1Z4MA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4mA01
1U2TA 2I7DA 1O08A 3L0CA 2G06A 3MN1A 5ALSA 4L6AA 4BEWA 3DNPA 3ED5A 4UARA 4Y2RA 3DAOA 3OPXA 3ZVMA 1RC8A 3AR7A 3ZX5A 1SU4A 5AESA 3KZXA 3E58A 3I6BA 2R8EA 1Z4PX 2WFAA 2OM6A 2WHEA 2Q4TA 3QUBA 4NWIA 1RPZA 4UMDA 3AR9A 3WKBA 1RMQA 4OD0A 2FPSA 4QQFA 5AI8A 2PKEA 3SF0A 2JGAA 3AR4A 2HHLA 3M1YA 2GFHA 3ESRA 4UAVA 2RARA 2FPUA 2G0AA 1N9KA 3ESQA 3FPBA 3K1ZA 2WF7A 3MC1A 5AVQA 5IT0A 4G9BA 2EAUA 2Q4RA 2G09A 4YGYA 3OCYA 3ET4A 3ZVNA 1L7NA 5ALFA 3DV9A 3U7GA 2HDOA 2WM8A 4YIHA 4QJBA 5AM2A 3A1CA 3ZUPA 2WF8A 4Y2TA 4BX0A 4AS2A 4Y3UA 3OCVA 2FDRA 3R9KA 4BEVA 4EX7A 3IB6A 3QUQA 1L7PA 5AI0A 2I55A 2W43A 1Q92A 3U13A 2R8XA 5AVWA 4DCCA 1ZD2P 1RKVA 2G07A 3ZW7A 1NF2A 5AVXA 3QU2A 4EEKA 5ALUA 5ALRA 4ZEWA 3SHQA 3HLTA 2B8JA 5ALOA 1YDFA 3ZWDA 2JAWA 3F9RA 5ALDA 4HYTA 4J2TA 4B6JA 3KD3A 4C4RA 4DWOA 1XP5A 4KN8A 5E0OA 5ALGA 1SWWA 3E81A 3P96A 3SMVA 4MWOA 5ALIA 2GHQA 3QNMA 2YBDA 5AKKA 2IOHA 1QQ5A 3QX7A 1K1EA 4UMFA 2FI1A 4BBJA 3UMCA 5AW1A 3GYGA 2P11A 3N07A 2CN1A 4HGPA 4XQ0A 2ODAA 3IRUA 1RKQA 1QH9A 3U26A 1Z4KA 1ZJJA 2HOQA 2RB5A 4ZEXA 2D2VA 5AIAA 2YMQA 3U19A 3L8FA 2FUCA 3S6JA 1Z5GA 2EATA 4CNQA 2CFRA 1TE2A 3J7TA 3DDHA 5AVRA 4HAIA 3A3YA 5T41A 2P27A 4BX3A 4AS3A 5AICA 5ALPA 2NO5A 4YCLA 3SLRA 4KYTA 1WPGA 3FM9A 2EARA 2W11A 3HYCA 3QYPA 1QYIA 3QGMA 5AW5A 3AR3A 3KC2A 4CF3A 2BDEA 5AKLA 4O8CA 4C4TA 3UMGA 2ZXEA 2G08A 2W4MA 1U02A 4Y2PA 2YFYA 3KOOA 5AKGA 5ALTA 3WGUA 3R4CA 1F5SA 1YNSA 1Z4NA 2GHTA 1Z4OA 5A3RA 2VKQA 3ZU6A 1ZD3A 3ZTWA 4Y2YA 1VFPA 1RMTA 3NASA 4I9GA 4E88A 5AKXA 2O9JA 3ET5A 5AIBA 3ZX4A 1Z4MA 3VAYA 4UASA 4Y2SA 2HF2A 1S2OA 4XE5A 2C8LA 2YJ5A 1L8LA 3FPSA 5AKJA 3PCTA 2RBKA 5ALLA 1SWVA 1TJ5A 1RQNA 3OCXA 5AM3A 3B8EA 3L0YA 2FPRA 3OCUA 4G63A 5ALEA 1Z5UA 3OCWA 3NAMA 3SKYA 2Q5EA 3BA6A 1QQ7A 5A3SA 2YJ6A 5ALYA 3FVVA 4JDPA 4F72A 1YJ5A 3W5BA 2DQSA 3FGOA 1YV9A 1IWOA 2RAVA 3ZTYA 4UMEA 1NRWA 1Y8AA 2GO7A 3PGLA 1RQLA 5FP0A 4UW9A 2YMLA 4EZEA 2YMMA 1T9ZA 5AW3A 3WK5A 3QUCA 2HCFA 2HEGA 4I9FA 3EF0A 2WF6A 4HGNA 3WK9A 5ALMA 1Z88A 2ZBDA 5AM0A 2X4DA 1Q91A 2BDUA 1L7MA 3B9RA 4OFZA 2FPXA 2R8ZA 2OBBA 2YMPA 1ZS9A 5ALHA 3WKAA 3L8HA 4BNDB 5AW0A 1VJRA 3RF6A 4C4SA 1N8NA 4KX3A 4Y2UA 4L6CA 3EPRA 3KBBA 2I6XA 3L1VA 5AW4A 3WKCA 3MMZA 2R8YA 4NV0A 4CE6A 4AP9A 2C8KA 5AM1A 5AVZA 2IYEA 2HF7A 2PR7A 1U2SA 3IJ5A 1CQZA 4L57A 3OTQA 2G80A 3B9BA 1ZRMA 2ZBEA 2HO4A 1U7PA 3L8EA 3L8GA 4HGQA 2C4NA 2QYHA 3OCZA 2AH5A 3QU7A 4Y2QA 2NO4A 5AW7A 1Z4IA 1FEZA 4UM7A 3FZQA 3SD7A 5AI4A 3WGVA 1YMQA 3L0BA 2AMYA 3NALA 3QXGA 3TLMA 1XPJA 4BNDA 5AVYA 1XVIA 4NAVA 3I1YA 4HGRA 1L6RA 5AI5A 1J97A 4UM5A 4UATA 5ALQA 3KDPA 3N1UA 3N28A 2B1QA 1EK2A 1TJ4A 3L5KA 3U7HB 2CFTA 5ALKA 3AR2A 4FYPA 1S8OA 5AW9A 5AK3A 4Y2XA 3QLEA 4UAUA 5AW2A 4NABA 5ALZA 2YJ3A 2C9MA 2JARA 1RMYA 5IS2A 1ZOLA 5A3QA 2AGVA 4J03A 1U7OA 2MU1A 2MSNA 1ZRNA 1X42A 2ZBGA 2ZBFA 3W5AA 4YCMA 1L7OA 4YH1A 3U7EB 1J8DA 4Y2JA 5AVUA 3WK4A 2FPWA 3WK7A 3NRJA 2G1AA 2PQ0A 3CNHA 3I76A 4F71A 4DW8A 2WF9A 1ZD4A 3I28A 3EWIA 4RETA 4KNVA 4JB3A 5AM5A 1O03A 4KX5A 5AW6A 1CR6A 4UMVA 3L7YA 3NUQA 4UU0A 3WK8A 1TA0A 5JJBA 1NNLA 1RLMA 4IG4A 2NYVA 5AKYA 1WR8A 3W5DA 3RFUA 3ZVLA 2YN4A 2IA5A 1WZCA 2JAOA 5AK4A 4PNHA 4CF4A 1EK1A 3N5KA 2CFSA 3NANA 5ALNA 4KNWA 1PW5A 3E8MA 3MPOA 4ZEVA 3R09A 5ALXA 5AVTA 2B30A 1JUDA 3D6JA 1MH9A 1AQ6A 4CF5A 2AUTA 3AR5A 2HI0A 2IOFA 2OA0A 5AI6A 5AVSA 5AKIA 2B82A 4NFLA 1TJ3A 3UM9A 1VJ5A 4BKMA 3PDWA 3A1EA 2HSZA 4GXTA 3ZI4A 3SKXA 4EELA 4OHFA 1L8OA 3A1DA 4XOUA 4XPZA 4FFDA 4UU1A 4HGOA 5AK6A 3CZ4A 5AW8A 5AM4A 1LVHA 1YS9A 2HX1A 2JAUA 2P69A 3QUTA 5AHXA 5ALWA 2OYCA 2WF5A 3QU9A 2GMWA 3M9LA 5ALVA 4MUMA 4EX6A 1RKUA 1Z4QA 4OCZA 1LTQA 1RLTA 1KYTA 2I34A 3U7FB 4Y2VA 5ALJA 5IT4A 1QQ6A 3W5CA 2IOFK 3AR8A 2B8EA 2FEAA 3N8GA 4IFTA 2B1RA 3L1UA 1Z4LA 2B0CA 1ZD5A 4H1WA 3ZWKA 3WK6A 5AKEA 2P9JA 3UMBA 3WKEA 3ONNA 4FE3A 2QLTA 2ZG6A 3PGVA 4EENA 2ZOSA 1T5TA 2C88A 4YCNA 4GIBA 3E84A 2FUEA 5AI9A 2I54A 5AKZA 3QU5A 1RRCA 4YIKA 1WVIA 1RLOA 5AVVA 2YJ4A 3QU4A 2I33A 2YY6A 1RDFA 2BY4A 4DFDA 3NIWA 3BWVA 1Z4JA 4BYGA 4BX2A 2O2XA 3EF1A 4RESA 3WKDA 3AR6A 5AKHA 1T5SA 5AK5A
chains in the Genus database with same CATH superfamily
2ONCA 4Q15A 2GFQA 3IAAA 1Q1BA 4Y1RB 3JQ9C 3KKKA 2HUNA 5AO9A 1OWLA 2FVXA 3HJHA 4NENB 2RH8A 2IYAA 4KSCA 2RD2A 3NVKI 1TB4A 3CGWA 4A26A 1W52X 3OT5A 1QORA 3GLIB 2CJXA 1Y48E 4H6PA 1Z37A 4DLVA 1QK3A 3CLUC 2RC5A 3GLRA 2IHTA 1PS9A 4BFWA 3Q87B 3E58A 2PGXA 3INRA 4RF4A 2Z43A 3TDMA 2BJHA 5IAKA 3SC3A 5DX1A 5B1EA 5ICGA 1T25A 4Y6LA 1YE5A 3E3AA 3JQ6A 4F04A 4FHDA 2GASA 5K6TA 4B3GA 3N8DA 4A92A 1YU6A 1V7PC 3GLGB 2VWPA 3P2EA 3BVPA 5CTJA 1RI5A 1JJVA 2AN4A 3AIKA 4LNAA 4G1UC 2I3BA 2NUAB 4FFSA 4DLTA 3REQA 3W3AH 2M6SA 1A5AB 1YR9A 5C37A 4RFVA 1UMDB 2MSDB 4UTXA 4WN9A 4KHPB 3GCZA 1DXQA 2IHYA 1CDOA 5FQNA 4ZDIA 2CE7A 3UCFA 1DIOB 4DG5A 3D43A 1BXRA 3K1ZA 2NN3C 5IT0A 4WLNA 2AXPA 4J0JA 4Z8XA 1C9KA 1JMKC 2G76A 5DVZA 2IHZA 1SCIA 3TLZA 5DEOA 4FYJA 4QBHA 4D8UA 4ZHQA 4LJSA 3FPLA 2C1XA 2PQ6A 5JNUA 4S3MA 2K6GA 1D2EA 1AVTA 1Y5RA 2QMEA 3NGMA 3KEQA 2V1UA 9MHTA 4PZ0A 4JJFA 1SG6A 2B4AA 2IW1A 1O94D 3VH1A 4MUYA 5LD2B 2M1XA 3I58A 4E14A 3NGLA 5BNWA 1YBHA 1BHJA 2F9FA 3RGWS 5B37A 3DV2A 4AF8A 2PKRA 1FTNA 2UYHA 3PL1A 1SC4A 2ERCA 2KYRA 3ICPA 1YQGA 2C5GA 3NC1C 4UUQA 1AC5A 1IU9A 4RJIA 5HQTA 3U44B 4JI8B 2G07A 3ZW7A 4MSUA 1XQ1A 1F2TB 4UHKA 3ND8A 3V55A 4FE4A 4MV1A 3ZLTA 2XA9A 2PLNA 1WY5A 3AZOA 4URUR 4FGLA 3HLTA 7REQA 4HQ6A 2G40A 3F9RA 4Q9IA 4OHKA 2QIOA 2ZCJA 4GBJA 3OUZA 3ER8A 3ZGZA 4J2TA 4LSZA 2X0FA 4KQ2A 1JMVA 3MELA 4B6JA 5KU1A 1QPGA 1QIMA 2ETVA 1NT2A 3CH4B 4DWOA 3LY7A 4RSHA 1C9JA 1IN6A 2IUSA 4EHDA 3R5KA 4M3NA 3C1UA 3IA2A 3TCXB 1P2VA 1QQTA 3ZNPA 3IEVA 4MWOA 4HDKA 1VLQA 2GHQA 2YBDA 1E1DA 4XFKA 1K27A 2NP6A 4HNGA 4UMFA 4ER3A 1DBPA 4MKZA 2IZ5A 3EVGA 1NUAA 5AW1A 2PRJA 4C5AA 4CN8A 3TAXA 3H8WA 3QG1A 1CS0A 2C0PA 2Y1GA 4X20B 1WSDA 4DSNA 2Z30A 1D4OA 2JD1A 5CT6A 5LYYA 1EGVB 2YV3A 3CFYA 2YN2A 3OLQA 3PX3A 4LTNA 4YXWA 4UTRA 5BR7A 1RKQA 3ONFA 3QKTA 3ULKA 2G9QA 1UXKA 2OD9A 2Y1OA 1HR0B 2PJUA 2W93A 1DLIA 1F7UA 1WCYA 4G5XA 5AUOB 4CM7A 1Q3KA 2NUPB 4LC0A 1WBDA 1F8FA 3CPEA 2TMGA 3DPUA 2BTEA 2VTVA 4ZGBA 3UT5B 1MGPA 1QFJA 4DLSA 3AT1A 1M2GA 5AXBA 2H2AA 2OHVA 1IH8A 1QRSA 1R66A 4GSYA 3SFTA 1TYAE 4P32A 1II8B 4M36A 1UC8A 1FX0B 4C76A 1QBGA 1UWVA 1DCFA 2PUVA 3U31A 3NHZA 3B1VA 3GLHB 5IEBA 2XGMA 2PU7A 1Q21A 5T4FA 1A7JA 3QVGA 1Q74A 3C3MA 4ZYVA 4YCLA 2K2QB 5C80A 4XIYA 2J7KA 4QUIA 2R97A 1ZW6A 5JPIA 1ZQ1A 3NS7A 4R2LA 3AVXA 1Q6YA 1V2HE 1O8BA 4ZO4A 5EE0A 4M8NE 4TT3D 5KCMA 5FWYB 3LKBA 1PSWA 4W4TA 2FB9A 4HEHA 1SQ5A 2G08A 2VJOA 4ERNA 3JZMA 1JZTA 2GPBA 2I80A 1QRRA 4MP8A 1IRXA 1Y82A 1U02A 3PNMA 2YFYA 3PUHA 3EZNA 4L73A 4MKFA 2IEYA 3ZD8A 1PI3A 2XPCA 1Z47A 3E03A 2HA5A 3ORFA 5FNVF 5CM8B 3THSA 3TMYA 2XNHA 4HGZA 2GZMA 4LWZA 3COYA 4TWIA 4AY6A 3RC8A 4LA4A 2H6EA 1X1RA 2OPBA 3MCUA 4JT8A 2EC5A 3PQ2A 1QP4A 2GFIA 2ZVJA 4PN7A 2GJ9A 2B2CA 3D7SA 3PC8A 4QFBA 4QU5A 5ICFA 4D8XA 3ZHVA 4RXTA 1QIHA 3TZCA 4MARA 5JJCA 4H35A 2XVXA 3C14C 4XUCA 3QE9Y 1CBUA 1U9JA 5BSGA 2H4ZA 1TM5E 5KHOC 3W2EA 1X1AA 1SUCA 2NPIA 4G8BA 1AS3A 1DC8A 2HF2A 2YOFA 5JAUA 5JY1A 5IYZF 1ZLYA 2XUPA 1FP2A 2PGAA 4QUHA 1R15A 3KT3A 5F64A 5KNDA 4R5HA 2RBKA 2FCRA 1V5GA 1M66A 4YI3A 3EBPA 1EP3B 1U7WA 1V4VA 2VRNA 1P0CA 4WKBA 1VDKA 3FHLA 4BE9A 4E1AA 4ZVVA 5EUBA 2P6MA 3NOXA 1QE0A 2FPIA 3J7AC 1P1JA 1Z5UA 4U8GA 3CCFA 3KOUA 1DARA 3OM0A 1J7KA 4AZ3A 4ISBA 4P4GA 3TX6A 3DV0B 3S2GA 2ECPA 4BMXA 1S8AA 3LUDA 1SEPA 1K6JA 4NTZA 4PCUA 1QZ3A 4KQGA 3EGDB 1AKUA 1PSDA 1R88A 1BTOA 2HK6A 1WQ4A 5E38A 3BFXA 1N5LA 2UVPA 2CZQA 3PNKA 1FPQA 2HNAA 4ZT6A 1P74A 3ER6A 3PEEA 4LZOA 4LXYA 1VPTA 1QHNA 3CU5A 3DNMA 4Q5IA 5BVHA 1MB2A 1OXSC 1REQB 1K5HA 2GN1A 2MHCA 3MJRA 1HE2A 1QUFA 2NO7A 4GVLA 3TSAA 3WVNA 3KTDA 4EO9A 1SC1A 5JANA 3KQNA 2AFHE 4ND7A 2ZWIA 1NRJB 2PUFA 2BGGA 1V9CA 2B78A 2YMLA 1M75A 1MUUA 3KXDA 5CNMA 2QM3A 3H11B 2XCRB 3EGWA 1XHFA 2WWGA 3U9LA 4B4KA 4QIHA 4E2XA 3R8FA 3WLFA 2QW0X 4HD8A 3T1HB 4B3RB 1BDBA 2F64A 2TYSB 2I6SA 4ZRMA 1RKBA 4RVFA 4EY3A 2QBYA 3ZDRA 5CEEA 1GAQA 1VLMA 2O8NA 2AR7A 5HG0A 1GG8A 1MC4A 5D3KA 1ZSVA 1CQWA 3B1JA 3EXG1 3I6YA 3MZ0A 4A5OA 4DDKA 4DXAA 3B6JA 4ZCTA 3OZ7A 4C05A 3SNHA 2H1LA 1K88A 2R8ZA 4LYAA 1GPMA 1VCNA 3AHGA 4YRMA 1LWNA 1XB2A 1XZLA 2DH5A 3FB4A 5AW0A 1N0UA 3B6IA 3AONB 4JS0A 4WOKA 3ZD7A 1JG4A 3S3TA 2XQGA 3QKRA 4KU4A 2IKQA 2O1XA 4WD3A 4UZFA 3IVXA 4KX3A 4KO4S 3UK6A 3EPRA 3ZYZA 5JNVA 3TG8A 4OMUA 1E64A 3WKCA 2CHGA 2RBGA 3IQZA 4G5FA 1BROA 4CVNA 5F7ZA 2FX2A 1Y6FA 1T3ZA 4AP9A 3OQHA 2BKLA 3H8VA 1T0JB 1RZ3A 2QI9C 2Y0BA 4DMFA 1L7DA 1G20B 1Z5OA 3HBAA 2PGNA 4XD7A 3RTEA 1ZC4A 1OGYA 5SZHB 2JLBA 3ZY6A 4AF6A 1UP7A 4QXMA 4TMZA 2EBFX 3WOVA 3BD8A 3S2IA 2ZRHA 3ZWCA 2ZJZA 1LBHA 1U7PA 4HGQA 3WRWA 2C4NA 5LP1A 4DR2B 3CSSA 1TNDA 5DHFA 1Y4DE 4XAQA 1AY0A 4HN9A 3MLAA 2EDCA 1NBIA 4TUYA 4UU7A 3D3WA 2ZWMA 3LPCA 1BRTA 1UBGA 1X1TA 2LCQA 3H17A 4FTWA 5K5EA 4E7OA 2OHGA 3G8BA 4GI5A 3ETHA 2QN6A 1ZFNA 1AZWA 3G1WA 5KOYA 3GGDA 1JIJA 1P80A 4PZ9A 3HI4A 3E2PA 3W78A 4MW2A 1E2QA 4HGRA 2PZGA 2ZUWA 1XTJA 2CXSA 2KW5A 2ZAOA 3PP8A 2Y4OA 2XZLA 1PR2A 1X19A 1Z7BA 1BXZA 5I9NA 2PUBA 2Y67A 1NI4A 1P17A 1QS0A 3E70C 3DE3X 4WOPA 4XR4A 2X41A 1CY2A 2VNIA 5HCIA 4EB6A 1X77A 2BZ1A 3U7HB 2KPOA 2JCYA 3AR2A 3IVCA 1MW9X 1N1EA 1P73A 5U4XA 5C3MA 3IDSA 5DNYB 2XGJA 3LDUA 4D0RA 4ZIRA 4XGNA 3OFND 2VDLB 4NJEB 4CEIA 4YT2A 1D2GA 2PZEA 1OAAA 1EVQA 1B16A 1YHNA 3QFFA 4KN6A 1IUKA 1ANKA 3O1JC 4RC9A 3TQOA 3HU3A 4PHCA 4CFYA 2I3ZA 1QKJA 1ZUWA 5AOAA 5BW6B 1ID8A 1KOGA 4J43A 1DRUA 4G0NA 1DC4A 2O7RA 4Z5XA 4Z4IA 3DWEX 5I9BA 4UNIA 2C98A 3S44A 2FWRA 1HFKA 1I4WA 2HA2A 2BFBA 4C9BA 4TXNA 4MULA 4KEAA 2R8BA 2ZAYA 3I0MA 2WOOA 3B9PA 3QA3E 3V7NA 3LUKA 4B17A 4M7WA 1MQ8B 4RZ2A 1Z22A 1ZH6A 4W6ZA 3MLBA 3PFNA 3NRJA 5SZJA 1GPYA 1N2HA 5CXXA 1DEHA 1JSXA 1HURA 4WBNF 3SIXA 4NDNE 4EHKA 4IHKA 5J9FA 4DHWA 4CM8B 3TCKA 1IJBA 3VO9A 1ADGA 1V16A 3V8EA 3A3OA 3DMDA 5EHXA 1EE9A 3KQWA 5FWNA 4HWKA 2J3JA 1TKAA 2M6RA 4ZCPA 4D43A 3FBTA 4R5MA 3VR5A 4GPEA 1H9BA 4IEFB 4JI5B 5HTOA 1A77A 2Q50A 5B6IA 1IEWA 2I6TA 2TMDA 2Q0SA 2PG3A 3BN3A 3B89A 5CK5A 2OZPA 5DGDA 5GINE 3GVIA 1G21E 3OJXA 1OTXA 3SYTA 5JD4A 1G18A 2QP4A 1A8IA 2QQ0A 3KM0A 4YRCA 4YJ2A 2GA9A 3IS3A 2ZSDA 3F4BA 2LRHA 2C3YA 2HJVA 1JZQA 2WU1A 3LLVA 4IQ8A 3WQSB 2WYIA 4BYMA 1WDLA 5BO5A 5A4DA 1E3QA 3LLUA 1LFAA 3A2LA 3UB2A 4II7A 3M82A 3OKPA 2UXBB 4YWHA 3NJRA 1A69A 4OYHA 1YXMA 3THXA 1IY8A 2RDMA 4G0WA 3MYYA 2HLDA 5KOHA 3SIWA 1M7HA 1ISFA 3B60A 1YU9A 1QDUA 1H2HA 3EA5A 3VHXA 4LDJA 2I9PA 3CTMA 2OA0A 2CZCA 1JDVA 1PVDA 2IXFA 3PR1A 3NGXA 1NC3A 3PRKE 3ZY3A 1UBTS 1TJ3A 3JPYA 1KVSA 3TUZC 1XI2A 2QG9A 3W6ZA 1NAHA 4IXMA 3DULA 2VDWA 4LJ8A 4DIDA 4HGVA 1UBFA 2NSDA 4G1CA 4JLAA 1OGJA 1EHCA 3JQ7B 3PTLA 4QUDA 2HBRA 2NU8B 4ZQEA 1QRAA 1HY0A 1OBCA 4M38A 3AERA 2QTHA 4MVJH 4ODIA 4M1EA 4XSVA 3RS0A 2P4UA 3CX4A 1QIIA 2HMSA 4RSRA 3WTCA 1A9ZA 1U3FA 4OK6A 1SUSA 3GJ8A 2Q6TA 3NVAA 4AYWA 6REQB 1O96A 5B55A 3RKRA 5A6VA 3CB4A 2HTFA 1J0DA 1WPQA 1TAHA 3OQNA 3GAFA 3DXYA 3O31A 3GEBA 4KRXA 4GI1A 2IUTA 2O2EA 3MW8A 1P5RA 2VJMB 5F4ZA 1GJRA 1NN5A 1W4BA 4MUMA 2LV8A 4BNTA 4N76A 1CF9A 3ENZA 4XCQA 1RLTA 4EQ6A 1KYTA 3PUZA 3FOZA 2VBFA 2QE7D 5CUQA 1KSJA 1WIWA 3K72B 3CBQA 4C30A 3B6ZA 2JIRA 5E7QA 1KO5A 2ZRLA 1G41A 2FPOA 1JHYA 5ESRA 3TNLA 2NVUA 4GZ5A 5BSWA 2B1RA 1TM4E 4GGPA 4LZWA 1FYDA 1VIDA 1XG5A 4EVIA 1RVV1 3H5OA 3H8JA 3BSYA 1Y6QA 1M34A 2EW2A 2ECQA 1S4QA 2ZROA 3S1SA 1UEIA 2WPDA 1DP4A 1KMNA 3EOZA 3MVEA 3PQDA 5D1NA 2ZIXB 4A8HA 1SGWA 2HRQA 1RRMA 2J4FA 4C2BA 1X2EA 2CL5A 3U39A 1XQWA 1LS1A 3RC2A 1OMOA 2ZKIA 3E84A 2SHKA 3BJEA 2Y6UA 5FKJA 4A0QA 1FTSA 4D4GA 4YV1A 2JJMA 2QPAA 1R16A 2NMVA 4QLOA 1OLSA 3C7KA 2UXCB 4M89A 1F0KA 1Y33E 3KX2A 4X1OA 4ARUA 4ESOA 2ODWA 2ZCUA 1V7CA 2QEQA 1LFDB 1W2GA 5LB2A 2XB2A 4YRNA 1NVEA 3B6MA 3NTRA 4GI2A 3DHVA 4JX9A 3UWMA 1JLLA 3BWVA 1FJXA 4BC1A 1U65A 1E6KA 4INOA 5A4JA 1I2ZA 3T9AA 1BEEA 1KEWA 4RESA 4RK5A 4MX8A 2FUKA 1BGXT 3WKDA 2V7XA 3CX6A 4JJIA 2VA9A 3G0IA 5HF6A 4X9XA 4E4YA 4O4IA 6PFKA 3OLWA 1WF3A 4IRXA 4MUGA 2R84A 4UBLA 4R71A 1M1YB 1U5BA 4LAFA 4MEAA 2IYVA 5FBLB 5JAHA 3IP1A 3DONA 1ZM9A 3FVRA 5COBA 3V4FA 1V8OA 1JSCA 4JR2A 3RK1A 4MKRA 1BA2A 3KQMA 3FROA 3ED5A 3NETA 4WLEA 2EZ8A 3W3AD 4BZQA 1N5IA 3LOQA 3NKFA 4FYVA 4TMTA 3A4TA 5KZMB 1AUQA 3IMGA 2F9MA 1SU4A 3KT8A 5FJIA 3S8MA 4BCCA 3Q9LA 4DJJA 3OPYB 2ODQA 1XZBA 1H66A 3K8QA 2ZXFA 3THOA 3CKKA 4B34A 2BYTA 1L5WA 2XYVA 2PL5A 4TPKA 5D8DA 1XZJA 4YPFA 3FYUB 2GM4A 1RYFA 1AH2A 3QTTA 4IHQA 3A11A 1Y3BE 3DEHA 1F6BA 1IVNA 4TL6A 3E35A 1KZ9A 4FOTA 5AVOA 4QQFA 4R01A 4TKUA 2YJGA 1QHXA 4X6LA 4C3VA 5JEEA 1FZTA 1EJ2A 4A0RA 5K0ZA 2W6JD 1J4AA 3GX1A 1VRVA 2XZDA 3Q0TA 3ZV6A 1SQSA 2XD9A 4MROA 3HHEA 3O93A 3I09A 3M8KA 4PO3X 4X7RA 3VNSA 3M6VA 1E2GA 4RDCA 3CI0K 3ZR4B 5ITZB 1Z2PX 3KCNA 1E2PA 4AD8A 2HHHB 2A1TR 2GZHA 1FDSA 3IFSA 4YECA 2R00C 2E82A 5EEGA 5KPJA 3OE7A 4BLUA 2V1XA 4MYCA 3OCYA 1A4UA 2PWYA 1GPLA 2XMCA 2AHOA 2BC9A 3FGZA 1NIPA 3NAZA 3R20A 4PNZA 4XLLA 4X60A 1TEVA 2VS1A 3JVDA 1SBHA 3OF2A 4HF7A 1KORA 4JYPA 3L8YA 4HLCA 4PLPA 4M1QA 2PYDA 2CNWA 4UCQA 2XA1A 3HJAA 2VP5A 3GNQA 4RZUA 4UNSA 3ZD9A 4MIEA 1LBQA 3F96A 1SMKA 4JC0A 3R9KA 5F2KA 2JJYA 2IPMA 3RU3A 3MYRA 3EK2A 2ZRJA 3AO0B 2VG8A 2YV4A 3R75A 2C5BA 2WJJA 1QONA 4LZJA 4PTLA 4RTMA 4DCCA 5EQTA 2EX4A 3IP7A 1PLLA 4FLMA 4Z8YA 3VPXA 1WWKA 5DM4A 1W0CA 2PS3A 4IOMA 1T2DA 1SHTX 1CLUA 4DZZA 2BONA 3F7TA 4E0BA 5KSPA 2VRBA 3P9SA 3SHQA 1UWLA 1YDFA 2H06A 3HNPA 4NAHA 5EHIA 2ZRPA 4OATA 5DASA 5IC5A 1PR4A 2XUZA 4IZOA 2WSSD 4CKZA 1F7VA 3P0JA 1AKMA 1G19A 1NVDA 1XQ9A 3HWWA 2CLKB 3MS4A 1GXSB 4NG5A 1NXOA 3R5HA 4XXHA 4H1VA 1U4NA 3O9ZA 1YR7A 3BWXA 2IH4A 3Q3VA 3SZ3A 1W30A 2XE7A 5EE9A 3F5QA 3KTFA 1CUCA 3E7FA 3T41A 2ZB7A 2RHRA 5ALIA 3HBNA 3UOAB 1T4MA 2B2XA 4ZCSA 1KHTA 1M1ZA 5NULA 3ZGYA 4K03A 3F78A 3RSHA 1R3DA 3ZDZB 5K45A 1XJQA 1Q2UA 2XT0A 3FVTA 4UJ3A 4RK6A 3BIXA 4ZMRA 2W2TA 1GAEO 3VNUA 2XYRA 3UUEA 3N07A 5EMLA 4LOKA 1ZMRA 5KX5F 3CEJA 4FWTA 3WQBA 1RXEA 4UUMA 1SOMA 3UEOA 1QH9A 3NNDA 2DCUA 1NSTA 1HKHA 2XIQA 4EY7A 4UAJA 5F1YA 3AHIA 5C7LO 5KYUB 4IP0A 1SH7A 4ZEXA 1KIMA 1OTYA 1XVVA 4IS2A 5C4GB 2JGJA 3UAGA 4C0KA 3RREA 4ABYA 2EJUA 3U19A 1E3WB 3G9TA 4PC3A 5ILGA 5DULA 4EG3A 1HT3A 1MC1A 3HL4A 2F59A 5DM0A 1GNVA 4LDRA 4AY3A 4RH0A 1WMFA 3BJZA 3R23A 2QV7A 3KU1A 4Z3DA 4AJ2A 3W2HA 1WNFA 2NZWA 3HXPA 1MT3A 1KGDA 5IK2A 4TVKA 3AB7A 5EVJA 1KBZA 2AR9A 4O63O 3IE0A 3WL8A 2PUAA 1DFGA 1SULA 1CK4A 2EARA 2IU4A 1V11B 1L7BA 2W11A 2ZUFA 2B3TA 4CGYA 4EO7A 4EAQA 1QGYA 1R1DA 3JYNA 4M6WB 3IOEA 5TXGA 4IDEA 2DM6A 2ZBPA 2Z8ZA 4ERXA 3VDNB 1SXJB 4IVQA 5I8PA 2ZJ8A 4ND5A 1EWVA 3WMWA 3L6DA 1G3UA 2V97A 3AEXA 1W5SA 4G9GA 4L2IA 3BMOA 4WBXC 5AKLA 5F3DA 3U4AA 1ISIA 1T5HX 3W05A 4YUVA 3R74A 3DEYX 4B09A 1YONA 4F9FA 2VHQA 3VTFA 1DCKA 1DL5A 4N7MA 2G83A 3KOOA 4A6XA 3ZZTA 4C7JA 1B76A 2DF8A 2DKNA 3E1GA 2IXEA 4U2CA 1GPNA 1HDRA 3FLEA 3OE4A 2WD8A 1YB5A 3HI6A 1T2FA 4X7BA 3O7MA 2PZKA 5HM6A 3AYZB 3LPDA 1GQYA 4XPIA 1RMTA 4YACA 1P33A 2CLHB 5AKXA 4F3RA 1HZZA 3AI3A 1JI3A 2OD7A 3ET5A 4LSGA 4OQNA 1SQGA 3F6RA 3EXIA 4F56A 1VG1A 1ZVMA 3CEAA 1E8NA 1F2VA 4PU0A 1UPUA 4YHBA 2BLLA 1T36A 4HTAA 3LGAA 3Q98A 4ND2A 3OM8A 1RABA 3FCEA 4RHUA 2BEKA 2O3SA 3E9EA 1OFUX 3FTQA 1JHOA 2K2WA 3GEHA 1CDZA 3N3AC 4KWTA 1UXJA 4DV1B 1C1HA 1QO7A 1IY9A 4FLEA 1CIPA 1UOQA 2AYZA 4I6GA 4OOEA 3M6UA 1IIBA 1X1SA 1C3JA 5AKJA 2XYPA 4YJFA 1W2WB 3V4SA 4D45A 4M9UA 3NHKA 4Q37A 1NDUA 3PC4A 1GNTA 2UZ3A 3D6VA 4NCBA 1TK2A 2H5LA 5IDWA 1XYVA 2AWNA 5KJ6A 2X4GA 2B21A 3MGCA 4WKGA 4IH4A 3SIPA 3TAHA 2AG0A 2HJRA 2G9VA 3PWTA 4Q4AA 2EWWA 2CV1A 5K03A 2F55A 3H1PA 2A7QA 3CR3C 4D80A 3K1AB 4JJ8A 5LA6B 3HJFA 1ECPA 3HFJA 4EH1A 4JDPA 1RYDA 3H5WA 4RL6A 5ULLA 1VJ1A 4L4UA 1YQXA 4P4SA 3FGOA 3F3YA 4TM8A 2OUIA 5LOVF 5TDHA 2C5FA 2QRNA 1PCXA 3BB1A 1QB8A 3EEFA 1YZGA 3O38A 1A82A 4FC6A 4Q9NA 1DT3A 1IXRC 3QQ5A 1D2NA 4PZPA 4EKNB 3KVYA 1Y3IA 3N39C 1WXDA 2WR8A 4HH1A 2JD2A 3N2KA 1RQLA 1U7UA 1MZVA 5K8IA 1TX4B 3PGXA 4N7BA 3K09A 2QTAA 2IEAA 5DX8A 5EHNA 4IDHA 1RZUA 1IG0A 4KXVA 2P90A 4RK0A 5UKDA 5I51A 4EJ6A 2HEGA 4HX9A 4RLHA 1M5RA 3KZNA 2OCAA 1L4HA 4Y8VA 2X42A 5HKLA 2IHUA 3KB6A 3KPYA 4YAGA 3A6LA 4LK2A 2PXAA 1I4TD 1Q83A 2B94A 4NL4H 1XJWA 4C3OB 1XN4A 4DZRA 3IJRA 2BM8A 2D13A 1O0SA 1QHEA 2VEOA 3HUEA 3HWRA 2BBTA 4ALKA 4F4IA 5I48A 5KSWB 4RTSA 5JUWA 3EIXA 4K6FA 4OOFA 2PTRA 2XKJE 4QDUA 4YP9A 2G9ZA 4XRGA 4JZYA 4N48A 3L6EA 4QICA 4BNDB 2WUVA 5KUTA 1PFKA 1AN9A 1ZYUA 2CD7A 3NLLA 3R5SA 1T3GA 1MEJA 4D2IA 4D7AA 5H9WA 3AZPA 2FSSA 4QWWA 1VJRA 5DSXA 2I9KA 3VOSA 5JY6A 1IQUA 1N8NA 1TLFA 1TJPB 4CQMB 2F67A 1UJ4A 3DW1X 3ITNA 4AY4A 3O82A 4HNTA 2WG1A 1RPNA 5CFOA 2ZTUA 1DQSA 2C95A 4RADA 2RHJA 4MR9B 3UUGA 2ZYVX 3LHDA 4NATA 1BOOA 4EK9A 2B1JA 2PMDA 2XB9A 4OI1A 3TTWA 5AVZA 3AF4A 4TXHA 1YE3A 5KNBA 4IGFA 4RUKA 1Z18A 1TZMA 2QGNA 4M2LA 1LCIA 1XEWY 4N82A 4YAWA 1PT7A 4DUGA 3N2ZB 4DSUA 1FTGA 3MBIA 4ER5A 2XUDA 3VSBA 1FFGA 1O0BA 4XRRA 2DLCX 1JEJA 5LQNA 1RQXA 1ZOOA 3FCCA 1U8CB 5AJXA 3ZDFA 1U1FA 2WDZA 3JZFA 4NCIA 5EP3A 4FHEA 3JARB 1L5MA 3UN1A 2R1VA 5E2IA 4X8LA 2NO4A 1XQVA 3DGEC 4RW0A 1GTZA 3T4EA 3TSCA 3TRDA 1EH5A 3VJKA 3RYCA 1Z8DA 3O8RA 4UZSA 1UDBA 1XTIA 2AG5A 1L1RA 3KL4A 2VPIA 1TCBA 3PIIA 1IG3A 4IFIA 2JL1A 3RU2A 2HHJA 4LBYA 4E46A 3KXKA 1FURA 3NI2A 4QBKA 1G9TA 1RI1A 3ORRA 1IUOA 4AJNA 1DAOA 3KKPA 2J3HA 2PT9A 3GGOA 3NVDA 1C7RA 1QK4A 4GYYA 2XOEA 3MWYW 3LDHA 3PTZA 4BNVA 2OZKA 5JYCA 2WAOA 1KC3A 3BGIA 4GP7A 2FOIA 2X1VA 1CRPA 1YD7A 2CFTA 1HFWA 4P93A 3RQSA 4EB8A 3TXXA 1RTKA 3PHCA 1GZ7A 4QDZA 4YWJA 1W85A 3ZK9A 4W63A 1U3TA 4P0TA 2WSIA 2A84A 3PSHA 4OPMA 1EZ4A 1TRHA 2VHVA 4CODB 1PD0A 3BK7A 3KWFA 3M4JA 3NKVA 3ILXA 4MUAA 1NZFA 2V9ZA 1XMJA 1UMBB 3LUPA 4ZYXA 1ZOLA 1C0EA 5A3QA 1KYWA 1QMPA 1ODCA 1JIIA 4ZAWA 5GJCA 4W1SA 1ES9A 1SELA 3A58B 3D3KA 1AKEA 4DY6A 2PD6A 2ZBGA 2ZJ4A 3LWZA 4ZI7A 2PL3A 3OQVA 1K2VN 3PZRA 4LTMA 2WHYA 4BO7A 3AUTA 3PHBE 1E62A 2Z6VA 3QVLA 4ZDJA 2AFIA 3KJZA 3TG2A 1SXPA 2RFLA 4K6GA 3EXG2 1QMGA 3T7RA 1U63A 1CNMA 1G59A 4WDRA 1CJTC 1N1DA 4U7JA 3LCMA 4ZP1A 1NONA 2FZCA 1K6EA 1HFJA 2NPFA 5B7GA 1Y81A 4CKYA 1JQKA 4FWIB 1SPXA 5GM2A 7GPBA 2OCLA 4BVKA 2D59A 1VCOA 1DO2A 3TECE 2JZCA 4UFNA 1G8SA 5B1SA 2VT3A 2J5KA 4RNCA 5LBIA 5C34B 3GMTA 1GCUA 1VGRA 3FNRA 2VBIA 3CCCA 3AL2A 5HGXA 3WADA 3RM3A 2MSEB 3VYRB 2Y1LA 4X5OA 3GFOA 4YYEA 5I9MA 3DBHA 4QD3A 1TCCA 3JAMA 3U16A 5B58T 5IKOA 4E1VA 5LL6P 2FSPA 2Y0CA 1TKRA 1PS8A 1Z0ZA 2VBCA 3OZDA 4PLHA 3RFUA 3RYHA 2OHXA 1O97D 2G9UA 4TTPA 4Y1RA 2Q99A 5P21A 4CBVA 2IUYA 4NENA 4EKDA 4YXFA 1E1QA 1G8MA 2C5LA 1KJWA 2Y9MB 3WZMA 3LVFO 2OV1A 3GLIA 1JEDA 4U5QA 3AVOA 3HRKA 3ZHBA 1WW8A 3NQ41 4D97A 3UPDA 4CR8A 5BWLA 3A1UA 2GYYA 1L8AA 4YVFA 3LFUA 5T4HA 1BOFA 5I3ZA 5AHWA 1KJJA 2YQ4A 1GGJA 2Q41A 2VJNA 3AP1A 5E9AA 3WWOA 1GDHA 5EJAA 3LQFA 4QXQA 1PQWA 3RD8A 2ANBA 3C1OA 3K6JA 4PGHA 5J2TF 2X23A 1AHHA 5AVSA 3GLGA 2R6DA 4HDAA 1FIUA 1QTRA 1FUEA 1V96A 3IVGA 4JI6B 1HTTA 1I7QB 1WMEA 2CUKA 5HCNA 5AUNB 1H9AA 3VAAA 4CMCA 3T06B 3I5YA 2C4WA 3PBKA 1UMDA 3EF3A 4EARA 1RAGA 2CF6A 3IIMA 2OCKA 4DOMA 1V8DA 2SBTA 2JI4A 3Q40A 3I6QA 3B1FA 2BR5A 1W75A 4IHJF 3HXKA 4DV3B 1EWRA 5T64A 3CLTD 2RE8A 1RRPA 3BTVA 3A6PC 3O84A 4EMBA 3K9WA 5AM4A 4F7WA 2HX1A 3FJOA 5IAEA 2GNAA 3IJEB 2G9NA 3RVPA 4HAOA 2BN4A 3A4IA 4HB4A 3SE0A 2RHWA 3D4LA 4L7QA 4GX0A 2DR3A 1UDXA 3KT0A 4O2AB 4EG4A 4DQKA 1LPBB 3FCAA 3OIVA 3QE4A 2XJ4A 5TSDA 3JQFC 4DR1B 1RHJA 3HUUA 4HUJA 5JYBA 3CH7A 2EZTA 3AI2A 3O3OB 2IK8A 4JUFA 2C5EA 1R8QA 1VHWA 5SY4A 3S2YA 2UYGA 5CM2Z 5B3KA 1XDZA 4MVJE 1Z5VA 4TS1A 3SG0A 3QBPA 1XTRA 2WMYA 3ETGA 3U44A 4ZK2A 4RK4A 3BTSA 1EGMB 2M9MA 3PGVA 4TLMB 2HCBA 5JLAA 5JNWA 1AS0A 1W88A 4W5WA 1WO8A 1SHKA 1D0IA 4BQQA 2JAQA 4F97A 3T1YB 1M6NA 3EYAA 4R2IA 5FUYA 3U3JA 3UT6A 4PLYA 1JPNA 1T4CB 1T1EA 2CLEB 4JP3A 3OZUA 2IY9A 4HMOA 1TTTA 2A9PA 2RBEA 1C0LA 1L4FA 1MXHA 3PGKA 2WTBA 1VKNA 3DA8A 1ZCFA 3GA5A 2FF5A 2UKDA 4PSKA 3ACDA 2ZTMA 1ZOIA 4C21A 3AP2A 1Z4JA 1DAEA 3NM5A 1DKLA 4LEIA 4QTZA 1UXHA 4TMWA 1ZK3A 3GOHA 1LI7A 4A2WA 1CWUA 3OPYI 1SVMA 3BBLA 3CLTC 3HFSA 2IWRA 4ZHSA 2QRUA 1NW9B 1MN6A 3OQ1A 1DTWA 1WXEA 4AYTA 1ZJ5A 1LLFA 2C20A 4X20A 1ODIA 2CNBA 3TWOA 4IDBA 4TKLA 1MH1A 2GAAA 2GZ2A 5BOVA 2F3SA 1SOVA 3IPXA 4G3XA 3MN1A 4M1WA 3D3JA 3F6EX 3UF0A 3ZHXA 1VPEA 1ZL2A 2H1WA 2AR0A 3HBMA 3UJ6A 3NP7A 1ZIPA 2QA5A 5C8DA 5IXJA 3AR7A 2NUPA 1KAHA 1I7DA 1W5EA 2NVBA 1WUKS 2QHXA 4NZ9A 3TH5A 2RHBA 2YHSA 5DHRA 4P86A 2G67A 4YCAA 1B8VA 3H5IA 2OZEA 2PNJA 4CCAA 1EFRA 1J0EA 2FKAA 2GCGA 2EOAA 5CLLA 1II8A 5IAJA 1FX0A 1IMJA 2AN1A 2V7UA 4P54A 4FDLA 4FHZA 4B83A 3LIPA 5HRCA 2PQMA 3K8YA 1I3LA 3A3KA 5DTEA 3EIOA 3MGKA 1IUNA 2XZOA 3OOSA 1EBBA 2XMQA 2KM1A 3OI7A 3EZLA 4IKOA 1N2CE 4AO7A 3VI3B 4EZIA 2X0EA 4TQAA 2B6NA 4OA5A 4YRRA 2FPUA 4TYWA 3OA2A 2VXOA 2O8BB 2MTBA 1CJBA 2ICAA 5DN6A 5DM60 4ZRNA 1PJCA 3T1QA 4P7KA 3URKA 1MU0A 2JHAA 1WHSB 2Q4RA 2QRJA 2H65A 3PI7A 3P32A 4G9BA 2XVZA 3GGPA 3KSDO 3PQ5A 4QFMA 2XWSA 4D81A 5FWYA 5F12A 2HF8A 2CNKA 3ZVNA 1RXYA 3HU5A 2FZGA 2Q9BA 2IDJA 3H9UA 2CFIA 4K9NA 4BVGA 1NBOA 3N53A 3DL4A 4KBYA 1NLZA 1O9BA 1RVDA 5TPWB 2VTDA 4BV8A 5DLEA 4BX0A 5CVJA 2GK6A 1IBCA 1L7QA 4RPCA 3UUWA 4CKBB 3ANLA 1L7PA 3WLJA 1Q92A 3L7KA 3P9KA 4ZAVA 5K0LA 4LJ9A 3WYDA 4BP3A 4DYHA 4QUAA 1RJ9B 1RKVA 1Z0DA 1WOYA 2OG2A 2OFXA 5I4BA 2UAGA 1NSYA 2H1SA 4RCVA 2WG2A 4AN0A 5JS6A 1F2UA 4F5WA 5ILOA 1T6NA 5EYPA 1Y7LA 4BBPA 1GOTA 4CL2A 4HAXA 3RH0A 4JXZA 1QIFA 1GZ4A 4KQXA 1QHHB 3UMSA 1DOAA 1OUMA 1WMDA 3L18A 3ZWDA 1UPBA 4WGFA 5F73A 1N36B 2GCEA 3F4SA 4RIFA 2IYPA 3E9DA 2C57A 3P2YA 3X2EA 5K20A 4KR6A 1COWD 2XTZA 3R0IA 4OK5A 2ORYA 2GCIA 3E81A 1GILA 2V7VA 2XUKA 3R7WB 4GECA 3RARA 4ED9A 3U4QA 1L5NA 1QVZA 2IOHA 5LP6F 1QYVA 4ADLA 3DV0A 2FCAA 4HDQB 3CZQA 5B7NA 4J1QA 3W1VA 4BBJA 4MHTA 2GSWA 2OHOA 3EGDA 4F4UA 2BGNA 4Q39A 2DQKA 5F33A 2GJ4A 3UG6A 3IP5A 1T8YA 1L5FA 4FN5A 1ZR2A 5E6UB 2VYCA 3LH5A 2P11A 1QHSA 3KKMA 2V45A 4UEQA 1IPEA 1SKUA 3ZXUB 4D79A 1NQ5A 1JFLA 1H2RS 3D4BA 5E6RB 1REQA 5HW0A 1EJ0A 2FWBA 4JBHA 4KPFC 4GD3Q 5BQ3A 4QM7A 2O19A 4JBYA 4L0QA 5HGJA 1ZJJA 1KFBB 1VMKA 3QV1A 3ZIAD 3VBEA 3E04A 1C50A 4JOSA 2PFGA 2AC7A 1Z39A 2D2VA 1NTRA 3A26A 3IAUA 1DIBA 2Y71A 1KMQA 1RLIA 5FLYA 3VUEA 3H11A 3MIZA 3J7TA 3DG9A 1W47A 4LMPA 4U5XA 5DE3A 4GI7A 2IV2X 3TFQA 2JRLA 2AJTA 1J70A 1FU7A 1BS2A 4HS4A 4JLOA 5AHOA 5AVJA 5FOXA 4DNOA 3HA2A 4EL0A 4KYUA 1G7RA 1P6XA 2QM8A 1A5SB 2WJPA 1BH6A 1N2EA 4HZGA 1M7BA 1NW3A 1S0UA 4RU1A 3BHGA 1SHZA 1YQ9A 2OVFA 1DRVA 3IO5A 5TVGA 3SQDA 3ZS8A 3PWZA 1DKNA 4ZOLA 3TPCA 5H82A 1LBSA 3IP9A 3U1TA 3VNVA 3VSAA 4PYIA 5JRDS 3D4PA 2PUCA 1PZGA 5EUQB 1X7YB 1LNSA 2GD6A 4CIVA 5BQ5A 3AR3A 3RBZA 2W6IA 1W93A 1E4YA 5CLFA 1E2NA 1E60A 1HE3A 5TMPA 2QW1A 2ZXUA 4RCYA 2KSQA 3FDXA 3R6QA 3T1NA 1ZGHA 5JCPA 4XWWA 1QG4A 3RS5A 2EWVA 5AQ1A 3LPNA 3SZOA 3OCEA 1XMSA 1Z6GA 4RLFA 4D9MA 5MGBA 1Y5IA 3DE5X 5TRTA 1VMIA 3UJBA 4JI0B 2Y2UA 1E3SA 1YNSA 3E1KA 3LWNA 4KPGA 1Z4OA 4G5YA 1D8AA 5HZMA 5KNDH 1FJHA 1FE8A 2DQ4A 1JEYB 4WY8A 2E7ZA 4DMKA 3AUFA 1QAQA 4PO8A 2BOVA 1G20A 1MXFA 3FR7A 1R0WA 2ES4A 3Q7QA 3U48A 1BGVA 1DKMA 1P61B 1TTPB 2P9YA 2E5WA 1QF6A 1ZZGA 4RAQA 1WCV1 3B2QA 1LXCA 3C5HA 4UC0A 5HK8A 1IBLB 5CVTA 1UJ6A 1XFAA 4RD6A 3OQIB 1AQUA 1YB1A 2VNSA 3KXIA 4UASA 4YUYA 1J99A 1QH0A 1XRRA 2Q5LA 4YC7A 3FWZA 2QN3A 3EHDA 2VYFA 4CIYA 4RIHA 4LOHA 3FI9A 1ONBA 1Q3TA 1ZNZA 1P7CA 3JYLA 2YQZA 3R3ZA 3H2ZA 4BB0A 3OCXA 4K8OA 4MIYA 4ENQA 3VU9B 4QG3A 4DNFA 3AI7A 3ZE9A 5DPMA 1VPLA 1B14A 1U81A 3PUIA 1XPRA 5CFPA 2QT1A 4YMSA 4EUSA 4U7GA 2Q3CA 2XUOA 3LCCA 4MUIA 3WMFA 2JC3A 1OLXB 2RJOA 3JQDA 4WLFA 2OFOA 3QLVA 4JU8A 1FS4A 4OREX 5LA6F 2XJ9A 1I2AA 1YFMA 3EMDA 3NHPA 3O21A 1E5VA 4NJEA 4YJ3B 3ZWYA 3U3XA 5J4VA 2Z5FA 2DQSA 4V0RA 3DD5A 4YRZA 1EFCA 2H1CA 2ZK7A 1HETA 4ZO9A 3R3JA 1IJKA 4QSMA 3L7NA 3IMEA 4UMEA 3ZE0B 4LF5B 4DUPA 3M4ZA 5EAIA 1UBNA 2ACEA 2C2WA 2DULA 1UJBA 2GO7A 3BQ9A 4F96A 6GPBA 1T2AA 2XZTA 3ZDYB 3UY4A 1RLJA 2ORVA 5FP0A 4AJHA 4CRWB 1DBSA 1Q7EA 4WNAB 4H60A 2AZXA 1BXKA 3HY3A 1T9HA 1CULC 2ATXA 3TVTA 4YP1A 5IM4F 1M1XB 5DH9A 5B5SA 3WNVA 5JASA 4BBZA 2CLIB 3R6DA 1X9HA 3E5HA 3TQQA 3R77A 3VUFA 2P8JA 3SVTA 4FXPA 3HCOA 3KEMA 1ZI9A 2VDOB 2D0IA 1MB3A 5HZGA 2BDUA 3ZTTA 2ZYAA 3ZBQA 4PV7A 2HWUA 3V4PB 1NOJA 1MGOA 4I5FA 2GEJA 5IFKA 1W36B 2EG9A 1DEOA 4CM8A 1Z63A 2BR3A 3M81A 1HX7A 3PRJA 3JATB 1PJ2A 2GTHA 2OHFA 3QXHA 5JSYA 4KPEC 1K3FA 3DEIA 1FW6A 2QX4A 2JIZA 2MR6A 1EFAA 1LRJA 2QX6A 1BAPA 1W9HA 2PUWA 1HI9A 3MWDA 4M9SA 4C4SA 5EJ2A 4DLZA 3IC5A 3X3HA 3TTTA 1UBSB 4JA0A 4RTNA 3UWDA 3TL6A 4PQGA 3HJCA 4G4GA 4BTVA 1DB3A 1X8XA 3GT0A 2HMVA 2PYZA 3I4CA 3LY5A 4M22A 4WESB 3W34A 1ZP6A 4A73A 2ZM5A 4LDZA 4A1FA 1B1CA 1EEXB 1WBBA 3DZJA 2XE8A 1A2BA 2I2CA 2DKFA 3L9XA 4ID9A 3WRXA 4O0MA 2G6BA 2PR7A 2C2OA 4EYKA 2FSVA 2WJWA 4MNTA 4DWVA 1CQZA 2FHPA 3HA5A 3RIEA 3RT7A 1I13A 2IEGA 2B9VA 2CGEA 5C8YA 4HFJA 3C8DA 3B9BA 5J4KA 2CXNA 4LFCB 3NC4A 2QMQA 2DFNA 1YBMA 3L8EA 3WHPA 2ZUUA 1H8HA 4HH0A 3R7DA 1PRYA 5IHXA 3UJCA 3OJEA 4BNJA 1NV9A 5EKSA 1TLLA 4FYYA 4YV0A 4Y2QA 3B3GA 3DKKA 3BCHA 4PGFA 3FZQA 2QN1A 3VH2A 5G40A 5ELXA 3CEPB 3CNEA 3G02A 2FQYA 1C8LA 1CZOA 4E31A 2P8SA 5IH3A 1GPJA 1XPJA 3GLTA 1KYXA 5DBOA 4YRAA 4NSLA 1CSEE 2Q6VA 3JQ7A 2TS1A 1GKUB 5I7OA 1TAQA 2NU8A 3NV7A 4DDHA 4XUDA 4LZAA 5EE3A 5KS2A 1PNOA 3DS8A 3V4ZA 1NU6A 4X95A 4HNSA 2OCIA 4QQ8A 1JHPA 2XWJI 3QI2A 5A1TA 4IIJA 1KETA 3L41A 3OHSX 1TJ4A 5DEIA 2IOQA 3T1VA 1XMVA 3GCDA 5FUXA 3WA7A 4DR6B 4JH0A 2CC2A 4H0CA 2WJ3A 1SQFA 1VIMA 1N9ZA 2JZOA 2VFAA 1X94A 1FQWA 1SIUA 3KU4A 2H9YA 4RZ3A 4K6HA 2YFHA 4WFJA 1QKIA 4WBSA 1E63A 1G21B 2VJMA 5HVNA 4ZYWA 1WSBA 3HEBA 1PL7A 1S3IA 2JDID 1PR5A 2C04A 4WZAE 2AD1A 2JFGA 2Y1XA 1TU4A 1IVYA 1E6MA 2VYND 3G5AA 1ESZA 3FETA 2ONZA 4YLEA 7ABPA 1X42A 2NZJA 1KI7A 1M54A 2FU5C 1HLGA 2RHTA 2PLFA 4OGLA 3T54A 1J56A 3UOGA 4YCMA 3ECCA 5AR1A 1N33B 1XRPA 2VQ3A 2HXYA 2P0YA 1LW7A 3WFZA 2ZIXA 3DUWA 1Z68A 3PHIA 4HQKA 3ZHOA 2CJWB 1MEOA 3GRKA 3PUYA 3CRVA 1CKEA 5D1HA 3TM4A 5BT9A 4HOYA 4YB8A 2I4NA 4HB3A 3GXOA 1WJGA 2UYQA 1PR1A 3P9RA 3GZHA 2EHJA 2BV3A 2IITA 1KOFA 3B2NA 3BL5A 5EE1A 1POWA 1NVVR 4H1UA 4EI9A 4W5OA 2EVWX 1V6CA 2WLSA 1RYBA 1ZH0A 4LHXA 4TWJA 5E2AA 3AFGA 1ZA1A 3P5SA 4RETA 4DLUA 4A8TA 1GZ3A 1AN0A 2ADOA 4KW7A 2FLVA 5BN3B 2XT9A 2A2ZA 4UHJA 2XSZA 2DX7A 1SCAA 2FJ0A 4PZZA 3RVRA 2LCIA 4EMUA 4GQIA 1EFTA 1RM3A 1A98A 2P1DA 1J9EA 1XV5A 2YY7A 3D1VA 4K88A 4UEWA 4JXXA 2VO1A 4NX2A 2Q5HA 3G5MA 4KXQA 4NDAA 4PAQA 5AJVB 4CMJA 3HA3A 5GV7A 1WW3A 4FB4A 2CYBA 4KN5A 5J1SB 4QL3A 5BW8A 1RJDA 1W0KD 2QLNA 3WIBA 2A5FA 5GVSA 4DR5B 2OV3A 3EZYA 2OO5A 4ZJYA 5IANA 2QM7A 3M6MD 1KVUA 1MJ5A 2FSHA 2PMFA 3VU8A 4Q66C 4PLTA 5CFQA 3KE9A 3C3WA 4PX9A 1P2DA 1V5FA 2G28A 2N9UA 4LJKA 2CB9A 3OPYA 4RJJA 1QOQB 1PLJA 3FWPA 3R3YA 3KYBA 4N5DA 3RE1A 3HCEA 3UHOA 5DNCA 4OIFA 2KBEA 4WT7A 6Q21A 1V6SA 3FYUA 4NCJA 3U4GA 3EIEA 3NWBA 5FULA 4BMVA 2AOWA 2JLUA 4GOOD 3N6XA 3GGGA 1RWKA 3PDJA 4TV9F 4TMXA 4IDAA 2CBXA 2Q0XA 3ITKA 3JRNA 3I2FA 3LRTA 3ZWAA 4NBUA 1G8PA 2A58A 2Y76A 2F7SA 2YWDA 1PNTA 3X1YA 3BWDD 2ZYDA 1ESDA 4R54A 2I4LA 1Q7GA 3R0JA 3M3HA 3VHQA 1SY7A 1V3QE 1UT5A 1EPUA 3ONWA 3HYRA 1V37A 1X74A 3EGXB 3T35A 3V1LA 5ITZA 2I1QA 4B7ZA 1RYHA 3R9WA 2SECE 3C6ZA 3Q41A 1E0SA 1Y7TA 2H8KA 4I55F 2H0QA 4I1SA 1TYEB 5EPOA 1XO1A 3N76A 3U4CA 1PZNA 3LGXA 3P19A 4E2YA 3O4HA 4MWZA 2VZ8A 3ZV4A 2IYSA 2P2YA 3LBAA 5FORA 1IXSB 1W94A 4WQMA 5SZKB 4IQ0A 1FFXB 2WSMA 1P7VA 4O2AF 3I61A 1U3CA 1RRVA 4OCZA 1ATZA 2I34A 1H1DA 4JLJA 1S4MA 4L1KA 4PWYA 2DFDA 4Y2VA 5B3AA 1EFHA 1SXGA 1PFYA 1QJCA 5JMWA 3LY8A 3EMBA 4ITRC 5BPFA 3GMSA 5G4KB 4GOXA 3N70A 3K8ZA 3QPVA 2EJBA 2VNJA 4HNHA 3TMAA 3BXHA 1JJ7A 1LW6E 3MINB 4IINA 4WNIA 3VZRA 4J0IA 2BH9A 1XF1A 3UJNA 2W6OA 4ZPXA 5F92A 3DE0X 4GRIA 3L92A 1JR4A 3IHKA 4NESA 4GX1A 2FWNA 1E2KA 3L04A 2ZREA 3KPUA 1DPGA 2AT1A 1UZMA 1V35A 3OLVA 3SR4A 4YS6A 1BFDA 4PQYA 2GN9A 3AKDA 4YV7A 2GRUA 4K2HA 1GXSA 3LCJA 3QU4A 1KJIA 2I33A 3UA4A 3ZCVA 1PGNA 1DDOA 2BY4A 4QOIA 4S04A 3C85A 1UC9A 3ZXYA 3DWFA 3K0AB 1DX4A 1EJ6A 3LT1A 5D6BA 5SYNA 3U61B 4G5OA 2VTKA 4LRXA 4MYTA 4C1NA 1R4NB 1ZGAA 2RCNA 4P7FA 1H5NA 1EK6A 4V0ME 4XA8A 1J07A 1GSOA 4Q9LA 2NU9B 3AR6A 1ZBQA 3EULA 3CZRA 3NX4A 1K89A 5AKHA 4Y18A 2Q4EA 3BWEA 3T0FA 1ZVKA 1JX6A 3F97A 3A05A 3QV2A 4UCXA 4ALNA 4FNAA 4HVAA 1U9ZA 3PNYA 2IVFA 2IZ6A 2OGTA 3TXYA 4OLFA 3ENQA 1YZQA 2GNOA 4FYKA 3UQZA 3NUZA 5IVDA 4W5NA 1YK1A 3K5WA 4K5QA 4YRPA 3NBZC 1H0KA 1JQBA 3GGSA 2JIMA 4Y2RA 3WIUA 2AIRA 1VKJA 5KYUA 4B48A 1A9PA 1G4UR 2MOKA 2P67A 4BQOA 1IXYA 3DF9A 4J9VA 4CR6A 5KCZA 3TCNA 5D84A 3IIKA 1Q16A 1UQTA 1MO5A 3A10A 3GAAA 3LFHA 1KQNA 5E95A 3T5DA 1Z4PX 3DLPX 3ELUA 4ZICA 4PYJA 1LVUA 5E4YA 3BH6A 1IBKB 3U17A 1DCNA 3AR9A 3A37A 3OQJA 2TSYB 4Q1CA 4OD0A 4PSCA 3LNTA 4NNJA 3GRAA 2PKEA 1H5QA 2ID8A 2IIPA 4YAJA 4BVEA 4GPTA 2Y6VA 2RH4A 3KUUA 3L0ZA 2Y2VA 3CV3A 2X76A 3O4JA 1YTUA 1QO0A 3WOHA 5T8KA 4YR7A 5AUPB 3AJRA 4RKEA 4GZLA 3AJEA 3GH3A 5F5LA 5FA6A 1OX6A 1DKPA 2HHAA 2VF7A 3B3FA 3GVXA 1N2BA 1U0OC 3DBLA 3PFKA 4J7AA 1WHTB 4PC1A 1APBA 1N6PA 3ESQA 3FPBA 2F8MA 2B7CA 3IBGA 3EN0A 1XLTA 2PUHA 3ESCA 3GRYA 2A9JA 4FNGA 4M6WA 2AI2A 2O2SA 3HB7A 4B33A 4E12A 1SXJA 2PRKA 3T3GA 5BV2P 1NW6A 3QXXA 1W4ZA 4QC2A 4NQRA 3A1SA 1Z25A 3BFJA 4BNHA 1WEKA 3W7AA 2JCGA 1N34B 1JA1A 3ZXSA 2DOKA 1JDBB 2P4QA 3NWOA 1JKMA 4INZA 3FMOB 3F1LA 2QZ9A 1EGQA 2Y1CA 2FDRA 3USCS 4BEVA 421PA 1AMNA 2UZ1A 3IB6A 2OILA 3SN6A 2W43A 3DTVD 2BMEA 3VMMA 5AVWA 1EK5A 4BVBA 3D3QA 1WXXA 1BU5A 2YJZA 1U8ZA 4DSAA 2XRYA 4GGMX 4JSRA 3EIWA 4HDRB 4LY3A 4H4EA 5HBGA 5AVXA 2V74B 1CUIA 3HA7A 3IERA 3E48A 4WK4B 1N1MA 1D5CA 2F00A 2NO0A 1RFGE 4MZXA 3C3JA 1AJEA 5K0GA 3GEMA 1KVRA 3S28A 4JNKA 3R6TA 1VCIA 5ALDA 4MWDA 3NHAA 1S2NA 3W6NA 4BL5A 2K7FA 2X4IA 4F21A 3ML1A 4BU0A 4HPXB 4YP6A 4M9XA 4XW2A 2P9QA 2OO5C 4AJJA 4EYGA 2M6KA 3EB9A 4RHEA 1NMXA 4TYPA 3P96A 1DX6A 4EPYA 5HPYB 1TM2A 3NHMA 2EWMA 2I1LA 3R0QA 4EGAA 5FDFA 1QQ5A 3QX7A 4UQLA 2ENWA 1D0VA 4OB7A 1NJFA 3RS7A 1Q1EA 4I8DA 4RY9A 3SQXA 4K1XA 2J1LA 4GL4A 2RGBA 3BMNA 3GMIA 4A1OA 1YAHA 4PW0A 4B1FA 3LY9A 3QI7A 2JEYA 2VT7A 3LCVB 3H16A 4I66A 1Z2AA 4A0HA 1E2HA 5KTTA 2Z6QA 2HL6A 2ZJ0A 4EKGA 3QPAA 5JHHB 4P3KA 4RTOA 1IZ0A 1P7YA 1ZG3A 1JIQA 2J6HA 1R8YA 1E7MA 4G37A 2HOQA 3GUVA 1U2RA 3NATA 3PFBA 5LBUA 1GNRA 5U4QA 2RHLA 2WSYB 3OU6A 2I1WA 3BWCA 1CZKA 1MV8A 3EZXA 4AWXA 2P75A 4BKQA 4CNQA 4ZQFA 2BW0A 2FR1A 5J5CA 1Q12A 3FSGA 1SHJA 3FRHA 1D4FA 1JHMA 1VIYA 2EBUA 2FRDA 2BAGA 4HAIA 4OMCA 4TN5A 3WGOA 3GRRA 2JH9A 3OVMA 4B0OA 5CFLA 4JP1A 3KDAA 1CIVA 1NTOA 3AGPA 1AGPA 1NUTA 2JI7A 3I73A 4LQDA 2I4OA 4OYRA 3MJCA 3AW8A 1J8QA 5K6RA 3SIRA 1BJKA 2PZAA 1EIZA 1UK9A 2QTMA 3JVVA 5DYYA 1OJLA 2R5FA 1VL0A 1K5DA 1TQDA 3QPUA 3PGJA 4F60A 5TPZA 5KNDD 5EMKA 4HWOA 4PGMA 4MDYA 2A5DA 3W8DA 2IQ5A 4MKHA 1ULSA 3KAKA 2IQIA 1KDYA 4H31A 3WWDA 2XOKA 1M9NA 2EJTA 2PAAA 3HL0A 3KC2A 4J1TC 2AZ4A 2BDEA 4MRMB 4QO7A 3TNDA 4C3UA 1XLWA 5FL7D 1ITZA 2RJNA 2VRCA 4CQMA 3GAZA 3COZA 3MHPA 1CPYA 2OQ2A 1W0JD 5AMXA 3UG7A 5BR4A 4YQFA 3WGUA 5K3EA 5HUHA 2VPXA 2RH9B 3IALA 3IR6A 1Y6JA 3ETDA 1W1IA 2GWHA 2J3KA 2C5HA 3V4OA 4KSYA 3VFDA 1XALA 2VP3A 4XJVA 2OHIA 4S12A 2O0HA 1JHAA 2D2IA 4EGFA 3SQWA 3SX2A 1NVFA 4QYMA 5AYVA 3MJVA 2ZUBA 4FILA 4AKEA 3SC2B 4MS3B 3K20A 2IODA 2DFPA 1Y80A 2VPZA 3S1AB 3HEAA 3JARA 2P65A 4HB2A 2B4KA 5BWCA 2CLDX 1LB1B 3I64A 3Q7RA 1OIVA 1AQYA 1YZFA 2HUPA 2YJ5A 1HE8B 3G5UA 3FVWA 1RWNA 5KTPA 1XZIA 3SU8A 3UKOA 4YMLA 2GOYA 1GZSA 3W0LB 1KR5A 2JFWA 1MR3F 2BE7A 2GN6A 1NVVQ 2DC1A 3HY6A 1WL8A 1XE3A 1I24A 3BE8A 1IWBB 4XX0B 5DTQA 1OZFA 1XVAA 1W9MA 5LQRA 3PPYA 4OHOA 2PFSA 1P1KA 2HD4A 3ABQB 3BIFA 5DNDA 1N1GA 3FFXA 2IXBA 1AKVA 2XUJA 4DDTA 1NVTA 3HCAA 3FVVA 1D4ZA 1BO6A 4X3CA 4DA8A 5J2UB 1XRMA 5EJIA 3D4OA 1FMJA 1OD6A 4QVKA 1IWOA 2VH5R 4M86A 1UMBA 1O87A 4V03A 1K8YB 3LHKA 1PV2A 3QLUC 2EFJA 1Z5NA 3F5MA 2DUJA 1QV9A 2BFCB 1GR1A 3QE2A 5D00A 4EG0A 1G6OA 1Z7EA 1Q17A 1QPZA 3DZFA 4KVZA 3OM1A 1N4AA 2ZSIA 3ZHSA 2A57A 4P81A 3JTMA 3PVZA 2CKDA 3A8TA 2VP0A 4D8TA 3SBEA 2RH5A 5LM3A 5K0FA 2BHRA 3A9VA 4LJYA 5AM0A 2PL9A 4IXTA 5H8WA 2GCOB 4OJMX 4D3FA 1GCIA 2OCYC 4DJTA 4D41A 1DQZA 1GPDG 1XBTA 4OP2A 2JHFA 3RK4A 3WWZA 1L7MA 3SYLA 3QWFA 1AO3A 1KVQA 5LYJF 5KNBH 3O75A 1P77A 4H3VA 2FPXA 3WMRA 4HTFB 4JV5B 3O8OB 2YMPA 2ZZKA 1MJGM 1Q57A 4J4TA 4KE9A 5G1NA 3IIIA 3BGSA 2XWQA 4JHXA 1DCTA 4PQFA 1KZ7B 3DE2X 3FPAA 4XM0A 1ECLA 3P2OA 5TE9A 3PPWA 3TJZA 1FJ2A 1DOFA 3OHPA 3L7BA 3N0TA 4NV1A 1RJWA 3ZKAA 2REQB 2WP0A 4AMVA 2QV0A 1QFSA 1XTBA 3FPEA 4HDOB 4EL5A 4MW6A 4N0DA 1FLDA 4UNRA 5FBHA 2LVBA 3O92A 1VSVA 1B41A 2O0LA 4IL5A 1C7IA 4G89A 3SF8A 4B32A 1X14A 4BNNA 2FW7A 5IEJA 1PZMA 1DHRA 2VVTA 2HGZA 2H57A 1PK9A 4JOQA 3LUFA 2QQEA 4LTDA 4R1MA 1XCGB 4QDKA 1Z5WA 1BVHA 4EA7A 3OCZA 3K70D 2AH5A 1JV2B 2R5NA 2YXBA 2E37A 1STOA 2X7JA 4OBWA 4WX2B 1H2WA 4XCVA 2FUG6 2OAEA 3G7NA 4FCTA 4B2PA 3CN9A 3EIFA 1RCFA 2NZXA 2QGAB 2C03A 2Z2ZA 1YA8A 3D2LA 3WIOA 2AEEA 3VZCA 2DUNA 3D1JA 2O7NA 4LDQA 4P5EA 2BR4A 4WKNA 5H16A 5C32A 2W6NA 4BKUA 4KXMA 3GFVA 4JJGA 2X75A 1L6RA 2VCEA 4E07A 1P4JA 4IGIA 3O1HB 3LLMA 4L4RA 4AIRA 8AT1A 3EVCA 3CVOA 5CJJA 3KEOA 3Q3EA 3ELYA 3RWOA 3BQMB 5IVPA 3RLFA 2H4YA 3Q3JB 4PHTA 3CZCA 5J3JA 1G6HA 3BH7A 5JDCC 4Z1MA 4FYPA 2J9YB 1YULA 5E7JA 4F45A 2ZI3A 4EJMA 3OHMA 2R6ZA 1H6AA 1V7QA 5KWJA 2OV6A 2HXGA 2OFPA 1C81A 3UAVA 3DM9B 1KRWA 1QVWA 2WKSA 1UJ2A 2OY0A 3DTNA 4YLGA 5CNJA 3KOZA 2FY8A 2F62A 4HEJA 3IH5A 4YYZA 4QU9A 4TLCA 4EGSA 2ZM6B 4ZANA 4C4ZA 4YRLA 1I1HA 1QYDA 4XWYA 4CEHB 3MG9A 1Q7CA 3K35A 3E5MA 3CPJB 1BD4A 3QKUA 1HYQA 4MB6A 2ZJ2A 4MS4B 1ULUA 3C3EA 2HQRA 3KHSA 3W8RA 5KB3A 3ASZA 4RV9A 3TNYA 1LDBA 5M04A 5CCXA 2A78A 1WETA 3K70C 4D02A 4MITA 3DOHA 2WMNB 2B2NA 5C1IA 3S2FA 3SEZA 4P7GA 5KINB 5DLQC 1OWMA 1XKLA 1GCOA 3FH0A 5BORA 2G1AA 4HEA6 1OILA 1UJMA 1C9DB 1DSSG 1IHYA 1T4CA 4ZO7A 4U2DA 4KKVA 3H99A 3MAJA 3C98A 5KQMA 2N1BA 5LU9A 2QROA 3DMNA 4WOCA 1EXVA 1G8GA 5FLKA 4TQGA 4KO2S 4PVDA 1OZ0A 2JJ2D 3DAHA 1RBQA 3WRYA 2HQSA 2UZ4A 1QWOA 3K96A 2IP1A 4HDCA 5EP1A 3L4JA 1GUAA 1TJ7A 4IKEA 3LNCA 2PVPA 4GVPA 2IT1A 2ACWA 2IDKA 1SU6A 3W5DA 3AKCA 1HV8A 2C9BA 4HDNA 1G5IA 1GNLA 2PO5A 2O2CA 2ZTSA 1IUPA 1Q0TA 2A59A 2CXRA 5MFPA 1K7SN 3T0GA 5FTWA 1SN7A 1EK1A 3M89A 3NDIA 3NP9A 4TTJA 5JSZB 1RXWA 2CFSA 1AF7A 2IBTA 1XCMA 3LUHA 1THTA 2HSGA 5IF9A 1QVRA 4I8IA 3E8MA 1CR1A 2BUAA 1OGIA 4MGZR 5DBFA 1BJRE 1WMBA 1ZSNA 4PX3A 2BHTA 1O6ZA 1KQPA 2V4ZA 5BN3A 4DC1A 1MH9A 2VAXA 2C2YA 3S7TA 2QIPA 1JR3A 1R6DA 4FT4A 4R1QA 3Q15C 3UCXA 2Y0PA 4HB0A 3WNZA 2WWXA 5CITA 5AKIA 4INJA 4NFLA 1N2OA 3RFXA 5CCDA 1YQQA 2YNMD 1KL7A 3ICEA 5H80A 4RGYA 5CYFA 2YX1A 3BB4A 1IY2A 3LQ2A 2VDNB 4DLPA 2JVKA 9ABPA 2R7AA 3UK7A 3DZBA 4N8DA 4X45A 4YFYA 2PMEA 4P1ZA 3L8CA 4EG5A 2EFYA 1CP3A 1WCXA 4FSXA 2WI8A 4G56A 2A1IA 4RWEA 4WZZA 4WZBB 4XOUA 2QAGA 4MPDA 2G72A 1KQ3A 3QUSA 4UU1A 1WHSA 3AVUA 4WCFA 5LKRA 1L5HB 3CZ4A 1MAHA 2F1OA 4U2FA 4CDNA 5AW8A 2EP8A 4CM1A 4GRAA 2B4TO 5LIPA 5EIBC 1NIJA 4N0EA 1JJIA 2JH3A 2OESA 3SZLA 1I4OA 4HFRA 3HXOA 3EVNA 3FZGA 4GMFA 4AMUA 1P45A 1IK6A 2YRXA 2BRUA 5TPWA 1TJYA 4B6FA 5JJIA 2A5YB 1A7KA 4HKTA 2Q0HA 1A0OA 2NZYA 3F6YA 5CT4A 1U0JA 5DMXA 4FM9A 2IS1A 1W4RA 4IUBS 1P72A 4CKBA 4RY2A 5H5JA 3WLOA 3PXGA 5FCDA 1IK4A 2YCBA 3R3SA 3IB3A 1Z4LA 3ZWKA 1RJ9A 2HSJA 1UBLS 1WDMA 3H1FA 4GXNA 4UVHA 4A03A 5C7IO 2BSAA 3EMKA 4FONA 1JKJB 2I5PO 4Y6PA 2HU5A 4QECA 2QTLA 3PENA 1M34E 1HM5A 2O0KA 3PT5A 5EEHA 1QHHA 1R0RE 2FUEA 3LCRA 4L28A 3TTXA 5KQSA 3C3XA 5F2OA 3RUIA 3EFBA 3REOA 3E1SA 4A5SA 3PXBA 2YNMC 3WBKA 4ZU1X 4B4DA 1N2CB 1FC0A 5AJZA 2DPHA 3SDBA 1IULA 2Q1UA 3NXKA 4ARCA 4OSOA 1KJYA 1VRWA 1GADO 2NSLA 3DEAA 3R3XA 1RE5A 3INNA 3R7WA 3EXHB 4YROA 3OPNA 2XNCA 3JQGB 1K0FA 3Q5DA 4MO2A 2IX3A 2GZ3A 1KXZA 2C7GA 3A1VA 3IKVA 3EF1A 4YNBA 2GESA 5CVVA 4C2UA 1YVRA 3AHFA 3DYVA 2WKRA 4M0KA 1E2MA 1N5RA 2V6GA 4OFXA 4OQQA 2YL2A 1OWPA 2REXB 5C1DA 4JNCA 5E6UA 1HH4A 2OE2A 4TL8A 3SM9A 4M0DA 4EHJA 5JVDF 2W0SA 1DQPA 4KREA 3H9EO 2E85A 4OY3A 2RIPA 1VI2A 1Y8CA 3JR3A 1SJ9A 3CO5A 1IOZA 2O2YA 5BUCA 3WFIA 3H4IA 3VGPA 3AU8A 1OXUA 3F6SA 4RDHA 3OZSA 2EGHA 3HYLA 4AB1A 4M8IA 1SIWA 1B2RA 2B92A 2F3UA 3ROMA 4A82A 2QLFA 2X4LA 1DRWA 2Q4TA 3DXZA 5DFAA 4M1ZA 3W2GA 5CEJA 1FRVA 1EUQA 1DU4A 2HIAA 1T5LA 4TKVB 2C9CA 1X7ZB 3CRNA 4MR7B 3LBIA 1W73A 2FXIA 3MEQA 1M10A 2FFHA 3N58A 3M83A 4Q1EA 5BSUA 1NNI1 1WXHA 2HHLA 4K81B 2CLSA 2M6LA 5KPDA 1N2IA 5JBIA 3A9RA 2QRGA 2CEAA 2PBFA 2WYUA 4IW3B 4DR7B 2RARA 3AJAA 3P9PA 3LOPA 1IQ0A 1JHZA 1GEGA 5JO9A 3HV2A 4LRSB 3RT1A 1X7YA 2PV7A 2Y1FA 3HJNA 4N5HX 3T15A 3DUFB 4QTYA 5CNKA 5F51A 3T5PA 2EAUA 5KTYA 2G09A 1BGWA 4W5TA 2XTMA 1GCAA 3TKAA 1QQAA 1E7WA 2B37A 1CD5A 4ZAYA 1L7NA 2IUUA 5HP4A 1ZKDA 3UWKA 4U6QA 1PW7A 1WRBA 4MV0A 4OB6A 1I0AA 1KYVA 1VBKA 2OCGA 1KOJA 4MICA 4UUAA 4QJBA 3OLCX 1AQLA 1X87A 3BAZA 4A8JC 4K86A 1EE1A 2WF8A 3AFMA 2R3SA 4RGVA 4WNCA 2J48A 4HI0E 3RTCA 2B4YA 4B2LA 4J7UA 1JEYA 3EQ9A 4GU5A 3ZH9B 1H8EA 3HVIA 2QN9A 3R0XA 2NXJA 4JCOA 1O6CA 3B12A 1M5UA 3O4IA 1W35A 3FCYA 3ESDA 1G3QA 4GEKA 3Q10A 5KYKA 1U4OA 4UVIA 2PSFA 4ARZB 3WRYC 1USIA 1SKYE 3CW8X 1DMSA 2QJTA 4AN1A 5CB4B 1NWCA 3OQIA 5LXTF 4ZDWA 1VE1A 2O4CA 3JYHA 2KI5A 4NSNA 5REQB 2WV9A 1USWA 2IIQA 1OBVA 5LWHA 4E5UA 1SBYA 1N3YA 2JAWA 1VP9A 3MERA 1D4AA 2ZT7A 1ZMBA 3ABIA 3EXFA 2Q3LA 4ALIA 1WZUA 1NULA 4PZAA 4B84A 3LK7A 3HSSA 4DR4B 4ZQBA 5DTRA 3TI7A 4WKCA 2I7CA 1JLSA 4JP8A 5DT2A 1P81A 3UAOA 3QW4B 4QLAA 4HNUA 2WSBA 1G5RA 3MB8A 3IAFA 1T34A 4DLNA 5K4AA 3HVRA 4BZWA 3L02A 4ZARA 1YJBA 3OIYA 3EFEA 4GKBA 4YJ3A 3RRZA 5TT0A 2AG8A 4EJSB 3DAFA 3DVSX 4OP1A 1A95A 5LCXA 4L78A 5BWOA 2V8OA 4ZQCB 4RSMA 4OL0A 1Q3HA 3EWSA 1FVFA 4GE0A 4IMJB 4DJFC 5JPDA 1TYCA 2QSZA 2CYCA 1DJQA 4GMDA 2H9AA 3RRFA 2WD7B 2YBEA 1OFUA 1T9AA 4JA2A 5JSUA 3L8FA 5D86A 4QUJA 4ZPJA 5J4LA 3AL3A 3Q8MA 2ZBQA 1DFIA 4DG8A 2Q9AA 1AXEA 2QAGC 3GJ5A 3P9QA 1PJSA 5A0TA 1G4HA 4PXYA 4H3SA 2F8LA 3D6FA 3A3YA 3C5CA 1XDWA 3E8SA 3F2IA 3QWIA 4C01A 1VKOA 4G26A 1VZ2A 5CPFA 3RC3A 4YMUA 4WVFA 1ZITA 4ENTA 1ZGGA 1P5ZB 3JALB 1JZSA 2NXWA 4OXKA 2Z8YM 5ALPA 4IGKA 3ZNQA 2ZUVA 2PX8A 1WS6A 2VSOA 1J20A 3C48A 3QFCA 4HO1X 3SZGA 2VLIA 2JIOA 4L0MA 4ZRDA 3B6KA 4C4AA 1CFJA 5ENDA 1F60A 3HP4A 4MPJA 2NSHA 3T7TA 1DINA 4URHA 1B73A 2GZAA 3KSZO 2UUOA 4J8PA 1ZW1A 3K0SA 1A96A 1K0UA 3NV9A 1J9GA 1U15A 1K5GA 2F3PA 4I4TF 1FJGB 3UMGA 3KRTA 1NJ6A 3MBKA 3A28A 3LS2A 1KRXA 1L1EA 2X1LA 3JWGA 1CE8A 2GJ8A 4WESA 1L7AA 4CIWA 5JARA 3JQPA 2J5RA 2ZKLA 5E4JA 4JEMA 4K3UA 1BKYA 3DCYA 4DC0A 4D9HA 1KY3A 1N9GB 2F3RA 2GERA 4M9CA 3HLKA 5EUMA 1M8JA 2YYAA 1QLHA 2V5UA 5IRCD 2WA2A 3AWDA 1LI4A 3KZ1E 4MUBA 2XNKA 2N75A 3ZX4A 4DMCA 1THMA 1Q5PA 2PGJA 4QGAA 3GRFA 3OC6A 3SJCA 2CVOA 1YE8A 4X8OA 2JFQA 2WIJA 5LWQA 3OIGA 5LQUA 1C1DA 2ZRCA 4OU4A 5JXWA 3IXQA 3ZLJA 4RE6A 4ARVA 1XZQA 2XA2A 4XVUA 2ISQA 4ZKEA 4DSZA 5L3QB 4M7OA 5EXSA 4E32A 3WAJA 1DTSA 3NHJA 1JBQA 1I01A 2L42A 3PCTA 3IEXA 4UTVA 5JAZA 2PCLA 4LJ7A 5DF1A 3DOUA 5K3OA 3OBBA 1IXKA 3DBIA 1ND6A 4KV9A 5JSKA 2C2ZA 3K0KA 3PJDA 1ZRHA 1FUOA 4MINA 1NBAA 4BO0A 6ABPA 4J6FA 1TAGA 4YTEA 4RZSA 4XCXA 1OBHA 1GGVA 4KIUA 4V1CB 1SC9A 5LKAA 2CV2A 4YO8A 2JVJA 2IDMA 4D9EA 3JQAD 4FOLA 2HIHA 2VAWA 1MNQA 5TX7A 1I3CA 5HBRA 5B2EA 1GM5A 1A5BB 2D4HA 5KYTA 1ZMOA 4OJNA 1Z08A 1JEQB 1H65A 3EASA 1RXIA 4JN6B 3M49A 4F72A 4LV8B 3FNBA 3AWIA 4GBED 3SJUA 1UK6A 1NXQA 1ISJA 1RAAA 1KEEB 3HJUA 1U7ZA 1MMFB 4IRUB 1E3EA 1Y5NA 2FN3A 5CDGA 4OJTA 2XUIA 4CJXA 4MUEA 3U7QB 3AIOA 4KR0A 3UC5A 5KNBD 2QP3A 5KOJB 1BZYA 1RJFA 2CLOB 2XHZA 1BFUA 2VDQB 3F47A 4OAQA 4AROA 1VJTA 1RXSA 1XXLA 3R7FA 3T61A 4E4RA 2AC4A 4HX5A 2D2XA 2QE6A 1I30A 2HF9A 1P3DA 4CT0A 4MJ7A 4I99A 1QCZA 4R8LA 4KMMA 4UE6A 1T1RA 3A9CA 1Q1ZA 4AZVA 3NONA 4C89A 3PF9A 4Z0NA 2FG6C 5KJFA 1WKVA 2G1JA 1YRQA 5E6SB 3RANA 3SFZA 3RB8A 1D7OA 3F6CA 2ORIA 4GAEA 3OJOA 3FPHA 1QGDA 1RXCA 2ATIA 5DP2A 5JJLA 2NGRA 3H7IA 1D09A 3DFKA 4KR7A 2RK4A 2XDYA 4FQ8A 4NPAA 2F9LA 2MDTA 1C0IA 1CVRA 4LVUA 5TEWA 1KY2A 3GJTA 4OQDA 4XVQA 2O3TA 4HNAB 3DL0A 2W2XA 4PBRA 5CFNA 4D0LB 4D9JA 5EXPA 1Z28A 1NVBA 1R0SA 2J59A 2EEZA 3G3EA 3O8LA 1SNYA 1OVMA 3H1GA 4MLZA 3W4KA 2R6JA 4Q3AA 2XAUA 2OCXA 3VKFA 4D42A 1MP0A 1GGFA 1IMOA 4MIKA 5U1PA 2HFKA 3WDMA 5B1IA 4QX6A 3WDSA 2CBGA 1M67A 5FTMA 3MWEB 2O2DA 5F9MA 4QODA 3C8ZA 4ZI2A 1N32B 1BN6A 4PIMA 5FTNA 2NX2A 3RFFA 4LZPA 3H42B 2M98A 3KDSE 4PE5B 1JU9A 2A88A 4RY0A 3RUHA 3SQLA 3ZQUA 5LZ4A 4YFVA 3IEUA 1FEZA 5KYWB 5TQ2A 3D54D 3GDFA 1GPH1 1RBZA 4R0NA 4YP0A 2BM9A 2BTQB 4Y7CA 3V4LA 2VUSA 3BERA 1GUZA 4PYRA 4RORA 2E4AA 1AKNA 2EG5A 3QYFA 5JYDA 2RSLA 2FX3A 1SVLA 1GU7A 1DJMA 4OF4A 3O1IC 1TW3A 5B36A 4QE3A 2CSUA 5T4BA 1J97A 2WYOA 3MMXA 4LF7B 3HPRA 3AM1A 3IPYA 3EGXA 3EEIA 3L6BA 1VHLA 4PZCA 3RUPA 1R6UA 4UATA 5HXAA 2GD0A 4PRYA 2BFOA 3SYKA 2LCFA 4EB0A 2I6GA 3A04A 2FW8A 4DDMA 1ONSA 3QBTA 2R9VA 3HH8A 5D01A 1EE2A 4AO6A 2H18A 3ILHA 3AJ9A 5JSFA 1WB4A 4YT4A 3GPLA 3KQHA 2FX5A 2AMVA 1QQBA 5C51B 5K4HA