CA 2X58A 1KRWA 3HRKA 5FQNA 1E6LA 5GM2A 4AKSA 4KXQA 2GZRA 3BHMA 3W4JA 4AN0A 1ZSYA 4L28A 3PE3A 2JD1A 3MLEA 2A7QA 5LYYA 3TMAA 2WHRA 1BQ3A 3U6KA 3OZBA 4U3JB 4E5SA 2PN1A 5F1YA 1GXSB 3H2IA 4RZUA 5C52B 1GLVA 3AGPA 3IHTA 1XMPA 1HSOA 3KSMA 4WY2A 3RT9A 4U6SA 3PDCA 1AKWA 3TTUA 2XNSA 2XUPA 1GU1A 2DCUA 2PD4A 1QIFA 4RACA 4DARA 1SCJA 1V11A 2HIGA 2JFUA 3HDJA 3T12A 4DDVA 3H8SA 3IP1A 3VOSA 2DAPA 4YP7A 3RU9A 2OLJA 4QUKA 1PN3A 1Z4QA 2H17A 4ZT2A 5KKCA 3IEMA 3U4IA 2A0XA 3AERA 3STWA 3THYB 4FI3F 1Z0DA 2Z5GA 2R6R1 1XXHE 1UJNA 2V7UA 2HJRA 4JVLA 4DMGA 5BXQC 5EZ5A 4YAKA 3PC2A 1L6RA 1YJBA 3PC3A 3RVRA 1Z5WA 5ALPA 2G3YA 4CIWA 4QYXA 2YJ6A 4C4RA 2C7VA 4I55F 3R7NA 3RAJA 2VA8A 4IUBS 1CD5A 4CUKA 3LWZA 4FHFA 3PNVA 3OQOA 4K9KA 4Y2YA 2P2SA 4ZJUA 3SKXA 2DLCX 1L3BA 1ZZEA 4OHCA 1AUWA 2VNJA 4WNAA 5FPYA 1UMKA 3LUDA 4AP6A 5EHZA 3IKVA 3IELA 3BB3A 5CFRA 4OL9A 3ZU6A 4NMMA 4RLHA 1QYRA 4QG7A 4QE3A 4RTPA 3SIWA 3CLRC 3H2KA 1EG7A 4DAEA 2KE5A 4UXJA 1FFHA 2Q5JA 3I2FA 2P4UA 1OWNA 4AYXA 3ZGZA 1X70A 1RFGE 4AFNA 4LEIA 3L0YA 2FZGA 3BCRA 3FSJX 2HLNA 4Q1EA 4ZEWA 1D0IA 4XWKA 4CMCA 3I04A 2VTVA 1SU4A 3M2TA 4O1MA 4QC2A 3TOSA 1JEQA 3VU8A 4I3FA 3C2QA 5TQVA 5C35A 4OY3A 4TYNA 1QK4A 3MPOA 2Y0PA 3T1NA 1OGJA 1S8NA 2A5GA 2FK8A 5E9QA 2QTBA 1HE1C 1V6SA 1G8SA 1T0HB 2CBZA 1W9HA 1NSTA 3QKSA 1GNPA 1VXOA 2C3OA 3CVXA 4Q4JA 3G2KA 3SZUA 1OXBB 3T3PB 4UUBA 2QN7A 1ZN2A 2VZEA 2X23A 4N7MA 3WK8A 3JWIA 2YL2A 4XYMA 4UAGA 2IY7A 3EZ2A 4LHXA 2QEQA 4R9NA 4YT2A 2G06A 4DQDA 3R8XA 5K6AA 5I7SA 4QPCA 2ACKA 3O8LA 3QVUA 3ZDCA 2G4VA 4LSWA 4MIEA 4ZJZA 2ZEJA 2IEYA 3VI3B 1TVKA 5H59A 1LDBA 4OK5A 2H2DA 4BO0A 5A9TA 3AJEA 3WL4A 1JIUA 2FMFA 4R71A 4DDKA 5KQRA 1HR0B 3O83A 1Q5NA 1PI3A 3V4PB 4UJ3A 3GY0A 4L3OA 4RZSA 1Q0HA 3VBCA 4D92A 1BE1A 1TZBA 4DA4A 5CM2Z 4WD3A 1JHYA 2GYWA 1E1MA 1FW8A 4GBED 1Z4PX 2HSJA 3ZE6A 4H3SA 2YZ2A 1QFZA 3GWGA 3QPBA 1E2JA 1P5FA 5C46F 1AXRA 1SUEA 1L5VA 2DPLA 1B76A 4M6WA 3BTOA 1QRUA 3LQYA 2PDAA 2BZ0A 2Z6UA 1GT91 5JNTA 5E7JA 4GI3A 4HMPA 4OJKA 1I1OA 1RHKA 3FDFA 1WD5A 4DSNA 4RENA 3DOUA 2IZOA 3U2QA 5KYTA 1YZUA 2I62A 3EXG1 5IVHA 3OF5A 2E2WA 1FIUA 4NI5A 3HE3A 3AY3A 1RWOA 2PKCA 2WQZA 2BGTA 2ZATA 2E48A 3V1LA 3VGPA 3WLTA 1DAFA 5JAHA 2PGLA 3SU8A 3V1MA 2NX2A 3WOVA 5KU1A 3JAMA 1XTIA 3WX0A 4DLKA 1VP9A 2JGEA 3SZMA 1E6KA 1AG9A 1T10A 3OF2A 3VYSB 2J5RA 4F6RB 2QRJA 3SVLA 4ADSG 3DBRA 4QGBA 2TECE 2HU7A 4QLBA 1OLXA 2I29A 4WXYB 2OQVA 2I7CA 1FUUA 1TYCA 4QWMA 2CE7A 2F6RA 1P2DA 3ABQB 4HGVA 4XGNA 5CPBA 3PI6A 1YU6A 3Q3CA 5DLQC 3EWSA 2HL6A 2WP8J 2O3RA 3HB1A 2F1KA 3JSXA 4NULA 5KYUB 2RE8A 5FEMA 2X77A 3EEFA 1PUIA 1KOFA 4YNBA 2C3UA 3PNOA 2QRGA 5EHIA 3OU6A 1LDGA 5EZQA 3WLEA 2X0EA 3GHYA 4LCEA 5B7QA 2NU7A 1P4JA 1FOEB 4ZARA 2ZRGA 2AH5A 1D8AA 2I6UA 2O2HA 3TX6A 5HBGA 4KSBA 2HPVA 2VWPA 4XB2A 1NW3A 3NTQA 1J21A 5DHTA 3V80A 3RU3A 3H3JA 3Q3JB 3R0ZA 2G36A 2XUFA 3B3JA 3SP1A 2OHGA 3UB3A 3R7WB 3ME5A 2HFJA 3MAGA 1F38A 2VP9A 4NJMA 4P7JA 3PHIA 3OFJA 3TD6A 1AQLA 1U28A 5EJ8A 1XD2B 1ZI8A 2APJA 2QUJA 2X8JB 1H69A 2QN6A 4YRJA 3V7FA 4C1NA 2QBYA 1PHRA 4EB0A 4WUVA 1JVSA 2YH2A 4PW0A 4HDOB 3HN7A 1GZ3A 5KSPA 3G5UA 2RGWA 1LTQA 3O7MA 4RV4A 4ON9A 3AB8A 4BASA 1QTRA 4F4FA 2XADA 3V33A 4ZKDA 2W4QA 2DWCA 3ZHXA 3DE4X 2KHZA 5LKRA 3PCTA 4CUJA 4N0MA 2HA0A 1U0GA 2HF9A 1OIVA 4LX0A 3IUEA 1O94A 1BFKA 1YCDA 1A8UA 2XQKA 1NF3A 3OKAA 3WJ7A 4RTJA 4FEAA 2PZJA 3LX8A 1W46A 1YRLA 1QYIA 2RGGA 3R7SA 5CVTA 3AONB 4XLZA 2C7PA 4KPYA 4UHBA 1NN5A 3RYHB 4EJ0A 1CX9B 1FU4A 3DEKA 2PPVA 3EDOA 3ZD6A 3D0OA 2V9ZA 3CLSC 2UKDA 1ID8A 2GUWA 3C3XA 4S1PA 4R1PA 1GKIA 2PGJA 1TCUA 4TVOA 3R7BA 4A8JB 2EQAA 2R751 1KP9A 3TCKA 1OGYA 3ZCPA 5I47A 4RTNA 4B8ZA 3AF2A 3O1LA 1GTVA 3R5JA 5ALHA 2RHOA 3DF7A 3UMCA 3F5FA 4HO1X 2OLKA 4JUDX 1CCWA 4EL5A 1GZHB 4KG7A 1AKTA 4YO7A 1E5VA 1OYOA 3L1JA 3FNBA 3MWJA 5JPCA 4ITUA 5IRCD 1CQWA 1V1MB 2G08A 3C14C 2C5AA 3QWAA 4AWXA 1ZJ6A 4B7ZA 2L18A 1U65A 1CUXA 3KD3A 4ALNA 3THYA 2FSSA 2GM9A 3VVMA 1AVTA 3R3HA 4OJTA 3ZU4A 3WL5A 1Y8RB 4ZAYA 1T34A 1A8HA 1Y8QB 1GYRA 3GT0A 3PNLA 1C3CA 4EI9A 3B48A 4L9WA 3RFXA 3EIXA 4FNAA 1HETA 5DHUA 4TUYA 5J2TA 4G5YA 4R6WA 3O8RA 2QR2A 2B8NA 1XMSA 2NXWA 3KYCB 3OM1A 3TE7A 2CLLB 1GOTA 2ATIA 1TYBE 5JSZB 1L7MA 1JJBA 4F38A 4HQLA 2XDQB 3ZLBA 4KYVA 4HRYA 1XVIA 2BM1A 2YZMA 4PZPA 2AUMA 4FE7A 3Q87B 2VDUE 1D4FA 1QYDA 4JDUA 3MCTA 2CXNA 1FY2A 2TMGA 1XN1A 3KLMX 5JQGF 1JR3D 1A2KC 1BROA 2CXHA 2R0QC 3FFBA 3PFFA 3RIEA 1XG5A 2FUSA 1DMSA 3L7AA 1TGVA 1CEQA 1W4CA 4MVJD 1H3EA 5ILQA 1D1TA 2F3TA 4M89A 4KLCA 4P3YA 5EWJB 3VC7A 2V9CA 4CM8B 4E14A 2PKWA 2X2EA 1F4LA 3OICA 1LDYA 3URMA 1L7XA 3O7WA 3KPUA 2HWKA 4Y0AA 1QGZA 2PT5A 1TTPB 2X0DA 1MENA 1J0XO 3QLJA 1JDNA 1PEKE 3GMSA 3T4EA 4B3CA 3C8ZA 3R6TA 4WEOA 1BWQA 1VMKA 2ZUEA 3QKSB 4MA5A 1GGEA 5BN4A 2QAGB 1AQYA 1PJ4A 1CF9A 1KMHB 3ZHUA 3HXQA 4IWXA 1RLUA 3ESDA 4MS4B 4LI3X 2ZJZA 4ER3A 1O6FA 3DT9A 4F84A 2QPLA 4I8DA 5CM9C 5FWDA 3T7RA 5CD1A 2BGLA 3RYCA 4Y1EA 4O29A 4ZAXA 3D6HA 4L08A 4XI9A 3RK4A 2QYTA 3E04A 4OA5A 4J3JA 1RXWA 3G6WA 4RGBA 4E32A 4I1SA 4OGWA 4IPTA 2QVCA 2WWHA 3HDVA 4JVNA 3ZIAD 5FOQA 4AJPA 2OGWA 3MRSA 3TQIA 5C4GB 3WKBA 4CM1A 3O90A 2ACEA 1XELA 2P9GA 2PS9A 4HGPA 1O8BA 1TA9A 4K9OA 1OJ7A 2QTTA 4WESB 5FORA 5B37A 2QL7A 5BNWA 3K70C 3WTCA 1FLVA 1K6JA 2A9JA 3I12A 5KTRA 4U2EA 3L9WA 5K0LA 1EVEA 2PZEA 1WKVA 3COVA 3V4SA 4A1OA 1NP6A 1PJTA 5D6BA 1Y5RA 2Q8QA 4GPTA 2NT3A 4R9SA 3HDGA 1ZR4A 2C2ZA 1EU1A 3K2BA 3HMKA 5ALUA 1VHTA 3CH7A 3SC2B 4BX9A 4I9NA 3I0ZA 5CB0A 1GR1A 3MELA 2J4CA 5BR4A 1P80A 1OFUX 4EJSA 3DDCA 1F3LA 2FZKA 2P0EA 2WSIA 2QRVA 4HDRA 3DEYX 2CHGA 1UPCA 1RI5A 2H57A 3CF0A 4KXVA 4RZ2A 1NULA 3N58A 3HV2A 4YC7A 4BO9A 3HSSA 3WLFA 2LV8A 2JJ8A 5AI4A 4P58A 4UU0A 2MMCA 2FN9A 3GN2A 4KR3A 3IUQA 4CG1A 3PUJA 4RHEA 5IK2D 3EC1A 3FMVA 1OR8A 1NJFA 1NVFA 5T4BA 2OV2A 1OASA 2D1QA 4I2NA 4K26A 5T5QA 5KHAA 3NAMA 1T4GA 4FOPA 1NIJA 5A0FA 4DMKA 5IMSA 3QLEA 3U17A 2V03A 2WB2A 1Y0BA 4BLTA 3DW1X 2HC9A 2XRYA 4J94A 1I7LA 1PFVA 3S6JA 5D7NA 4FN4A 1EBUA 3L8YA 3V34A 2WKPA 1ZIYA 3N3BC 3OIYA 4K6HA 4N0QA 2AYXA 1U0EA 2R8XA 3H11A 4HX9A 3VOBA 2OG2A 5T64A 3MXTA 1BO6A 1FB5A 4MRAA 3W77A 4B4VA 4D9BA 3L7KA 3QEBZ 3RABA 3I9JA 4GH5A 2BBTA 5J58A 1D9ZA 2AD5A 1NONA 1G6KA 4GMXA 3GLIB 4KTVE 4C0HA 3L7MA 2YVAA 2YOFA 4TMVA 3SM3A 4KR7A 5AK0A 4EJ6A 1VRWA 3R74A 1F1JA 1I30A 3FY4A 3L6RA 5AJZA 3T06B 4EPRA 4ZN6A 2NIPA 3LSYA 4JKYA 1N8KA 1L9KA 4CR7A 1L4LA 4YQFA 4KNYA 3BGOS 2VJPA 2Z30A 1U7ZA 3PX2A 4W5TA 4U0KA 1Y1KE 3PC8C 3Q98A 4M36A 3IV7A 3QV1A 1W36C 2EW2A 2DUNA 2Y9PB 3MAJA 3GFPA 2JS7A 4IWNA 4XD7D 3FTNA 5DX1A 4UBJA 2W98A 3EBLA 4BV3A 1WX1A 3CF6R 5HW2A 2IOFK 3FHOA 3K8ZA 1J00A 4KBYA 3VR4A 4B48A 4W9NA 5DI3A 1IW7D 3I9NA 3WK9A 1F48A 5F77A 5CLFA 3UWKA 2IOYA 4DFDA 4WBXC 3TQOA 4YACA 5AW0A 3LP5A 2VJAA 3R9XA 1I5OA 1U3TA 1VPLA 4KDCA 4BLPA 2YXNA 3GJZA 3EIHA 1DEKA 1I51A 2HSZA 2JJQA 4D9KA 4V0NA 4F6CA 4JR2A 3IVCA 3PUKA 5K3DA 1SC1A 2FWAA 1GAQA 1EE1A 1CZNA 1QAQA 1WE2A 1XEWY 2PL3A 1P0PA 2R1UA 3O9VA 4RQAA 5AW4A 1NJGA 4ZYYA 5AVUA 3QFFA 4DXHA 1G21A 2R7MA 4QD3A 2QAIA 4KMSA 4XW2A 1H42A 3FPLA 3GGOA 2FDRA 4PGHA 1LSOA 4E4RA 1Y48E 3WL3A 1JDBB 4YUZA 4BJ6A 4DV4B 3UBTA 3C3EA 2C5SA 4EF4A 3ZDQA 5JFOA 1NW9B 1JYFA 2JFFA 1IY2A 2D4HA 1ESEA 3EVDA 4PIVA 4KV7A 2QLMA 3H5IA 4UM5A 4V0KA 3DWFA 5TVGA 2C0CA 1PX0A 4UTVA 1NIPA 2GJ4A 3RWMB 4CM9A 1Z5OA 4I6EA 4Z4QA 1N25A 5DYNA 2MSWA 2ZK7A 1THZA 3AVQA 2M98A 4GW3A 1YNOA 3GOQA 3IS3A 4ID3A 4WFKA 5FOWA 3BE4A 2ESRA 3F6EX 2BTEA 3PHGA 4LC9A 1T5HX 5BN1A 1FFAA 1QONA 5T6BA 4NU5A 1E5LA 3FZEA 5BW8A 2GFHA 4S1TA 4B3RB 4B7AA 2NVBA 1GTSA 3TZ6A 1ISSA 1V7CA 2YDYA 3G2JA 2ZROA 1GGNA 1RAHA 5D5HA 2B5OA 4HH4A 3ROKA 3KWFA 1MJFA 4NFLA 3Q1LA 1ZMBA 2WA1A 4AJNA 2BKEA 2CLEB 4QOFA 4JP2A 1ZU5A 3MS4A 1E1DA 1NZFA 1VBFA 2R6ZA 2FRVA 3JVEA 5UKDA 5DNWA 2RCYA 3ICCA 1T3SA 2JW5A 3SBXA 1K6IA 4FXOA 3W5UA 5AUPB 5JZSA 1KYZA 1EM8A 4DV5B 2PSHA 3GFGA 3D54D 1DZIA 1PYOA 3I72A 5LB2A 1E2UA 3T7JA 3ZU3A 4XYBA 3SSAA 3UANA 2YN4A 2FFHA 4K8RB 2FUG6 5DGCA 4EUFA 1LK0A 4HAZA 4DC0A 3V4ZA 5L3QB 2PNFA 3RUFA 2DULA 1GUAA 2HHLA 4HVTA 3PE4A 3R8CA 3QKTA 4BE4A 1Q92A 2XNHA 4TRRA 3K0FB 3ZJ5A 3RLFA 3CJRA 4LF4B 2QVGA 4Z0PA 5JEEA 1IHDA 1BHQ1 1DC4A 1RAIA 1DCFA 2GCEA 2R5NA 4MKFA 4N0DA 4U9HS 2EFGA 2IOQA 3TGPA 2WFMA 8ABPA 5JAMA 3NGMA 3SR3A 5E8JA 1R6BX 1HYGA 2HBQA 1RVDA 4FNGA 4FYJA 5HDBB 2Q6LA 4L5AA 4EW1A 2D2EA 4RAOA 1LS1A 5CLGA 2ZQZA 2DR2A 3KUCA 1LBQA 1NVTA 2C9DA 2W93A 4QOHA 3KKEA 3L6UA 3LLVA 3WLKX 4BRWA 3LKBA 5J63A 1GFIA 4G5RA 5J5VA 2F64A 4LVNA 3UXEA 3UT0A 1I5EA 4Z4HA 1DWOA 4H3VA 2B1IA 4Y8VA 5DT9A 4F11A 1M6EX 2PKRA 4F86A 5FBVB 4BCBA 3C4JA 1V8FA 3LFHA 3KZNA 3V8QA 5KNCH 3JZFA 3O93A 1CP3A 1S7GA 1ZM9A 1VECA 5HOEA 3BSSA 4P93A 1J3UA 4PZ0A 3S81A 3PXCX 3QFHA 2EJUA 1FNBA 4CLRB 1QMGA 2ZCVA 4YREA 3C5CA 1XTRA 3VPDA 2PZFA 1SBHA 4XIFA 4DABA 4F4JA 3H6KA 2OC4A 4KV9A 5HIJA 3ZV3A 5KMGA 2CVHA 4F1KA 1IEXA 1V5EA 5F4BA 1SKBA 1IK4A 2H1IA 2VQFB 5HK9A 3IBCA 2C9YA 4JQYA 3CRRA 4MW9A 2JH3A 1CQJA 4PLZA 4PYIA 5EJGA 3SHQA 5LSAA 2O8BA 2V4ZA 1JSLA 2QN8A 2SECE 1ULSA 3Q40A 3QNMA 3DLAA 5J9FA 3GLHA 3R7AA 3VUFA 5KCZA 1B23P 4AI6A 2Q4OA 5I9BA 2H59A 5FT9A 4F8JA 2QN3A 2RG1A 3CLSD 2ZB7A 3KJIA 3PKZA 5IC4A 1VLLA 5FADA 3JRWA 4A26A 4A36A 2PRSA 5DX8A 4W6QA 4EAQA 5KNDA 4B09A 5AJWA 3BDIA 1G7TA 5EMLA 2Q2WA 3GJRA 5D5QA 4BWVA 1I1QB 3IIEA 1XTUA 2QRVB 4HDRB 5HTKA 4MPPA 3TOXA 1T9GS 4XIYA 3WDKA 2PTGA 1HYQA 2JBAB 1V4BA 2ZRIA 3CUKA 4D9EA 5BV0A 1QC5A 1M1YB 1E9VA 1QAOA 3P9QA 4M8KA 3ZCRA 1TIBA 4ZCRA 2FPMA 4QYSA 1VIDA 4YRAA 5IJZA 4NMLA 2QTZA 3WFIA 2QLJA 2YXDA 4RKYA 1XR3A 4OHZA 3REQA 2RGXA 1HDZA 3SZGA 4B45A 2EVWX 4FSXA 1EP1B 1XX6A 2AWNA 4CM9D 4EY6A 1N5IA 4M0EA 1MBZA 1JS1X 3NTVA 4IF4A 4FX5A 2GARA 4NBRA 4KIFA 1TF5A 5TY0A 4ILKA 3UPTA 4DTIA 1XAHA 2GBFA 3B60A 4P54A 1SRRA 5CT4A 5FLKA 3QY9A 4I50A 1QQTA 3TSWA 1E32A 3NYWA 5L6MB 4WKNA 1QU2A 1HT0A 4G5SA 3UJ7A 5I8WA 4EHHA 1NUQA 2XZDA 4XCXA 3MINA 3LNTA 1EVYA 1MB2A 2ASEA 3HJUA 4QAJA 1QP4A 4LFAB 4DIOA 1Z82A 1J7KA 4JOCA 1S2LA 1NN1A 1Z8HA 2HOQA 3PFGA 1EGVB 1JRLA 1TW3A 5HMLA 4A0HA 3LXMA 3TM4A 2R85A 2FHSA 4EO7A 1WDTA 5F9MA 2KQUA 2Q8PA 4WZAB 5K3FB 3SVZA 3HYRA 3PXBA 1BEEA 1IUOA 1XZGA 2J48A 4MCJA 2XGJA 3PC8A 1JB1A 1A7AA 3SZ3A 4MB0A 2WFLA 2XF2A 3LOUA 1E8DA 1Z29A 2VH1A 3BXOA 1JHXA 3ESBA 2PX8A 4ZYVA 3N2ZB 4V02A 3IOMA 5KJEA 3O5AA 1GL7A 1PZMA 1W2HA 3Q9UA 4YPVA 4U2CA 2ZPUA 1SC9A 4X1OA 3RFFA 4XVCA 2ZVDA 2ZRHA 4AIRA 1E2FA 2XY4A 1BMFD 2DSNA 4JCCA 1W5SA 4LQDA 1EXWA 3R77A 5CFNA 1FX0B 3C98A 2YR0A 3AUKA 1C3LA 1HDCA 3B1KA 3PA6A 4Z9AA 4C0LA 4POAA 1K7XB 4HQ0A 1YDEA 1GFZA 2PH3A 3I58A 4Z3KA 3TF5A 4MX8A 3K7EA 5DN6A 1ETHA 2PD3A 3CF4G 3IKMB 5AK3A 3UV6A 5EQFA 2W6ID 4H0FA 2PG3A 4N5MA 3U7EB 2K7FA 4UHDA 2UYQA 4DV0B 3MC1A 4MB6A 1TEZA 4LJYA 3GJ7A 2PGXA 5REQB 5LLSA 1EJ6A 4UBNA 2P3SA 3NHAA 3I6YA 3BRQA 1H8HD 1G20A 3REQB 3ZWXA 5IFLA 1MORA 1T9ZA 2GF2A 4FFBA 3T7KA 3E1GA 4R1SA 5KYUA 5JZVA 1CPYA 4HGOA 1XFAA 1TO2E 4EPXA 1RPJA 1YZKA 2HDWA 3FGOA 1RXYA 6YASA 5PGMA 2I54A 1F8GA 3NOOA 1U4SA 5H70A 2VPYA 5HQJA 1AMOA 4RDIA 3VOTA 2IH5A 1DOFA 3JARB 3T6KA 1AURA 2WPDA 3GXOA 1YB6A 2C07A 2OMEA 3FNIA 3IEUA 2QUHA 1E89A 1MVLA 3MIIA 4ZV7A 5HRCA 4C01A 4HUTA 3A6EA 4GOXA 1VMAA 2E18A 2ZSEA 4FJ0A 5LQAA 1X9GA 4HH0A 4B43A 2FPUA 2W6MA 1XCMA 1NATA 1R15A 1I8TA 2FPGA 5DT2A 5F2OA 2O5RA 2J0VA 1SAYA 4RKRA 2FTKE 3AIIA 2XDWA 1UEIA 3HUTA 1UKVY 2M6KA 3C3WA 2GPWA 5I7AA 5KB3A 4DY4A 1DT3A 5CAEA 5DV9A 1L4KA 4YP9A 2HKIA 5A6SA 4O2RA 3LPAA 4EFLA 2WWXA 2REOA 2G17A 3MCAA 3GJ3A 1I7DA 3OZGA 4M1KA 1KQOA 3ESCA 3DOFA 3HCNA 5EMJA 2QTMA 5JWHA 1ZUNB 1C8VB 2P7HA 5E4JA 4DXDA 4GGPA 4UM8B 4EHAA 1XL0A 4IMJB 4LYYA 4PX3A 5AVOA 1I4LD 1EP2B 1YS9A 3ER6A 2RI6A 3W3ZB 4DLAA 1NI5A 3ZWAA 1XTTA 2V7PA 3I9KA 1SOUA 3LGXA 4XX1A 4YUVA 2AN5A 3FHLA 1E8MA 5IJ9B 4YCNA 1U9YA 3EDQA 1MJGM 4YCMA 3M89A 3BG5A 3A32A 2FW7A 1GRRA 2XLBA 4AQ7A 4NENA 1HDGO 1LRJA 3NEPX 5EVJA 5FBLB 5J59A 1I2ZA 1MHTA 3MA0A 4JSTA 1G6HA 1YFMA 1US8A 3GVIA 1W8DA 2Z6QA 3DAYA 2DBQA 3DEHA 1YFEA 2YFHA 3E53A 3HEMA 4JROA 4WOBA 1ANKA 1DT5A 2V4MA 4UFNA 2OTCA 4C6RA 5IN5A 2YKGA 2JGLA 2YWJA 3NIWA 1A9PA 4MVJE 1M5UA 5K4HA 3UV7A 3IOYA 1UOQA 2LDBA 2WHPB 5A9RA 2AEEA 1ULAA 1BA2A 1KI9A 2XUOA 4Y2UA 4YRTA 3BE5A 3Q7PA 5ADHA 1Z7BA 3MM4A 3DKIA 3X2EA 1F5SA 1M6WA 4D8XA 2XCQA 3D0QA 4FHCA 4MV6A 4HAUA 3GT3A 1LI5A 4KQGA 4OFBA 3ODPA 1KJ8A 2JIPA 1EE9A 5C31A 5KYYA 1PWYE 1Y7HA 3VX4A 5JNSA 4BTEA 4H7DA 1YBFA 5JMTA 2IZ1A 1G20E 5LP6A 1RXVA 3KFXA 3ILSA 3X1YA 5F7XA 3DUFA 4I14A 3ZD7A 1KEEB 4BZXA 3U3JA 1XWIA 3R3ZA 5GZ3A 5AOAA 3F6PA 2ZJFA 4I81A 4QUEA 5KVCA 2WC1A 3KUXA 2B2CA 5F91A 1Z9BA 3DA8A 2OBFA 3DBLB 3JTMA 3LTNC 2PL1A 3W6UA 1P4GA 2EYQA 3FRHA 1TGYA 2XB4A 4KGXA 2Q6OA 3CO0S 3EDMA 5IG2A 2WNHA 3SJUA 1V39A 4B81A 3DEFA 4WJZA 1T6XA 1DDGA 1EX7A 1QOQB 4IIJA 4IIFA 5CD9A 4E46A 3IAM6 3BMNB 4R8LA 5TVKA 2UU9B 4B44A 1H9AA 5BT9A 3RREA 3R3JA 4CHTA 4WXHA 3GIDA 3KJGA 4GGMX 3SY8A 1DCKA 2YCBA 3I53A 3N2GA 4J1TC 4QBTA 4BE9A 3F7NA 4IZOA 3WA7A 3BDAA 3FPHA 1LKZA 1YKFA 3WKAA 4EPTA 3FMFA 4UATA 1AZSC 2A6PA 4KQMA 2HRZA 4BCCA 1UXIA 5LMZA 1X7WA 1JB9A 1B6RA 1J6UA 4E15A 1P5JA 2W2OA 2XQJA 2VTEA 2XGGA 4IMPA 1FRQA 4PZ9A 3SIPA 1OAOA 3TINA 1LPOA 4J2OA 1BAPA 1L5KA 4BYMA 1IQPA 5DXAA 3KPJA 3GJSA 1WMAA 4J76A 1E4OA 1YHNA 3R5KA 4XDHA 5IKEA 1TNDA 3OIFA 1KK1A 2NT4A 2NZ8A 1C9NA 3F4LA 3FLAA 4YQZA 3S5UA 3VU9A 5JXHA 4PG6A 5JAZA 3RYTC 3NWJA 2WG0A 4GYYA 1SKQA 4KTTE 3CW2A 1O95A 1P81A 1KAHA 1SCIA 3DAGA 3DBHA 2BRUA 2OORA 3S7ZA 4V1CA 5K01A 5LQSA 1AUXA 3P0FA 4XRRA 1QGED 2VYVA 5M3BA 3U37A 1KWKA 5FUMA 3WMGA 3CN9A 4HBGA 1TLFA 1FUYB 3HGQA 3WLIA 4YJ3A 2WSBA 1JDVA 3FLBA 3OCXA 1M6HA 5DW0A 5K1ZA 1NFRA 3FLEA 3MWYW 4MA0A 4R40A 3OTIA 3W6PA 3W1VA 2F90A 1UOPA 5HPYB 2X0KA 4CCWA 3DPUA 1RJEA 1QF7A 1N0VC 3UFXB 3QF4B 1ESMA 1NGSA 1V16A 2R6JA 3OZRA 3FSRA 1Z4JA 2JFOA 3PNPA 3SFTA 2EIHA 4Q0MA 2COUA 4ZU1X 1Y4AE 3PRKE 4EYEA 1QHGA 3D02A 3DLTA 4ZDIA 4ENQA 1SZDA 1COZA 3D6FA 3HYTA 3SMVA 4BMVA 3MWFA 2P6OA 2OD9A 3IV9A 3O21A 2P9TA 1XCPA 3OEHA 4K6KA 2KI5A 1ARZA 4QYTA 2V54A 1RM5A 4QWWA 1RRVA 2Q3DA 2VRNA 1PWEA 1C80A 1ZOPA 3ELDA 4NOKA 4R1MA 2R8OA 2YV3A 2VP0A 4BB5A 2X1MA 3MBOA 3GJYA 3AUFA 1KI8A 1OREA 2WAOA 4JGBA 4JA0A 1RD4A 4N3AA 4K05A 3LFUA 3T41A 3BKXA 4BKOA 1NJ6A 2VQEB 5I01A 1KMMA 1UMCA 3RSZA 4ZV9A 2ID7A 4CU5A 4M87A 3D3WB 1RMYA 3N53A 1B0UA 4C88A 4OF4A 3TZKA 3QNUA 3VYTB 4RELA 2D4AA 4WNAB 2DM6A 3DMFA 4ZYZA 2GX6A 1GZUA 1F8FA 3X2SA 2PLFA 4PWYA 5D2CA 2QDKA 2GBCA 3GLHB 1HFJA 4X24A 1Q6YA 1GNSA 3ASUA 3DQPA 4CM3A 1SKMA 3FN4A 4IH1A 2ZR8A 4Z0HO 3L0CA 4EG8A 5LUAA 5DASA 5HKBA 3LHSA 3VO2A 2JVIA 3PJEA 4ZC8A 1NI4A 4A3SA 2O2YA 1RXSA 3TBHA 3QSGA 3ZGOA 3H1BA 4YPOA 4GSLA 5IASA 4CL2A 2PYZA 4D3SA 3ANNA 3Q8WA 4TV8A 3ZCTA 4EG6A 3OIGA 2GN4A 2JI8A 1G1MA 1NT2A 2X41A 3Q0TA 3SS8A 3DJYA 5DULA 2W83A 1C9JA 3GNQA 5J4HA 1P5ZB 3AHCA 2JI4A 2JGMA 3Q3HA 3VNQA 4E2XA 3BMOA 2WDPA 5A04A 1TM1E 1R18A 2RHJA 4MS4A 3SXUA 5H1YA 1UKCA 1GKUB 3H1AA 3KZMA 4DNQA 4LBZA 3W5HA 4Z49A 3BN3A 4D44A 2F4NA 4P2BA 1F9EA 1A8QA 4XLLA 4YO8A 2OGUA 1EKXA 4MINA 4BFZA 2WTAA 3H5AA 2BFNA 2PX6A 1OTHA 3IFSA 1FFDA 4WLNA 5ALGA 1G66A 1W76A 4G85A 3DO6A 4FEYA 1EH5A 5FFNA 1P44A 3ZIDA 1J56A 2ZVJA 1YGYA 4YB8A 1YOVA 1TF7A 3VNUA 4I0WB 3HGTA 2O48X 5ES3A 1TJWA 5TPWA 1UK7A 2YJNA 5EOVA 2EDAA 4LBYA 2HMUA 3LECA 3BFVA 1H1LB 4ARZA 5BURA 1RQXA 4RFSA 4XA8A 1SU6A 4BQFA 4XB1A 5AESA 3A0RB 1TYDE 1O8CA 2AC4A 3NBQA 2BHLA 3J7TA 1H6BA 4JI4B 3L02A 2IBSA 3DYIA 3MOSA 3SQOA 1UBMS 3EPHA 1YDFA 2Q3MA 3O4JA 4GSYA 1WMBA 3O3MB 3N70A 3B9RA 2P30A 2V9PA 1HG1A 1Q2UA 3VISA 1FFXA 2QY6A 4N7JA 3Q72A 1ITZA 3UHOA 3FDZA 2C8JA 1PF7E 3UJHA 4G0ZA 4M1YA 4N1AA 3CWCA 4BE7B 3TL2A 1ZVVA 5KEIA 2HCJB 1PNRA 2QT0A 3KKZA 3KYDB 3PQ4A 3G9TA 2ZRNA 3G2IA 2Q5QA 3IHWA 1QHIA 3K5HA 4BX2A 4EMSA 3HVJA 2GLXA 4FSHA 2E9FA 1CZLA 3KZVA 3P9RA 5LP6F 3IEVA 3MJTA 1G41A 4Y7DA 3WLJA 4EM6A 4TZ6A 5BUCA 1UEXC 4IXDA 2Q27A 4D74A 1AQ6A 5KINB 4WQMA 5GVRA 2FE4A 3C0KA 4YRNA 3PRYA 4YEDA 1M10A 1XEXB 2ZJOA 3AUYA 1EFLA 1DTWA 4XARA 4XJTA 4Y18A 2WV7A 4GPZA 1YACA 1G60A 1SA0B 2GTHA 3OQNA 4C6HA 4JWKA 1CS4C 3AJRA 3LBNA 2ZAGA 4DG9A 3RKUA 3VKFA 3R5SA 3CH5A 3E3MA 3LLMA 2EFYA 3NH9A 1Z28A 3JQRA 2CV0A 4N8DA 1X80B 2RARA 2A59A 1E1QA 3K1TA 3FNHA 3AETA 3NBXX 3BDVA 1GZ6A 4C3ZA 4IH4A 4D8YA 4DZTA 2WWFA 7MHTA 5F7ZA 1PKXA 7REQA 1GEEA 2RI1A 2VPTA 2JIZD 5BR1A 4ARBA 5CFZA 1JLLA 3FRJA 3UGKA 3I76A 4NMHA 3IXLA 4NPAA 3FDXA 4MGKR 4BEWA 5DHRA 2Q7OE 3LT4A 4YY3B 3K6KA 5L3VA 2FFJA 3UXMA 2D7CA 4C2UA 3GXBA 5JCZA 1U7PA 4PLHA 2O3SA 3QWHA 4BXOB 1EFVB 5FJJA 5TMDA 2NPFA 2AWOA 3W4IA 2EBUA 2XQFA 4YONB 3MOIA 2MSCB 4ZO9A 2ZZMA 1DC8A 1RWWA 3EPLA 3WVNA 3GGGA 3O92A 1YRYE 4YHHB 4FMBB 2QTLA 2JLYA 2EG5A 4H7HA 3ROMA 2O54A 4ZT6A 2PO7A 2N1BA 1CRLA 2FUKA 3DBVO 3N5KA 1A9TA 3KK0A 1DIBA 2ERYA 5CB4B 2QTGA 4W63A 1TE2A 1S2MA 1P7YA 2AIRA 4K9NA 1Q20A 2AR0A 3ODGA 1Z63A 1JDBC 3IE0A 1X0XA 4HQ6A 5D6OA 1VL0A 1K6XA 2W6JD 5JVDA 1CUBA 4PXYA 3RF7A 3BXGA 5I9LA 2XODA 4CQMD 4RD0A 2XBMA 3ET5A 4ISCA 3FPGA 1B14A 4J03A 3HA5A 2IHUA 3GLRA 4TTRA 2M1XA 2GKSA 2B9VA 3QXCA 1NL3A 3TECE 2HA6A 2C7RA 3NANA 1NJ5A 1BXRB 3EZLA 4WK2B 3A2NA 3GEGA 1JHAA 3NOXA 4IFEA 2YWBA 2MDTA 5T6MA 1XIVA 3N0VA 2P8SA 1UPTA 5AOCA 2VJCA 4PN7A 2WTNA 3UEOA 1WXEA 2QJWA 1OYWA 4FMPA 4Q9JA 2Q07A 2QM3A 4LRXA 1MHPA 1P9NA 3C1OA 4XJXA 2QP9X 1U7HA 2NG1A 4KN8A 4IDCA 1M3SA 1E4VA 3BK1A 3MF4A 3G85A 2PQ0A 1N77A 4Q7JB 4AY3A 3QVGB 1OKKA 4UDXX 1FDOA 4Q24A 3AR9A 2ODBA 4CV2A 2MT9A 2IYYA 2V7XA 2XE4A 1T2VA 3QK7A 2MYPA 4O2AA 3I3SR 3E9NA 1EGQA 3PVZA 4RBNA 4XWGA 4BFVA 4CDMA 4PC2A 5JNUA 3O8CA 1BSVA 1C9YA 2W2XA 5JNVA 4ITVA 2Y0CA 2R4UA 1QHFA 4G5HA 2G88A 3IB3A 3IMFA 5IM5A 3K20A 3LCUA 1U3CA 1HEIA 4P2GA 1MDFA 1KJQA 3PQDA 4OQ4A 4WINA 1UXJA 4EFMA 2I6TA 3EZ7A 1SK9A 3EQ9A 3STYA 1RM4A 2GPYA 2L2QA 3TI9A 5BSVA 5CU7A 3FPJA 5EPUA 2R79A 2RGCA 4MPJA 4QAQA 4FYMA 5E6UA 1WW2A 2BFOA 3DZGA 3QEMB 1QG2A 4NONA 4PG4A 4UVIA 3BTVA 1ZMRA 3U1TA 3CKYA 4MQ6A 5H68A 5EZ6B 2QQ5A 5LQMA 1N33B 2PRYA 1C30B 3HDTA 2PTSA 3KQPA 3NU1A 4PNHA 4TXMA 4UDYX 1FDWA 6NULA 2UYOA 1PL0A 1QIGA 1Q1EA 2QVBA 3RFCA 2EX1A 4KXFB 1G5QA 3CZQA 3EUWA 1XQXA 1L4GA 1XEXA 2ZYRA 4J7AA 1U2DC 5FULA 4NAVA 4XWTA 2YC2C 4RSHA 5JU6A 3FKJA 4AO6A 4QFCA 2VBGA 1CDEA 2HWWA 2BEKA 1Y81A 3DTTA 1CE8B 1HXHA 4JT4A 3WAKA 4YMGA 2AX3A 2IYRA 2GVNA 2L0XA 1NVGA 1VLMA 2HQSA 2ZRMA 1SHJA 3C6ZA 4OA8A 3WNDA 7ABPA 1J7JA 3QG5A 5A4IS 1R9MA 1TEVA 5AP9A 2PTQA 1GFSA 2WWTA 3A8TA 1G8KA 2OBNA 3IQZA 4P4GA 4PPQA 1AKVA 3T9DA 2GAFA 3HCCA 3O8BA 4NJEB 3PL5A 1GCGA 2EJBA 3F8TA 3EVCA 1GKLA 3IESA 3E9EA 3G7SA 4I9HA 5E3IA 4UEJA 3RK1A 3UMJA 3K4HA 5KDOA 2DLNA 2RGNC 3ISVA 2Q3FA 4CKEA 3GEDA 2QUBA 1W0KD 1KPGA 3MPUA 1A27A 2A92A 2I8CA 2JZNA 3IP5A 4V3BA 1ZM7A 3LUGA 2IYEA 3OJLA 3Q5GA 3MWEB 1C1XA 1DEOA 1QR6A 4OK3A 1PQYA 2OFFA 5GADl 1TAGA 1VJCA 3HBAA 1DX9A 1O77A 5NLLA 3OT1B 4FGWA 5EE5B 5BYBA 2M2IA 4XEHA 3BZUA 3R24A 4G25A 1IBRA 5HZGA 3RS8A 4LN1A 1UMBB 4EKDA 4M1MA 3ZXYA 1QC5B 5DM0A 2OHJA 1MN6A 2VSQA 3HO8A 3NUZA 1WW3A 4EDHA 5DI9A 1U8CB 4ZI3A 2IYZA 2ZIWB 4QO8A 1N6HA 2AHRA 2C04A 2IITA 1FUKA 2YXEA 1YZYA 5FV4A 2JFXA 3W2HA 4U7JA 2YZGA 4Y7CA 4DR2B 2PMKA 2RONA 4ZICA 2YIDA 3CLHA 3WLNA 5FUYA 4LHYA 1LBEA 3RFVA 4QRDA 5I7UA 1UBJS 2FXIA 3VHRA 2AG1A 1XZAA 2CCKA 2CFTA 3DZ8A 4H9GA 3CRZA 5BSWA 5KWSA 3KT3A 2GKOA 3URKA 3TMYA 2A9RA 4MRVA 3H18A 2GTIA 2CV2A 1H9CA 2QR3A 1V7PC 1XTBA 2H5EA 4LGMA 4NCNA 4EPYA 4KO3S 2R68A 1QSGA 1P4RA 2ZUWA 1NPYA 3EISA 4RMHA 4P53A 3RBAA 4CETA 4DIBA 3NGLA 1N7JA 5LYJF 4DSTA 1N5RA 2PU5A 1CUGA 2C4MA 4FWBA 4ZVSA 5K3CA 2HV8A 3D5TA 3E4CA 3LGAA 1NVUQ 1W49A 1T1SA 1SC4A 2ZP1A 3O2JA 3PSAA 3AOGA 3T3MB 5GINE 1U3WA 4V2UA 1GV0A 3IJPA 5AM0A 2XJ4A 3EIWA 1QS0A 1BJKA 3IAHA 1GGVA 1B73A 4B75A 2Z2JA 3OOEA 4UTZA 3K6SB 5J2UF 1ZCAA 3AR3A 1Z5UA 3ZV4A 1IQ0A 2BGRA 3DL7A 3FBGA 2WTBA 1FUIA 3HCPA 2XTNA 4QX6A 4TM7A 3F74A 5EKSA 1Q7EA 1KARA 4ITRC 4UHCA 4DUZB 1DC7A 2C2BA 2A1TS 4KQHA 2JDID 4AURA 1ICIA 4PY2A 3W8EA 4H16A 4TX1A 4E5YA 5IT4A 1ZM3A 3QE4A 4N7RA 1K6MA 3QI2A 2ZI7A 2A5LA 4X41A 5BYJA 1DBPA 2IYNA 3OJXA 3DCJA 3N75A 1F6BA 4B4KA 1K6EA 4KVFA 1HNWB 1IUPA 3AC0A 2XOXA 1JTVA 4EGJA 4BQRA 5G4KB 1PZXA 1YZFA 3ANYB 3N6RA 1YE3A 1A8PA 5IJAA 3U1VA 5KC8A 3K71B 1FVOA 1X9IA 4J0GA 1DKMA 4P5EA 1X7XB 1OBCA 3RRFA 4DW8A 3ZI0A 1ZRHA 4B1FA 1FUEA 2Q3CA 4IUCS 3R7FA 4ZYXA 4GXQA 4KRFA 1ZK1A 3QGMA 4ZOEA 4W5WA 4GMHA 5CDFA 4CTNA 4F97A 4UHHA 1E2GA 2I22A 1G7SA 3TKLA 5JVDF 1X7ZB 4OXNA 2ZWOA 3EIFA 3OESA 1WP4A 1AS0A 2V65A 5DNYB 5LWQA 2IUFA 1YR8A 3LQ2A 4NWIA 3EF3A 1TA4A 3U56A 4NNOA 3MRXA 4BZZA 4AP9A 2GPBA 4HEA1 1XKTA 4R8MA 3KC2A 3BJZA 2GD2A 3Q9SA 1KI6A 1L5QA 5F7JA 4K2HA 4L73A 4TOIA 2PS3A 2QI9F 3L4BC 5T8KA 1T0UA 3KB6A 3OJCA 1EXMA 3QVKA 4R16A 5C1OA 2YV5A 1C7FA 4PIMA 5F5LA 3THRA 5M04A 5EP3A 3JQAA 3PLRA 2O57A 1G3RA 3AX6A 1ZM2A 3IA2A 5CNJA 4QREA 1KJNA 1MJGA 4WKGA 4D8UA 5JZMA 3ACBA 1OLUB 3SC3A 2LBPA 2E6KA 3OX2A 3VO9A 1B6SA 3OT1A 1RMTA 4WE3A 1EWRA 3E9MA 1Y9EA 3VZCA 3LO5A 2C2GA 2IS6A 4TV9B 1EMDA 2OGSA 2P9HA 4RTQA 1N32B 1M2EA 3WLLA 3HYNA 2B4RO 4MI9A 4YMWA 3MTAA 3GGCA 3TH5A 1Z6QA 1MA0A 4A8TA 4ADLA 4YQEA 1W52X 4NEGA 4RQBA 1JEJA 4NYMQ 1QHNA 5H3LA 3I6BA 4B83A 4AS2A 4DNOA 2F9MA 2IVZA 1N2SA 2XHZA 4RS4A 3CWZA 2VHQA 4N3CA 4YRQA 5EJIA 1YRQA 5FUVA 1WD7A 4MRNA 1RYBA 5A02A 4KC0A 4R54A 1TC2A 2XUKA 1VXRA 3JATA 3L8CA 3UK0A 3VDRA 3M5WA 3IJRA 1ZNXA 2ZREA 3JXEA 2B2XA 5B4UA 2HUNA 3K0AA 4JBYA 4K6OA 4L74A 2AFHE 4QU5A 4Q4HA 5AHXA 4V39A 5FPTA 1ONOA 3H9JA 1AQNA 3IEIA 2AMJA 3OO0A 4ER0A 1FSPA 2XXBA 2IK8A 1CZUA 2X0IA 4M49A 3UT5B 3FROA 4XX0B 4NTZA 1K2WA 1CIVA 3H9QA 3OPVA 1EB8A 1WB5A 4RL4A 5CXSA 2YWEA 1CLEA 3N74A 3PR1A 2I4OA 2IX3A 4UU8A 3OKPA 2O14A 4TKVA 2ORWA 4KXMA 3IDOA 5CR9A 5E6RA 2YVKA 3VKHA 1MV5A 2NQ2C 1ORTA 4HVAA 1H1TA 2JFVA 3PIIA 3DNPA 4GE3A 3TLYA 4HYQA 1LV7A 1EIWA 1JAYA 1G8FA 1XNJA 2D7JA 3O2SB 4UDNA 2R84A 4Q16A 1DX4A 1L8LA 3JSAA 3KPYA 4PQYA 3RRJA 3VYUB 5IM4F 1IIRA 1P1CA 2CDNA 1ZC3A 4HS9A 3V6MA 3SYNA 5IJ0A 4TQ9A 2FZ5A 1N7GA 3H19A 2Y3IA 2QV7A 4BYGA 5I7FA 4HNTA 3AKDA 5LZ8A 1HG0A 2XZOA 4PLWA 1B0ZA 1PFUA 1F2TB 4QXQA 4KQKA 1ABEA 3PG5A 2HGZA 4GWKA 3WK7A 3NB0A 2VYQA 4JQSA 1D5CA 4WK6A 3ICVA 5ERGB 3UJ6A 4WVFA 3MMNA 4DDUA 5KQGA 4LOAA 1U4NA 2G1UA 5DOVA 1QHEA 2VHCA 3RUPA 1X1QA 5JBQA 5IULC 1U2SA 5FOVA 2WJ4A 3V1YA 2PFGA 4XOIA 4MDFA 1OYVA 4AYWA 2CHQA 5C4IA 2ORIA 1KSFX 1LWNA 2IHYA 2OQIA 3U4AA 1H6DA 2J45A 3ZOZA 3DBOB 4PSUA 1OXXK 2PU7A 4GLFA 5CGQB 4FR2A 5EAIA 4UOQA 3VTFA 3GDHA 1CUVA 1EDDA 4RMJA 2JHFA 3ZW7A 5IJ9A 2CSUA 1CY1A 5T41A 1DBIA 4DGSA 2FMHA 5A3VA 4YDRA 5E1DA 2C77A 2M32A 4OVKA 4ROTA 3WIDA 4B3BA 5HKOA 2FETA 4HNGA 3DLCA 2H65A 2G7MC 1ZD3A 3H2BA 1M8FA 3FFXA 4HLNA 5FWYA 2X86A 2PUJA 3OBBA 4AJJA 3PFWO 4J3NA 2GR9A 3HUDA 4M0MA 4W82A 3SX0A 2C7BA 1MZPA 1D0SA 5JMWA 1MCZA 2YWHA 4AUKA 4P22A 1IJKA 1FNSA 4AZWA 3L82B 3A2KA 2RJOA 2DP4E 4K0KB 5JMPA 3M9WA 2C2KA 1T15A 2BBWA 2D2IA 1C9EA 1UDCA 4DMMA 2CMKA 2XUIA 3GZNA 4XSHA 2ZYIA 1JVNA 3B85A 3IQWA 4AW9A 3DO5A 3RTAA 3I2IA 2O4CA 2CLMB 2Y66A 5YASA 4HZIA 2Z4RA 2FHPA 2F55A 3PS9A 1K66A 3UH1A 1EUDB 1HE3A 5JD4A 2HWYA 2OAP1 4ARVA 3RS9A 3DTNA 4KOAA 4RVUA 2QS9A 3O1HB 4U00A 1K5DA 5ALKA 1II8B 2V74B 3ZH2A 1Q19A 3L84A 1GTMA 3BBPA 1EJBA 3WNBA 6ABPA 1F12A 3A6DA 3GX1A 1WDWB 1SBCA 2Y1CA 4NS4A 5EIHA 4EGQA 1QG4A 2EHDA 3WAJA 5K0TA 4C21A 2VNHA 1P73A 3BE6A 3NDRA 1EBFA 2B61A 1T25A 2V7QA 3MT8A 4G37A 1U8TA 2ZW9A 4JYBA 4ZQIA 5EIOA 1JSZA 3SBOA 1KZ4A 4LHVA 1ZN8A 1EJ0A 1TVKB 4I5GA 3ENWA 3GELA 3ORYA 4B3GA 3WBBA 2HF2A 1O0CA 2IIBA 4EG7A 5F33A 9LDBA 2V5AA 5A4FS 5C8VA 4B35A 3VZBA 2GEFA 3I09A 4BNWA 4D4MA 1DAOA 1UZAA 3FVQA 1NMXA 3CFYA 1I7SB 2E3JA 2PUGA 4ANFA 3ZK8A 1XU9A 3GJ0A 1DRJA 1A5ZA 1RQRA 3BCHA 3DZKA 3JVDA 1QWSA 3G1UA 4YJDA 2JFNA 5DMXA 5HGJA 3CB4A 2X0FA 1ZJ4A 3GAZA 2DBVO 1ZFNA 5AVVA 4RA6A 3MOGA 2AJDA 3P7MA 1NSFA 1NUAA 4ND8B 3CX8A 3EH2A 4X1IB 4AYTA 2P6RA 1PR5A 1GUBA 4FNOA 5BVGB 3ZJTA 5FBWB 5IBCA 3IVGA 5FR1A 3CLVA 4KH0A 4DNXA 2XUZA 3DMTA 4YIKA 3K8YA 1L4YA 4I1IA 3WFJA 1CYDA 1X19A 5AOBA 1S02A 3GJQA 3JD4A 4AKTA 3KKKA 1TXGA 4PRZA 1YBVA 2GD0A 4C6SA 2VPWA 3N8GA 3TW0A 4PC1A 4L1KA 4TLCA 3N59A 2P2LA 1N5LA 4DSZA 3D6MA 4H2DA 1K7WA 2X2PA 4GYJA 3TQHA 4JJFA 1JKJA 2ZJAA 3ZDDA 1NNEA 4MS1A 3X1XA 1IVYA 1KBQA 3ECSA 3DDUA 4OAPA 4R6XA 3MGCA 5BUSA 3W8FA 4HWPA 4OHMA 3PV0A 4TV9A 2VN8A 5EQTA 1LDMA 2ZSIA 1PS9A 4EHFA 1RHQA 1K5HA 5TIIA 4ARIA 3HYLA 4OL0A 1Z5GA 3E18A 3LA8A 2XJ9A 3MYYA 4RO0A 4AMYA 4RY0A 4BCDA 1DCTA 3HFRA 1JP7A 1XL1A 2ECQA 3PQ5A 3L6OO 3NTUA 4OHOA 4ZOLA 5SY6A 3OQ6A 1KOGA 1XZ8A 2VPZA 1KJZA 5MFZA 3WLSA 2OXEA 1N3YA 4P9NA 3H2GA 3HHPA 5CVJA 3NAZA 1UIRA 2NNWB 4WERA 4X60A 3CLTC 3JU3A 2CBGA 3LBIA 4MAAA 3HKCA 3TWOA 4IWYA 2REBA 4C5CA 1WF3A 2FWNA 3IT3A 3F4SA 2K2QB 3ENVA 2IV2X 2NZUG 3CH4B 2UDPA 3QPDA 3SQDA 4C20A 4JD5A 1QKJA 4F8EA 3VYRB 5B58C 2FOXA 4M83A 5ESDA 4OGFA 1L8OA 1IMOA 1RBZA 3CF4A 5GM1A 3ZZ1A 2IE8A 1X2EA 2GNAA 4LRQA 4GL4A 1FP4B 1W5TA 4FMCB 5SV2A 1YVEI 5INTA 5J4LA 1EESA 1FL9A 1US8B 4DJTA 1ZL0A 1BG6A 4Y1RA 3SBDA 3GH1A 4KN5A 3TTSA 1E96A 1R0SA 3FH0A 4U2KA 3EPJA 1EFRD 1OBFO 1XTZA 2GZ2A 1OAAA 4ZVKA 3GFSA 2D5LA 3EMDA 1ULUA 2J3QA 2I3AA 5T4HA 4OQFA 1KVTA 1YCHA 4KYIB 3CVYA 1P3DA 1GUZA 4LNAA 3PFBA 3ZY4A 2C9ZA 5ALEA 2PMEA 3PEFA 5LOVB 1W7AA 4PAQA 2BAGA 1T4CB 4K81B 5CLQA 5DF1A 1M2NA 3QJ5A 5TE9A 4CODB 4EHNA 6LDHA 2ZTVA 2Z8YM 3HADA 5FRDA 2WG2A 3TGLA 3M3PA 3HXKA 3RARA 2I80A 4IDQA 2XNJA 2R87A 5BUQA 1LJUA 1V96A 3E9ZA 1N5JA 3RIXA 5CLIA 1K4MA 1KFEB 1Q21A 4EO4A 4FGUA 2XA9A 4C3OB 2GEJA 3UATA 3SDZA 4C08A 1SXJA 4J0JA 4ZCMA 3AP2A 1MXFA 4U4AA 4MS1B 3W5CA 3CZ5A 4GM1A 1QKIA 1XVLA 1JR3E 4JYZA 3UMBA 3KBBA 1X6VA 1ZMXA 4ZGWA 4DC9A 1WHSA 5EZYF 1Z2CA 4AZTA 5EGNA 3UHJA 3HXLA 3KNZA 4HGQA 3ETJA 3EXEA 2RGEA 2D27A 5CX1A 1PUXA 3LUHA 2HO4A 1ZQ1A 1HYHA 2F1JA 4J91A 2AOUA 4LJ5A 1RHJA 3ELUA 4R3NA 2CDBA 4CIVA 3WLRA 4NV1A 4CKZA 5BQ3A 1RIIA 2V7QD 2Y77A 3PYLA 4PAMA 4RORA 3OY7A 1ZPDA 4MYTA 4Y2XA 3K0CA 1A9ZA 1H5UA 2PK3A 4UBOA 2SKCA 3ND6A 3LBAA 5KNBA 3STXA 1KYIA 2P41A 3PXDA 4MKHA 3MSCA 1MEOA 3ZIUA 3CUUA 3LFTA 3OA0A 2HCRA 1WXDA 1H2FA 2AW3A 3PHBE 4KL8S 3U13A 4LZAA 3LY5A 4F5EA 1DJOA 3MERA 1XMQB 1HMPA 1GA6A 3DOJA 4XYGA 3TRDA 2XMQA 3WP1B 1LXCA 1NYQA 3OFNA 5FB3A 3RKRA 1J97A 2QVLA 4QXPA 4P82A 1DAHA 3LUFA 2ZJ0A 1UQUA 1V8ZA 2PRKA 2GYYA 3DXZA 4KO4S 4MVWA 2PT9A 3OURA 1Z26A 3VI4B 4YI5A 4LK2A 3RS0A 1GNVA 1LX7A 1T4BA 4QRIA 5BMVB 1YMVA 3OM0A 1KEKA 1VJDA 1E7MA 1VDZA 4D98A 3O8OA 1KTVA 2Y1WA 3L4EA 2WQ6A 1SZCA 3QHPA 4NBKA 2G40A 4CR6A 4J1NA 3BSFA 4Q9HA 5T4FA 1I6WA 3GCWA 2GYVA 5E2BA 1BVUA 3OSUA 5GOZA 4PEVA 1U0RA 1QGDA 3EZGA 4RLQA 5EFZA 4DMFA 4KR9A 5JYEA 3Q8MA 3PQ8A 4E5PA 4Z9XA 2GN6A 4OPMA 4E13A 1N57A 2HB6A 2XVMA 4ZVTA 5F5NA 2GO7A 2JHGA 3ABIA 2EU8A 2HIMA 4URXR 3N87A 3CJQA 1N2EA 1ZU4A 1J06A 3HYCA 7AT1A 5IM4A 1UXOA 1H6AA 5CYOA 4BVBA 4DGQA 1YIOA 5AUOB 3EG9B 2GN0A 3NHJA 3QXGA 5L53A 1BQ4A 3NBYC 4QL3A 4XPIA 3EXFA 4GX1A 1HC7A 1KPHA 2BYTA 1NXOA 1CK4A 3IJEB 1TMGE 3MJDA 1G21E 1YZGA 2GCPA 3OE5A 4G4SP 5TT0A 2GM5A 4C14A 5CA0B 3G5AA 5F92A 4HR7A 3BA6A 4IBOA 3ESZA 1UC4B 5K0GA 5LC1A 5H4GA 3AQIA 4MEJA 1QFXA 1D0VA 3LX6A 4YP5A 4MQBA 3HWRA 1ZVQA 4BNJA 1P5RA 5A4KA 2H16A 3LPNA 5IEJA 1V5FA 1LK7A 1ESZA 1CZOA 3GGPA 3A1WA 2P5SA 4RQUA 3TXAA 2XSZD 2I2FA 3PUIA 1JVBA 2JCXA 2XVAA 4Q1DA 2PJZA 5DBHX 5EXXA 3WGMA 1NBMD 1T5BA 4G24A 2F67A 3P2KA 5FH9A 1PJ3A 3PGLA 1YF3A 4K88A 2FJUA 3R09A 4O2BB 1DL5A 4OQEA 1PG0A 1UFQA 4HGRA 2JJ1A