1Z4MA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
molecule keywords 5'(3')-deoxyribonucleotidase
molecule tags Hydrolase
source organism Homo sapiens
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4mA01
4QJBA 2C8LA 2FUEA 3NALA 2NYVA 4UARA 1Z5UA 3TLMA 4MWOA 2WF6A 3B9RA 3QUBA 2C88A 1Z4MA 1K1EA 2NO4A 2ZOSA 4EENA 2EARA 3NAMA 3VAYA 2NO5A 5AW2A 5AW0A 3WK8A 4UMVA 4L6AA 2YMPA 3FGOA 5ALGA 1J8DA 2AUTA 3HLTA 2X4DA 4OCZA 2PR7A 4G63A 3CZ4A 2B1QA 2JAWA 3A1EA 2HOQA 3QLEA 2P9JA 5AK3A 1TE2A 5E0OA 3DAOA 3R9KA 5AK4A 1YDFA 3ZWKA 1LVHA 1L7MA 3MN1A 3UM9A 4Y2PA 1PW5A 2G80A 3OCWA 4UW9A 3QUQA 5A3RA 2QLTA 5AW5A 3AR4A 4AP9A 2P69A 5ALWA 1QQ7A 3L1UA 4EX6A 3ZUPA 1T5SA 1RQLA 5AM5A 1WZCA 2CFRA 3ESQA 3FZQA 4YGYA 2WM8A 4Y2XA 2YN4A 3ZW7A 1L7PA 5ALUA 2FEAA 3I76A 1SU4A 3OTQA 3KC2A 2HX1A 2RB5A 3QNMA 2G09A 2CFSA 2IA5A 5AW4A 4NFLA 2R8YA 4RESA 1Z4LA 1ZD2P 5ALZA 3ED5A 4C4TA 1Y8AA 2I55A 2BDEA 2C8KA 4BNDA 1YMQA 4JDPA 5AIAA 1TJ3A 3SF0A 1QYIA 4L57A 1Z88A 4DW8A 3WK7A 5AK5A 1SWWA 3OCUA 1L8LA 2WFAA 4YIHA 2B82A 4ZEWA 4BEVA 4YCLA 1JUDA 2O9JA 3WKBA 4BKMA 4Y3UA 3WK9A 2B8EA 3DNPA 1RKQA 1F5SA 3U13A 5AM3A 5ALHA 4Y2YA 2W4MA 5AW9A 1QH9A 2IYEA 1QQ5A 4HGOA 1ZOLA 3QGMA 2GFHA 4HGRA 4Y2UA 3R09A 3KZXA 4CE6A 2YBDA 1T9ZA 1AQ6A 3U19A 2OM6A 4EEKA 2G0AA 3QXGA 3AR5A 1RRCA 5ALEA 5ALOA 3A3YA 4BYGA 1U7PA 1YJ5A 1N8NA 2JARA 2B30A 3L8HA 3A1DA 5AW1A 3L1VA 1YV9A 3ZWDA 5AI0A 2AH5A 2GO7A 3SKXA 1RMQA 2BDUA 4UU1A 3L5KA 2HI0A 4BX2A 2YY6A 3ZTWA 5IT0A 4EZEA 5AKLA 3ONNA 2D2VA 3FM9A 2P27A 3PCTA 3DDHA 3ZI4A 3WGUA 3BA6A 4BNDB 4XE5A 2BY4A 1TJ4A 1U02A 2ZBGA 4AS3A 1XP5A 4HGQA 5ALQA 4KYTA 2ZBFA 4HAIA 3SHQA 4IG4A 1CR6A 3QU7A 1EK1A 5AVZA 1RKVA 2IOFA 4Y2SA 2YMLA 5T41A 1Z4NA 3EPRA 3HYCA 3N8GA 3AR9A 1RKUA 1XPJA 5A3SA 4UAVA 3U7FB 3QYPA 2JGAA 1ZS9A 5AKIA 4NV0A 5AK6A 4ZEXA 3WK5A 1NNLA 2IOFK 2IOHA 3E8MA 2P11A 5AKKA 1ZD4A 1WVIA 4PNHA 2GHQA 4Y2VA 4FFDA 5AVQA 1T5TA 4IFTA 3PGLA 4UAUA 2FUCA 4I9GA 2B8JA 2AMYA 1ZJJA 5AVYA 5AI9A 1VFPA 2G06A 5AI6A 5AKJA 4MUMA 3AR3A 2WF5A 4BX0A 4G9BA 4YCNA 2C4NA 2GMWA 4L6CA 4Y2JA 4F71A 3L0CA 3QU9A 4GIBA 1CQZA 2RAVA 1RDFA 2HO4A 3U26A 1YNSA 2FPXA 3DV9A 5AW3A 2FPRA 4E88A 5ALTA 4JB3A 3RFUA 2I54A 4OFZA 1S2OA 1XVIA 3L0BA 3WGVA 1Z4KA 4F72A 1L7OA 1Z4PX 2YJ4A 3D6JA 5AESA 1L7NA 2I6XA 4C4RA 1RLTA 3ZX4A 2I34A 3R4CA 2OYCA 3PGVA 2MSNA 2EATA 1VJRA 3K1ZA 2OBBA 4YCMA 4BX3A 4DCCA 2W11A 5AW6A 3RF6A 3UMBA 3I1YA 1U2SA 1O08A 3WK6A 4CF3A 3E58A 3QU2A 2G08A 4UASA 5AVVA 3NASA 2WF8A 3WKCA 2RBKA 4FYPA 4BBJA 1YS9A 3AR6A 5AKZA 3QUTA 4ZEVA 3ET5A 4XPZA 2WF7A 5ALXA 3ZVNA 2PQ0A 2Q4RA 4Y2QA 1EK2A 5AKGA 1IWOA 3PDWA 1ZRMA 4CF4A 4NAVA 3P96A 5AVSA 3U7HB 4UMDA 2EAUA 2I7DA 5AIBA 2ZBEA 2HF7A 3S6JA 2Q5EA 1RLMA 1RC8A 3BWVA 2B0CA 5AKYA 3MPOA 2B1RA 4J03A 5AKXA 3OCXA 4UU0A 3W5CA 3QUCA 1WPGA 3KOOA 3NRJA 5AM1A 4OHFA 2CN1A 3EF1A 5AI5A 3U7GA 2WHEA 4EELA 5AM2A 5AVTA 4NABA 3AR7A 1Q91A 2YMQA 5AKEA 4KN8A 5ALVA 3N1UA 4YH1A 3FVVA 1U7OA 1Q92A 5ALSA 4CF5A 5ALKA 5AI4A 5AVWA 2ODAA 3WK4A 2HHLA 4C4SA 5A3QA 4OD0A 4HGNA 1Z5GA 2CFTA 4QQFA 3ESRA 3ZVLA 2QYHA 2YFYA 2DQSA 3B8EA 2G07A 2C9MA 3FPBA 3ZX5A 1N9KA 4EX7A 2VKQA 3QU4A 3E81A 2FDRA 4GXTA 4UM7A 1S8OA 2FI1A 3QX7A 3N28A 3FPSA 3F9RA 4B6JA 3I6BA 2Q4TA 3NANA 2FPSA 3W5DA 3SMVA 3WKEA 4KNWA 3M9LA 2MU1A 3WKAA 2YJ5A 5AVRA 3OCVA 5JJBA 3OPXA 1SWVA 3N07A 3SLRA 5FP0A 3E84A 2O2XA 1ZRNA 5ALPA 5ALYA 3KDPA 1J97A 2HEGA 5AM0A 4H1WA 3QU5A 4XOUA 2HSZA 5AW8A 3N5KA 1RLOA 1L8OA 5AI8A 3ZTYA 1Z4OA 2ZBDA 3AR8A 3L8FA 3ET4A 1VJ5A 3L8EA 5ALDA 1RMTA 5AVXA 2GHTA 5AKHA 4Y2TA 2PKEA 1ZD5A 1NRWA 5ALRA 3ZVMA 1ZD3A 5ALIA 2HF2A 2RARA 4HGPA 5AW7A 1L6RA 1MH9A 1RQNA 3OCYA 5AHXA 3MMZA 1NF2A 1WR8A 5ALMA 2R8XA 3IRUA 1Z4JA 4BEWA 4KX5A 2I33A 4DWOA 2WF9A 3IJ5A 4HYTA 3SD7A 3WKDA 2HCFA 2YJ6A 2G1AA 1QQ6A 2YJ3A 2OA0A 3SKYA 4J2TA 2W43A 5IS2A 3UMGA 5ALNA 3W5AA 3NIWA 3J7TA 5AICA 3UMCA 3EF0A 1TA0A 4CNQA 1LTQA 2YMMA 4I9FA 3U7EB 3NUQA 5AM4A 2R8ZA 4FE3A 3ZU6A 5AVUA 5ALLA 4UATA 2HDOA 2FPWA 4AS2A 1X42A 1U2TA 3GYGA 3AR2A 1RMYA 1Z4QA 1KYTA 4Y2RA 5ALFA 2R8EA 1TJ5A 5IT4A 1Z4IA 3M1YA 3KD3A 4KX3A 2JAUA 3CNHA 2JAOA 3W5BA 4KNVA 1FEZA 3OCZA 3KBBA 4NWIA 1RPZA 3L7YA 4RETA 3I28A 3MC1A 2ZG6A 4UMEA 4DFDA 2ZXEA 3L0YA 4XQ0A 4O8CA 2FPUA 4YIKA 5ALJA 3B9BA 2AGVA 3EWIA 1O03A 3IB6A 3L8GA 4UM5A 4UMFA 3A1CA
chains in the Genus database with same CATH superfamily
2IHBA 3Q15C 3FYUC 3O8DA 4DZZA 1BE0A 3FOBA 4UARA 1SJ9A 5L3VA 1I3LA 3H42B 4NNPA 1BO6A 3U3JA 2EFCB 2BP7A 1N6NA 1RP7A 3LPNA 1RJDA 2HA6A 3FNRA 3DP7A 4P53A 2PX4A 3CLUD 4R2XA 5JATA 1FLNA 2MIIA 4DMHA 4ZK6A 3PFNA 4MKZA 1BE6A 1O3YA 1ZJZA 5DP2A 3TQTA 1WOYA 2ZZNA 5DSTA 1TRKA 1IY9A 3HLTA 4I6JA 4IYJA 4UHFA 2X4DA 1S1CA 2PR7A 2PUTA 4IQFA 5EJGA 1X14A 5AK3A 2GDJA 1PE0A 5C3MA 1BEEA 1ML3A 3CEHA 3OFNA 4AKHA 3F8WA 2DZDA 2ONKA 4H7EA 3OJXA 1ZONA 1VKZA 2OXEA 2WFZA 3RRJA 2QT1A 1PFGA 3D02A 4I1SA 4ZVMA 1JR6A 1AXRA 4CM9D 4CR6A 1B74A 3ZD9A 1ZU4A 1CUXA 2DBQA 4X1IB 1XC7A 2O3QA 1OBOA 2P9BA 4B7AA 1YB1A 1RPJA 1RHKA 2O48X 1ZUWA 2QLTA 4IS3A 4PR3A 1EVJA 2BVNA 2RHLA 1HZJA 5KNBD 4ERXA 4KGZA 4QPCA 4BLUA 4I4NA 4IIJF 4GE0A 4RGYA 3VV3A 5AW3A 2PR2A 5CA0A 3HBLA 1CERA 1U3WA 1XCLA 2DHDA 2PA3A 2FOXA 4ZMBA 4E15A 1XA4A 3UBTA 1GCUA 1QVVA 3DO8A 3KS9A 3LLVA 1L1QA 1NSTA 1TM3E 4XB2A 1BEZA 4HS4A 3RTBA 2PX3A 1VDKA 1R2QA 3A2LA 1F20A 2P5SA 4AJNA 1GZ5A 3ACDA 3B6IA 3D4BA 4L6IA 4WZAE 1T3GA 5A0VA 3URMA 4XYMA 1QGDA 2XNCA 1CWUA 1SPBS 1UFOA 1ZD2P 1FUYB 3GPIA 5K4AA 3U9SA 3IH5A 1VJTA 3ZHQA 4GRIA 2I55A 2GXAA 1KMCA 4WBNF 5TRTA 1FSFA 3DBIA 1D6MA 5K6AC 4C4AA 3H2KA 2XCIA 4OYHA 2E9FA 2YOFA 2J5QA 4LV6A 2O2ZA 1F2UA 4JIGA 4WY8A 3WYFA 4AWAA 1JP7A 1R5OA 1VPEA 5IXJA 1OX4A 4ZYXA 3MRVA 2XCTB 2EBHX 4O5OA 1C1XA 4REOA 2H3HA 1VPLA 2GBLC 4Y3UA 2VAMA 3AF6A 4XYLA 1EWKA 5CM8B 1A4XA 1FTSA 4NEHB 1IEXA 4OU4A 2VHVA 1AUOA 3ZGNA 4D8XA 2RSLA 3GMTA 1X7ZB 3I04A 1TQHA 3WIUA 3TL6A 3FBWA 1DMSA 3JALA 2W6PA 3OLCX 3TW6A 4RMIA 1ZOLA 4X65B 4LJRA 3U31A 1QIGA 3HKCA 3RVOA 5JEDA 2Z6VA 5AQEA 3NDIA 5KYTA 4LF8B 1K88A 2P6UA 4W5JA 3C70A 3H1PA 4RM3A 4H6WA 3U19A 2OM6A 4UHJA 1V45E 3K0BA 1IG0A 4NYJQ 3EB9A 3NHMA 4PC1A 2CV1A 3P5BA 1P18A 2G17A 3RYTC 3A1UA 1W36C 4F2GA 3NIDB 1PBNA 4IL5A 3INNA 4EEZA 3VC3A 2LXNA 1QPBA 4NENB 3CRQA 5IANA 5KTRA 3LQQA 4E32A 1WXXA 1GZ4A 1RKXA 3A10A 3IUBA 3LCUA 3ODPA 5LOVF 1JLLA 3I9JA 2HYIC 1DWQA 4J3NA 4Z1MA 1NTRA 1KAMA 2CHUA 1E1NA 3FPAA 4UBJA 3O4IA 2WTMA 1G20E 3RYIA 2GFQA 9LDBA 1Z13A 1GTG1 5JBIA 4L50A 2PMBA 3CPEA 3SJBA 2C4VA 3CH7A 4D9KA 3AL2A 5A4KA 1TJ4A 2WTUA 1RYHA 5DLQC 2H8GA 3L8MA 3TTVA 2P4UA 5FYQA 3KUDA 3D7MA 1RLIA 3M5CA 4JQCA 1UC9A 4DLRA 4LXQA 3GDGA 4QFDA 3GDFA 4BASA 1G21E 2HSDA 1GL3A 2WUFA 2JDIA 2YHBA 3LWNA 4RK1A 5EPUA 2XYVA 4HL6A 5GJBA 1TQ4A 3QVKA 1NOIA 4KUGA 5IJAA 1DG9A 1FJHA 4F3NA 2YWCA 1DV2A 1ODSA 4RV4A 1AUQA 1HPLA 1KZ6A 3CLRD 4Q1AA 4X3CA 5IKEA 1HE2A 1RI4A 3H9UA 4FZVA 4Q7QA 3I3SR 3BC1A 2RONA 4CEIA 4AL4A 1X9GA 4LWOA 5ADWA 1TKRA 1EFCA 3ZHXA 4DNXA 1J99A 2P6PA 4QXOA 4BBAA 3HN2A 4BCCA 3I53A 2GBFA 2GZ3A 3IHLA 1KP3A 2H1CA 1N1DA 3IMFA 1ZIDA 4DLYA 3AF4A 4RDIA 1FP7A 1EWRA 2PH5A 1ULSA 1XEXB 121PA 4OU5A 4PRZA 4RVGA 5A1TA 4L8VA 4FHEA 3DAGA 4FN4A 3TS1A 1Y3HA 3GPDG 4B6SA 3QVSA 4FT2A 2HNAA 5DOZA 2SHKA 5EWMB 4BTVA 5BQ3A 2VT7A 2IYRA 1DFGA 1L4YA 3OKPA 2MCFA 3AP2A 1OYWA 4MUMA 3ZCXA 3Q3CA 2XLBA 2IYPA 2YY7A 5K0GA 1MHTA 1UMCA 3OECA 4L6CA 1X8JA 2R84A 4XH9B 4EG8A 3OP4A 1Y6JA 2VZLA 1EFVA 4U4AA 5HKOA 4CR8A 2ISQA 3DTYA 3O47A 3W90A 4B79A 1TZBA 4GGOA 4MIEA 1N32B 2G6TA 3BIXA 2QBYB 5AXAA 3IVMA 1GA4A 4LZOA 3NAGA 4XD2A 1SHTX 3R3YA 1DEAA 1FYDA 3REFA 5BR4A 4YLGA 2V4ZA 4P0QB 4C0SA 4MP6A 3D3KA 4XPIA 3AINA 1E3IA 2NLOA 2R6FA 4E09A 4PN7A 5ED0A 4M37A 4C4RA 4KWCA 4DJDC 3VMMA 1JQAA 1C9NA 4MYCA 2PZAA 2I7CA 3JYLA 1GLGA 3LC0A 1P8JA 1DSSG 4URZR 3X1JA 2QW8A 4C7XA 1XTIA 2OMKA 3EWNA 1U0TA 1FVHA 1ZL0A 3VR4A 1COWD 4P3NA 1N7IA 4U6QA 4UEOA 2ZZKA 4YX9A 3ON5A 5I6DA 3A3NA 5JH7F 3IQEA 1R15A 4LF5B 1PBTA 2H65A 3KQLA 3IJEB 2AJTA 1T13A 4GPAA 4AJHA 3UMBA 5KQGA 1NUSA 1KTVA 2BLNA 2X1HA 4LPSA 2SNIE 4YRNA 1HYQA 1DZIA 3A3PA 3ASZA 1VE7A 4PBRA 3RF7A 1HLDA 3I4CA 2QXUA 3GFTA 3TIFA 3CJQA 3EUAA 3LKDA 2RBKA 3EDRA 3OM9A 4HH1A 3I9LA 1KAEA 2M2IA 4LRSB 1K7WA 2PWZA 2O54A 4K9DA 2PBFA 4ZPJA 1MXHA 3TTSA 4OHZA 1ZVJA 3GFQA 3OZFA 2OSBA 4U5XA 4M7OA 3U3KA 1K8QA 3DZJA 4PZCA 4X85A 3OZTA 3VU3A 4R3WA 4UPEA 5CR9A 1M34B 3OJLA 3JPWA 1S3GA 3NX4A 4OB6A 3Q9LA 1XTTA 1KDTA 5AVSA 2EAUA 3GNLA 3EGIA 1NQXA 2QV0A 3Q7PA 2VDOB 2V0GA 4XM2A 4GU5A 3RDPA 1XTZA 3ELBA 3UBMA 4J29A 4L8FA 5IXSA 3GLIE 1MF7A 4JXKA 3DNFA 3RTEA 1AB5A 1Q21A 2O2GA 3ZK9A 5A03A 3CZPA 3SN6A 1DEOA 3ORHA 4DCTA 3RI3A 2LVBA 4YTEA 2BEJA 4OHYA 4HHEA 4JA0A 2NU8B 3L41A 1DXOA 2BTQA 4UFNA 2AN4A 3OZWA 5AM2A 4PX9A 4R1SA 4MGIR 1M2JA 2CC2A 2PQ2A 5CIYA 1GQOA 2CVPA 2HYDA 3MB8A 1ABEA 1CDZA 1Z6YA 3JX9A 3U7IA 3ZGOA 1O9HA 3ZHYA 4UHDA 1IMOA 1PR9A 1WW2A 2BLLA 1DBSA 4PO9A 1SZPA 621PA 5FV4A 1JHRA 4KGVA 5DBEX 1ZNWA 4AJ4A 1JQ5A 5D3KA 1L4EA 3DZCA 3U3RA 1GFWA 3MTJA 4J94A 1WQ1R 2WU0A 3ZHVA 2VUSA 4UTRA 3M5WA 1QIKA 1WDKA 4HH0A 1AQYA 3NBQA 3OU2A 5AVWA 1N77A 2FZCA 3V7NA 2XT9A 3AI1A 3IUPA 3A6GA 4YRPA 1Z5GA 3KQPA 3D54D 1G5PA 3BDAA 1Y7TA 3TPCA 1JQEA 1HY0A 4ZQBA 2WHPB 4IH4A 1BMTA 1XCGB 3DMDA 2X8WA 2DTXA 3WGQA 2R7MA 3OE7A 3RFFA 4B32A 2BEUB 4GMKA 3V1YA 4EMBA 1REQB 4QQRA 3T5GA 4EX7A 4KSYA 3WIVA 1ZJYA 2NO0A 1XUOA 1GZ3A 2RI6A 3E9YA 3F5MA 4JI6B 1G8YA 3UT5A 1ZPDA 5F9HA 5DDIP 4JU8A 4DWWA 5LFAA 4XASA 2JS7A 4CMKA 3ER6A 3F9RA 1OIVA 3HMQA 3I6BA 1AKYA 3P2OA 1AZTA 1QUFA 4ZO9A 4AS1A 2XBMA 3G1UA 3RSGA 4IUBS 3TR0A 4JC8A 3I2FA 3AF0A 4OQXA 1RT9A 2CDBA 2AYZA 4OFBA 1KPGA 5E2AA 2P30A 3M9LA 2VXOA 1QBGA 3RHZA 2QTVA 3AF1A 4MGHA 4URUR 4DC1A 4D5GA 2FSHA 2DPXA 3CUUA 3RS8A 2J9FB 3D7RA 1ZMTA 3OPXA 4KMOA 4MYSA 1L2TA 3RVNA 2HTFA 4PM4A 3L46A 4II7A 4LYYA 3V34A 4ASUD 1V37A 4W5QA 1JKJA 1KEVA 2KPOA 5ALPA 3MTBA 5KOJA 2FWIA 1UM9B 1RHMA 1XLUA 1UIMA 4P7KA 1BGXT 2Z9CA 3GT4A 2O8VA 4TS3A 3VNQA 4RL4A 1E3JA 3LT1A 4BVGA 4RJTA 2D1YA 2JCGA 3EC1A 1OA1A 3OA0A 3ZDAA 4UZSA 5DGHA 2QZPA 3TZ6A 5I4KA 4ISBA 2BEVB 5DJ5A 4BOYA 1HR0B 1Z36A 3BH0A 4M7RA 3N5KA 4N5LA 5BT9A 5KYYB 1HTWA 3BK7A 2VVTA 4Y1RB 2IU4A 1RZ3A 3JR7A 4WKCA 4MRPA 3S29A 4CEJA 4X94A 2IHTA 2YFKA 4H3VA 5EWLA 4CCYA 4OLAA 3UFXA 1DAOA 4RXUA 1CUAA 4J3JA 4JR1A 2PKEA 1VKNA 3H0CA 1C3OB 3HWX1 4AUNA 4EQ6B 1XCPA 1VLZA 4O4JB 2JKZA 1EJBA 4W5WA 4UCFA 4D44A 1NBMA 5IUNC 1RHRA 2JD0A 4C0JA 4AI6A 2WAAA 1JXMA 2H7VA 1DQNA 4WZAB 5LYYA 4EGCB 4KQFA 1XVVA 5JOQA 1XD9A 1N7HA 2OBLA 1RACA 3FMFA 3P0FA 1ZFNA 2XGGA 1YQTA 2VZEA 2BR4A 4KJXA 5WRFA 2XUHA 5JZMA 1LPBB 5FOVA 1OU4A 2NUTA 3PEFA 4DLVA 5BV8A 2QVXX 5REQA 3WS7A 4BEWA 2PKRA 3WGZA 4PYNA 4YP0A 2ZRAA 3OF5A 3GLFA 1AKEA 3KYDB 4D4JA 1YJ8A 3DKKA 3E1SA 3G9QA 4H1UA 4KN6A 1VOTA 4MS4B 1MB2A 1V6SA 5ENDA 3ZQKA 1MDFA 4BC1A 5FBWB 4RTJA 2QGZA 4LDPA 4MVJH 4X6LA 4WWHA 2GAIA 4FN5A 4XLLA 1PFUA 1QYRA 5K0CA 2FV8A 4N65A 4F3CA 4Y6GB 4I08A 5KDLA 3CNEA 3JQGB 2O0MA 2B1JA 3CI0K 3KALA 6LDHA 2A1UB 3UUFA 4EAQA 1I7DA 5JADA 3SZMA 4KMMA 2RGEA 3NUQA 4JASB 1DUIA 1NQOA 1EZ4A 1A2KC 3D8NA 3F6BX 1EPUA 2OFFA 3WDKA 2I4MA 3KL4A 3GQVA 4B76A 5EINA 3RT1A 3H9JA 5BUZA 3C15C 3D31A 1SH7A 2ET6A 4NQRA 4P54A 1V8BA 4YQZA 4Q7KA 3WGKA 3CLVA 5JS1A 2PCLA 2QN1A 4H7PA 4YN3A 3P9CA 3SVLA 4RHEA 1ISGA 1WPRA 1NBAA 3QEMB 3JQDA 1SD1A 1G60A 3BG5A 4OXXA 3QVLA 3IE1A 2VDUE 4CKEB 1VRCA 4FWBA 3CU5A 4C5AA 5EMMA 1EB8A 3LBHA 1N1GA 4XCQA 1RYNA 3C3XA 4FK8A 2O8DB 3AP3A 3D59A 1EVZA 3QVGB 4G2NA 3V4OA 4DA8A 1SUEA 4KWIA 3VVCA 2JAOA 2F64A 3KDAA 3EVEA 4Y6SA 2Q2NA 4KNVA 5FWYB 1IZ0A 4I4IA 4YAKA 1YZFA 3MGCA 2DULA 2WWYA 3KR1A 1GGFA 1CQJA 1E2KA 2G1PA 4RETA 3VHLB 3MC1A 4DQKA 4DHEA 4ZYLA 1U28A 1YI8A 4R7ZA 1I1OA 3TMYA 4DWJA 4ZCSA 1CRPA 3V1LA 1TYZA 3VMFA 1K98A 1V8PA 2CT8A 1UANA 2XH8A 4XX1A 4X44A 3D3WA 2ZYTX 3MFQA 1GPMA 4CW7A 2P7IA 4RM2A 1RJ9B 3G9XA 4NZPA 1KYQA 1H94A 2RG7A 3ESYA 3Q5GA 4I66A 1EIZA 3OKCA 1G21B 1M0TA 4BGUA 1FU8A 3AKZA 2YCBA 3L8GA 4GBJA 5IYZB 2J9RA 1Z7BA 1TAHA 3QMPA 4F97A 2G0NA 2VRNA 3EGXA 2QW1A 2VJLA 3NALA 1JQDA 3UMYA 5JNWA 1Q0SA 2CHVA 4G5HA 4US1R 1NY6A 3QOFA 2C88A 3EFBA 4PX3A 5HRAA 3AG6A 3DLHA 4APBA 1HYEA 2QTMA 4RE5A 1II0A 5JCJD 5FHRA 4MRNA 3DEJA 4H6VA 3SR3A 3UOGA 3PXGA 1KJNA 1NF8A 2CK3A 2ODPA 2VBCA 3H1EA 3LAWA 2CY0A 4V0SA 4N9WA 2QTLA 2YR0A 1R0RE 3A28A 3GGDA 4NJEA 1OBFO 2C00A 5BQ5A 4CM4A 5G0SA 2R6R1 4FDTA 2YQZA 2FVXA 3DM5A 3UAGA 3VPDA 4D79A 2B1QA 4AJJA 3B6KA 2VYNA 2AVDA 2WWFA 3K9QO 1F14A 2IHKA 1NW5A 1MMFB 2N0SA 3B7WA 3OT1B 4JODA 5FB3A 1PZEA 1BHQ1 1SXJA 1XCBA 3JQ8B 3PNOA 1HRKA 2C0CA 3I01M 1EFLA 1JG6A 3RVMA 3VSDA 3EGWA 3KU1A 4OX9Y 1GGKA 2GESA 2R2AA 3OCWA 2HMVA 3S2YA 4I7EA 5FQNA 1RABA 4RAOA 4ESOA 1IDN1 3EGOA 4QHTA 1PQUA 4TM7A 1UPXA 1SCBA 4TWRA 4M0UA 4DIKA 4DXHA 4A23A 4PYMA 3P0EA 2ZCVA 1RQGA 5TQ0A 1C2TA 4XYEA 3KR0A 2Q1WA 3R8FA 4CMIB 1QHXA 1E1KA 3L8CA 1SXHA 1LBSA 3KOWA 3T7DA 4MJXA 1N8TA 1Q6ZA 3CT6A 3F2VA 4IJMA 4HUQA 4JXJA 4OB8A 3ODGA 5A05A 5DW3A 3V8BA 2HRQA 2BZSA 3W9BA 1WAMA 2BJWA 1U2GA 2IA5A 2QRNA 5H7XA 3TZEA 1HRDA 4O4IA 3UHAA 3USZA 4A0SA 3I6YA 4LBWA 2XBLA 4LYEA 1CDOA 2R8YA 1OFTA 3L0IB 3W4JA 3ETDA 3TQQA 1ESCA 1JSCA 1VE1A 2V9ZA 3ED5A 2WWXA 2JGKA 3LYUA 5A6SB 3UH0A 5ELXA 3JD1A 4Z9BA 3HK2A 2ZYIA 3SVZA 1XJCA 1UKCA 3A2MA 4RY9A 3FVQA 5L95A 1G291 2GASA 4DW8A 2XIQA 2YASA 3EEOA 1QYCA 3OCUA 3CRMA 4UCWA 3T9CA 4YV0A 1A9QA 1UKEA 3AI3A 4MGZR 2HKIA 1R50A 1HYGA 1SCDA 3HCEA 4RACA 1F48A 3JWGA 3CH6A 2K5UA 3WKBA 1LQUA 1QANA 2XYHA 1T3HA 1N4DA 4C0XA 1FMLA 1S89A 1CUWA 3OFSA 1A5TA 2YCLA 3ENWA 3TRJA 2F62A 3GXBA 3NDJA 4Z3OA 2G9ZA 5BUQA 3TQCA 3O94A 4XGKA 1QAMA 1CDDA 2JFFA 3I72A 4D8YA 4ETNA 5D5HA 3FDZA 4WOBA 1CY1A 4BAGA 3EEFA 1FTQA 4YK7A 2GFHA 1NV8A 2A4MA 4B5KA 4E12A 5CB4B 1PS8A 1C1HA 1F38A 4Z9XA 4YP9A 4LIPD 5DN6A 1YVRA 3IEIA 5TT1A 1T91A 3A3KA 1ATIA 1MC4A 1UFKA 3QXGA 3HM9A 1P8AA 3P32A 1G6HA 3NM4A 4K05A 5EE9A 4C7BA 3KFXA 4QBTA 1CJVC 2CJXA 4HO1X 5A4FS 3M7IA 3BSYA 1U7PA 2WV7A 1QS0B 3GBPA 4P2BA 2F67A 2QAGB 2Q5HA 2HDNB 3B6ZA 4WFIA 1FUOA 3GZTB 1F8FA 1QNFA 2O3TA 5E3JA 5I8ZA 2DWUA 2OCKA 3CX3A 2D0DA 4BNIA 1BS2A 5IJWA 3TF5A 2DFKB 4P4SA 1JEDA 1Y82A 2EEZA 4XIYA 2WP8J 4BGIA 2WPNA 5HCNA 4E7OA 5JQGA 3KAKA 1ZCJA 4V2UA 1EG7A 1VLVA 2H7CA 3NAQA 2NXWA 3GZNB 2GYWA 3GGJA 5AKLA 4B2LA 4C3OB 4CN8A 2REQA 4ROTA 1PDVA 3MIIA 2WVGA 5D7NA 1YZHA 3GWGA 3V4PB 4DCSA 5KJCA 1EAYA 1M6YA 2R00A 3K70C 3KU4A 2UKDA 2GXUA 1G8MA 1NUTA 2PUHA 3LBYA 4ZVOA 3GRCA 3QE2A 4UEKA 4AC9A 2GK3A 1AB6A 4PCAA 3VFDA 3NKVA 1VG0B 4HAIA 2QRQA 1D4OA 3QU7A 1T8SA 3A6LA 2ZUTA 4YP6A 3REQB 4AF8A 2ALJA 4GI7A 3RB8A 4HUTA 4P4GA 2JCSA 2ZWVA 1RKVA 2GPJA 2YXNA 2Q6IA 1YGPA 5KU1A 4ZV9A 3AR9A 1FX0B 2UVDA 3C1TA 3OOEA 4YR9A 2CV2A 1U9IA 2PM8A 1QFSA 2XWPA 3BRWA 3DJFA 4TMXA 4QRHA 2QUIA 4YQYA 5SZKB 1J2UA 3CZ5A 1U3TA 5AXDA 1KFJB 3C1AA 1WG8A 1CUUA 1IBCA 1GLVA 1XRMA 1Y9EA 2CW5A 2MOKA 3BD8A 3INYA 1XDBA 5FLEX 4NV0A 4QGAA 4EM6A 5JMPA 5BPHA 1D0VA 3IS3A 1P31A 2AK3A 4OREX 5TV2A 1FRQA 2GRJA 4MUFA 2IOFK 2EJUA 4Z2YA 2QDXA 2HJHA 3EEQA 1XEFA 4JNCA 2PJRA 3MWFA 1T5DX 2OV3A 2OXRA 2P11A 3IQHX 2WIGA 5JIBA 2Z2JA 2A1TS 1QP7A 2PFMA 1E1QD 2P5UA 2YIMA 1OZGA 4F6RB 4YRBA 3S7TA 2ZB4A 4GR9A 4EGAA 1AF7A 4IZHA 5J5CA 5BRAA 1CU1A 5BV0A 1K0FA 2BKXA 1CNFA 3E2MA 4QPPA 5AVYA 4DUZB 3ICQB 2PSDA 2HIHA 3JARB 2FRDA 2Q9UA 2QG4A 1P4AA 3LVBA 1NDHA 3AR3A 4OATA 4BNUA 1U0FA 1XRLA 1XCMA 4GI5A 1JFLA 1SN7A 2BEKA 3RUHA 4BFLA 3D4LA 2C4NA 2NUAB 2CVHA 3MTGA 1CY4A 5IH7A 2AQ8A 3AF3A 4K2AA 5J2UA 5IX8A 1M2VA 3KPJA 3NNSA 3FFBA 2AV6A 3GVXA 3QU9A 3THXB 4GIBA 1OLUB 1A50B 4HDCA 4Y98A 1A3CA 2B7CA 2GZHA 5D01A 4CFSA 1JFVA 1FFXA 2FSUA 1PQ4A 3OESA 4PPYA 5ALTA 3T3HA 1FYVA 5IAOA 4ZQCB 1QHIA 3IAUA 1QGED 3T5AA 1M7GA 1XN1A 4Q4DA 4KIGA 2FJUA 4XQ9A 1QYVA 2WYWA 3EA4A 3PBKA 1Z4PX 3H2BA 5AESA 3IA7A 1SUFA 3O2JA 2K4MA 1JBEA 5DMHA 4ZRDA 1QP4A 4TZ6A 1KJWA 1QE3A 1UZAA 1QHEA 3JZAA 1RSZA 4QQKA 4EO9A 4G23A 4JC4A 2FPIB 2KQUA 3SR0A 5FUMA 1DKNA 1DRVA 4LJ4A 4HDSB 4MEJA 2ZP1A 1ILEA 3FSRA 4W9NA 1IOWA 1DC8A 4QDKA 4YCMA 2W71A 2HW8A 4FDVA 2AMVA 3C3DA 3MUOA 1N33B 3R5SA 5FOQA 2BUCA 3HKDA 2EZ8A 3CW9A 1C9EA 3PC6A 3VI3B 1ZAYA 2PN1A 4P84A 5E4TA 1CUEA 4G4SP 1JR3A 2WF8A 4RIGA 3S2EA 2G28A 1JE0A 3H8JA 2G0TA 2XRMA 4FYPA 4M83A 1SCQA 5E7MA 5JNRA 4YJ3B 3DWEX 3EK2A 4DIUA 4G1MB 2I2XB 3B1FA 4BNMA 1GUDA 2F6RA 3GLGE 2Q7DA 5FFMA 1H8HA 3GZJA 3KWJA 1LD3A 4LOLA 4RHTA 1HSOA 3FF4A 4OK6A 1FP6A 2C4HA 5DTRA 1MX9A 4L95C 4B6EA 3MWDA 4PXAA 5LDGA 3SC2B 4MMYB 1KI4A 1IOZA 3FFAA 3CE6A 3AHFA 3N2LA 3SKVA 1BOOA 1UL1X 1P44A 4CF4A 2HO5A 2ONZA 4XLTA 3WRYC 1TEZA 3BB4A 2QPAA 3UAWA 1E2BA 3A36A 1T8PA 4PPNA 4ZTZB 3OZ7A 4NV1A 1LVUA 1Y6FA 4UKDA 1U8FO 4R8MA 1RLMA 4GX5A 1UJ2A 2ARKA 4UAGA 3HA2A 4LJ8A 2VDWA 1SVIA 4KACA 3GW8A 4UU0A 1O95D 1SGWA 4O6VA 4YONB 5DGTA 3THYA 2F3QA 4BLQA 3LO8A 4JD5A 4V1CI 2INGX 3EFOA 3OJOA 2PU5A 3O8NA 5F77A 3Q7RA 2PUGA 3RFCA 2A67A 1Q95A 4X91A 5AJVB 2H9YA 3D4OA 4N7JA 2OXFA 1RCTE 1IATA 2UVQA 2JH8A 2Y77A 1Y1RA 5ALVA 2PO7A 5BN4A 4YH1A 4I4TB 1NXOA 4R0NA 1IN1A 1A4RA 1N9GB 2BM0A 3KR2A 4U02A 4BNXA 1WSBA 4CF5A 3KVRA 2EG5A 2ZKIA 4IIVA 1RBZA 4R81A 4RLQA 4HGZA 4ARAA 3A6ZA 4JQZA 3NHWA 3D8SA 3U9TA 1UK7A 4TLEA 2JAXA 5A3QA 4HGNA 3B13B 1FP4B 1MORA 1D5WA 4JKOA 3K7EA 4MW4A 4JU9A 5TPWA 16PKA 1ZISA 1R6TA 2PKQP 1UP7A 2QLLA 3SCZA 5HRCA 3FA2A 2EBWA 1XNRB 4KO8A 1HORA 5TQ2B 4NYIQ 2REXB 4R9VA 3A9SA 1N36B 4QJ3A 5JYDA 5LYJF 1MEEA 3MQ2A 1EM8B 1YZ3A 4GXTA 4B81A 1U1IA 4HPXB 5BMVB 5L3QB 3CSUA 2E9SA 3OQNA 1VSVA 3M1IA 1MC5A 4YMSA 2QKYA 3VR2A 2Q5IA 4XFKA 3A25A 3WBJA 1DTWA 4C0AC 1TTQB 3C8HA 5CLJA 4ALJA 5BYKA 4V1CA 4PF1A 1ECGA 1PD1A 2XF8A 1TT5A 2CLMB 2P2LA 3EW9A 3N59A 4PPFA 3V7FA 5B6JA 5JXWA 1WBJB 3DQQA 5KYWA 2ZUCA 3HGTA 4CQLB 3BXHA 1AMNA 3NEAA 2OK7A 4FFLA 2A0XA 2GK6A 1F8UA 3QBJA 1OE0A 4B35A 3BJMA 2EJVA 1IUNA 1M6WA 1X74A 1JE1A 1SU7A 2J7PA 2W6MA 3DOCA 3H11B 4WDQA 4DLLA 5BY2A 2PRSA 3A6JA 2ZW9A 3M6LA 4IO0A 1C1DB 1VE3A 3DC7A 3H84A 4MPRA 3WDSA 3PUIA 4DQUA 3QM1A 3KDPA 2ATCA 3IUQA 3AWIA 5LA6F 5AM0A 2RGNC 3QX8A 4ZVSA 3IP6A 4PVCA 1T9GR 2ATIA 3LZDA 3JWIA 1M1NB 3BCHA 1E2PA 1QBKC 4LFAB 2O2CA 3H1GA 1P1CA 1VDZA 1W7AA 4NNJA 1MRSA 4JUBA 3E3OA 4FYYA 1T29A 2HXSA 5AHWA 2VWQA 2ZSDA 3CVVA 1SQ5A 4J1NA 3PV0A 1PLJA 1WHTA 2ZT7A 1TMGE 4Q4JB 1GGEA 5JTTA 1UBMS 1H9AA 4Y9UA 3I6ZA 3PIRA 3RARA 4HQNA 5J4LA 2HVGA 1N6PA 4NX2A 1E3LA 1WDTA 1Q1AA 5GGYA 1FY2A 3H3JA 3NR2A 3PFFA 5B4UA 4BFZA 4L8LA 1NP7A 3LSYA 2A5GA 6ADHA 4A03A 2WJJA 3ZIAA 3ZBPA 5CA1F 2W6CX 5DNDA 3SYLA 1FDOA 3QNWA 1GRCA 5JPDA 1LU9A 1K06A 3C8DA 1W0JA 4ARZA 4OVKA 5FOUA 4FKMA 2WJ4A 3F46A 1H1DA 3QG5A 4NCBA 1XN4A 1UBFA 4B0PA 1R5NA 3BZWA 3BX1A 3QFRA 3F90A 1Z5ZA 3IJ5A 3JQPA 1EX1A 4OAPA 5H02A 3WKDA 4FW8A 2NUBA 5EUCA 3ZH9B 1A9OA 1R9GA 2H0AA 2ZI9A 1YU9A 1PDOA 1N2ZA 1LC0A 2YC4C 2YJ3A 1LI7A 4M9SA 2LWIA 2EGUA 1INLA 3QVMA 2W43A 3TXXA 1G38A 1K2WA 2WOOA 3GP5A 2FGKA 3IPCA 4NBLA 3KCQA 5DTIA 5GONF 5MN4A 2ZULA 4RVCA 1U7DA 1KI8A 3UG7A 4I50B 4ZCIA 3GEBA 2FN4A 2VOEA 9LDTA 2QM7A 1Y9ZA 3FWHA 1H69A 1XO1A 4MQUA 2X6TA 4RIHA 4X7MA 4NH0A 5LJIA 2IWRA 1Z5WA 1T1EA 4QA9A 4WXYB 4CV1A 4NE9A 3UPTA 2AOTA 2AFIE 1IHXA 3K8QA 3VC7A 4X00A 2E4WA 3F6RA 1I5EA 1SHUX 2DOKA 3DT6A 2I91A 4K6OA 1WWKA 2PVPA 4GI3A 4RFSA 5C4GB 2P68A 1NNUA 3BHGA 5SZHB 1SCUB 3G8CA 3LG2A 4GAEA 1KE2A 3WWCA 2HLPA 2QLFA 1MT3A 4HNAA 2X7JA 3IQFA 1PS0A 4M1QA 4Y0VA 5K3FA 4AJLA 2NPOA 4KE9A 1EEXB 2H2WA 2J3DA 1U8UA 3GN2A 4FLFA 5CT9A 3SYKA 1A8QA 1M3SA 2QX8A 2XUIA 3RYCA 1VCHA 3EXFB 6ABPA 3P52A 1DFHA 1C4WA 1OVGA 1GV0A 2ZJ0A 5CUQA 1QX3A 3FPCA 2NN3C 4KX3A 4LN1A 4OXRA 1Y6GA 3B89A 3GAAA 1U94A 5EA2A 2IUSA 3OZRA 4ZEMA 3ZXSA 5DYTA 1G9TA 4AECA 3CCBA 4NWIA 1JHOA 3T9BA 3WJAA 3LA6A 1W75A 2P65A 1NVWQ 2X14A 4MAMA 3IAAA 5FL7D 1GGHA 1T6ZA 4O4HF 1SUAA 1O97D 1GVHA 3GB9A 2OG1A 4R6XA 1WY7A 4MTCA 3A0UA 3BWDD 3I73A 3NEJA 3OETA 1H0KA 2QTGA 3RS7A 3PEEA 4OBEA 1LA2A 4BX9A 3L40A 4Z9FA 4Z7JA 5KYXB 3MQ4A 4GXRA 3ELDA 3E9NA 3ZCQA 5ILQA 4WEOA 5FPYA 3IB6A 2V45A 4XB1A 2WWWA 1T8TA 2EDCA 2ZTLA 3PHBE 3QBEA 2FMIA 3OOJA 1D9XA 1CUVA 5ED4A 1B8PA 4IDAA 1E3WA 3H5LA 4JOBA 1KZ7B 2XUQA 2WF6A 2DT5A 1KA9H 1NMQA 2XITA 4K40A 4LBZA 4ND8A 3M34A 5CDYA 1VTKA 4GC9A 1TLLA 2C3MA 2NO5A 4ZQFA 4IDPA 1GYPA 1TD1A 4QFCA 1A7AA 3RSOA 3GLTA 5LUAA 3R9XB 2WG1A 2YUTA 2HZBA 1KO7A 2OP1A 4UM8B 1MEJA 2QRMA 4DNFA 2J32A 3RFVA 3WL6A 3K6SB 4N5HX 2WTBA 2R6JA 2PL1A 1LV7A 4IHJB 1JXOA 3RFXA 3UG6A 2D62A 2QE7A 2RKBA 3D0RA 3D4NA 1IY1A 3E9DA 5E0OA 3VZBA 5J2TA 1XU4A 3GMSA 4N82A 1RTKA 3PXDA 1BS1A 1D2EA 4JFAA 4M0LA 4PPGA 2C97A 5F98A 5I9SA 5CD9A 3EZXA 4I19A 1PJTA 2H85A 5I9NA 4I9UA 3CH4B 1D04A 2GF0A 1PEKE 1M54A 1W6RA 2OZKA 2WYOA 4HN2A 4WV3A 4FMPA 2Z1NA 4IKPA 3TAHA 4ABTA 5FOTA 2OB2A 4Z1MD 4ES6A 3KKNA 4R2MA 3EVCA 4BQEA 1ZM9A 1J8MF 1PKEA 3EBOA 3HADA 3UUEA 1CRWG 1FFAA 1MD9A 1X7XA 1DAEA 4OGFA 4EY4A 5JT1A 3WGTA 1PLLA 3I09A 4LV5B 4F7DA 2VSXA 2R6DA 4Q7EA 4R1QA 1YA4A 3K0SA 1U0EA 3OT5A 3OIWA 3VOTA 1C0IA 4FX5A 4JJ8A 1FURA 1JB9A 4FFBB 4MITA 2V6FA 4ER6A 4GICA 5DBOA 3B2QA 2ANBA 2J6HA 3F47A 3LYHA 4JUAA 2ECOA 4CIBA 3U6BA 4ZOEA 3NHYA 4DR2B 5C8ZA 4GBED 2JDID 2PX2A 2GXSA 4JVMA 2PU7A 2VPQA 1HFWA 1NBOA 4ICIA 3D9QX 5A4DA 4EUEA 2C5LA 2O7VA 3MTIA 1XXHA 4GC5A 2Y1FA 1E66A 1EFKA 2JHGA 2F4VB 3OIDA 2QQ0A 4IZOA 3MJ4A 4F56A 3I5XA 4UUOA 2YHAA 1KFEB 4G0NA 3ZQJA 1R8SA 1UT8A 2A7QA 1ZZGA 4HG2A 5HZHA 1RZVA 4AXBA 2AF3C 3LT2A 4RY0A 4IVRA 1FDSA 3RPEA 5DCYA 1V5EA 2DFTA 1XROA 2R1VB 4ZC8A 1RRVA 3GLGB 4K9SA 2BEWB 5CH3A 2O07A 1WVMA 3KZXA 3TLKA 3F4SA 2MINA 4EYQA 4DPKA 3SFTA 1UAYA 4K3UA 3P94A 4CR7A 4N0EA 2AEEA 3AR5A 3G9ZA 2FK8A 3EARA 5ER6A 1QGUB 4FD2A 4IY1A 3E0QA 1NVVR 2C0QA 1DAKA 4V0NA 3VU0A 5IM4F 4KK4A 3PLNA 4ND1A 1JXQA 4R1LA 3NBMA 4YAJA 3LPCA 2OZVA 4LXIA 1TZCA 1UPTA 2FNAA 5HEKA 3G5AA 3MMXA 3V55A 1LSOA 3TK1A 3NWOA 6REQB 3ONEA 5A06A 5KIAA 1KI1A 4JP3A 4M8KA 2H08A 2IYAA 4KQ1A 2PV0A 3ONNA 3HKBA 3L9XA 4LC1A 4EGFA 2NACA 5HDBB 1KZ9A 1M2FA 1UXHA 3LDFA 4F85A 3GCGA 1FYWA 3OEEA 2BE7A 1TGYA 2HBQA 1RFGE 1UKYA 2E87A 1U02A 5EIBC 5EKUA 2OORA 5HTOA 4Z4QA 1F3OA 1G3MA 3GA7A 1XP5A 4A3SA 1BN7A 1C3EA 2VDMB 3RKSA 4XGNA 5JCXA 1MZPA 1LWOA 1DX6A 4KWHA 5LPNA 1TU0A 3JATA 1NR5A 2OCLA 3IVGA 1EK1A 3M4YA 3PPYA 3VR4D 1U7WA 1GA6A 2CDNA 4QXAA 4C0HA 4J1TA 4UTVA 5LSAA 2DQ4A 4XQCA 3KLBA 5T41A 4IMJB 2OHVA 1JHZA 1BDHA 2RGGA 3OPNA 3PNBA 2GVDC 2CUTA 3DMHA 5FUXA 1XPJA 5DLYA 2AL7A 2XDYA 3TUJC 2ZDQA 1VJCA 5BN3A 1FRFS 1CF2O 2O3JA 1LSUA 2OD9A 4HCJA 4M8SA 5A2QA 7AT1A 3COJA 2Q3LA 4P36A 3EUEA 2IOHA 2ZYGA 4WGFA 1GAWA 1OHHA 5AKKA 4CEHB 2YYAA 4CKYA 1V25A 1YQGA 3HKEA 5F7ZA 3BIWA 4WNCA 3DCYA 5AWFC 1GSIA 1N5IA 2RJOA 2Q7OE 4MA5A 3VM6A 1VYHA 3I0NA 2XA2A 2ODNA 5KX5A 1UBSB 5H3CA 4CF6A 3T61A 3EVBA 3KWFA 2XB8A 3HB0A 2ZCUA 5BNIA 2BRUA 1RC0A 2CYBA 2ZBVA 4NBKA 1JRLA 3I39X 1T3LA 2NZ2A 3C41J 5DXJA 5F78A 1N2CA 5DRYA 4CL8A 5TMPA 1ESNA 1JWBB 3D7NA 4AY4A 3AW8A 4G84A 2O8FA 2I62A 3VKHA 5SICE 3DVLA 3FVRA 1ZMBA 4OKSA 1LW6E 4PCVA 1AHNA 3A9CA 1DADA 1N3LA 1S9DA 1OWLA 2Y1GA 3LT0A 4PY2A 1GNSA 2QZ4A 8ADHA 4A92A 4DV6B 3IAFA 3W6PA 2DHCA 2GSDA 2ZLBA 1MH1A 2C9ZA 3D3QA 3W6OA 4C1NA 5A5EA 1WDLA 3ZKWB 2AC4A 6PFKA 4LDAA 4FNMA 5KTYA 4GNRA 5T4FA 5YASA 3D6FA 3WL3A 1IQPA 4Y6OA 5H1YA 3H19A 4C6TB 3HRHA 4BPRA 3EEBA 4LA4A 3GA5A 2I34A 1L4BA 2DPLA 4IKEA 3K09A 4LXHA 4Q9AA 4FHGA 4FWIB 2OBYA 4N40A 1WEKA 3TAXA 4YJ2B 4DUPA 1P9WA 3K1ZA 1H2HA 1NC1A 3EA0A 1M10A 3ONWA 4G1VA 3KPYA 1LF5A 4OP1A 4QDZA 3WMRA 2F8SA 4NE2A 1HDEA 4ZZ1A 1GD1O 2FQ1A 1FS6A 1SC3A 2QAJA 3OF2A 2HL6A 1YRQA 1NN0A 1PCXA 3IBCA 3MRSA 4P2GA 4ZO8A 1AF4A 1THGA 1NN3A 3T6KA 4B4UA 3PEWA 2XE8A 1K7SN 3GMIA 1WMAA 2RAUA 3WKCA 5SZJA 4OLBA 1RPNA 5AJUA 2Q3FA 3T99A 1YE8A 1ZNZA 3W2FA 2GCOB 3PDCA 4IDEA 3ZIDA 2CZCA 4J0IA 4KZPA 5B3JC 2ZBUA 3IQWA 3LC7O 2WU4A 3H5TA 4CKBA 4K0KB 1YC2A 2EKZA 2D8AA 2Q4RA 4KFUA 1Z34A 3Q85A 4HB2A 4BGEA 1MQ9A 1P60A 3H97A 1P9OA 1V2GA 3O03A 3FOWA 3O4FA 4WLOA 5AKGA 1MW9X 2C9CA 2ONYA 4UHKA 4ABYA 3CZMA 3T1YB 2CL6X 3BHJA 1H5UA 5IP5A 3RU3A 5TXGA 1BH6A 1BKSB 1K9SA 1MC1A 1Q7BA 1YKSA 2DMRA 3EVTA 3C5VA 3HWWA 4I14A 4EI8A 2ZSBA 3GZ4A 4KV9A 4DABA 2B0CA 4TXHA 1U63A 3QYAA 1CQWA 1SBQA 4OP3A 1FNBA 2JJ8A 4DBLC 2O8CA 4D26A 4ZI5A 5BSRA 4V03A 4BQQA 3IELA 4ALIA 2BCGY 4J9UE 5JD3A 4FJ2A 4D56A 2ODEA 4QE3A 1KMIY 2ZI4A 1ESZA 3TIVA 4HMOA 3P4YA 2SECE 5AVXA 4OA5A 1A7KA 1NU6A 1SZCA 3MLEA 3RIYA 3S7ZA 3SDBA 1T3SA 4XUGB 3R8XA 3NIFB 4L9AA 4XWOA 2GZSA 3VO1A 1PVOA 3F98A 4TT3A 2BGKA 2MYNA 1A2BA 2P78A 1TM7E 2AN1A 3RKUA 1R4NA 5PNTA 4YMGA 1HT0A 2PUCA 1JIJA 4U3JA 1V6AA 1WMFA 2D4HA 3UAXA 1JIQA 2DBYA 4GWLA 4TV8A 2IDMA 1ZHHA 4NE7A 5BURA 5IAJA 4D0GA 1MQSA 2OGWA 3AKDA 1SO8A 3Q7EA 4D97A 4F91B 4M0CA 1W85A 1KEKA 1Y7PA 2QMEA 3T0IA 3K30A 1J70A 1FDVA 4M3NA 1LSSA 4CMBA 4OD0A 4HQKA 4JT9A 1GZVA 3UKDA 1KR2A 1W9MA 3JALB 4WLUA 5K8TA 1SD2A 2JIQA 5JSKA 3UWKA 2BELA 3DB2A 1ZGAA 5H3HA 3BB3A 1QZUA 2K6GA 2O8NA 3LDHA 4RA9A 3UB4A 3R20A 3GY0A 2XZLA 5KVVA 4RX1A 3X2FA 2QUKA 4LF7B 5AO9A 1T2AA 1V8OA 4Z4HA 2DYKA 2HA7A 4ZJUA 4BQOA 4G4GA 3MOGA 1LZKA 4I5GA 2I1WA 2X4IA 3KYCB 2PAAA 3BQNB 6YASA 4A2WA 1T0JB 4URWR 5EGNA 2O3RA 2AUMA 1MVLA 3E15A 1OLXA 5D3ZA 2UAGA 5B4TA 2VK4A 3DMNA 3QV1A 5EMHA 3RKRA 5EJ7A 2PUVA 3CJTA 1FLVA 4HFRA 2FN9A 1D2CA 2X2EA 4YV7A 4ZJZA 5AXBA 1OTHA 1P4JA 4YAGA 1X3SA 1GITA 4RVDA 1JLLB 3ORYA 3R5TA 5HYVA 2GCNA 3OCVA 3IMGA 2FW1A 3K20A 2H1WA 5EIAA 1E59A 4TVKA 3MYYA 4XWTA 4ZVQA 3U3MA 4FOLA 1SWVA 2VTBA 2XMRA 3LF1A 5BQXA 2Y3IA 1HL3A 2H7YA 4KXLA 5FP0A 4S05A 1B00A 1E77A 2BFFA 2HA0A 1YGYA 2FZEA 3FCYA 3GAZA 4WTOA 4HSEA 2B78A 4Q34A 4FCTA 4B3BA 2PQMA 4OQFA 3I37X 3VHQA 1W0KA 1XK7A 1XELA 3K9GA 4PWYA 4X3OA 1PL7A 2VHXA 4WDRA 4Q16A 3NLLA 5DM60 2X15A 3H5IA 3JVDA 2JI9A 1V5IA 1IJEA 2C58A 1TA9A 4OQLA 2O1XA 2FPPA 2CBGA 4EW3A 1AKMA 4XSVA 3COZA 5JALA 1YUNA 3T94A 5ETJA 1GCIA 4UHCA 3WLOA 3ZTYA 1Z4OA 4GKKB 3AR8A 5K2MA 2DM6A 2GHRA 1OI4A 4C6HA 3GFPA 1H6BA 4X1OA 5CLHA 3TDKA 1JA9A 1I8TA 2JFUA 3ZTTA 1LBIA 3NHBA 2H59A 4MGKR 3U80A 2JEYA 3K0CA 4I99A 1XXLA 1FJGB 1MH9A 1L1RA 3T9EA 5KAMA 1VPDA 2NXEA 4PZEA 2P9ZA 4REMA 3FGZA 5CLQA 4RVUA 4YAWA 2IJGX 5E4YA 1BVYF 4B71A 1U0OC 2QXYA 1NJSA 4JI7B 1JILA 1NUPA 2C1EA 4L15A 2C3UA 3VKGA 3GJ7A 4FGUA 4FYXA 2AI3A 2ZAOA 4WJZA 3SBEA 1TU3A 2OXCA 3OOWA 3STWA 2PJDA 3ZNQA 2VH2A 4YV2A 3O74A 2G6BA 2G5GX 4XR9A 2Z30A 2Z0MA 1KIFA 5NULA 4GT1A 2YN0A 2HMYB 4N0PA 4A36A 3U60B 1ZGGA 4N0QA 5KCZA 1TO6A 2FP3A 2O57A 3JQCA 3KKZA 5L4LA 1GPUA 4A91A 4NFHA 3VH1A 4PO8A 4EOGA 5DRTA 4YUXA 1G16A 3PRJA 4OSEA 4OGLA 3IV9A 2WVAA 2QYTA 2VYQA 2YMMA 3TRDA 2CK3D 2P0AA 1W5TA 2D5CA 4CIVA 1Z22A 2QLNA 2Y2VA 4FNOA 5IWAB 1Z33A 1VMDA 4IAOA 3H4VA 3G0BA 3SAJA 2CNBA 2C3OA 5AVUA 2VYND 1ISMA 2H4XA 3V7UA 1VP9A 1XPUA 1T4BA 4Y8VA 2GZ1A 2XTNA 1D2GA 2Y99A 3L43A 3FCOA 1SXJD 3MXTA 4Y9DA 3GHYA 4IFEA 4E5MA 1RBQA 4DA9A 1KHTA 4WLNA 5E1BA 1PO7A 1R5JA 2PVCA 4YCBA 2Q3CA 3ED1A 3OWHA 2XSZA 1VMKA 4Z2AA 1ABBA 4QTXA 3KL2A 4TLMB 1ZZEA 3ZUGA 3K96A 3KD3A 3JSAA 3MWGA 3CG0A 3O7MA 1U8EA 5CGZA 1IWPB 4E1BA 1A96A 2UUPA 1QYDA 2WHRA 4QGBA 5HZMA 2JJQA 2WSIA 4JLDA 4WESB 2AJBA 1ZI6A 2J31A 3EY9A 3OHMA 4INPA 4MPJA 2GCPA 5JVDB 1UFQA 1Q2XA 3G68A 5ECWA 3QPCA 4L3OA 4V3BA 4ZT7A 3N0TA 3RD5A 3CUWA 3NMUF 1E5TA 4RE6A 3T5DA 1AS3A 2A9OA 3K73O 5JYBA 3R7DA 4GVLA 1WV0A 2VN8A 4E70A 5KVQA 1QB7A 2HFKA 2JLAA 2ZR9A 4NBNA 4V39A 2ZE7A 4XQ0A 3WV4A 1T5IA 1A98A 2C7BA 1YDGA 3DV2A 1RLJA 3P7MA 4H6XA 4O8CA 4OXNA 3FNFA 4JQSA 2HWXA 4ZODA 1M8PA 1ZM2A 3WXBA 2GN8A 5ILGA 1FIUA 1QOQB 1SB9A 1N5DA 3FPLA 3UWPA 2W90A 3QUAA 3VPXA 1OXTA 5KNDD 4QGGA 3NFRA 1DAPA 4IMIB 3ST7A 5BSKA 1YBVA 4NFSA 2H1SA 5J58A 2YKGA 5JJKA 5DCWA 2GZ2A 5GIPE 4WCFB 2QOEA 5IZCC 1ZVKA 4EENA 4BVKA 4I5FA 4YJGB 4KGXA 2O5EA 2VRCA 2CLOB 4G0UA 1X1TA 3SSOA 2A94A 3P9NA 2XODA 4CVNA 1U5AA 3WTCA 5LKRA 1L7VC 4B3MB 3P26A 1EK0A 2NT3A 4ZYTA 5IT9A 1NZJA 1M2WA 1EXWA 2AUTA 1Z9BA 2EL9A 3OPYI 4GOOD 4XAQA 2PUBA 4I55B 2GO1A 3K9WA 2P8SA 3UY4A 2W2KA 2ZE6A 1T2UA 3PC4A 2GM3A 1BXGB 2W2MA 2BTQB 2IYUA 3C3JA 3PDUA 3W9UA 2CL0X 3QX3A 2A5LA 2R2GA 3V9AA 1MGOA 4H0FA 2DETA 3CCCA 1TYCA 4L16A 4YPOA 5DN6D 3VOAA 4F4HA 4D9FA 3TW4A 1FU4A 4IICA 1QMGA 4Z3KA 3H13A 4B8WA 3AIMA 4CF7A 4DY6A 4H3SA 1Z8DA 5B58C 3IO3A 1VM6A 4DA0A 2V7VA 3AR4A 3HL0A 3QHQA 4XX0A 5FUYA 4REQB 1UINA 4RA6A 2ZRPA 4KSBA 4G5XA 1DI0A 1DQPA 3ZXYA 2XCSB 2ZWAA 1PR4A 1USUA 4YMLA 1WHSA 2E7ZA 3AB7A 2WICA 2XOKD 2ZAIA 1DTSA 4RMHA 3X43A 5HQ3A 2CWWA 4TLAA 4FTWA 3KRTA 3ZGVA 5AW4A 3TG8A 4OBBA 5JFTA 4HDNA 1E1CB 3DP9A 1IWBB 4NFLA 2XPCA 1BFDA 2A9KA 1OREA 1QORA 1R6XA 1X0VA 2DT8A 2EKQA 2ZVJA 3DBRA 2EJTA 3IT1A 3GHHA 4MVJG 4D8VA 1TCUA 1SKYB 5ALZA 5G3YA 4C4TA 2C77A 3WGYA 2HHAA 4WVFA 1Y8AA 3WAGA 1UMBA 4RLFA 1FQWA 1RJGA 4JDPA 2G76A 5EXSA 2PSFA 4D98A 3CNLA 4L57A 1HEYA 3OPYA 4R16A 5LU9A 2YYSA 3HCBA 3WA6A 3H5AA 5H0IA 1O9BA 4AJIA 2CNLA 2ZPAA 1SD5A 3IAHA 4O2AF 1T9GS 2HHCA 3DEHA 2NQ2C 3I05A 5CX1A 4GZLA 3ZD8A 2R9VA 2O9JA 4NCJA 2RJ3A 1R6AA 2V7XA 4B46A 4WZ6A 2OSVA 2AK2A 5JD4A 3KFVA 1FMCA 2DAPA 2QJTA 1RKQA 3BRWD 3U13A 1H22A 1HL7A 1MO6A 1QLHA 3BXZA 2BBSA 4HMQA 3WFZA 3PFBA 4DQLA 3WMFA 2K2QB 3CZRA 2EQ5A 5GJCA 1UFVA 1NUHA 1UOQA 3G2QA 3CLUC 2WNSA 2XMPA 1X1RA 4LRXA 1YQUA 4Q00A 2XVZA 5B58T 5C8YA 3TLYA 3DE7X 3ZLUA 8OHMA 4DCNA 1POWA 3W8FA 2IP1A 5K20A 4G86A 2VKTA 1AGNA 4R9RA 4R9NA 2QRLA 2CLCX 4CM8A 2W0MA 4MWZA 1UP6A 3F8TA 1TO1E 1JJAA 3BL5A 3DBVO 2V4MA 2VQSA 3B38A 4XUCA 3DXXA 4CDGA 2YW2A 1I0IA 1PJ3A 2IF2A 1GWNA 1XZJA 1JDZA 1GRQA 1CUYA 3JSXA 5LQRA 4G9GA 4QXPA 4TS9A 4TMTA 1KARA 1V5WA 4Y1GA 3GX1A 5JWOA 3THWB 4CEJB 2EW1A 2JFHA 4LDNA 3MJTA 4H0NA 4MCIA 5TQJA 3UFXB 5LOVA 4V0OA 1BFUA 1RHUA 2R7KA 5DYWA 3GPLA 3LY8A 3HLKA 2PSSA 1SC1A 2P40A 1TKAA 1IM5A 2QS9A 4UU1A 3BGWA 4NJOA 1DKUA 3ZLVA 2Y0DA 1MO5A 2RHJA 3U4IA 5JSZB 2VPPA 2B7BA 2JFYA 3MS2A 4B3XA 3G2MA 3RH0A 1NVGA 3MUFA 1W4ZA 4B6QA 5JDIA 1QCYA 1KO8A 1VI5A 1Q57A 1FLDA 2OGSA 1ZN2A 1IK4A 2Q2OA 3TLJA 3HJGA 5KJEA 4ADMA 4PQYA 1ZCZA 1WL8A 1QRRA 3V2IA 3QEBZ 4PIPA 4UUMA 1YK1A 4QBKA 2WPDA 2ORED 4YRGA 1JHUA 2IHYA 5DM0A 4EPTA 4FKZA 4OXIA 4DLTA 4GDMA 1AURA 1ADBA 1WUTA 4P3PA 3U4AA 2ZTSA 3VDMA 4LY0A 4OHXA 3IEXA 3EPRA 3GCDA 3N70A 1A1SA 1VJ1A 1IQ0A 4AP6A 5IBQA 2CLKB 4DDVA 3I5YA 4QKQA 3MT8A 2JFXA 1JHQA 2Z83A 2IV7A 2A0WA 2HGSA 3QYPA 2IHJA 2QZSA 4L08A 4MB6A 1HLGA 5B2FA 1GQRA 1JR3D 1GYRA 4L5IA 5LWHA 5KNLA 3K0AB 3W5IA 4RTSA 2IC5A 3P0JA 4FOOA 4CG2A 4QYIB 3KQNA 1ZHFA 4G0ZA 2OAGA 4LXYA 1WVIA 4PNPA 3SMQA 2IX3A 3WJ7A 4Z4EA 1QDLB 1R0LA 1P5RA 3GOQA 1LBQA 3K0KA 3OD1A 1N6OA 2C5SA 4H60A 4IV5A 5ESWA 4XRGA 1L1FA 4B7UA 1H8HD 1V41E 1UOOA 4KQEA 5EZYA 4IOKA 4UNPA 2EX1A 2GX6A 4I0WB 5J63A 5CYOA 5LMZA 3C45A 4A1FA 5MDHA 3B1YA 1XEAA 4BQSA 1IBLB 5MFZA 1QO9A 4UBNA 4M21A 5EHZA 3HZZA 4X41A 3NDRA 2J3LA 4K1LA 3JW8A 2FWRA 5DOVA 3UQYS 2Q29A 5H68A 4F8JA 4ZV4A 1WSAA 3BMNB 4YVFA 3RRNA 4NCXA 3RSFA 1Y3CE 2RGUA 3B70A 3D4PA 1QHYA 4WI1A 1BN6A 3DL4A 4JV5B 2IELA 3IDAA 4N4AA 3RLFA 3DTNA 3X1ZA 3GRYA 1GQ2A 3EVGA 4RH0A 4S1PA 2NXCA 2BKEA 5I3CA 4W1RA 2J9YB 2Q2QA 2ZROA 5KSOA 4RNDB 3WGVA 1KF0A 1ZXLA 2YJ4A 4OHWA 3ABOB 4CLDA 1OPXA 1BYUA 2Z8ZA 3ZZMA 2XB4A 2PT5A 4URHA 3WLSA 4DY4A 4OHUA 3T1TA 4UUAA 1X7WB 4G0PA 3HSSA 3R7FA 4U2CA 3VDRA 2GVZC 1K6MA 1BKYA 1WVGA 2AOUA 3ISVA 4I2NA 1JPJA 1PTJC 1VMIA 4WT7A 4XYBA 4YEDA 3ZYZA 1KMHA 2FW6A 3LLUA 2PG3A 5L45A 1PJ2A 1CUGA 4MR8B 2FMKA 4DV2B 1TADA 1XLTA 3HZHA 5KUTA 1L3CA 3MPUA 4KRFA 3AY0A 3JVEA 4DPMA 3ZVKA 2Y67A 3AUUA 3R6QA 5LXTB 1QQTA 4W63A 3ITNA 4MTLA 1USIA 3N9IA 3QA9A 4UE2A 2Q62A 3A1WA 3EOZA 1WULS 2VNAA 3K15A 3O2QB 4AG5A 1JAHA 1LBEA 2IYQA 4Q82A 3FGNA 2G5CA 2IYLD 1I10A 4FGKA 4O63O 1AQJA 1UEIA 3HUEA 1PT8A 4JBNA 1KEEB 3G8YA 3D8RA 3LUKA 1VE5A 2WJWA 4IDOA 1EYZA 1JJFA 1Z6XA 3BULA 4HWOA 4M36A 4IDBA 3ILSA 2ZRGA 1Q20A 3DUWA 3OICA 2FFBA 3PCRB 3QZUA 2A5DA 3FGPA 3K1AB 4RENA 2DBVO 3GT7A 5CYFA 521PA 1T0IA 2ZJ3A 4FCWA 4MUBA 4AKIA 1KWGA 2J7PD 5LMUB 4LRQA 3C7DB 3GTDA 1M1YA 5DPMA 1Z0AA 1GQSA 2WZQA 4RD1A 3TMAA 3W4KA 2XADA 1N2EA 4TKUA 4WY2A 3VU8A 4QVIA 1DFIA 1QH8A 3OLXA 3MQFA 4RD3A 2WHEA 3VVMA 4KR9A 4MQ5A 3FW1A 2BHNA 5E6RA 2EKLA 5C2JB 4BZPA 4YT8A 1IBSA 1RRFA 3PUZA 3GQBB 2HCBA 3E70C 4XUEA 1J0XO 1NW7A 2C96A 1QDEA 5LB2A 4ZVPA 5HUQA 1VSQA 4RLHA 3FMGA 5IZ4A 3IEUA 3WP1B 2I6GA 1HKHA 3B3QA 3O8OA 4GPTA 5JJIA 4JLBA 4G67A 2JFWA 4BNGA 1J9GA 5EIEA 2XJ9A 1NG9A 1UBUS 3IAM1 1GY8A 1P7VA 2WNHA 1QH1B 2ODAA 1EXMA 1E3QA 3LS2A 3OQJA 1CBUA 2I66A 2NTJA 1E98A 1LH0A 2VIIA 2ZR0A 2FJ0A 5FNVF 1BDBA 5K0SA 4FGWA 3GYBA 1L7EA 3ZIAD 4B2YA 4QLBA 4U0JA 2VKQA 4QG7A 1SY7A 3DR5A 4BNLA 3AEXA 5JRJA 3ONFA 3QX7A 1SA0A 2Q6LA 3FR7A 4DJFC 1CB0A 4Q4LA 1X92A 2LPMA 4O2BB 2A5FA 4O29A 3T7CA 1A8IA 4GWKA 3OIFA 3NT4A 1K8XB 4UOQA 1AHIA 2IDKA 2ZBRA 2VZ9A 1KZ1A 2VHWA 2VJMA 4ZOQI 5CH8A 3VU9A 1YS6A 3DULA 1V16B 2O2JA 2AX4A 4X93A 5G4KA 2A0KA 5AJXA 1U3VA 3SMVA 3PIIA 1VSTA 1EFPA 1T3ZA 3AONB 4AUEA 3IBSA 1ECPA 5EJ8A 1OXVA 1UXJA 3P2MA 3ND8A 3TSCA 3Q9SA 4G89A 4P4SB 3BRSA 2IXAA 2OKGA 3B5JA 3C85A 3LHDA 3PFKA 3V1UA 4CBVA 4JYMA 1VL0A 3LUBA 3STYA 2RD2A 1AKVA 1YFMA 1XEWX 1GRRA 3Q3GE 3DL0A 4JROA 2KHZA 1OFVA 2GM9A 1SU8A 5COAA 2REQB 4NR0A 3C3EA 2I8AA 3FCXA 2APJA 4LVNA 3M8KA 1BRMA 2OBMA 2VHUA 4X54A 2SKCA 4WACA 2ABWA 5FKJA 3RR2A 1E3TA 2VDRB 3DW1X 4CPDA 5K01A 1J8VA 4JELA 5TNXA 4PQEA 4XIIA 1GNTA 2B5OA 4FI3C 2NVOA 4EIWA 2LTAA 2IUEA 4ETMA 3DGEC 3OBIA 3H5VA 1Z5VA 5EPEA 1RLOA 5AI8A 3V1MA 1WB9A 3RYHA 4EHDA 3KHKA 1FTWA 1VRWA 3R1IA 1VJ5A 3W7BA 3ZWMA 4M76B 3C39A 1KVTA 3RRXA 4OV6B 5CA0F 1N1MA 1UUFA 3HACA 1ZD5A 2CLDX 3VAZA 3C97A 3FNQA 4CRWB 5CDSA 1E5DA 2J0QA 2FW7A 1J0CA 1O5TA 2KM1A 2YZMA 4HI0E 1HETA 3DO6A 4P7JA 2AXQA 1NVBA 2XGSA 5F52A 3UC5A 2NVUB 3DWIA 3V42A 1XAJA 1XZHA 4N9QA 1XKQA 1ECBA 4P5DA 5EL0A 5AW7A 5A04A 4D4HA 3BAZA 5CDTA 4LX0A 3HLYA 2AFHE 2AX3A 4PZDA 5L6LB 1NF2A 3BMXA 4R2IA 4AYTA 4GXQA 2XVMA 4BIIA 3CF0A 4ZTBA 1N7JA 4DLZA 4EITA 4MWCA 1RWXA 3PE4A 1Z4JA 1GPNA 1XLVA 2A9VA 2EFHB 2WK1A 1ISSA 1EI9A 2CHQA 2JFBA 4MGYR 4KSCA 5F4BA 3MJHA 1DAGA 3QVWA 2FZVA 3BIOA 4IXDA 2HCFA 3KKPA 2WJYA 4KXNA 4OMDA 1GTVA 3NHAA 3OX2A 1QQ6A 4P31A 3JQ6A 1IDOA 4B8ZA 3HVIA 3HY3A 5LQNA 4B40A 1VJ0A 3BB1A 3KQSA 1U80A 1B14A 1M83A 2RI0A 3AZOA 4RJJA 2RHOA 3J7TA 2BSAA 4BUJA 2JD2A 1PZMA 2QB5A 2PRZA 3WL7A 4DTIA 4AMBA 3IR5A 4YCAA 3KUXA 5IXYA 4HQ0A 3NDPA 2FSVC 4NEGA 1BA3A 1LCIA 4KAXA 4X5OA 4EFNA 13PKA 2R6ZA 3P1JA 1U1EA 4IX9A 5EZSA 3OO0A 4M53A 3UENA 5K3AA 5CTJA 3TRKA 3HPRA 3MMNA 4QEKA 1DLIA 3B1XA 1EGVB 2QE7D 2QZ9A 2AYYA 1I2ZA 3JYNA 3LCCA 4DGSA 5G0VA 2XDAA 3VUEA 3NAZA 4U6NA 1MCZA 2P62A 5A4JA 3ANNA 4GSKA 4O4LA 5KHLB 3RABA 4LHZA 1U3UA 1Y4SA 1A04A 1I01A 2I4NA 2P1ZA 2FWNA 4OI4A 1GZ6A 4C0KA 3ZU2A 4NNOA 3HPQA 4NC9A 4RFVA 1PFVA 2VXBA 4N7MA 1Z4IA 1W59A 4HAUA 1GUFA 2OCDA 2VQDA 3BBPA 1H8EA 3RRZA 5A3VA 3T38A 2BGNA 3IKJA 4P58A 2GT1A 1NBIA 2IS1A 4HLCA 1T5LA 3MJRA 2J3IA 3DF9A 4E22A 1TECE 3CC8A 4TTRA 3I28A 3MERA 3R2JA 1K89A 3SXUB 4E5SA 2TMKA 4MP3A 2ZRDA 2Z3VA 2YJZA 3LBFA 2RGWA 2I3AA 3HYTA 3AU8A 3CUVA 4LQ4A 4W5HA 4FDLA 4MARA 4BJ1A 2MSCB 3C87A 4NMMA 1XRSB 1F9AA 1VG1A 1Y48E 2C1ZA 2CMDA 5FO1A 2P9YA 5B37A 4HFNA 4BYMA 2PUAA 2ZI7A 3HHEA 3QKRB 3BCSA 4R68A 3D6VA 3MJVA 3QPAA 2FXIA 1YACA 3K5WA 4ND4A 4OYLA 4UMFA 5E4FA 3UK0A 2EX0A 3V80A 3NTLA 4JEUA 3ZZ1A 3PUVA 1MAVA 1GGMA 1U3CA 2HSGA 1Z5UA 1VRVA 2PZKA 1U7ZA 2ZYUX 5K0BA 2VUTA 1P2VA 1Z29A 1T36A 1L5HB 1PGJA 2YL2A 2G63A 3FVTA 3E3AA 2QMHA 4OTZA 1M7BA 5I7SA 4PX2A 4KXXA 3FWYA 3IEVA 3AC0A 3WK8A 2WWVD 3HNRA 1JG4A 3HTXA 1JF8A 2CLHB 3FUUA 4RANA 1VCMA 4PIVA 1KEPA 3PUXA 3UB3A 3W4IA 1G55A 3FMIA 2NYUA 1OI2A 3MINA 1IN6A 1N5KA 4GP9A 5A02A 5E6SA 4M1KA 3H2JA 1Y1PA 1JFFA 3ETCA 1O6GA 2QX4A 4TTAA 3MA0A 2B61A 5IHXA 4GI1A 1XRQA 1P1KA 4KBFA 4WBXC 3KJEA 1KY5A 4UREA 2O5CA 2HMUA 2DLDA 5BN4B 4FVTA 1JQKA 3QKTA 4C0QC 5SYAA 5EEGA 1V9SA 2O6HA 3OUTA 3WNCA 4DA6A 1EP3B 3IEMA 4YP1A 4NU0A 5KNCH 1XNQB 2DXIA 4L5BA 1N8KA 1OGYA 1TVCA 5GM2A 4JJ4A 4EB6A 4D9NA 3M82A 5IM5A 2JANA 3NFYA 4U7WA 2PPLA 2FSGA 4GDFA 2JCVA 1CZHA 1L7PA 2A5JA 2GD0A 3FYCA 5LDDC 1SOWA 3NHLA 3ZBUA 2JLUA 1Z7EA 4Y1FA 1RCFA 3GFGA 5KAPA 3RU7A 5JNVA 2G09A 2CFSA 3ZPXA 5C1BA 4YREA 2OG2A 3BUSA 1KK1A 1DDOA 2DCMA 2X9GA 2VBFA 3DZIA 3OEED 1JSWA 4E11A 1XMPA 4P0PB 4QU8A 4KGDA 3TL2A 4Y7DA 3DCJA 5BWOA 3AZPA 1FJ2A 2CL7X 2BFEA 1FVOA 3L7IA 2G1KA 3GJZA 4LI0A 5COQA 1TJ3A 3IT2A 2R7AA 1VPTA 4HNGA 3WRXC 3DG9A 5BN1A 5AUNB 2GHIA 3Q3HA 3FNBA 2CDCA 4H1TA 3RC7A 4AY3A 3K0HA 5ECYA 4BMDA 1TT5B 5A2GA 3UV3A 3KJFA 4GX2A 4BEVA 3QQPA 2J5BA 4CDMA 1EFHA 1FFSA 5TJHA 4NXMB 3WIDA 4B17A 3DE1X 3PTAA 2AOXA 3ZCRA 2XKJE 1Z5OA 2H5JA 5JE8A 4QGFA 4YNBA 1V7CA 3BWMA 2A59A 1J9EA 1Q14A 4WL0A 3IMEA 4MIYA 1IVSA 3VPFA 1UXGA 3Q0EA 2P7HA 5H83A 2HEIA 4LISA 3L02A 1X70A 1T0PA 2WABA 3EXHB 4ZQEA 5BW6B 4DIMA 3A1NA 2HCRA 3OLVA 1T9KA 4PHFA 1IB6A 3UZUA 4EF5A 4P34A 2EFJA 4E1VA 5LP6A 1RQ2A 3HCOA 4N0DA 2O0LA 2CD7A 2ODBA 1BXRB 1RWBA 4ZALA 4RHFA 4F3KA 2G4CA 1C3JA 1PJBA 4E2YA 5D85A 1L0BA 1T26A 3BJZA 2VTEA 3DT9A 5K1ZA 1AQ6A 2JVIA 1OFHA 1P62B 2BSXA 2V3VA 2XQKA 1XMXA 2WMOB 1TO2E 3DVAA 4FMCF 2XNKA 4LG1A 3BGIA 3EMKA 4L72A 3BH6A 1Z2DA 3W8EA 5A3JA 3EIXA 1BD3A 3KJXA 1QZTA 2JVJA 5ALOA 2F9FA 4I36A 4B3IA 5T8KA 3BKWA 2A4KA 4H1HA 1YJ5A 4JC0A 2VF2A 2H5IA 3IMCA 2B30A 5EMKA 2VBIA 4E21A 1E2FA 5KTTA 1U0NA 2VPTA 5SZIA 3S2SA 1EQUA 4OAQA 1CJMA 2AN9A 4J76A 4MWSA 2AH5A 1A5BB 1QE5A 5C0OE 4X1YB 3UT6A 4ZK2A 5CAEB 4WAUA 2FCRA 3KD2A 1IQRA 4UAJA 3RRBA 3ZK8A 1JBKA 1PQPA 3IAS1 2QA5A 3FM9A 2Q1UA 5DLEA 4UQLA 3ZI4A 4C04A 4HXYA 4OJYA 2O52A 4AJOA 4BNDB 3AQIA 1GT6A 2W9XA 3I9V1 3CEMA 3ZD7A 4ZOCA 4NBVA 4HEQA 3VUFA 4PHTA 3E53A 5J4VA 2GPAA 3EQ8A 5U9CA 3ZY2A 4E5DA 4GZ6A 7YASA 2BFBB 3FYUA 4L28A 10MHA 4I8XA 1HF3A 5EE5B 2VLIA 3GG9A 3V4ZA 1PYDA 1ISHA 1YMVA 3QKSA 3N2GB 2A0FA 1E2MA 2AZTA 4DR6B 1KJ8A 3EGCA 3B52X 2R8RA 4I3GA 4D02A 5EWJA 4MX8A 2F00A 4MVJF 3T4XA 1B16A 1A5AB 2JC3A 3G8BA 2NMVA 3WGMA 4MV5A 1PJRA 4A2CA 1L1EA 3CXRA 2IY7A 5ILOA 4HEA1 1GZSA 3R0JA 4LRWA 1M2NA 1OZ0A 1XZNA 2GXQA 2WE7A 4HEJA 4I1IA 4INOA 4K46A 2Y0BA 4KFTA 1UCFA 2ZRQA 4L74A 4NYJR 3T7JA 3ZG6A 2OWDA 3KQOA 4CIDA 1W36B 3ZWAA 2B4QA 2AA3A 1E4EA 1NXSA 1ZL2A 3C6XA 3MUNA 4Z0HO 5FPTA 1XYGA 3L7LA 1NQ5A 5FUWA 1EP9A 3EIOA 1T5TA 4N3NA 5L4NA 1X80A 2WMNB 3GLHA 1ETUA 2ECKA 5JYCA 3RRFA 3LPLA 2IHVA 1G4AE 1IJKA 1Z8FA 2IH2A 4CMEA 3TECE 5K3OA 3T3MB 1AD2A 4UBLA 1W52X 3T4PA 4EO4A 2YRWA 4P98A 1GUZA 3PKZA 1RFLA 4CLOA 2IEGA 1EVQA 1WKVA 5BVHA 2FN3A 5IJZA 1NWHA 3IO5A 1KQFA 3PNVA 2A9JA 2D7JA 5HFJA 4FJ1A 1ANKA 3G0CA 3JRWA 4EFCA 2IXGA 3LX8A 2H16A 3LQRA 4UTZA 1MC8A 2OB1A 3X3HA 1L8QA 2EGGA 1SCNE 3STUA 1A27A 3EDOA 2IZ7A 2OKCA 2J5KA 3F73A 4PBSA 3V32A 1DC3A 1KYXA 2BGUA 3ASVA 3DV9A 5JISA 2QX6A 4MK4A 4URFA 4X7RA 5FI5A 3QX9A 3O4HA 4B4DA 4JK3A 3PDIB 2IPOA 3KXKA 1NR1A 3CKYA 4D3SA 1IM8A 2FFAA 4LY9A 4X6UA 1F06A 1ZVMA 5I7VA 3SQXA 3ZHRA 2HY7A 5CG2A 1WUKS 1VJDA 3S27A 3HO1A 2J0SA 2RH5A 4IJUA 2G9VA 5E6UA 3FAKA 4HQRA 4UBKA 2IVZA 1LFAA 4KYVA 4NICA 1CUFA 4PLVA 5AP9A 1Q1EA 2MSNA 1L5GB 5J59A 2BGRA 4YHHB 1AVTA 1ADGA 1DAIA 4PEVA 1JMVA 3UJ8A 1F7UA 5E7IA 4HDMA 2C54A 1Z0SA 1OZHA 3VH3A 3COPA 5ES3A 2C78A 1U2SA 2AFHB 1Y1QA 3O0DA 4BWYA 4CMCA 4XWGA 3K94A 3PT9A 1I14A 4XSGA 2ERCA 2FPKA 1S1MA 2Y1CA 2LR0A 3ES9A 3ISTA 1LBHA 3GEDA 3TW0A 1NMYA 1P5FA 1SBTA 1RI3A 4KQXA 3SJUA 4I1PA 3AIIA 3BDIA 5KQLA 1X1EA 1WF3A 2Q9CA 3HCNA 3KYIB 4PRLA 4W7IA 3ROGA 3W3ZB 3PX3A 4TSRA 1FFCA 2ZE5A 3KKMA 2H8KA 4MQLA 5LCXA 4B6GA 3V1TC 4LF9B 4AP5A 2O19A 1U1DA 2I3BA 4GD3Q 5I4BA 2CUKA 1JG2A 1CD5A 2P3OA 1QHHB 5ENZA 2XXAA 2XA9A 4YACA 2QNIA 1GL9B 2IXEA 5K8CA 4WFJA 5JDCC 3C8TA 1NYTA 1V8DA 4Z0PA 1ZN8A 4J07A 4J49A 3UQZA 2P9GA 5GJWC 2JPDA 4HH3C 1CS4C 2HF7A 2FFQA 5DASA 5BOVA 2Q5EA 4TV9F 3WDLA 3BWVA 1Y80A 3KM0A 3MPOA 5B6PA 4IDGA 2OK8A 3DH0A 3NTRA 4J03A 4O3FA 4XYGA 5TGDA 3DFUA 5AKXA 4CL0A 3W5CA 1EQAA 3GCWA 3QUCA 4V0RA 4MDYA 4O0LA 4Y67A 4TRJA 1CYEA 4LCBA 3HXLA 4TROA 4AICA 2QDKA 2YICA 4E3WA 1WS6A 4BLRA 1W0KD 3A2NA 1YFJA 2AFRA 2C07A 2FF5A 2XZTA 2L18A 1CR2A 2ZAYA 4TM8A 1KJ9A 4CTMA 3K0FA 5EY5B 4ETWA 4BBZA 5CX4A 3LOUA 2X0IA 1U2DC 5L51A 1WB4A 3A2KA 2AR9A 3KJQA 2CBZA 3N1UA 4QBGB 1NUUA 1TYBE 3AVYA 1U15A 1EESA 5C31A 1PYGA 1NT2A 2X9QA 2OR3A 2NIPA 1Z39A 2P2YA 3A1FA 4J16A 4E0BA 4EG0A 4US2R 2JAPA 3CF2A 4KH0A 1KSFX 2YHIA 2MSLA 2FR0A 4QUAA 4TRMA 1TLTA 2GS9A 2QPOA 4EJ6A 1QFXA 1BDMA 3CISA 4UVEA 2JAQA 5DTEA 5CCDA 1QRTA 1ESMA 5BORA 4E7PA 2BE9A 3DLIA 4AXXA 1B41A 2E2WA 2WDPA 5JW6A 3RRMA 4YUVA 4GUAA 3TLGB 5L53A 3ESRA 4PANA 1N6RA 3N87A 2QYHA 1J2RA 1O87A 1YCHA 1R0YA 4J0DA 4WXRA 4I1OA 4AT1A 2PHZA 3QU4A 1RYDA 2I2BA 5LYJA 1DO2A 4Z7OB 1LJUA 4LYHA 4PCUA 1Q7TA 2FZWA 2BCEA 1XQ1A 3L1JA 3OFJA 3UCEA 2FI1A 3G0IA 2M6LA 3VKWA 5CDUA 2MINB 4MUHA 2NO1A 3DE3X 4G8CA 3U4HA 5KYGA 3Q3EA 2RKWA 1G5HA 3WLEA 4CTOA 3KZOA 4TWAA 3JQAD 4R1TA 4Z53A 2EWWA 1MFPA 2JLQA 3BMOA 3F7TA 2L17A 2DUWA 3F67A 2PY6A 1VB3A 4EA9A 4DJTA 1A95A 2HU5A 3PQEA 2ACVA 4PLPA 4RTLA 3DEFA 4FSXA 5DLDA 5BSUA 4FU0A 3NU1A 2L69A 1MUUA 3I23A 5K3EA 1H2YA 2IPXA 1NPDA 5DSXA 2W6ZA 4N3GA 4MDFA 3MIZA 4BB0A 3QEKA 3E84A 1G7SA 1V47A 3DAPA 3FDFA 4OFWA 3TQRA 3IV6A 4K2HA 2HAEA 3CX8A 4QM7A 1DIOB 4A8JC 1ZSNA 2QRVB 5CFPA 1CJTC 4BJHB 4NOKA 3DLTA 4PG5A 1L4HA 2ZRBA 1ZWLA 4P32A 1O95C 4DG9A