1Z4MA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4mA01
1EK2A 3ESRA 4G63A 2WF9A 4RETA 2GHQA 4O8CA 5ALMA 2HX1A 3RF6A 1WVIA 3AR4A 3L1VA 1CR6A 4UATA 4I9FA 3UM9A 5FP0A 2YJ5A 2FPUA 1RQLA 4EELA 4Y2JA 3FM9A 1TJ5A 4Y2XA 1T5TA 3R09A 2ZG6A 5AVWA 3ZX4A 4BX2A 5AK5A 1N8NA 1ZD4A 3WK6A 2CN1A 5ALHA 3L7YA 1EK1A 5ALDA 5ALLA 1U7OA 2FPWA 3I28A 2GO7A 4EZEA 2MSNA 3L0CA 1XP5A 1ZD2P 3HYCA 4UMFA 1RMQA 2C88A 5IS2A 4UU0A 5AW3A 2OBBA 4UMDA 3PDWA 4KNVA 1L6RA 2JGAA 3MC1A 2OA0A 3P96A 3L1UA 1O08A 1SWVA 2YMQA 4L57A 2AGVA 5AHXA 2EAUA 3BWVA 2B1QA 4Y2UA 1XPJA 4L6AA 3QGMA 1RKQA 1RC8A 1Z4LA 2FEAA 3L0BA 3NALA 2IOHA 5ALGA 4UM7A 3U7HB 3QU9A 4BBJA 1U2SA 4GXTA 2O9JA 2BDUA 1ZD3A 3ZWDA 2YMMA 3DAOA 2DQSA 3R4CA 3L8EA 2HSZA 4YIKA 4QQFA 5E0OA 4UM5A 4YCNA 3K1ZA 3W5BA 1Z88A 5AW9A 4JDPA 5ALIA 2IOFK 1S8OA 3OCUA 4ZEVA 1ZRMA 4CF4A 1TJ3A 2JAWA 3QUTA 5IT0A 2FUCA 1YV9A 3WKCA 2WF8A 5ALUA 3AR9A 4IG4A 4NWIA 4KYTA 4Y2QA 1Q92A 3OCXA 4OHFA 4Y3UA 2I54A 3ZVMA 3TLMA 2JAOA 1FEZA 4F71A 1YNSA 2CFRA 2X4DA 2YMLA 3NRJA 2EATA 4B6JA 5AESA 3SF0A 2W4MA 2HF2A 2YBDA 3ZUPA 4EX6A 5AK4A 3QYPA 5AVYA 5ALZA 3OCWA 2YFYA 5AKEA 2P69A 3SD7A 3QUQA 2PKEA 1YDFA 3EF0A 2FPXA 3M1YA 3WGUA 1RKVA 3ZW7A 2G09A 3NUQA 4NV0A 3QUBA 2YJ3A 1L7NA 4HAIA 4UAUA 4FYPA 2NYVA 3ZX5A 4BNDA 2ZBGA 2O2XA 3NAMA 2YJ4A 3OPXA 2BY4A 3EPRA 1Z4IA 4BYGA 5JJBA 3A1EA 3I1YA 4C4RA 2W11A 3NANA 3WK4A 3W5CA 1K1EA 3KZXA 4XOUA 3ZVNA 1QH9A 2GFHA 3AR7A 5ALYA 2YMPA 2HCFA 5AVQA 5AKKA 2HDOA 4BX3A 1Y8AA 2PR7A 3E8MA 3W5AA 1VJ5A 4BNDB 4FE3A 1Q91A 1Z5GA 2HO4A 4AP9A 2Q5EA 5AI6A 1WR8A 2G08A 1Z4PX 4BKMA 2G1AA 2WM8A 3ESQA 3A1CA 1MH9A 1PW5A 4AS2A 3OCYA 4EENA 3J7TA 2RARA 2IA5A 3L5KA 3ZTYA 3SMVA 1RDFA 3IRUA 1XVIA 3L0YA 4H1WA 1RPZA 1YS9A 1QQ5A 2GHTA 3A1DA 2HEGA 5AKGA 1TA0A 4BEVA 2R8ZA 4Y2VA 5AIBA 3ZU6A 4DCCA 4J2TA 1SWWA 2ZBDA 1ZRNA 2HOQA 3DNPA 2ODAA 3KC2A 1KYTA 4HGPA 3EWIA 2C8LA 3BA6A 2RB5A 1ZD5A 2CFSA 2WF5A 5T41A 3ZWKA 2BDEA 3QU2A 5AKXA 5AI5A 2B82A 1RRCA 1ZJJA 2Q4RA 5ALKA 3B9BA 4J03A 3WKAA 1RLMA 4HGNA 5ALJA 5AI0A 2R8XA 5AM5A 4E88A 5A3SA 2B0CA 4NAVA 4C4TA 3SKYA 3CZ4A 4UMEA 3WK5A 4IFTA 2NO5A 1RMYA 2B30A 3QNMA 4CF3A 1ZOLA 2OM6A 1AQ6A 1LVHA 5AI9A 3L8GA 5AVTA 3QUCA 2R8EA 4BEWA 4OCZA 3FGOA 3U7EB 3WGVA 3U7FB 3DV9A 4CF5A 4UMVA 5AW8A 4DFDA 2I6XA 3QU7A 3QU5A 2IOFA 5AKIA 3R9KA 3SLRA 5AKLA 5AW7A 3D6JA 1Z4QA 2P27A 2C8KA 4KNWA 3ZTWA 1T9ZA 2WF6A 2CFTA 3NASA 1S2OA 1O03A 3WKEA 1RKUA 4KX3A 4JB3A 4Y2PA 2G07A 5ALRA 5ALWA 3IJ5A 4OFZA 1NF2A 2D2VA 5AVXA 3PGVA 1CQZA 5AW1A 2ZXEA 4RESA 5AI8A 5IT4A 1U02A 5AKYA 3L8FA 2ZOSA 1Z5UA 4UU1A 1L7OA 3AR3A 5ALOA 1WPGA 2NO4A 5AKZA 5AW2A 1SU4A 1JUDA 2G06A 5AKJA 3FPSA 3U13A 3QU4A 2ZBEA 5AI4A 1Z4KA 5ALTA 5AM2A 4XE5A 5A3QA 3HLTA 4CNQA 5AW4A 3EF1A 3U7GA 3E58A 4CE6A 4C4SA 3N1UA 2QLTA 4I9GA 5AKHA 1QQ7A 4FFDA 2EARA 4Y2RA 5ALFA 2RAVA 4HGQA 4YCMA 2JARA 3FVVA 3WK7A 3FPBA 4YH1A 3I6BA 2Q4TA 3RFUA 1QQ6A 1Z4OA 1YMQA 2R8YA 3ED5A 3MN1A 2ZBFA 3WK9A 3ET4A 5AVZA 1L7MA 1Z4JA 4XPZA 3IB6A 1RLOA 3WK8A 4GIBA 2RBKA 2FPSA 1TE2A 2FI1A 5AW0A 3KD3A 2G80A 3OCVA 3N07A 3PGLA 3N5KA 4MWOA 3A3YA 4Y2TA 5ALXA 3SHQA 2FPRA 2AMYA 3UMBA 4UARA 2QYHA 2B1RA 3QXGA 1NRWA 2I33A 3U26A 2PQ0A 2HHLA 3ZI4A 3NIWA 4G9BA 5AW5A 2I55A 3ET5A 5AVRA 5AW6A 1X42A 4MUMA 3AR5A 3OTQA 2MU1A 3AR6A 3DDHA 5AVSA 2I7DA 2I34A 2YJ6A 3FZQA 4AS3A 2B8EA 2FDRA 3OCZA 4KN8A 3N28A 5AICA 5AM0A 2C4NA 5ALSA 3UMCA 5AM4A 4ZEWA 2IYEA 2JAUA 3ONNA 5ALEA 4HYTA 2FUEA 3AR2A 4Y2SA 5AK3A 4UASA 4EX7A 3I76A 2AH5A 2AUTA 4UW9A 3E84A 3B8EA 4NFLA 3UMGA 3S6JA 3QX7A 2G0AA 2WFAA 5AVUA 4HGRA 3E81A 1RMTA 2YY6A 3F9RA 1T5SA 3WKDA 4DWOA 2C9MA 3WKBA 2HF7A 4ZEXA 3CNHA 3GYGA 2HI0A 3MPOA 5A3RA 4F72A 4YGYA 5AVVA 4DW8A 1RLTA 5ALNA 2VKQA 3VAYA 5AM3A 5ALVA 1WZCA 1J8DA 1U2TA 4QJBA 5AK6A 2B8JA 3QLEA 4BX0A 3MMZA 2W43A 4UAVA 3N8GA 3AR8A 3KDPA 4XQ0A 1U7PA 4YIHA 1VFPA 3M9LA 3B9RA 2P9JA 2YN4A 3W5DA 5AM1A 3U19A 1LTQA 5ALPA 2GMWA 1L8LA 1Z4MA 5AIAA 3SKXA 3L8HA 1TJ4A 1L8OA 2OYCA 1QYIA 4L6CA 5ALQA 2WHEA 4YCLA 4KX5A 1N9KA 1Z4NA 1F5SA 2P11A 1NNLA 1YJ5A 3KBBA 4OD0A 4NABA 4HGOA 4EEKA 1ZS9A 3KOOA 1RQNA 3PCTA 4Y2YA 1IWOA 2WF7A 1L7PA 1J97A 4PNHA 3ZVLA 1VJRA
chains in the Genus database with same CATH superfamily
4QGBA 3IJEB 5L40A 1QSGA 5FYQA 5I9TA 1T9GS 2HK8A 3FCYA 1VIYA 4AMVA 4C76A 3F3MA 5JS8A 2NNWB 4UTVA 1ZSNA 1MGPA 1BN7A 3ETCA 1KMCA 1N6PA 4H17A 4TWRA 3PGA1 1P3DA 5J4KA 3JASA 4L51A 5JD6A 1KYYA 2IHYA 2FPUA 4JNCA 4EELA 3I01A 3EGXA 3K31A 5IUJC 3B1VA 2CC2A 2QZSA 1E4EB 3OAAA 5KQRA 1AY0A 2QZ4A 4GEGA 1AUWA 1N32B 4WINA 2RE8A 2OHOA 2VA8A 1XZEA 2CXXA 1SVMA 4O4LA 4HH3C 1HORA 2K7ZA 1H93A 1XZNA 3LHKA 3WK6A 4DR7B 3D8RA 1PS0A 2JRLA 2LP4Y 2ZUBA 2BMAA 2QTFA 2VVTA 4KYVA 1PW7A 3IOEA 5JZMA 2JA1A 5H3CA 4URVR 5CFRA 3T41A 1G21B 3RYHB 1EK0A 2RI1A 3LF1A 5KKNB 3AUUA 4ARSA 4B6OA 1LVUA 5ECWA 1XNQB 3WBJA 4KHZA 2CV2A 4KPYA 2YXNA 3B1KA 3ER9A 2PMBA 1IXSB 3I9OA 4OAPA 2H9AA 4K0RA 3DKPA 4NX2A 4O3FA 2EFYA 4WFKA 3RC9A 1DC8A 4F84A 2B1QA 4WECA 1Q12A 5EQDA 3GROA 1W2GA 2D5LA 1SQ6A 1FRFS 4L75A 4RM3A 1GPDG 1R0YA 3DTVB 3S2SA 2DR2A 2ISSD 1GQ2A 5HKKD 1KBOA 4QOGA 1B93A 2QI9C 1BAPA 5EKSA 5FPSA 2V55B 2VXYA 3T3DA 4LV8B 1HG1A 1FL9A 4UM7A 2V6IA 2VDMB 2NUAB 3RJTA 1FS5A 3SDZA 1JS1X 4BBJA 2IQ5A 1N1EA 1BCRB 1D5CA 7MDHA 4KE7A 1JYFA 1UPTA 2ZBPA 1NBMD 1ZK2A 3NEPX 1OT3A 4L9WA 3OEHA 4PF1A 3V4ZA 3CG0A 4BU1A 4DIFA 5KCZA 1FS6A 2XD4A 5LYJF 3EVDA 1U7ZA 3FH0A 4FFPA 5GY7A 4D4KA 5JC1A 3QRWA 1H0SA 1LWNA 2VHYA 1A9QA 1UM9A 2BSAA 3HJAA 4PEVA 4YCNA 4JUFA 5DEOA 4EPRA 3TBHA 1N4DA 1MRSA 3GVPA 3OIUA 4JDPA 4C3ZA 4WFQA 5HNKA 2YN2A 4AY2A 2J9FA 2R47A 1S8OA 3KOXA 3VV3A 3WAKA 3N87A 4YJHB 2E89A 3RC2A 2DHQA 1NVBA 3H3FA 4DT1A 5CU7A 4EJ6A 3AY3A 3LYHA 1K92A 3PCRB 4DXHA 5I8PA 3DEAA 5THKA 3OFSA 4DNXA 4DY4A 4NEQA 4IJWA 2GBFA 3TQRA 3WYNA 1YI8A 3F6RA 3VZQA 1FVFA 4INAA 3OCXA 2AS0A 4M9SA 2J31A 3QFRA 1M72A 1F3OA 1CY7A 5KWSA 3HB7A 3RYCA 4RC9A 4C4OA 3DZKA 5DULA 4U5QA 2FN8A 5L45A 1JXMA 5HQTA 4C6TA 5M2QA 2WJGA 2JEYA 1YQGA 1G291 1MENA 2CFRA 3P9SA 3ZXYA 4I55A 2ATXA 8ADHA 4UVGA 1RQ2A 3RSHA 2DHCA 1HV8A 2QR2A 1BU8A 4TGLA 3LC1O 3AUJB 2IV3A 3S2IA 1A27A 2GSWA 3BIFA 5B64A 4TRRA 2YZ2A 3ZUPA 4EX6A 3FBWA 1Z8DA 2P2ZA 5ITZB 3GF4A 1HO3A 2Y6UA 5JWHA 3VSBA 2HRCA 5JPIA 4QOIA 2P69A 5P21A 5JAOA 1CRPA 1RWXA 4HQNA 2NUAA 2AOUA 4I3GA 4AJ1A 1I1NA 3K4QA 1NDQA 1JG6A 3NT5A 1QG4A 1CERA 1I4LD 3LRXA 4GC5A 4Q48A 3UY4A 4UUAA 4QGGA 4RTMA 4OBWA 4PIMA 1H2HA 5JLJA 4HRYA 1HZZC 3ZX5A 5AOVA 1A4XA 3HJBA 4ECAA 1L5QA 2WINI 3QVLA 4QGFA 3FSGD 1FSGA 4HWKA 3DMYA 4H3HB 4CBVA 4IDEA 1USKA 3N2YA 2BY4A 2WSYB 2HM7A 3A1EA 4P38A 5HA5A 3VO2A 1NDHA 2HA5A 1JWBB 4I4IA 1E5DA 2PWYA 4LJLA 4P8RA 1F8GA 4OU5A 3W5CA 3ILHA 1YB5A 3V7YA 1U5BA 1H8HD 5DP1A 3EMVA 1KS9A 2Z8YA 3A8TA 3AR7A 4BJ5A 2A94A 4PO9A 2YMPA 2Q9CA 4WSOA 4O2LA 4JBYA 1UEXC 4P5EA 2OD9A 1RACA 1YR1A 1XKQA 1W75A 2IS4A 4LBZA 4C89A 4HEA1 4DA7A 3C43A 4GKJB 5G1NA 3TRIA 5KQSA 1E9FA 3BILA 5AI6A 3D4NA 3WGQA 4N76A 2Y1LA 5CLLA 3KT0A 3WOVA 1V5IA 4Q3DA 1A7JA 2R25B 3PXUA 4I08A 4EB8A 4ZVRA 1PO7A 4LY0A 5BN4B 3KRTA 2A14A 2FN7A 3IL2A 2VPPA 3R44A 1XZAA 4YRCA 5EIBC 3THYA 3DR3A 2A6PA 1ZBQA 1SIOA 3OO0A 2AI1A 3LW8A 1RDFA 2BI4A 3EYAA 1FRZA 4AWBA 2NW6A 4YRGA 1FUPA 2IL1A 1GZVA 1DJNA 1G5IA 1TOAA 3IMKA 1R6AA 4FYYA 2VNIA 2FPPA 2EP5A 5TPWB 3RV3A 2PK3A 3KKEA 1UPBA 2XCSB 3MOSA 1G59A 3UMYA 3I37X 1O9BA 3B78A 4KJXA 3DV0B 3F8TA 3S99A 3WGLA 4BMXA 4GKBA 3WMXA 1BMFD 5JOQA 4WN3A 4X24A 2HSGA 2JH9A 1MRNA 2W0SA 4ZQIA 3SC4A 4M60A 2L2QA 1UDCA 2BMFA 2R5NA 4MOWA 4EFMA 3QMMA 3ROZA 2MHCA 4X20B 3IP7A 3B36A 4L4RA 2C8LA 1YQTA 2H3HA 1DCNA 2VYVD 3MTGA 3SZOA 5KWEA 3TOSA 4LA4A 1HDGO 1HZJA 3VC2A 1HQDA 5CH5A 4IMRA 4PCAA 4RULA 5CDGA 1EXNA 4BNGA 1Y5LA 3OAAD 4JLBA 1K5HA 5EJAA 1TYDE 4C21A 5J47A 2A5YB 2J4DA 2ON6A 2YX1A 1AQUA 3B6ZA 3C3PA 3OSUA 1E5TA 2ORWA 2FPPB 2X8AA 5ALJA 3ZZMA 5KQGA 2VHTA 4KXWA 4XIFA 4POOA 1MVNA 1INLA 2ESRA 3DV0A 4B76A 4JKYA 1E7YA 1KTIA 4CQNA 3KZ1E 2VPTA 3ABOB 3CZ5A 4E5YA 1UINA 4IFTA 3L4SO 4KO3S 4LY6A 4MHTA 3W8NA 2GOYA 4LOAA 3H6HA 1XZIA 2DFDA 1GDTA 2QXTA 4YYZA 1PZXA 5B12A 5LPNA 5EIHA 4GS5A 1LVHA 3I5MA 2ZWIA 3B70A 3RUHA 4IDCA 4DCTA 1F1JA 4AIIA 3KLNA 3VR6A 1W96A 3FA2A 1BMTA 3QUCA 5EHNA 5L4LA 3A26A 2GZSA 4MQEB 4PS0A 4UBMA 2HA4A 4OCZA 1W5BA 1WHSB 1GQOA 3HKDA 3MRTA 5EIAA 1DX4A 3NIDB 3TCNA 1K0UA 1T2EA 2JCBA 3EIEA 4KXXA 4MW6A 3EX7C 4QPDA 1QYDA 3FOAA 3HJHA 2BFBB 3NHJA 4J8PA 1JA1A 2VDJA 2IZ1A 1BC5A 1CIVA 2UXCB 1L4GA 2IV2X 1A4RA 2ZCVA 1OF1A 1QS0B 2NXWA 2ZBRA 4JYBA 1XPOA 4H7KA 3HFJA 3NTQA 3G9QA 4J0FA 3KSAC 3T12A 1GSOA 3AMVA 3A0UA 2CFTA 3M6AA 3CCCA 1O6ZA 1VL1A 2I9PA 2Q45A 1IIBA 1VHJA 3N2LA 5FLYA 4E2ZA 5KJCA 2QMHA 3DLAA 4N9WA 3P2MA 3A3NA 5CB0A 2PO7A 3RE1A 4URWR 3M2TA 4HRVA 5EQTA 4BZWA 4JB3A 4DMMA 4JSYA 3GJXC 1H9CA 1AS3A 1T24A 1XHLA 4MDFA 1O94D 1DTSA 3IHWA 3EUAA 5L7WA 1T5BA 3RVBA 1CR1A 1D2MA 4N3BA 3OCEA 4F45A 2NO7A 1VMDA 2AFHA 2QG6A 1P9NA 1FDTA 3LY8A 1OZGA 2PKCA 3ASYA 3KJXA 4ACAA 4C43A 2ZOSA 2CMHA 2I65A 2PIDA 4YBRA 2HA2A 5DIZA 3GZJA 4K3VA 1MN6A 3EXIB 3PHGA 3PQ3A 4A73A 4HBZA 3MTBA 1MORA 2CHUA 1SEVA 1N8KA 2XXAB 1O6FA 3LUKA 4DLBA 1KWKA 1JUDA 1WMEA 2PSSA 4J2OA 3UT5A 4POAA 3LY7A 3PRHA 4LX0A 4CLOB 3H2SA 1CZNA 1RYEA 1ZMRA 1WP4A 5FOWA 5CFZA 2F48A 4ZC8A 2GJ8A 3MCZA 3SI7A 3TSZA 1I2AA 4QICA 3MYYA 3WB2A 4CNQA 1XXHB 3TSWA 3UHOA 1AZSC 1CR0A 3RWOA 3LECA 1VMAA 1X87A 1UJ5A 5L51A 4KITB 4XWTA 3C1OA 2WIFA 1C3OA 2XYPA 1PFVA 3OCFA 3TQFA 1PGNA 2GEFA 2GTPA 2PAFA 3CNOA 3RROA 1TIBA 2O2YA 4YCMA 3F73A 2O2ZA 1U9IC 2X8LA 2JCXA 3CZMA 3B3QA 1ABBA 1QP4A 2P8SA 4TMXA 3X1MA 4NZYA 3ME5A 3D5EA 3QA3E 1G8HA 5MN6A 3ONFA 4KUHA 4EFDA 1DFGA 3MJVA 3UC9A 4QT0A 4GM0A 1M34E 3QKSB 1HA3A 2O7VA 1G2OA 1UDRA 1JHXA 5TR9A 3TLXA 1J8QA 3CUSA 2HSEA 1PL6A 1WETA 1VE9A 4NBRA 2HLPA 3ZCPA 1SZCA 4IILA 3KB8A 2B7BA 5G3ZA 1UWVA 3T0FA 2R65A 1H69A 5K0ZA 1GQRA 1K2WA 4BNMA 1I5OA 1O95A 2RBKA 4NENB 3OWOA 1YQDA 4GOND 5JVDF 1XAHA 3LPNA 1ISJA 1JAZA 4GI1A 3FKSD 4AKEA 1PKEA 3M9XA 1UBGA 4YR9A 1LPBB 3ERCA 5EKXA 1YRQA 4NLEA 2X2OA 2X6RA 2YBEA 3PE4A 4FMDF 5E1MA 1ZGAA 5LA6B 2GXQA 4RD4A 4ZHQA 3HM9A 2Q5JA 1AK1A 2DKOA 4TS1A 1KK3A 1V4BA 4CLXA 4QU0A 3GA0A 1ONSA 4DXDA 1P2TA 4DR1B 1E4EA 5B2ZA 3E2IA 1HG0A 3G2QA 4EI7A 1UFOA 2WU0A 2ACEA 2IEAA 2HHJA 3K73O 4CKYA 1QH1B 1RI3A 1NRWA 4H59A 4MUHA 2HJGA 3FUVA 3WO1A 1CEEA 4P6VF 2H2DA 3MSCA 1YJ8A 8ABPA 1DQYA 3DQQA 4CG3A 2QRJA 1VKNA 2HBRA 4Q4JB 2K2WA 4M1TA 3UHJA 4ZIRB 2JAXA 4NBUA 2OV6A 2W6PA 4GVXA 4NZZA 1LW6E 1L1FA 3RAGA 2YIVX 1YDHA 4XEUA 2B21A 5H8WA 5JQGF 4FK8A 3BVPA 3X1YA 1C30B 4RM2A 4EVQA 5CEEA 3LFHA 3S70A 4AIRA 3ZHUA 2AYXA 1R0SA 2I34A 1U8TA 2O3SA 1JDUA 2Q3JA 1KE2A 3SEAA 1MO6A 2XXBA 2ZSUA 3FPJA 1N0WA 2WWRA 2Z2JA 4EB6B 3SX4A 5ISMA 1YFLA 3GLVA 4OBBA 3QJGA 2Q5CA 2Q62A 4X60A 3RUCA 2Q1YA 3ROTA 3STTA 1AH2A 3NETA 3QPBA 4DLAA 1EUQA 1ONPA 4AJJA 1UADA 4RU1A 5DYNA 1JJVA 4YXWD 3MTIA 1SNYA 3UAGA 5HXAA 2OD2A 5BPFA 5L8VA 4RHFA 4BX9A 4Z9AA 1VSTA 3Q0IA 4UW9A 3PC2A 1P7ZA 4HVCA 3BTUA 3E84A 4D5EA 4MRNA 4YMWA 3MOGA 1CZRA 4M6WB 5I7VA 1P1HA 2XKBA 1FX0B 5EIEA 2YICA 3AEQB 5CT8A 4B6GA 3EPPA 2GBIA 3IQZA 3IUNA 2YXLA 3SC6A 4BRWA 4QBKA 1SELA 4EAAA 2O50A 1TK9A 3JQ8B 5HZGA 5JZOA 2XMGA 5CA1B 5GM1A 1M66A 3F98A 4MIEA 3REOA 2P8JA 4TROA 2A3NA 4JR2A 1VQ1A 3IE2A 1UM9B 3MAAC 3G7UA 1AA9A 1PSWA 2V0GA 1GKKA 1N2OA 1FE8A 1M6HA 3BXEA 4JJFA 4BMCA 3G2KA 3P27A 1NW3A 1ZXLA 5A0FA 1ECBA 4BNJA 1M1YA 3H3XA 1L5KA 4EECA 2VATA 1KMMA 4GYYA 4QTYA 5C7IO 4C0AC 1C1XB 1T3GA 2PUTA 3MMZA 5C80A 5FNVA 4CMEC 2HF8A 4HO1X 4LXQA 5CK5A 4BEBA 5FUQA 3FY4A 3LHSA 3P9YA 5DF1A 1REQB 2F43B 4NYIR 4YRDA 5BV0A 4DUZB 2R6FA 4RWEA 5EINA 1AF7A 1IY9A 1XXLA 1G7CA 3EQ6A 3F8WA 3MRXA 3NWEA 3OTWA 4L5IA 2GRUA 4GBJA 5A6SB 5CA0A 2IWHA 2NO0A 1P5HA 4NR0A 2DG2A 2HSWA 1KVSA 3L8HA 2F00A 1COWD 3W2IA 2AR0A 1DRUA 1AQJA 4Z5XA 5IVKA 3DDUA 3HA7A 2ZJ5A 1A5AB 4ANFA 5DX8A 5LQAA 3WI7A 1B6RA 2QY6A 3WWPA 3K0BA 1XDUA 4BZXA 1ZS9A 1RQNA 5BY2A 4MJLA 1BA2A 2QORA 2XW6A 1D2CA 2ZAYA 2ZUWA 3KUUA 4FYJA 3ZHSA 2J9XB 5HR5A 1PUXA 2WF7A 3D3WB 4C7VA 4UTOA 4JGIA 5F4BA 2HKIA 2ZJ7A 3NMUF 4MS3B 4WLUA 1W0JA 1USIA 3HWWA 3DE1X 4UAJA 5A6SA 3LIIA 2VDPB 1XN1A 3GEMA 5DKFA 3OE7A 2HX1A 4X84A 2JHGA 3TIVA 3FJOA 1RJFA 3FR7A 3CG4A 4KUEA 1XO1A 2XRMA 1W5AA 3L1VA 2XEDA 2GH1A 4BN0A 5FR2A 1KQ7A 2P5YA 3LK7A 3N58A 4FS8A 2PX2A 4PW0A 4RWZA 3WWDA 4CFZA 5A6VA 4JYAB 1Y3HA 3FNEA 2JBAA 3UAZA 2ZRNA 1BXZA 1FC0A 1KJYA 3QKRA 4UTXA 1RXEA 2OGSA 4XDGA 2WPNA 5B3AA 3NNNA 2D2FA 5IJ0A 4YRJA 3ZE7A 3H5WA 4YV2A 3IFSA 1L7RA 1G0NA 5SYAA 4FGSA 2QLNA 4KQGA 5ES4B 3G0HA 1GITA 2EGUA 2I7XA 2RH4A 3OP1A 2QW1A 1SQFA 2GRJA 3EZGA 4IG9A 4O08A 3BD9A 5DV9A 5E4TA 4IV8A 4WVLA 1Q21A 5JY1A 1P0QA 1CS0A 4MR9B 2VHUA 5LP1A 5I7HA 3I28A 2GN6A 6REQA 1ILEA 2OSBA 3L0CA 1E6KA 1ZD2P 1XSEA 4EY3A 4C2UA 1ZY2A 3PFKA 3OA0A 2WIKA 2BTEA 2NG1A 3HLKA 4RABA 3TMYA 3WIDA 5JBNA 1OH5A 2XDWA 4URHA 5LZ4A 5BV8A 1SWVA 1OROA 2OORC 3LVQE 2QLMA 2Z3WA 3OQPA 5DFAA 5TQVA 2EAUA 1JI3A 1MR3F 1V3VA 1OXMA 2IPLA 4HNRA 1N4AA 3UMJA 4F85A 4B79A 2GDJA 4AX8A 5ICCA 1VMEA 2XDYA 2YR0A 3PQ5A 3WBBA 2JCSA 4BC0A 5CB4B 4OI4A 1YA4A 2C2ZA 4C1NA 2Y4NA 4I8IA 4MAMA 4EPWA 5KNBD 1ESEA 3QGMA 1RHJA 3EIXA 3VOAA 3ZLUA 2A35A 4OJMX 5M3BA 1IE3A 4BFCA 1N77A 2PXAA 1XAGA 3KKQA 2CLMB 4LVCA 2DLCX 3P9IA 2DX7A 3O3MB 4PBRA 3S7TA 4BKPA 4NK5A 2BDUA 1RP7A 1QF7A 3DT9A 3W5JA 3R4CA 5B4TA 3FMPB 2D1YA 3HWSA 1F2UA 4O4JA 2A5FA 1MPXA 2IV7A 1FNNA 3DVQX 4BL5A 3HDQA 4PLHA 2PV0A 4C4YA 5FDFA 4MVJD 2ATEA 1H22A 3I9MA 1OI4A 4PC7A 1R6BX 4LJYA 2ACKA 1OSNA 5AQEA 2OYRA 4MQFB 2NIPA 3LCUA 4ADSG 3B7WA 3AZPA 4QUBA 4E31A 3FJYA 1A9ZA 3PZRA 4MUYA 1TM3E 3B5EA 3I6QA 2XB2A 3OQJA 4CEIA 1MXHA 2PJZA 5BVHA 1V8DA 3IAM1 2HQBA 2M1XA 4PXSA 4NBVA 1JVNA 4LGCA 1GZ5A 1JQJC 3WLRA 2M6KA 3PPXA 1VECA 3EOZA 3OZXA 5KDDA 1FW6A 2E55A 1C81A 2ADMA 2VBFA 4WXHA 2VBGA 2OKGA 3HLYA 4EKDA 5FH9A 1ULHA 2W2LA 2JJ1D 3FSJX 2BMEA 3EGXB 1EWYA 3KQTA 4HEQA 4QPJC 4ZD6A 3K6SB 3L0SA 1II8B 1BQ3A 4MWCA 4GKAA 4EO4A 3ZV5A 5LP6F 2EF0A 3CF0A 3NC0C 3P8ZA 1TYCA 5FFMA 1GTJ1 1P45A 5ENVA 4CR6A 1QZZA 5DBEX 3NBKA 2JW5A 5DGTA 5TQJA 3WLNA 4AJ4A 2VTBB 2HIGA 3A1FA 2YBDA 3JQBA 1RC0A 2PZJA 1JIXA 2FJUA 1QS0A 2V7TA 3IXMA 5AK4A 4ZDIA 4HVTA 2C9CA 5HILA 1GV0A 1N7GA 1ZICA 2P7IA 4HGZA 5M29A 4UQOA 2PR2A 1KU0A 1P73A 1XNGA 2GHIA 1F1BA 2XECA 3K5IA 1TMOA 2VSFA 4CKWA 2PKEA 3I0NA 4X3OA 1LK5A 2VAVA 3OBIA 4D8UA 5FI3A 3VHQA 1CHDA 1S2DA 1W73A 2G09A 3C8ZA 4FFNA 4ZXPA 4R4JA 2J0UA 4BMPB 2CSXA 2GZRA 4F1WA 3T1VA 3ZGXA 4BV8A 4UUPA 5CM8B 2ZBGA 1IN5A 3ZKWA 3QJYA 4WADA 3DF9A 4M7RA 3T9AA 3P1JA 2GVZC 4KH1A 3HN6A 2I8LA 4R3NA 3E9MA 5K6AC 1ECJA 2FHSA 2P3LA 3I61A 3A9VA 3R5FA 3HDTA 1P19A 1T2UA 5A02A 4C4RA 2AMLA 5HTKA 3NANA 4NARA 3IE1A 3F9CA 4QTZA 2P9QA 3PXBA 4UHDA 4O4LF 1JG1A 4C0XA 3BB4A 2QTGA 1Q20A 1NMQA 1UL1X 4HK4A 4ID9A 5EYPB 3LHDA 5FOTA 3LT5A 4AL4A 2CVPA 1GU0A 4G65A 4MV8A 4AO8A 3KQLA 3GK3A 1B73A 1R4NB 1WWKA 1YRAA 2HDOA 1P1RA 1M54A 3CNLA 5TGDA 3R7WB 4BMVA 4H1VA 3H11B 4BBAA 2FMFA 1BA3A 3NIBA 3Q11A 4FE3A 3STHA 3PQ2A 2HO4A 4X8OA 1OQAA 2II6A 4Y7DA 2IEIA 3ONEA 2O7NA 1WR8A 2OV2A 3JQFA 3KCQA 1JPVA 2Z5VA 4LSWA 3PS9A 2GN4A 4CTKA 4HVAA 3G2OA 2WHXA 3ODGA 4LCJA 5E9QA 5K4AA 4EGCB 2VQFB 1OJ7A 4Z9YA 4PFKA 2L42A 3T7EA 3OBBA 3QK7A 1R8YA 3QLUA 3W3AA 4RKFA 3CQ9A 4HWSA 4AYWA 5ED4A 3ADOA 2K7FA 1U0HC 1ZFNA 2D0DA 3LQ1A 4MAFA 4CN8A 2J7KA 1KAHA 4RF3A 1TAGA 3EXEA 1OGIA 1XLUA 3AXSA 3AEKA 5I5GA 4DLWA 2D6FA 5KC9A 3CW2A 5DTMA 2LCFA 2OZVA 2C4HA 3SDBA 1S4MA 1XNJA 1T0PA 1GFIA 2ZRPA 3KTFA 3W7AA 3WICA 4C3UA 4I5DA 2ZYAA 3T3NA 2XMPA 5C8ZA 3HABA 4OI2A 4OLBA 2OOKA 1RE0A 3KO8A 4C20A 3M83A 2GD6A 3TIXB 1Q7RA 3D81A 5TMDA 1IVYA 1N6KA 2NV2B 5LA6F 2JHPA 3SEQA 3IILA 2I3AA 4FMDB 5IFKA 4QAQA 3AILA 1Y3AA 4GT1A 4LN1A 3X1XA 1P75A 1XRJA 2H0QA 3I12A 1JVSA 4OATA 4HAUA 3U1TA 5A3SA 4AZ3A 2BGWA 1JU4A 3IGFA 3BX1A 5HKKA 2LRHA 1ZRSA 3CLUD 5JVDB 3R6QA 1NIJA 3VNQA 4KE6A 6ABPA 1Z3CA 4LRTB 3GGOA 5B1IA 5B7PA 5BSHA 1DEOA 4YJ2F 4IHAA 3KFLA 3OPVA 4YRPA 4WOBA 4NU8X 5EVCA 3UBTA 1HKHA 2W8ZA 3JATA 4LCEA 4RAOA 4F0JA 2LCQA 3EZYA 3PEYA 4BQIA 3QQPA 4XM2A 3KYDA 2DEUA 4RQBA 5BWNA 2Y6VA 5IX8A 2C5BA 3O8OA 4JJ7A 3EDQA 2ORVA 4C4ZA 4WBNA 1RM4A 2XADA 4TS4A 4EEZA 3T52A 3WLJA 4B6FA 2R9VA 4ER3A 1CT9A 1DQSA 3ZIUA 3IAS1 4XWYA 4G8DA 1L5HA 4P0QB 2VYVA 2GZ2A 1OFHA 2JPDA 2KYRA 2BM8A 3QBTA 3D8TA 2QUHA 3QU5A 4Q5IA 1JIQA 5G53C 4EJFA 3H4IA 4INJA 2JZOA 1OCEA 3OEYA 1EA5A 1O6GA 3WRYA 5BNIA 4TL9A 2BN4A 3D6JA 1JIUA 1HY3A 1X1RA 5J3JA 2PU5A 4YACA 5EJEA 2IP2A 3CLSC 4KNWA 2OFFA 4XCQA 1NUTA 2F90A 3HGTA 3OF2A 4BKRA 1ZNXA 1KR5A 5J2TF 1Y7IA 3FTDA 4QUJA 4FP9A 4RLSA 1RIIA 2V7VA 2GYUA 4AN0A 1AKVA 2R6GA 3CEMA 2HLNA 3F97A 4L5AA 5IKEA 1DRKA 3CUKA 3L7JA 3D0RA 4AO6A 5ALWA 1MC8A 1H9BA 3RU3A 1KDZA 3INYA 2AJDA 2FUNB 1C9JA 2D5IA 2A58A 1ENOA 1NY6A 3DAPA 3PC3A 3RYIB 4DUGD 1EE2A 3KSDO 5IT4A 3LQFA 1IMOA 1GVHA 3JQFC 2V4ZA 4DG9A 4E08A 1UJCA 1KPHA 1Z5UA 2WYOA 2ZAMA 4AU1A 3QTBA 2H00A 1DZIA 3UFXB 4I1VA 1FFSA 3PB3A 4GUDA 1KFBB 1Z2CA 2YDXA 1N2BA 1ZW6A 3T6KA 4X7PA 1ZN9A 3OUUA 1PNVA 1C3EA 1VSQA 3AP2A 1QGED 2QAGC 4IUYA 4Y7CA 4XLTA 1E1RD 4B73A 3M6IA 4CL2A 3O92A 5AI4A 3NBYC 3A32A 4WK6A 3L7KA 4E70A 1P60A 3DKRA 2QZJA 1DBRA 3S55A 1V16B 4XVUA 1NXQA 3MT8A 3QELA 1VHLA 2IKSA 3EEBA 4LFBB 2Y1EA 3GMIA 2Y77A 2QN8A 3R9IA 5ALFA 5H59A 4QLOA 2FR8A 3V8VA 2QD3A 1OV6A 2AQHA 3IYLW 5FWYA 3HE3A 4OHCA 2OCYC 2B69A 2Q4TA 5HRCA 1QQ6A 1YFMA 4MQMA 2CXPA 2DLNA 2FZGA 4URXR 2FR8C 2FMHA 4KKXB 1Z4OA 4R7TA 3OUZA 3V8MA 3VKVA 3L8YA 3PXCX 5A05A 3UWDA 1DPFA 4N6NA 1PJBA 3HHEA 3IHKA 3WNVA 2X3FA 1U0EA 1YS1X 1I2CA 3WK9A 4R41A 4EW3A 1YZGA 4MQ6A 2HJ9A 1YMUA 4XX0A 3IB6A 3X1ZA 4CDMA 1EWRA 1E9VA 3I9NA 4IQ8A 2IHTA 2OUKA 4BKQA 1N2GA 3EPLA 1X15A 1KRXA 3M7IA 4MGEA 4Z2YA 4ARAA 2BH2A 1E69A 1M3SA 2FI1A 2JATA 2R7NA 5B7GA 1G16A 5AW0A 5I9NA 1X2EA 4GZMA 4NJEB 3GFRA 5G1OA 3TD9A 4CM6A 4H7IA 1DAPA 2FWRA 1PHPA 2N0SA 3RTDA 3HXTA 3PGLA 1JFRA 4N3AA 3DEJA 1GV1A 2CY0A 2Y0EA 1O97D 3GNLA 1C7FA 4LSGA 3UMBA 4DJDC 2G7MC 2X0JA 4IIVA 4P93A 2B1JA 4D96A 2C5GA 4ENQA 3T7RA 3TSCA 2R3SA 2YOFA 4DCUA 2QYHA 2ZB7A 3ZJUA 3CMMA 3QE3A 4TTJA 1AT1A 1ODKA 3CYFA 5B4UA 1EQUA 5LC1A 3ROPA 1S01A 2ZU6A 1J49A 1JDJA 1TYEB 4OFWA 4NSNA 1EGQA 2H4YA 3E53A 4R51A 4HDOB 1JG3A 4BFTA 3TMKA 2Z58A 3AHDA 1EWTA 4HX5A 2WW8A 1JKIA 3FWHA 3I2GA 1JEAA 3EODA 1QNFA 4FFSA 4YJ3A 1OLUA 2UXBB 2AFHB 1K2VN 2WICA 4YJGB 4A0SA 2VWQA 4EWLA 3U0VA 3AR6A 5CYOA 5IJZA 4P5DA 3O82A 3CVJA 3DDHA 1DOHA 3MW8A 4BO2A 2NLOA 1P9RA 4YUVA 5H4GA 1QCDA 4D3FA 2G6TA 4RK1A 2PRKA 4Q01A 2BFFA 2NV0A 4Q1FA 2GEKA 4M46A 3ZPXA 4DQDA 3BQMB 3WYBA 4EYSA 3O2NA 4NCAA 2POCA 4GP6A 3RUAA 3B6IA 1WM1A 3P9XA 3T9FA 3GJ4A 3ZHCA 3NVKI 1BWSA 3LQKA 2IYEA 2IYNA 3CLTC 3WL4A 3RT7A 1EE9A 4BVJA 1P0IA 5AK3A 4CU2A 4OH1A 1K6IA 1PDWA 2KJQA 4Q6WA 4PC2A 1DS6A 4MPTA 4QVKA 3TW4A 1JHOA 1BKDR 4RV5A 2VF5X 4REQA 4CM8B 4YRNA 1F2TA 2QTCA 4K6CA 2N46A 4RK0A 2ISCA 4ZJYA 3UMGA 4KQHA 4C04A 5HUHA 3F78A 2MMCA 3HHPA 3URKA 2C5AA 1Z56C 1VI2A 1ZMTA 3A1TA 4MVYA 1VG8A 1CU1A 1N3YA 1TCVA 2WJAA 3ETJA 4RVNA 2QX4A 4MDEA 3VM6A 3FPGA 1QZ3A 2YCLA 2CNWA 4S1WA 4GXRA 5AJZA 3VC1A 1AHIA 1EFDN 2OCLA 3AEUB 3JRXA 3N05A 4IUBS 4NYIQ 2D54A 1BWQA 1LPOA 2PQ6A 2C4MA 1JTEA 1E6MA 1GU1A 3SVLA 4A8JB 5DHRA 1H2WA 4B82A 3JWPA 1Y9EA 4UOQA 4YGYA 2FPKA 4F4IA 4PG8A 4KFSA 2ZRLA 4Q4HA 2MOKA 3DFIA 1ZCJA 2WE8A 3HADA 5HK9A 3QNUA 1NUHA 3A4NA 3ZYCA 4ER0A 1Z7GA 1JKJA 2P9CA 3TTUA 3FUCA 1QLJA 1F0YA 1N7IA 5IABA 1LKZA 1PX2A 1P0FA 3M9WA 1VJGA 1A5ZA 3JSXA 4OP1A 4XDHA 3QLEA 4NBTA 4ZARA 1AURA 4BX0A 1JALA 3C4JA 4WLOA 1L5YA 4EHHA 4DV1B 1E6EA 4M0FA 1W34A 3CH6A 1QRUA 3LOPA 1XA4A 1DOAA 2VDLB 3I34X 1XZ8A 3KQYA 3H13A 3MILA 4X0EA 3UV6A 2P9JA 1LU9A 2NM0A 4OK6A 1XQ6A 4HT3B 4S24A 2XUAA 5LMZA 4YJFB 3QXSA 1Y5NA 2Q5LA 4NDNE 1XMJA 1KQOA 2DCMA 2IHKA 3B2EA 5F5NA 5DTEA 4XGQA 3T15A 1EFCA 1NMXA 1WXWA 2HLDA 3MWLA 1XX6A 1IJFA 3N3AC 4HDKA 1QYIA 1Q5PA 2G9UA 4JBIA 4LUCA 2W6QA 4KX5A 1Y48E 5DBHX 4LF4B 4AX4A 1NNLA 3SP1A 2DVMA 4XCXA 1BHQ1 1T8UA 3MGAA 4M86A 5JNLA 4BCBA 1WB9A 3FROA 3DAHA 4LHWA 5MGBA 1IU9A 2MSLA 1DC4A 5K5EA 2XB8A 2Q5FA 2WZCA 3BMXA 3LCCA 1NGSA 4QAJA 1R16A 4N7JA 4N3CA 2A9JA 1HR0B 3T7DA 4YBZA 1RHRA 2CJPA 3BS4A 1R4MA 1RXIA 3IP5A 3KEFA 3R3XA 4BO4A 1VBMA 4RENA 3Q2OA 3KWMA 3C97A 4J0GA 1SCUA 4APBA 5L3ZA 4UATA 5KDOA 3V2UA 2EDAA 4A1OA 3FNRA 1Z8FA 4HNAB 2ZRIA 3E2PA 2HA7A 1DE0A 2OFOA 5LD2B 3GRAA 1OA1A 4PZAA 4Y2XA 3VYTB 4CIDA 4Z4QA 3R09A 2IYOA 5A9SA 1BYUA 2GBLA 4M9XA 2QMEA 3Q2KA 2B5OA 1I6LA 2YHSA 1JXAA 1VI5A 4ZMRA 3LUPA 1XWOA 3ZCQA 4DC1A 3S1AA 1HY1A 4MX8A 2UYHA 3VX3A 3SQNA 5REQB 3O74A 5TSDA 4XYBA 4UDYX 4RTQA 3VSCA 1R2QA 1X1TA 4J1QA 2GERA 2PANA 4R81A 3F74A 2ECOA 3PDHA 3WVNA 1AS2A 1VP3A 1FFHA 4PV7A 1TPYA 1ZQ9A 2IZOA 2NYUA 3F8SA 4QQNA 4TLDA 3QEBZ 2V3CC 2MINA 2XJ9A 3B8HA 4L78A 1C9KA 2FG7C 5BVGB 2IIPA 1Z29A 4R16A 4HC4A 2O8DB 4A0RA 3U2QA 1TM7E 1NYQA 3IEUA 1UIMA 5DW3A 2ZRCA 3AH8A 4PGFA 2NT3A 1VDKA 3HVJA 5CJ2A 1WSDA 1SHJA 3GFOA 4J1SA 4J3NA 5CDFA 1KXZA 1DQZA 3CT4A 3KJIA 4MSUA 3UAXA 5CDYA 3EQZA 1HE4A 2WFLA 3CRNA 4PG7A 4FT4A 1AGXA 1NVMB 4EB3A 4PHGA 4EHNA 2FGJA 3KEMA 5DBGA 2FVXA 2UZ1B 4TV8A 4ZYUA 5ICGA 1OBCA 4EYKA 1ZI8A 5TE9A 1DZ3A 4OSEA 2ALJA 5AVWA 1LF0A 1T29A 1ZVKA 3KL4A 2P6NA 2Q2OA 2VJMB 3PJDA 4INPA 3GDOA 2YWEA 4JUDX 4UE3S 3KJNA 2IOHA 1HDZA 3PWTA 3LM8A 1K6JA 4WD3A 4YRTA 1NFFA 3W2FA 1F4LA 5L53A 1QTRA 4QJ5A 1GUBA 2F3RA 4YRQA 1Z15A 2VR1A 4G0MA 4IGFA 4EA7A 3MWDB 3CW9A 4K86A 5ITWA 1SU6A 5HF5A 1KI7A 1T8RA 3UUEA 1K5GA 3K96A 4ZAGA 4AI6A 2B36A 1Y4ZA 2ZQZA 5LQUA 2CDBA 1DX6A 1NAIA 4IHQA 4OAOA 2BGTA 1YS4A 1E96A 3DE5X 3FFBA 2ZWOA 3QE4A 1E2EA 4Z3DA 3NOOA 2QAGB 5JMWA 4BB9A 3JQAA 1ECCA 3W8FA 3H1GA 5ALIA 1G5FA 2BVNA 3EDMA 1KJJA 2WG0A 2VHVA 3ON5A 2J4FA 1EFUA 2HVGA 3JWGA 5CR9A 5MN5A 2PMWB 2AJCA 3TTYA 1YH3A 2WF8A 4XH9B 4BBZA 4RJKA 2O06A 3C1AA 2QV0A 4H7FA 4IGKA 3CX7A 3B7GA 4U6QA 5JADA 1R0RE 3LNTA 3N75A 2A7QA 4KGZA 1E3WB 4ARUA 3G8BA 4DJTA 3DMGA 3AM1A 4R1SA 4GOLD 4BE7B 2BLNA 2BKVA 3BRCA 1GUZA 5JQWA 2ZYVX 3CY6A 3C6MA 4FXPA 3T5DA 4JNKA 5KYYB 4YV1A 5BOSB 4PLVA 1OAOC 1XRRA 5BWLA 1V6CA 1TL7C 1YT5A 2JS7A 1YU9A 4D5GA 5HPYB 1MB9A 3H16A 1F14A 1H5UA 2ZJ6A 3KBOA 3L1KA 1T6ZA 1UP4A 4CQMA 1T3TA 1DVRA 1P80A 2HF2A 4JB0A 4CCYA 4CIVA 1ONBA 4R9VA 3EGDB 4MK4A 4DMFA 5F92A 3IXQA 1W36D 2JFFA 4OY3A 4LZLA 1CYEA 3DQZA 2C2KA 2BFEA 3PIIA 1L7DA 1SCQA 2F64A 3FI0A 5TGZA 1YDFA 3QKIA 1JR2A 2NU7B 3PEVA 4OHWA 4GRDA 4B47A 3OEHD 1S3GA 1NBEA 3OOEA 3QUBA 2ZEJA 3NWPA 4HWRA 2O0LA 2VT7A 4M0PA 3U1BA 1CQWA 2HMTA 1X1EA 1MU0A 2PUVA 2AHRA 2ZIGA 2QN3A 4RF5A 4FFWA 5YASA 2BKUA 3KTOA 3UV7A 4HLNA 2E6UX 3IUBA 5T7BA 3HM2A 2ZI4A 2ERXA 4LAFA 4ZQGA 5CLFA 2PWPA 4ZVQA 3VA7A 5T4EA 1TZCA 4L74A 5DHFA 3W90A 4AKTA 3O9MA 3I64A 4ND1A 3TZQA 1KY5A 1HQCA 1KAQA 3Q5EA 5J1TB 1AMOA 1C7EA 1QH9A 5I47A 4U6SA 2GFHA 4N39A 4OI0A 1ISRA 5CYFA 4H4DA 2XBUA 1J07A 2XWBF 4TYMA 1M8FA 3PGJA 4H4CA 4BB0A 4D82A 4QNNA 2HJVA 5LFAA 4DDMA 1ZM7A 3L0ZA 1T4DA 4FMCB 2JGMA 4FEEA 2ZAGA 4R2KA 5T4HA 3PUYA 3FHTA 3QHAA 1JDVA 3F4LA 3UMFA 3WJAA 2QUKA 3AG6A 4OGWA 3GLHA 3U7QA 5DM70 3TTTA 2AG8A 3K1JA 1V7PC 2BEVB 2ZZNA 2BKXA 1RWVA 2B7LA 1E79D 3FVRA 3RVJA 4CLRB 3FCCA 3MUEA 2RARA 2QX6A 5TMPA 1NQTA 1E0DA 1JLMA 3H5AA 5DHPA 2FMTA 4BGUA 4CZ2A 4FSDA 2ZB4A 4EG0A 2NUBA 4JI7B 3R6GA 3U5TA 4WEOA 2JFPA 1H2RS 1ZM4A 4J7XA 4URYR 4AF7A 2VDOB 1HRKA 1O0SA 1O94A 4WNAB 4BQFA 1G64A 4IH1A 5K51A 5FBRB 5FQOA 2PA0A 4RHYA 1I0LA 1N9ZA 3BSYA 3B1WA 2A78A 2PLFA 4UPEA 4QC2A 2OLEA 3O83A 1U3UA 3GPDG 3L46A 4QJIA 2BM0A 2JI6A 3TFQA 2WBLC 1ID1A 3PFHA 3TZ6A 2Q3EA 2HMAA 1WX1A 3O91A 4JLAA 4TUYF 1ZH6A 3AL2A 2WT8A 4A8JC 4AT1A 4CGYA 4P0TA 4ZHQF 1ZD5A 2WF5A 5C53B 1CNEA 4ESHA 2GVNA 2QRLA 1A8IA 3G0CA 4IEFB 4FU0A 1E2QA 1VCHA 1W0CA 2PFSA 4MLDA 4QNMA 3ZY6A 5GJVC 4HMQA 2EKQA 1W19A 8GPBA 2XQVA 4LBWA 3DSRA 4M53A 4I3FA 3QE9Y 5AI0A 4DLLA 1JHQA 4E88A 1V39A 4JI3B 2B3TA 1NWHA 3SKYA 4UMEA 1I4EB 1J8FA 1PNOA 4MV1A 3OX3A 1K3FA 2P7HA 5LYJA 5TC4A 3Q8WA 3ULKA 4LHZA 5K09A 3EUFA 2HN9A 1D1PA 4LRWA 3OKCA 1XCGB 5BV1A 2XE6A 3CLVA 4U9HS 5G4LA 3U17A 1ULBA 3BXHA 5EZQA 4YJ3B 4CM1A 4FYXA 3U60B 1UBUS 4JHXA 1Y42X 3JPWA 3HBAA 4I0WB 4HRXA 2EFJA 1K68A 4OHUA 4D9EA 5KPJA 2LV8A 5ITSA 2P4QA 2YOGA 4XDYA 2I2DA 1UH5A 4QRDA 2IX9A 2M32A 1ISGA 3H5IA 5H16A 1E89A 4RQUA 1UBNA 4RCZA 3TKLA 3IEMA 1J33A 1Z5OA 4F04A 5LL6P 2Y2UA 3DZFA 5JT1A 4UMVA 1X19A 1JDPA 3HDGA 3PV0A 4GOKA 1G19A 4KRGA 1FXWF 1I10A 2VPQA 3I6MA 5FQNA 4OFBA 2X14A 3ORQA 3FGPA 4GLBA 1RHUA 1JILA 3TRJA 1KFCB 3NIGB 1L5MA 1EPUA 1KBZA 2GK7A 3DZJA 1Z4QA 5H5JA 2DFTA 3OIGA 4H9GA 4OQYA 5EIXA 1T9ZA 2C5FA 1IW7D 1F8YA 4MMZB 5F12A 3D0KA 1B6GA 3MTJA 4QBGB 1HE8B 4DANA 3X44A 4AY4A 1M2VA 2VF2A 3OTHA 2UVQA 5D87A 5EZSA 1IVSA 2UYOA 2FLKA 3M1IA 2OHGA 4ZP1A 2JI8A 5KKCA 2DB3A 1E3QA 5AVXA 3I2JA 1KQFA 3T1NA 2VDWA 2GJSA 5AW1A 4I9NA 2PNJA 2QS9A 2W6ZA 2C84A 4NU0A 4YB8A 5IJ9B 2XTAA 1IVNA 4XM1A 2QKYA 1E0KA 3RKUA 2H2WA 2VIIA 5B37A 4B3DA 4ESEA 1ELOA 4MICA 5ALOA 1K06A 2FNAA 4LYJA 1BWPA 1ST2A 1P72A 1JR4A 1T0HB 2DOKA 2HRDA 4NPAA 3ZCXA 1OHHA 3SX2A 1ORVA 5CDHA 3L8CA 4KWIA 2UUBB 1JAXA 2CYAA 3U13A 4FUQA 4XFKA 3SOPA 2X3YA 1IEQA 1QFYA 5HVNA 4C4AA 3WQHA 1GNTA 4MV0A 1XBTA 1I3NA 2IU6A 2CLDX 2PD4A 3F90A 3WNDA 5KVSA 3GXOA 3M6LA 2XYQA 2AC4A 1YTUA 3RG8A 1TJUA 3UMVA 3IVMA 1KZHA 3K1TA 1WXQA 3BMCA 2NQ2C 3H8WA 1RWPA 4HDAA 4JT8A 4M4SA 3HMQA 1T8TA 3IUSA 5H02A 4YDHB 1RNLA 1GZSA 4L0MA 3AEQA 3LPMA 3OP4A 1R0ZA 4BVLA 3PFFA 4O4LB 1T43A 2WU8A 3OQVA 4ZU3A 1A4UA 1A9TA 3DMTA 4E46A 1W46A 1QYCA 2FGKA 3RWMB 3UHAA 4D3XA 2OAQ1 4C06A 2IH2A 1W1IA 3FMIA 1OWMA 2GZMA 3FPLA 5SICE 1NA5A 3R7LA 5A5EA 1AK2A 2HFJA 4MWSA 5BUSA 3GZHA 1NMYA 1BGVA 2ANCA 4Q1AA 1BE0A 1Z34A 3ET4A 2J3EA 5E7MA 3EXHB 4XPZA 1LZKA 3BSWA 2MIIA 2FPIB 2ZE5A 4QTXA 3IP1A 3K6RA 1OVMA 2JJQA 3REQB 1Y4SA 4QA9A 1C8LA 1F12A 3LNCA 3LKDA 1JPUA 3AKCA 4UBNA 4V0OA 5IHXA 1F3LA 2QE7A 2BFPA 3STXA 2WWVD 3GRRA 1SCIA 4KKVA 2VTEA 2XKAA 3BIJA 1RJ9A 1I1OA 2I67A 2QGAB 1QB7A 4MWOA 2WSSD 4BXOA 3NHWA 1V9LA 2KBFA 2W6OA 4PC1A 3HDHA 2FPRA 5DNWA 3OZFA 2E1RA 4PYOA 5IF3A 1U0NA 1XTKA 1Q84A 4ITVA 4B3JA 1H1LA 4XWKA 1ZAKA 3KSBC 2ZT6A 2GN0A 2G9RA 2ZJZA 1PR9A 5BNFA 2Z09A 4FKZA 4FKBA 2JGFA 4KXVA 3U26A 4FC6A 3VBCA 5K8VA 1UQUA 4O4HB 1MZPA 1YL5A 3BXFA 4QOJA 4ADLA 2RH5A 1QZXA 1BQEA 4LJ9A 4MW5A 2W2KA 4I81A 4YV0A 2QSUA 4LWQA 4OB8A 3S8EA 3HI4A 1MB0A 4TMVA 2A4KA 5K4GA 2SECE 4B3SB 2VP3A 4FX5A 1GCIA 1DJMA 4L9SA 2JFUA 3F7NA 1WTCA 3P2KA 1IM2A 3HSYA 3LYLA 3SN6A 3K94A 1KOFA 4KN5A 4LNUB 4QOFA 4QUDA 3GLHE 2HHCA 3T9DA 3HUDA 4KN8A 4JC5A 1K8XB 2Q3HA 3QOFA 4GPD1 5ELLA 1Z7EA 2WD9A 3J81k 5DU2A 3QVSA 1JW9B 2XUQA 4J6FA 1AZTA 4K2AA 4Q15A 3VSDA 4C7JA 5FL3A 2HXSA 4JYMA 2G4CA 3I3OA 4BGVA 1IZZA 3SBDA 3QYJA 2CWDA 2Z6QA 1DDGA 1WSAA 4B7UA 4K40A 3GHYA 1EUCA 1PP4A 1L5NA 3VAZA 3WGMA 3B8EA 1XKLA 5E8JA 4C5AA 2GB4A 1QGDA 2WQ7A 2Q27A 2P9YA 5DYIA 3KZKA 3IEKA 3THOA 4DRZA 4QKQA 5BURA 5DPMA 1GZUA 4Q4DA 4KDRA 2ILVA 1F4PA 3NV9A 3BDIA 4GE3A 4TLCA 1ZN2A 3WKDA 2GK4A 4P3OA 4UD2A 3VHLB 3K1YA 1J4AA 1N5LA 4BQOA 4LNAA 3V34A 3PI6A 4EVRA 3H8SA 1JKFA 3AY7A 3BCSA 1O2DA 3GDWA 2W2OA 3SYKA 5BRJA 3T1HB 2ECKA 2PCJA 3OJOA 5TS3A 2FSVA 1O95D 3ZV6A 5LDDC 3KT3A 4XTCS 5AXBA 5DSXA 1NZJA 1PBTA 1SXHA 2G70A 5CA1F 3OKAA 3ZHZA 1SHZA 1AHHA 1U2TA 2QN1A 3KJEA 3NHFA 1KVQA 2HRBA 3AVXA 1K89A 3VNSA 4JMPA 5DT2A 2NX2A 2Q1UA 2VKTA 2YXPX 3RM3A 4JMLA 5FBQB 2F8SA 2CZQA 1OB2A 5KEIA 2P78A 2YN4A 3LLCA 1LWOA 4JIGA 5G0VA 4ERXA 2BMWA 2R84A 2Q3MA 2ROQA 4YA6A 3G6WA 1XCOA 2FUG6 2XUFA 4RDIA 1SC9A 2C7BA 3T99A 1DOZA 1TJPB 3HBFA 4MWEA 1DCMA 5A5FA 1N6OA 3L0IB 3Q5GA 2AMVA 4H3VA 6ADHA 1F4VA 3AFHA 4UVIA 4WVFA 1PQWA 3V9AA 4E5DA 2QQGA 3E48A 1ESDA 3TG8A 1E7SA 1THMA 1ZIOA 4NABA 3VUEA 1KIMA 4JU8A 4HQKA 4RF4A 1TMYA 3RK0A 4D9KA 4QFDA 1Y7TA 3BHGA 2IDKA 4GGMX 5DM2A 2AYYA 3X1JA 2FEMA 4N9QA 5E3HA 5BUQA 5H68A 3MTEA 1Z33A 2C20A 3PWKA 4F8JA 3B1YA 1N36B 2GLTA 4HDRA 3EA5A 4DSZA 2AWNA 1P2GA 2ZSBA 1QHHA 4LRSB 4MYUA 1G6KA 2P9FA 1GZDA 2QVLA 2GSDA 3VMFA 4JXKA 4UTNA 3LQRA 2RH9B 5I4IA 5CCXA 4L0QA 5A7HA 2VAWA 2PKRA 1QCCA 1CR6A 5T6MA 2YS7A 5KTPA 3G0BA 1SZDA 1VKJA 4LW8A 4TQ9A 4X90A 1EX1A 1FY2A 1RI1A 1YDEA 1LQTA 3OJLA 2Q7XA 2R1TB 3PCXA 3OFNA 4LOHA 4PZDA 2RGBA 3WWOA 2JVIA 3II6X 4LC1A 4XYEA 1PFWA 4QWWA 4Z0PA 3HMKA 3X1DA 4BN4A 1TAHA 1WUIS 2O2GA 4UU8A 5B3JA 2HLHA 3SYLA 2JJ1A 1ODLA 2R68A 2HSDA 2Y2VA 4ZA2A 2J6IA 2RGCA 4PYMA 4F4DA 3EFHA 4U7TB 5FFFA 3D1VA 1IPFA 2AFHE 2RAFA 3U3ZA 1Z6GA 3DBHB 4G9EA 3I32A 3PA8A 4N1AA 3WSTA 1UXJA 2IY8A 3ZCVA 3QKRB 3DCNA 1AUXA 1NF8A 2CUZA 3ZE0B 4EA9A 3GLKA 1G6Q1 1OWNA 3HYCA 1CEQA 2C42A 3GUUA 3RSOA 3O4JA 2W00A 5HG0A 3KKKA 5C51B 3M4YA 1OZ0A 1QKJA 2WIAA 2OXTA 1FRVA 4RJTA 4TZ0A 3MVEA 2E0IA 1OXKB 2FF5A 3TTXA 1X8KA 3K70C 4BU0A 1O57A 3DVLA 4MVJA 1J2TA 2BONA 5IH3A 4OFXA 1K4YA 5AOCA 3TX6A 1NN1A 2GF2A 1HLPA 1G4HA 5LP6A 3DEYX 1TKAA 3BWVA 3ITEA 1QE5A 1N9GA 3WO0A 1ZL2A 3GFPA 3T4UA 4BNFA 3SJBA 3QWBA 2HUPA 1EFVA 5C1IA 4CKXA 2X5XA 5CYPA 3RGWS 4FZVA 1PZHA 2AKEA 4C5CA 5CB6A 3CH7A 3IVGA 1M6NA 2NSJA 5JSFA 2YHIB 3WNQA 3LRPA 2XYHA 4IJKA 4PZZA 5EMJA 3W7BA 4Z3KA 1L4HA 2WJWA 3NATA 3OM1A 3V7FA 2J9RA 2AR7A 1FUOA 2ETXA 2PH7A 4KBGA 1ZIYA 1ORDA 3HO8A 4UXIA 2YMMA 2JDID 5CCBA 4ABTA 3BD8A 2J4CA 3RS4A 5FBWB 3ZU5A 3WGIA 3VZPA 1SKMA 4HPXB 4QFCA 1DRJA 4G84A 3WJ1A 5D6BA 1CVLA 3JYHA 4HAZA 2GTIA 4URFA 2PMKA 4LI0A 2BTQA 4XKJA 1IAQA 3Q1LA 3QFSA 3FDJA 3ESZA 4JI2B 1J0EA 4C0BA 4FQ5A 4MEAA 5KJ6A 4RGYA 2BP7B 5L7YA 3FCSB 1CDZA 2JJYA 1T0BA 2WV7A 4BQPA 4IDBA 1T2VA 4Q3KA 4WBXC 2FB9A 3DDCA 3PRJA 4L8GA 4BLQA 2YVQA 4Y3UA 4JGGA 1U9IA 3BDAA 1IUOA 2HMSA 4LZNA 3TN7A 1W76A 4YK7A 1CD5A 3G1UA 1DO2A 5BW6B 1YNSA 1JFSA 4LJRA 4G4SO 2FV8A 2EX0A 3L5OA 2MTBA 1F9EA 1GTG1 4R3WA 2WJJA 4DWJA 5HZKA 1P5ZB 2QUAA 4ZOAA 3ZQ6A 5I9BA 2P3SA 1CLEA 3VU3A 1IZ8A 2BFDA 1LPPA 1PFKA 2QI9F 3LUCA 3R3JA 3HKEB 4B31A 1ZD9A 1M6VB 2XWSA 1T26A 4MRVA 3DG9A 1E3SA 2XYRA 1NY5A 4M9RA 5SYNA 4UCQA 5SY9A 1CY8A 4I19A 3ZOKA 3OPYA 4BWFB 3RRXA 3WYCA 1LI7A 4UCWA 2OL4A 4MUIA 3ICCA 4D4MA 3P19A 3ER8A 2VSOA 4TM7A 3WRYC 4EFCA 1CR4A 1CDEA 2XUIA 3M89A 3Q9SA 4NLLA 3N6XA 2UKDA 4Q1VA 5CURA 5K8IA 2PX5A 3WAJA 5JAMA 4E94A 3A4VA 3V7UA 2VZ9A 4DR2B 4L7QA 2JASA 1OHHD 2O2XA 3ZLTA 2E9SA 6AT1A 4Z3OA 5CEFA 1WTAA 3UAVA 3UCFA 4C08A 1TYAE 2WM2A 4Q3OA 1VLQA 3KVVA 1ZP6A 3H18A 3W77A 4BKOA 3HKEA 1ESMA 4LFCB 4GPTA 3DEZA 4GBGA 3IX7A 1LLDA 3E18A 1DFHA 3I0ZA 4HDNB 4RHUA 2CFIA 5JEDA 2P0YA 1OKKD 3NAGA 1T3HA 1RE1A 4H6WA 4OXYA 3R8CA 2B9VA 2QB5A 3WK4A 4Z7JA 1BOFA 3HK2A 4YUWA 4DNPA 3AM4A 3DBOB 3CEHA 3OT1B 4BO9A 1VIVA 2CWWA 2VYQA 3MWFA 4PSCA 2HQ1A 3V4FA 4RJ2A 4MZDA 5DP2A 2VRCD 5F52A 3U7RA 1JIKA 1YB6A 5KCMA 4ZAYA 3NUZA 3UJHA 3A1NA 1QH8B 4BX8A 1DCTA 1NUQA 3MIZA 1Q91A 3G59A 3UPDA 1NPDA 5GZ3A 5IZCA 3TVTA 4NCBA 2L82A 2VI5A 3LCVB 1G3IA 1HLDA 1ML3A 1R6VA 3A6KA 3I5AA 4QUKA 5DX1A 3VGPA 1G98A 1DHRA 2WM8A 4ESOA 1AQNA 1D9ZA 5HGXA 4E3ZA 2REQA 2GN9A 3PHHA 3MXTA 1ZVQA 1PI3A 2AG0A 1YI0A 2XNCA 3UJ6A 3ZTYA 3BMNA 4MR8B 3JWEA 3OT1A 3CWCA 4G37A 1RPZA 3PNVA 1Q11A 1BXKA 2GHTA 3RCBA 4QU8A 3K8YA 4HUJA 4GOJA 1E64A 2OXRA 4LC0A 1EIWA 4QXQA 4P33A 2Z8XA 4DEXA 4CIXA 1LK0A 3MBKA 4BIIA 2W2VA 1Y9AA 3ZU6A 3RIGA 3I04M 1NNUA 1O96A 1DEKA 3HZOA 4P4SA 1PR2A 5IM5A 4M98A 2V59A 1QDUA 1U0JA 2Q5HA 4RACA 1KYTA 1RRFA 1JBKA 1LPMA 1JB9A 1IN6A 1A2QA 1GYRA 3KYJB 3GLUA 3OZAA 5EJGA 1FFYA 1RRKA 5JTUA 3SDSA 2JHAA 3EGVA 4LQCA 5EXEA 4MPJA 3TZCA 1RQGA 2OCPA 3INGA 2CFOA 2OC9A 2QTNA 1Q14A 1IMJA 1PGJA 2B82A 3M4XA 2ZTUA 3UFXA 2NWQA 5BSVA 4J03A 1LLUA 5GQSA 1CQIB 3A05A 1GKYA 3WKAA 4HGNA 5WRFA 1OPRA 1YUNA 5A9TA 1C5KA 3GJ3A 3P2YA 4L95C 4M54A 4TUYA 1SPBS 5LMCA 2D2XA 3K3PA 3CVUA 2INGX 2FTKE 1N1MA 1O54A 3PNYA 1N2SA 5COBA 3PHJA 4R5MA 3FPFA 2RHMA 4UHCA 3IBCA 4I50A 1M1NB 3P32A 1BGXT 4S0XA 5IRCD 4QGSA 1EMDA 2IIQA 1B7GO 1RABA 4UZSA 1LBHA 2EL9A 4MVJM 5BMVB 2CYCA 3ZWXA 4Y6OA 1JWLA 4HN9A 5FOUA 3EIOA 4GEKA 3DFMA 5EJ6A 3CKKA 3FVWA 2YDYA 4KIWA 1N3LA 1GLGA 3FCUB 2Z6UA 2OAGA 1DX9A 1UCFA 2LR0A 2QW8A 3UA3A 2A9OA 4X7BA 4F91B 4IIJA 3PDUA 4DLTA 3U7FB 3D6HA 4UUMA 4Y9UA 5K7SA 5LDGA 4BPBA 5EFZA 5C4GB 3TGWA 4BO8A 1PLLA 4RTOA 3NBXX 2GCOB 3PYXA 1U6KA 3OQ1A 1VB3A 4QTUB 1B1AA 1S7CA 2QV7A 1YRYE 2P27A 4UHJA 1ZJWA 3L4BC 4GKKB 5F7OA 3HY3A 4EG1A 3A4YA 1D6NA 1YR6A 1FUKA 2WF6A 2WU3A 1V2HE 4CMHA 5KSWB 4PVCA 3NASA 4G81A 3AJ9A 4EG6A 5T4BA 4D6YA 1SN7A 4EMTA 4IYJA 3I9KA 4MVJE 4B75A 1EDOA 2GKGA 2RB4A 5KZMB 4HEJA 5KTMA 1U9YA 3DCYA 3ZKWB 2FP4B 4JJ8A 4RKQA 1Z0ZA 2Z08A 1G7RA 1OMOA 2BKEA 5IJAA 4Y0NA 3BD6A 3P5BA 2XTMA 1ZNWA 3CF4G 3DS8A 4D6XA 1PJQA 1GG9A 4FFBA 2A1UA 3QEAZ 3TQOA 4BMDA 4CNBA 3ZGNA 1NT2A 4I50B 3VR5H 1KY2A 1ZEMA 4JQZA 1SU4A 2WAOA 4LISA 5U1PA 3DV2A 4X1KB 3AOGA 1IZ0A 3EC7A 1MHTA 1C1DB 3FYCA 3PQ6A 2CT8A 4Z8XA 2AW5A 3RC7A 1TLLA 1WXFA 4WK4B 2NSHA 3LT0A 5DM60 4YJGA 5C8XA 2I91A 1H4SA 4QUGA 1D1QA 2FH5B 3MG9A 2IY9A 2PT6A 3PKJA 4EG5A 5CEJA 4TKLA 3U7GA 5DDIP 5FTKA 3QVVA 1NULA 3WLSA 4CE6A 5EZYF 4DN6A 3Q8LA 4I9GA 1U28A 3N6RA 2CXSA 2SHKA 4FFDA 4LQ4A 3RRMA 2RAVA 1S1CA 1YK1A 5BRNA 1AKUA 2OC4A 3V1UA 4B4WA 4HNSA 2QTHA 4Z6KA 1F5NA 3D7SA 3T38A 3KHUA 5CIWA 4YMGA 1DWUA 3PNOA 1KQNA 1NMSA 3DT8A 4EB6A 3Q0EA 3K71B 1A5BB 2YYZA 1NUSA 4JBNA 4U7FA 5D1HA 3AKYA 4NFSA 1UJNA 1OPXA 1OZFA 1C4OA 2HL6A 1E7QA 2UZ3A 4JLDA 1IK4A 3LFUA 4IIHA 3OM0A 5AJTA 1GUDA 3TZEA 1IRXA 1L7MA 4YX9A 1S89A 1Z5ZA 2A5DA 2P4HX 4HRAA 4QECA 1XEFA 1ZGGA 1OXUA 2PD6A 4G85A 4S2EA 4YWHA 5IKXA 3QW2A 4N5HX 1XU7A 1V3QE 3H9UA 4EPVA 3E9ZA 4ILKA 2D8AA 2H4FA 2ZFUA 2G80A 3V1LA 2O2IA 3KOUA 3VYRB 3C6XA 1T6NA 5EMNA 4ZVPA 3EDRA 4UBKA 3WGNA 4HEA6 3UTDA 4OOFA 3LUDA 1YZ3A 3M3PA 2WC1A 4M0KA 2GYWA 3IPRA 2C9DA 1R9NA 4B45A 5ALXA 2H2FA 2PMCA 4AY5A 5IJ9A 5IYZF 2J07A 3KLBA 1QG0A 1C1DA 3FUXA 3AO0B 1ZOOA 1WEKA 1YFEA 3KPVA 4PYKA 3GTDA 4BFVA 1XEXB 1ACMA 2HK9A 1SC6A 1Q74A 2QU7A 5TMEA 1CQJA 1CZKA 3OSZA 2IEZA 3NJ8A 2AUMA 1XXHA 2B6HA 2ZYDA 2HWKA 5EP4A 2PYDA 5EZYA 4Z7OB 1NC1A 4G5QA 5AW5A 1WUJS 2CUNA 4FHFA 4X7RA 2AIRA 1WUKS 4AROA 1DAHA 2PS1A 3C24A 5KOHA 2J41A 2B8WA 1QTIA 5CAEA 2AD1A 3NM5A 4ZHQB 2P2GA 1G21E 9ABPA 1YB2A 1KDPA 1E1CA 1M2GA 1RJWA 4GI2A 4LCBA 4M9ZA 5DWDA 4F60A 2JLCA 1T25A 1M8GA 4PZPA 4JELA 3TNFA 2OCBA 2PS9A 3BRWA 3E3AA 2GTHA 3F7MA 4EF4A 1TW3A 3BSSA 4XWOA 2E7ZA 3MTDA 4MIYA 1SXJE 4GYJA 2RGDA 2UZAA 1YB1A 2WT4A 2C7RA 2BEKA 2VNAA 4HATA 3DE2X 1TUBA 3SIXA 4HDQB 3SJUA 3CN7A 2E87A 4IIGA 1Q1AA 4QEDA 4UASA 3SFVA 4P3PA 4LQDA 1MX5A 5LZ5A 4CN9A 4ZMBA 3DDNA 1LBSA 3JWIA 3JWHA 1J6UA 3ELWA 4NJOA 3VI3B 1NVWQ 3GA7A 3BXPA 1LJLA 2PL5A 3HWX1 4LJSA 1AX9A 1DL5A 3NBQA 1E58A 1SCBA 5JWRA 2D5CA 1LDMA 4JEHA 5J2TA 1P4HA 2GASA 2YY6A 4FFOA 4MS3A 4DWOA 2X2PA 5JNTA 4TSFD 4BNHA 2CKMA 2H1IA 3K9LA 4R1QA 2YVKA 4DGQA 3WKBA 2F3TA 1ORRA 4ZEXA 1ZQ1A 3CNHA 3O8NA 1BKSB 2J5QA 1IHUA 1Y8QB 2ZYHA 1AGRA 1SRRA 3KB6A 3NBMA 4KREA 4WZZA 2C29D 1NBIA 2Z9CA 1XUOA 1JLRA 1UWCA 1LEHA 1HBJA 1EZ4A 4RMHA 3VZSA 2W6NA 5ALNA 3GPLA 2GI4A 4IDNA 4BE9A 1UFKA 4AS1A 2H5JA 4HS9A 2HCJB 4LZZA 4GDFA 3IR5A 1B8VA 4NYJQ 1PLJA 1RYHA 3QVUA 2A1IA 2O1EA 5T3YA 2W43A 5FBKA 1M10A 3KU4A 4HJXA 4X8LA 1YQ9A 3B1ZA 4ZT2A 4YRKA 3CKLA 3OESA 4YIHA 3O73A 3M9LA 4B3TB 2ZDQA 3A6GA 2BBOA 4FE4A 3C3AA 3CO0S 1Q0QA 3O8QA 1XZKA 4BTVA 4FZ3A 2Z2XA 4IAOA 2XVXA 3J80A 1SXPA 4QULA 1DJPA 3SU8A 1NE2A 1ZHFA 2C8JA 3NHMA 2JA2A 4BIMA 4D9HA 1JXQA 4WZBB 1T6BY 4HNUA 3CRRA 3RREA 3BL6A 4EJ2A 1E2IA 2PTHA 4IM7A 3A9SA 4YCLA 3WBKA 4D6PA 2PL3A 3FTQA 1Z4NA 3WWZA 4QXOA 4MROA 4RPLA 4EDFA 1I7SB 2W2KB 3ZDDA 3AVOA 1YS2X 4K3UA 3VGJA 5C9ZA 4CGZA 1IXRC 5D3MB 4OH7A 5IASA 3N2EA 2IYFA 1V2GA 4KN9S 5H3HA 1NR1A 3EDYA 1VPVA 1L7PA 2LGJA 4XQGA 5T4FA 4EPYA 4WACA 2CMGA 2O1SA 2G0TA 2NZ2A 5D00A 3CC8A 3L6UA 3LWNA 4G63A 4ZGBA 1C0IA 4D0SA 3G02A 3GLGB 3CRW1 3OICA 5A1JA 4G5YA 5ALMA 3LUBA 1AK9A 3GZNB 4LMRA 4XB2A 3K05A 2R6JA 1EM8A 2VCHA 3IV7A 1SEPA 5ADWA 4GQAA 5F23A 1BE8A 5HZHA 3PXDA 2PGLA 5IC4A 4KQ9A 2C03A 3UM9A 1F2DA 1DV1A 1OY1A 1H5QA 1I0ZA 4FNOA 2CVZA 3JQ6A 4LYFA 4OHXA 4WNYA 3I4FA 4HYYA 5HBRA 2HK7A 3PPVA 3E05A 1I2BA 3EGIA 4R40A 3RK1A 4OQZA 2FWAA 1ZDMA 4J3JA 4QQRA 1GPWB 2P9EA 2EU8A 2XOKD 3EFEA 3SGLA 3I62A 1RRVA 3UK0A 2GFIA 4KODA 4NH0A 5I8WA 1A9PA 1C1HA 4U7GA 1T3LA 3FFWA 521PA 5F1KA 1IONA 2FSPA 3HA2A 1CZOA 3IUEA 1MIOB 2ZI7A 1UAAA 3BMQB 3PEEA 2PUGA 4DCMA 3TDNA 1SHKA 1PG2A 4N40A 2V7EA 3UHPA 2V5AA 3ZZUA 4O4IF 4D3DA 4YHBA 4QO8A 3B2QA 3RTEA 3TLMA 4D9IA 2IIVA 3GAFA 4UMDA 2C59A 3FOCA 2DHEA 2WTBA 1TKRA 2I2BA 2YV2A 3P96A 2Y1DA 4MLZA 4Y0AA 2OA0A 4OHYA 3HN2A 1K0FA 1TLTA 3G9TA 2AGVA 3HCCA 2UYQA 3Q1KA 3GBVA 3GLRA 1L5VA 3QFTA 3TAUA 1XRPA 3HP4A 1BU5A 2VK8A 5LKAA 3ZJ5A 1MFPA 4PGGA 3GG9A 3A11A 1Q57A 5DNDA 3KM0A 5IVPA 2HWYA 3OFKA 1E9CA 4BUZA 2C07A 1RC8A 8MHTA 3L0BA 4TL7A 1M6EX 2IYPA 3CTMA 3TFOA 3INNA 4R1UA 4YRZA 1SOWA 2KM1A 2P5TB 3QU9A 5DLQC 3TSYA 4X1YA 1L1RA 5C35A 2PGOA 4HSGA 5M5BA 1AE1A 1HFWA 1FDIA 2PGIA 1L5WA 1Z0IA 2EKDA 1P6QA 2A5LA 5EWLA 3MINB 3TB4A 3P94A 4PCVA 3NTRA 4ZOBA 5CLJA 3W6PA 1LDEA 4FHGA 1BFKA 1RJGA 1T4BA 2DTEA 5DSZA 2HRZA 4JZYA 4RD2A 4X92A 3QJ5A 3GC6A 4G8CA 1XAJA 2G1JA 4YPVA 1DUIA 3BAZA 4QDZA 2YYAA 1TF7A 5ES3A 4DQUA 1CS0B 2H4XA 4ZO6A 2H52A 2FQXA 1YV9A 2VZ8A 1TYBE 5DYTA 2YWHA 3CN9A 4NWIA 5JO9A 3T3GA 4B3FX 4I8XA 3NB0A 4K9PA 4KYTA 2UXDB 1EVLA 3R7BA 2ODQA 4OHFA 3X2EA 5IBCA 2CK3A 1II9A 3HSSA 3OZCA 3ICWA 4KFCA 4UOZA 5KVVA 5E7QA 1I7LA 2V58A 3LZDA 3I53A 1D03A 3ABIA 2AI2A 1FDOA 4G4IA 4HB4A 1DAIA 4RFSB 4ZU1X 3W5IA 5ARBA 4EFNA 1S4QA 4H7HA 1VMKA 2GBGA 1FZQA 1CLUA 1P7WA 1W93A 2UZIR 2NU8B 4U2EA 4COOA 4EBBA 5KINB 5L95A 2CVFA 2JLQA 3GGCA 6NULA 2KS6A 1PYGA 2E4XA 3WSVA 3EFBA 5JO0A 4ZTZB 3MZ0A 3MFYA 4CMIA 1I14A 1ZC3A 2J0SA 1BG6A 5T6BA 4BNKA 1G2PA 3GN2A 3FHOA 4DRYA 3QYPA 3UICA 5BVHB 5AVYA 3VVBA 3FF1A 2QNBA 4PPGA 1WCIB 4G5RA 4YMSA 3ENKA 4A9AA 3OOJA 3NO4A 4BZPA 5FAKA 5FTLA 5JZVA 5TQ0B 1YR7A 4Q16A 3K0CA 3DKVA 5JS2A 1WQ3A 3KB2A 4IXWA 4R9RA 1S7GA 4NV0A 1Y89A 1QUEA 3E9RA 1SG9A 3ND6A 4HAIA 1Z7BA 4MI9A 2BGNA 4FYPA 1PR3A 3U3RA 4EUFA 5AQ1A 2YXBA 4BNDA 3FSGA 4PLPA 3DAFA 2D0PB 1DBIA 2Q9UA 4A10A 3U9TA 3M6WA 3BAFA 4BFZA 4D9MA 5HF9A 1RI2A 4ND6A 3ZD8A 2WTUA 2P9BA 2OPBA 1H23A 3BUSA 1FFBA 3M6VA 4YS6A 3OPXA 1IHOA 1XPRA 5BR1A 2GAIA 4L28A 5JH7B 1A82A 4ALJA 2D7DA 1Z12A 1R5NA 3DVRX 1WBJB 5KVAA 1LD3A 4JI5B 4RPJA 4JI0B 5LXTF 3SR4A 4FDVA 2QENA 3KL2A 1NP7A 5DB4A 2PZ8A 3HPQA 5ER9A 1COWA 2D0IA 2YWJA 1TW2A 2IYSA 5FTWA 1PT7A 5HKAA 2PGDA 3ADCA 4R0NA 4BVBA 4QUIA 4GRAA 5B36A 3KAQA 2QYTA 4X3CA 1N75A 2VTBA 4IUCS 3D6MA 3H1AA 1VJ5A 1NJSA 2RJ3A 3NXKA 1UZNA 4BNDB 4NS1A 1KWGA 3OTOB 3AL3A 3UFBA 2E1PA 3P9QA 2Q5EA 5AHKA 3A6PC 1B23P 2AZ4A 2RHOA 3ID6C 3RO7A 2X4LA 3BIOA 2G1AA 4BQNA 5KYKA 4XB1A 3THWA 2DFNA 4ZFNA 5EJ4A 1Q6YA 2J0EA 2FSVC 4RORA 4DC9A 1BDHA 2X0NA 3WQRA 4KO8A 2E4WA 5J40A 2J08A 2PE5A 4JWKA 4UHFA 2D59A 1WW3A 4B09A 1FP1D 2DTXA 1OI2A 1X39A 4CI9A 1AUVA 4S12A 4ZQHA 1PLKA 2XYGA 3RT1A 4J1NA 2P40A 1H2BA 1IM5A 2EFCB 1B3BA 1W8IA 2QXUA 4MHSA 3F49S 1KDVA 1NC3A 4FYHA 2HPZA 3WB1A 4OGGA 4PC3A 2F1JA 5CVVA 5HOEA 2J3QA 2D74A 3V4LA 3MAJA 3IQXA 4EFKA 4YI5A 1OILA 3E70C 1JYEA 5CM2Z 4JLOA 5DGDA 3TGLA 1Z6YA 4BP8A 1SQ0A 2J3DA 1QHGA 1N6LA 3U09A 3EMDA 4OM8A 4AW9A 4M1ZA 3UHFA 4BASA 4ZOCA 3LYAA 4R8VA 4NC9A 4NATA 3M82A 1GA6A 2OBNA 4ZYTA 1CNFA 4ZAFA 2GGSA 3HB9A 3NR2A 2FE1A 3JQ9C 4BV2A 1K62A 1RLMA 4OV6B 4DRXB 3QZUA 3DWFA 4KG7A 2ZRFA 2B99A 2SKEA 2YYSA 4GMDA 5IBQA 3ZCUA 4GLLA 4MR7A 3WY9A 1P8AA 3CUUA 2IZ0A 5K0EA 1V5EA 3C8MA 3DE0X 3C3MA 3KVNA 5AJWA 4DCJA 1A8HA 3LG2A 1J9GA 5C46F 1THTA 1RMYA 3E9NA 3MT9A 5BSRA 1VPEA 1X86B 2R8BA 2ZPAA 3VDNB 3DWIA 5DNCA 4TSFA 2OM6A 3KSZO 1T6XA 3AEUA 4RTKA 5EVJA 2FMKA 5IG2A 4FN5A 3PEWA 3L06A 3JYLA 4BPRA 1VL6A 4WNIA 1K9VF 1DKLA 4EPTA 1CJBA 4NMXB 4ZVNA 5HF8A 1L4EA 2J6CA 2ICAA 1E4YA 1NZDA 2TS1A 3FRJA 1CS4C 5KYYA 4BEWA 4U0KA 1RXYA 2VHEA 3SXUB 4P36A 1NWCA 1QZUA 4AN4A 5KU1A 1YR9A 2WSBA 2REQB 4EFLA 3PP8A 1LBTA 3MD0A 1QJCA 4KOAA 4ZV7A 2C77A 3HYSA 3DBLA 2XNHA 3LUGA 4GM4A 4LZOA 4ND4A 3T3IA 2GA8A 4B6RA 4BJ3A 1RZUA 4WXYB 1JZTA 2BJHA 4LIPD 3JATB 3A4IA 4ON9A 5C8VA 2QHXA 2C8KA 2ZTLA 1I1HA 1CP3A 2GCEA 2WLSA 3DE3X 5KAMA 3ROQA 1G3MA 1P5JA 3VPXA 2ZUVA 3LPDA 1QPGA 621PA 1JR3D 3WKEA 3OIYA 1DTWA 5LJLA 4E6EA 3BBLA 3OE7D 3GFSA 2ZPTX 1ULZA 3O1IC 1I7NA 4JLKA 3HBNA 4N41A 2V1XA 5JR3A 2OP0A 2B4AA 5H4HA 2Q5OA 2ZXEA 3IB3A 1TMKA 2VN8A 4I2NA 2EXXA 3O4HA 4PWYA 2N3ZA 1D9XA 1YJBA 4LJ7A 1QX4A 1JXOA 3UJNA 4KR2A 1EM6A 1GJRA 2E4UA 2YHBA 2ZAIA 1KP2A 1WNTA 1XTTA 4BJ1A 4DBZA 2NZXA 2NSLA 1VYTA 1NI4B 3WHPA 1D4FA 1XEWY 2QIOA 3LF2A 4JBXA 2JGEA 3FPSA 4G0VA 4W6QA 4Z7QB 4CI0B 4RJLA 2GEVA 1SG0A 1JZQA 1YVUA 5EERA 2H17A 2B83A 4ITUA 4MRMB 1EFPB 3KE9A 4QPZA 5FHQA 1A96A 1X7GA 3ACCA 3HCRA 3KVOA 5BW5A 4U4AA 3EYWA 3ISVA 3M3DA 4GGPA 1J8VA 3NHUA 4RY0A 4YT8A 4EUSA 3MJEA 3OG9A 1PWYE 4NULA 1VTKA 4UUBA 1BMDA 1R12A 1FLVA 3DA8A 1U4OA 3DQPA 3O4VA 4TOIA 5DLPA 3RRYA 1W36C 2ZBVA 2XB6A 4HGQA 2JARA 4OYRA 1MB3A 4NU5A 3WK7A 3RC3A 4YMLA 4DKJA 4YMIA 1K7WA 4PX2A 3SYRA 3GDFA 2ENWA 5EUBA 1IN8A 1ZA1A 4NYMQ 2I1WA 4PR3A 1I7PA 1YMQA 1WHTB