1Z4MA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4mA01
5ALEA 4AS3A 3S6JA 4EELA 3NUQA 3ESQA 4XOUA 5AKKA 5ALTA 1ZJJA 3ZUPA 2G80A 5ALZA 3OCUA 3QUBA 2CFSA 5AKLA 5ALYA 2BY4A 1EK1A 5T41A 3AR6A 2PR7A 2RAVA 4GIBA 2BDUA 4FYPA 3U13A 1J8DA 3SF0A 3ZVNA 2G07A 2DQSA 3KOOA 4FE3A 2ZBDA 4C4RA 1JUDA 4MUMA 2HCFA 3FM9A 1RQLA 4UATA 4ZEXA 2HF2A 4EENA 2YJ6A 1Q92A 3HLTA 4CE6A 1U2SA 3L5KA 3L8EA 1ZD4A 5AVZA 3QYPA 1Z5UA 2I34A 4KX5A 4UMFA 5ALOA 3QU9A 1Z4LA 5AVUA 4B6JA 2R8EA 4HGQA 2GHTA 2WHEA 1CR6A 3WKBA 4BYGA 1Z4NA 2B30A 5AKHA 3ZX4A 2B8EA 3OPXA 2GMWA 1O08A 2GO7A 5AVVA 2FPRA 2D2VA 2ZXEA 4OD0A 2JAUA 2O2XA 1SWWA 1ZOLA 1IWOA 5AKYA 3WK6A 3E84A 3NASA 3N07A 5A3SA 4UARA 2I6XA 2ODAA 1QQ5A 2HSZA 3N5KA 4DFDA 1SU4A 4EEKA 2R8YA 4JB3A 4EZEA 3A3YA 4AP9A 2Q4RA 1ZS9A 3L1UA 4UU0A 4I9FA 4KNVA 5ALGA 2FEAA 4AS2A 4EX6A 3R09A 2JARA 3ZVLA 1Z4OA 4L57A 5ALIA 2R8ZA 2IOFK 5AICA 3KC2A 1ZRMA 3D6JA 4BX3A 2FUEA 4H1WA 3SKXA 2IA5A 1L6RA 3I1YA 1RQNA 4UMVA 2GHQA 1NF2A 2CN1A 1MH9A 1XVIA 1WR8A 3AR4A 1J97A 1X42A 2YJ5A 4XE5A 4HGOA 1RLTA 5IT0A 3DDHA 3U7HB 3BA6A 1Q91A 2P69A 1L7PA 4YH1A 2Q5EA 3E58A 1NRWA 2C88A 5ALJA 2C8KA 4Y2SA 3K1ZA 4Y2VA 2RARA 1TE2A 1U2TA 4OFZA 4Y3UA 2CFTA 3W5AA 4CF3A 3B9BA 4CNQA 1N9KA 3ZU6A 1L8LA 5E0OA 3I76A 4ZEWA 2WFAA 2HF7A 4HGPA 4OCZA 3N8GA 2AGVA 5AVXA 3WKDA 2I33A 3L8GA 3FPSA 4KNWA 4PNHA 4OHFA 5IS2A 2YN4A 3ED5A 4KX3A 5AM2A 2FUCA 4NWIA 5AVYA 3N1UA 3QGMA 1RLMA 3OCZA 4YIKA 5AK4A 1U02A 1TA0A 3WGVA 5AKIA 4UMDA 2OYCA 1F5SA 5ALHA 1YJ5A 3R4CA 2MSNA 3AR9A 3NANA 2YY6A 1RMQA 3L0YA 2IYEA 2I7DA 1TJ5A 4KYTA 3KZXA 3A1CA 5AM1A 5AW4A 2W43A 2WF5A 4ZEVA 2ZBEA 3L1VA 2AH5A 2O9JA 2X4DA 4XPZA 5ALMA 5AK3A 3B9RA 3QU2A 1LTQA 4UASA 4UW9A 4UM5A 3W5CA 4CF5A 3OCWA 3N28A 4F72A 1ZD5A 2WF6A 4HAIA 3RFUA 1RPZA 3QUTA 4QJBA 3CNHA 3EPRA 2G08A 3HYCA 3MN1A 1QQ7A 4MWOA 3KDPA 3AR5A 5AVRA 3AR8A 4Y2JA 2G1AA 3ZWDA 2HX1A 5AW8A 3PGLA 4Y2PA 2YMQA 4C4TA 1YDFA 5AW3A 3OCVA 2B1RA 2EATA 1AQ6A 2C8LA 2IOFA 4G9BA 4J2TA 3UMBA 3ZVMA 5AI9A 3OCYA 2AUTA 3QU5A 4YIHA 3U19A 5AK5A 4Y2RA 1Z88A 4Y2TA 5AVWA 1T9ZA 3KBBA 1N8NA 2FPXA 2JGAA 5AHXA 1NNLA 5ALSA 3ET5A 5AESA 1Z4PX 3MMZA 1VJ5A 4HGNA 2YJ4A 5AKEA 4YCLA 3L0CA 5AI8A 4DW8A 1RC8A 3R9KA 4BNDB 3NALA 1Z4KA 3E8MA 4Y2YA 3PDWA 3WKCA 4E88A 5AKGA 3SHQA 4RETA 4Y2UA 2FPUA 2WM8A 3RF6A 2YBDA 5AW6A 1CQZA 1XPJA 2FPSA 5AK6A 4YGYA 4IFTA 3ZI4A 3EF1A 3ET4A 1YV9A 3MPOA 1YNSA 2I54A 5AM4A 1Y8AA 3SLRA 1TJ3A 4UAUA 1Z4MA 2G09A 1EK2A 3VAYA 2JAWA 3BWVA 2I55A 3WKEA 3ZW7A 4Y2XA 2PQ0A 4BX0A 2CFRA 3WK7A 3P96A 1T5TA 5ALUA 2B82A 3PGVA 4F71A 4I9GA 1Z4IA 5ALNA 5A3QA 2W4MA 3AR3A 3CZ4A 5AKJA 2YJ3A 3SKYA 4BNDA 2P27A 5AIAA 5ALQA 4QQFA 5ALFA 3DV9A 1SWVA 3AR2A 2PKEA 3FVVA 3NRJA 5ALLA 4NFLA 4CF4A 3QNMA 1ZD2P 3EF0A 1L8OA 3A1EA 2P9JA 3DAOA 1WPGA 2B8JA 3OTQA 2WF9A 4FFDA 5AVSA 4NABA 3UMCA 2ZG6A 3IB6A 3ONNA 4YCNA 1RRCA 4UU1A 5AI0A 4BX2A 3U26A 4HYTA 4L6CA 4RESA 5AM3A 1YMQA 2RB5A 4YCMA 3QX7A 2YMLA 2HOQA 3DNPA 4GXTA 5AI5A 3FPBA 4O8CA 3WK9A 3AR7A 3F9RA 1PW5A 3MC1A 2C9MA 1Z4QA 2B1QA 1U7OA 3TLMA 5IT4A 3IRUA 5AM0A 2WF8A 2OM6A 3L8HA 3ZWKA 5AVTA 3ZTYA 4BEVA 2WF7A 1WVIA 4NV0A 3ESRA 1L7MA 3WK8A 4DWOA 2R8XA 3L8FA 4NAVA 3UMGA 3OCXA 1KYTA 2YMPA 5AM5A 1ZD3A 4C4SA 5AKXA 2IOHA 2NO4A 2YFYA 4IG4A 3ZX5A 4BEWA 4KN8A 5FP0A 4Y2QA 3WK5A 2GFHA 3W5BA 3EWIA 3A1DA 3WGUA 4UAVA 3SMVA 1O03A 3KD3A 5ALXA 4J03A 3E81A 1VFPA 2ZBGA 2G06A 5ALWA 3M1YA 1QH9A 2FDRA 3SD7A 4UMEA 3IJ5A 3I28A 2B0CA 3U7GA 3I6BA 5A3RA 5AVQA 5AW1A 1LVHA 5ALRA 5AKZA 5ALKA 5AIBA 1S2OA 2G0AA 2HHLA 3W5DA 1RMYA 3NAMA 1TJ4A 2QLTA 1RMTA 3M9LA 2QYHA 2NYVA 2C4NA 2RBKA 2OA0A 4JDPA 5AW2A 2MU1A 2NO5A 1QYIA 2FPWA 5ALDA 5AW5A 3WKAA 2Q4TA 3WK4A 3QUQA 3U7EB 3QU7A 4UM7A 5JJBA 1ZRNA 3UM9A 1RDFA 1S8OA 2OBBA 4XQ0A 3ZTWA 2HI0A 2ZBFA 3GYGA 3J7TA 1Z5GA 2BDEA 3PCTA 2AMYA 2VKQA 4HGRA 1L7OA 2P11A 1K1EA 1QQ6A 1XP5A 5ALPA 1FEZA 3QXGA 1RKQA 4G63A 5AW9A 3NIWA 4L6AA 2JAOA 3U7FB 3FGOA 5ALVA 1YS9A 5AW7A 5AI4A 1RKUA 2EAUA 1WZCA 1U7PA 2EARA 3L7YA 3QLEA 5AI6A 5AW0A 2HDOA 3FZQA 2ZOSA 1RLOA 1RKVA 4DCCA 2HO4A 1T5SA 2YMMA 2HEGA 4BBJA 4EX7A 1Z4JA 2W11A 2FI1A 3B8EA 3L0BA 3QUCA 1VJRA 3QU4A 1L7NA 4BKMA
chains in the Genus database with same CATH superfamily
3OT4A 3JRWA 5EWMB 3BDIA 5F76A 3ZCSA 3L7BA 3TR0A 2WSIA 2INGX 2C5HA 4R9UC 2NXWA 5EFZA 3E05A 1N0UA 4WKBA 3DW1X 3VNBA 3W2TA 4CUKA 1F51E 2F48A 1GKUB 3L0ZA 3ICPA 4J90A 3AR6A 4KNYA 2PR7A 1ULZA 5C5DA 2H2IA 1KFKB 4R83A 1BA3A 3KUCA 5BW8A 1OA1A 2ZT5A 4GZ3A 4B6EA 2XGSA 3R77A 1SUWA 3HYSA 1QSGA 2X86A 3R0XA 3IHWA 3OFVA 2J4CA 2CNDA 2J9YB 2XJ4A 2H4ZA 4KQKA 3SQMA 2JIDA 2ZBDA 4A8JA 1XV5A 2PKQP 1S01A 3EIOA 1B8NA 1MAVA 2FDXA 3AHCA 5KOJA 1E8NA 2B92A 3EVNA 3QM1A 4TTSA 1GPBA 2WOJA 1IUPA 2VTDA 4YP1A 1IWPB 1IN5A 3OLYA 3NC1C 6AT1A 4V3BA 4NQZA 3WG9A 2HF2A 4G1BA 3OJOA 5D5PA 4MUBA 4W5OA 2MSKA 4DXAA 2PZ8A 3AW9A 2SKCA 2HH9A 3DHEA 5UKDA 1NNI1 3PE3A 1U1CA 4FLMA 4MLPA 4K9PA 3Q2KA 1BXGB 2C3UA 4TXMA 1AGNA 3H83A 5DPMA 2P8SA 4B6PA 3TPZA 3L8ZA 5FJJA 5ITVA 4P53A 4BMVA 4EL0A 2WHEA 5IYZF 2AFRA 3WKBA 1ECBA 1ULAA 4XQCA 4ZZ0A 1QRTA 4TVOA 1RIIA 2QN3A 3H9UA 4QEZA 3QXHA 1O08A 2HBQA 5BV8A 2R86A 1G6Q1 1BQ4A 1IHPA 2AOXA 3G7NA 2VHVA 4PHFA 4RA9A 5LQSA 4DCPA 3I61A 4KXFB 1GNQA 2QTFA 1QRSA 3EZLA 2CGEA 3PHGA 5C3MA 2H3EA 2VDPB 3IVXA 1TIPA 3JQAD 4BWYA 1C3OB 4HQOA 1Z6YA 4U7WA 4YHBA 4EG5A 5TF0A 1BNCA 2QRVB 1FSFA 3CBQA 4M1OA 4Y6SA 1NFFA 4JC8A 2LXNA 3C3AA 3FR7A 4L8WB 3OQNA 1XKQA 2PGLA 2QK4A 2ZYGA 5DHAA 2B9EA 5DGXA 3LXRA 2NXCA 3NG1A 2FR8A 3GA5A 1J06A 2I91A 2HSJA 4UHJA 4KDFA 1D4FA 2R62A 2CKMA 4JVOA 1K66A 1K8RA 5H59A 1ZS9A 3L1UA 5LCXA 1OBCA 4CWAA 3U37A 2RGNA 2JGDB 4LJ7A 1EP2B 4R1TA 3WTBA 1XGKA 1FPQA 2CVFA 3VTFA 1QGDA 4UPEA 5CFLA 3R2JA 3ILYA 3ME5A 4L9SA 1V1RB 1JQ3A 2ZTVA 2RGWA 4PAQA 2ACKA 5J5VA 3QFRA 3TTVA 3KL2A 1JNXX 3L4BA 3AI1A 4ZCSA 4EUSA 4HDNB 4TKUB 4OFBA 1ZNXA 3ORHA 4MMYB 5AICA 5EKUA 5LNK1 4U7DA 4OLBA 4NTZA 1G2QA 3OLVA 1TLLA 1DXHA 2XUHA 3K0EA 3H3JA 3L4EA 3W3ZB 3ZY6A 6REQB 4GDMA 4P35A 3QVWA 3K30A 3M9XA 1ABFA 2GLXA 2IPXA 4HS4A 4PAOA 4KAJA 1PEYA 1O9GA 1SXIA 3U3ZA 3ZE7A 2PH7A 4YUZA 4KIGA 3EEIA 5DLEA 1IJKA 1XJ0A 3AR4A 1Y4DE 1B6RA 4IXDA 1W85B 2OXIA 4NXMB 1J7KA 1NF9A 2IELA 4WKPA 4C03A 521PA 1FS5A 2XZOA 2O5RA 1GY8A 4IKPA 3DE2X 2Q6IA 1VLJA 4UNIA 2O0MA 1L6IA 3M82A 5DLDA 2OYSA 2R6DA 3AEKB 4RK5A 3T5MA 2ONKA 1N6KA 3DC2A 1TM1E 4KI7A 2Q5EA 4N12A 1VKOA 4BC0A 4FW8A 1UMCB 3IP1A 5CFQA 1Z83A 1XZNA 2E87A 2R60A 5DULA 1TE2A 1GPLA 1TZBA 5EMKA 3G89A 2HA7A 1YS2X 1E3QA 4G5XA 2BH2A 1RRGA 1H2WA 1ICIA 5KAMA 3JQBA 1VPVA 4XYLA 4D3DA 4Y0AA 2BEUA 5BVHB 2QSUA 2PAFA 1WMFA 2WP8J 5CPFA 2VXOA 4RDHA 4F1WA 2FUNB 1NBOA 2EQ5A 3DS8A 4KEAA 4P9NA 1MIOA 5GIPE 5HQ3A 4IZIA 2QJRA 4F5YA 4ZK2A 3ZXSA 4GE3A 2W4QA 2H5IA 2PKWA 3UJHA 3OBBA 1SQSA 4BJ5A 1R50A 1IMOA 4UNQA 2WWGA 2WNIA 1TF7A 2ZT6A 3NRBA 5ESWA 3N8IA 4OSPA 3ESZA 4JP8A 2EIHA 1JWBB 3D7LA 1ML3A 2AMFA 2YN4A 4KX3A 5BSWA 3B3QA 3K9HA 2UUCB 2GNAA 1MUUA 4G36A 1JQKA 4C88A 1LBEA 1ZGAA 2IYSA 3H6GA 1RLMA 5JJ5A 1I0LA 2ZM5A 3LCVB 4MUGA 3HM9A 4XIIA 5EEHA 1TA0A 1U0FA 3HKDB 2ZUEA 4EDHA 1TJYA 4A2PA 5EE9A 1PEKE 1IBMB 4DMRA 2O7QA 5FFMA 3N74A 4H77A 1LRLA 1KYIA 1N0VC 1QH8B 1TJ5A 3HEMA 1M2FA 1XHLA 1GUAA 4CCYB 3LYAA 1YOBA 3G7UA 2Q6VA 1O96A 2GCOB 1E2GA 1ZK2A 2JJMA 2Q3FA 2W43A 2WF5A 3LFTA 5BOSA 1MJ5A 3KTFA 5B4TA 1NMXA 1PHPA 5DBOA 1UWLA 4ER5A 2GK4A 2PSFA 3JAWA 4DSZA 1J2UA 1H42A 2G82A 4FLFA 1YA8A 3A9TA 1C1YA 4ZU6X 5E6RB 1P80A 3Q7TA 1PRYA 3NHJA 4D79A 1HUQA 4N8EA 1SH7A 4IDHA 3RFXA 4R6XA 3FTEA 2ORED 3PLNA 3MHTA 1R4MA 2G08A 2E82A 1KMHA 3HUTA 1G3RA 3INTA 3CH4B 4TRMA 2O4UX 1KMNA 2G5PA 3HB9A 2CJPA 1OB5A 3PGLA 3RASA 1JDVA 1G8GA 4N47A 2C2KA 3NQ41 4UE2A 1RZRA 1KI8A 3B12A 4IIBA 2I76A 1DMSA 2ODPA 3SZUA 2MT9A 3EWSA 4I8DA 4JLJA 4FTWA 4JXKA 1AQIA 1X94A 3CPHA 4QREA 4TTQA 1CUVA 2QRNA 2GLTA 1IY9A 2B8TA 2DKOA 1THZA 1RKBA 2VHCA 2X77A 1XEAA 5SICE 5DSTA 4H31A 4F9GA 5DKFA 1MEOA 4YIHA 2D5CA 3KWMA 1Y1TA 1H05A 2EEPA 2EW8A 3KOXA 3OWOA 5LQDA 3LT1A 3U6KA 1M6YA 4ZKEA 2Y3IA 3KO8A 2YIVX 3HH8A 1B73A 5AJVB 1NJGA 3ZY5A 2WFMA 4MVJA 4LYHA 5LM3A 1ZMTA 3QUAA 5JSHA 1FJGB 1UK6A 4J1TA 2FQWA 1OXKB 1ZIDA 1O5IA 1JYFA 5H9VA 5TJHA 4RACA 2QPLA 4BRWA 5FAKA 4BNDB 1UOPA 2C2HA 2W93A 2G63A 3SHFA 1QO9A 4XFJA 3E8XA 2H48A 3BE4A 2XMQA 3SHQA 3PR2B 3Q41A 3RVOA 4FZRA 3K35A 2YBDA 2PZGA 1XROA 4ZVKA 1KOGA 3Q6IA 3GNLA 1U8UA 4PSKA 1UM8A 2YHBA 1HDOA 6PFKA 3HL4A 3ELDA 4KR9A 5LD2C 4Z4QA 5EY5B 3OIUA 3LKBA 1HFWA 1OA0A 3PA6A 3M3PA 3W5SA 3CR8A 4JL5A 4WNYA 2XLCA 2AXEA 3WHLA 3IQXA 3DFIA 1T8YA 3TRIA 3WNBA 5M7EA 3HO1A 1EK2A 2P4EA 3ICCA 3UIEA 2F59A 2JAWA 2MSLA 2FSUA 5CIQA 2NNLD 1OVMA 1LEHA 3PGJA 1WBJB 2E37A 5FYDA 1G8JA 2FMKA 2HHAA 2Y92A 1QZXA 1CE8A 4MS1A 3V1TC 2IFTA 3WK7A 1T5TA 1T2CA 3R75A 2GN2A 4U8GA 1JG7A 3CPSA 3CLUD 4F71A 3L84A 1S8NA 5ALNA 3OA2A 3IUMA 1OZHA 2IT1A 4QDZA 4BGUA 1NPYA 1GL9B 4OBXA 4QO8A 4X20B 3OCEA 5EUCA 1RVV1 4K05A 4DR5B 4AKHA 5JEDA 1NVGA 2ZK7A 2QAIA 2EL7A 2Z57A 4JASB 4EAAA 2WSMA 5CH8A 3W1WA 3ZE6A 2VNJA 1YQXA 2QP9X 4GO1A 3MGKA 4EB6B 2V7EA 5C8YF 2YJGA 5BYJA 1Q95A 1CUBA 3O3NB 4C3UA 3BREA 1U0SY 3QUSA 4TWIA 3FVQA 5F78A 5JAUA 5FTWA 3V42A 3V4VB 4JB2A 1D1TA 2W90A 4QXMA 1BCRA 2Q6KA 1UBOS 1AGRA 2GWRA 1ZN2A 2FUG6 1EBBA 1NOIA 2FPGA 2PTGA 3BA1A 3FYDA 1CD5A 1VTKA 4LBVA 4OQMA 2P3OA 1DIRA 4HAVA 1BOFA 4YC7A 2SCUA 2VDNB 3MHPA 3DMGA 3OZUA 5D01A 4XVCA 5CCEA 1ZVKA 1LPOA 4FYIA 1CW2B 4K9QA 3A6LA 2WVHA 3M4YA 2OD2A 2WTAA 2HMYB 4QULA 4CMGA 1O87A 2ZVPX 4BQOA 4UFOA 2EX0A 4LYGA 3D1JA 1T4CA 1RC0A 3A1UA 3IEXA 3NC4A 4OOFA 3IT0A 4PCVA 4WA8A 4XB2A 3VHRA 4AUMA 1KRWA 2VZEA 3PUVA 4I99A 2O59A 1H2YA 1SFRA 1U7OA 3AILA 5IT4A 2ZTHA 3KZNA 2Z2JA 3F2VA 3R3ZA 4HWTA 4UXIA 3BMNB 2MMGA 1L4BA 2OCKA 4CDRA 3HLYA 3QELB 3T35A 3DKRA 4O1HA 1SVOA 1ABBA 2JVIA 4CKCB 3HUDA 1OOEA 4FZ3A 1FS6A 5L53A 1V7CA 3CLUC 2VDJA 4LWPA 4G86A 4BX9A 1JSWA 2VN8A 1IPHA 2CHUA 3BJEA 4H7EA 2HN9A 1U15A 5JWRA 1TT5B 1I3OA 1TZ2A 4IR7A 3F78A 1GP2A 2VYQA 1E7YA 4WZ6A 3UK7A 2WNHA 3DKIA 3VR0A 1AMUA 3VNAA 4IG4A 3ZX5A 1V26A 4WJKB 4BP9A 1PVOA 2AOTB 1FU8A 1DFIA 1T10A 4II3A 2NP6A 4RZ3A 2O8CA 1RQ2A 1M6EX 1MX1A 4WL0A 2HU7A 3SZRA 1PZEA 1QDEA 1UBEA 2VF2A 1V5GA 3A1DA 1LBIA 2BRUA 1TKRA 3DD1A 3ROGA 4MI9A 3EDQA 1YB1A 1OLSA 2E49A 1ID1A 5DGTA 1EM6A 1KOFA 5IBRA 3DZDA 3KD3A 5B3KA 1GSIA 2AX4A 2FWBA 2XKAA 2D0PB 4POAA 4WX2B 3UAYA 5KVCA 4E09A 4L2IB 4U8HA 3V5NA 2FJPA 5AJYA 4A2QA 1DEXA 1U3UA 4J2HA 4UHDA 2VP2A 2XOXA 3WQHA 2DBRA 4KR7A 4IS3A 2MR5A 4LIPD 1KA9H 1U1GA 3A7EA 3I1IA 1OMOA 2CFIA 4L51A 1EWTA 3WY9A 1Q0RA 1RYDA 4IFEA 5FH9A 4UUNA 4EYKA 5JISA 2AZXA 3CUUA 4HEA6 4EECA 2EFHB 1YJ8A 3BMOB 1YFMA 2YTZA 2MWMA 1A50B 1E0JA 2PSDA 2OGTA 2XMPA 4NV3A 4GPTA 3UAZA 1YBAA 3QYFA 5DXAA 2Q3HA 2QL6A 3HWWA 3MOIA 4G97A 1J56A 4GZMA 3GT7A 3X1JA 1CB0A 3RT1A 3RRNA 3CH6A 3GN1A 3W8EA 3EZXA 1I3NA 2Y0DA 2IEYA 1MAAA 3HCOA 2HLPA 1P2DA 1A8PA 3A10A 4PYIA 5HF8A 4K9NA 1SO8A 4OQQA 3GHHA 3HCBA 4RZSA 1EMDA 3HU2A 1EIWA 1WDWB 5JSUA 5D5QA 2ZE5A 3MTEA 3QU7A 2H7VA 1NUUA 2I2FA 2VOEA 3TTXA 3HVHA 5H4HA 5F9HA 1N33B 2A5YB 3O4GA 3EXEB 2PKRA 1E2EA 2ZSKA 4W8HA 3W06A 3R6LA 3VV2A 1ZVMA 1X9GA 1NE7A 5BQXA 1SCIA 3PNPA 3TWOA 2YJZA 1J07A 4O2AB 3S2IA 2AMLA 4NYJQ 2GRAA 1RJDA 2J0UA 4PZYA 3NYQA 1QQ6A 1SY7A 4KAFA 4IG9A 4CIDA 2GFQA 1I5OA 1GFIA 1PX2A 5F5XA 4EL5A 2NADA 1YRLA 3V4RA 4DQVA 1E7SA 3DHYA 3GLHA 1PSWA 3CNEA 3HJUA 1RE1A 2X8BA 1E58A 1E9SA 3OIGA 1TC1A 3I2HA 3QKRA 2CL0X 2JAOA 2FXVA 2PFKA 1R4NB 1NN5A 3FF1A 3EHEA 2PRJA 2X22A 4F7WA 4GMKA 5DW0A 5FAXA 1QTIA 4BFSA 1H2BA 2P67A 3BD8A 3MERA 4KVZA 4EVSA 4L50A 3SI7A 4R8RA 1VIYA 2JIOA 1ODJA 4FIDA 5JS2A 1BHJA 1ZUD1 3ROQA 3TTUA 3CGGA 1SOUA 3F1LA 3DHNA 2ON6A 1L5MA 4YAWA 1B76A 1JKFA 3GARA 3GD7A 4ES6A 3C3YA 2ONYA 1XVTA 1GKKA 2C61A 3OFNA 2QGNA 5KSOA 3ZWYA 1I1QB 2CBZA 3JAKA 1NRJB 2Q5LA 3GIDA 1VYUA 4CIXA 1HPLA 5DVZA 2FWRA 2RCYA 1F60A 4PS1A 2RG1A 3WLLA 2VDWB 4H3SA 3OCUA 3K70C 4M49A 2FTKE 2P4QA 4EDFA 3E7WA 4ND3A 3TFOA 3P9RA 5FOVA 1LLQA 2CXNA 3UA4A 4QC2A 1GPKA 2ZRIA 3VDXA 1CHNA 5J59A 4JUCA 4B43A 1JJBA 3FYTA 4D96A 4E3WA 3UENA 4F8YA 1ZONA 2GNOA 2DPYA 3KOOA 1XUOA 5FLKA 4C4RA 3G9QA 2OB1A 3M2TA 4W4TA 2YRWA 3PJFA 3NTQA 4U3JB 2AXQA 2CDAA 5CDGA 3CEMA 2PSEA 1K86A 4RKQA 1SZPA 5CVCA 2JHCA 1U2SA 4B3GA 4RD3A 5T4HA 2HIGA 3KYCA 2JFWA 5BNFA 3V7UA 3T15A 1XLWA 4X7PA 3V34A 1L5ZA 3GLGB 2XMRA 2RBEA 2W2TA 3AGPA 3CUWA 4P32A 1CVRA 4UMFA 1BQEA 4LNAA 4Z0TA 2R8EA 2G67A 3A8TA 3H8SA 3UXYA 4FYWA 1IATA 4ONEA 4YGXB 5MN5A 2HUPA 2IXBA 4RK1A 5AKHA 4AUNA 4GX2A 1FYWA 4OXIA 2QMHA 2NAFA 1C7RA 3RFVA 1W19A 5AJUA 1AK1A 3NIBA 4OI4A 4YMHA 1KJNA 1PKEA 3JQ9A 5DFAA 9LDTA 4YV2A 4AMGA 5HJ7A 3TW4A 1SUCA 1DCNA 3KP1A 3EXHA 5HCNA 1UWCA 4DR2B 3N7AA 3SVTA 1ZOLA 1RWWA 2ZJOA 1N57A 1K7XB 1L7QA 1GU0A 4CXMA 1CJSA 4NC9A 2RJNA 4UZSA 4O63O 3RABA 2VR1A 5KCZA 4OLHA 1BKDR 3HFGA 3ORYA 4YRZA 1ZKDA 4M6WB 5BN3B 3A9SA 1ZEMA 2PA0A 3QA9A 4GEKA 4K87A 3T1NA 1ULSA 2VRNA 3VTZA 3RAGA 1VE1A 4D8VA 1V39A 5BQPA 3ZCVA 1SBTA 4F5WA 1DQPA 4S0ZA 3BIJA 1GR0A 1PT9A 4FT4A 4LG1A 4YJGA 1N9GB 1QHHA 3FWZA 2OENG 4P31A 4BVEA 5C80A 1CIVA 3QPWA 1M76A 1RFGE 3NU1A 4KNVA 1YFZA 2Y27A 4M98A 4H7KA 4CIYA 4QU9A 3X1YA 3DWFA 2YKGA 2Y1EA 3CIFA 2FPPA 4EHIA 3LT0A 4ESVA 1IDOA 3LA6A 4YP0A 3UOGA 4ZRNA 4OX9Y 1T91A 4CFSA 3IA7A 3QPBA 3U0VA 2WSBA 3ODGA 4ZT3A 2YOHA 5JXIA 1IB6A 4LJSA 2LRHA 2BI8A 3EGXB 3L77A 1VZ2A 3IR7A 4QX6A 5CHYA 2HUNA 1N6LA 4MA5A 3UUGA 3DTVA 1XMIA 2IZ5A 3PQFA 4H1WA 1EQAA 4JDUA 3O7MA 4IQJM 1L6RA 1YKGA 4J3FA 4TMVA 3G0IA 1E3IA 4UEKA 1Z62A 2QTWB 3KQOA 4RM3A 2JLVA 3O0DA 2C94A 1E2NA 2AG0A 2C95A 3B6MA 3C39A 4PCLA 3V1NA 3X43A 1XHFA 1I7SB 3N7UA 4B7UA 4OPMA 2ZM6B 1F3OA 3EIUA 1UOEA 4KHZA 1CU1A 2YJ5A 5KNCA 2PWYA 2YVLA 1Z0AA 2II6A 3A4YA 2KSQA 3Q1LA 2X0FA 4DILA 3QY0A 3HCNA 4K3VA 4WIAA 2C82A 5JDCC 1ZM3A 4XX1A 1VG1A 1ZAKA 3B1XA 4KQHA 4XW2A 3EA0A 3MTAA 3T38A 2Q2WA 2OLJA 4RPHA 1UKEA 3INRA 4QT0A 2HU2A 3AI2A 4YH1A 1MV8A 2J8ZA 1IRXA 5BURA 4DQ0A 1YUMA 5KJ6A 2O3UA 2NGRA 5AR1A 4KQ6A 5BN1A 1MC4A 4XM0A 1DXQA 1V45E 3DOCA 1CSEE 3TZ6A 4D3FA 1KVTA 4J0FA 5LDGA 1H65A 2PA3A 2W5UA 3FYUC 5IVDA 3SMQA 4D43A 1NN1A 5TT1A 3U7JA 4ECAA 1HL7A 3E8SA 1XMOB 3K71B 2N47A 2R1VB 2C3OA 2WIAA 3O9ZA 4P1ZA 2C4UA 3C98A 1EUZA 1KO1A 1JMYA 4G09A 1Z35A 2AZ4A 4YN3A 5IZ4A 1RPTA 5COQA 3OE1A 2BEJA 2AGVA 3MG9A 5AVXA 3Q9SA 1W5AA 5CD9A 3IAS6 2JJ1D 1Y3HA 1JJIA 4WK2B 3EC2A 3CI0K 1KJYA 1C9KA 1TM5E 1VL6A 4BNMA 5ER9A 1WXXA 4PNHA 4GDFA 3P27A 1P5RA 1BW9A 1EFVA 4I1OA 3THWB 1QONA 1IFXA 2R8PA 4IGAA 1Y6FA 4ETIA 3CT4A 3T5CA 3GO4A 4IIYA 1I80A 4Q3OA 2I2BA 1UR5A 1QIKA 2R5WA 3ORSA 4P7KA 1FDWA 4ENVA 1YQDA 4JVLA 4U2EA 3VRHA 1PEDA 5JCJA 2JLQA 2WVAA 3CT6A 2D74A 2YIMA 3M5WA 4ZU1X 4AO7A 3MWLA 4YV7A 2AI2A 3VPSA 2YIJA 2HWKA 1P2VA 3DV0A 3LUJA 1IRIA 2QUBA 3PC6A 2VQ6A 1KAEA 3CURA 3A1CA 5EE3A 3UT6A 4E51A 1HRKA 5CM8B 5A9RA 5DN6A 1E2MA 4YAIA 1JIQA 2ZYDA 4N0QA 1BSVA 4GOKA 4G8DA 4IOJA 3TZKA 5SV2A 4AVYA 4D5GA 5HIMA 5A4AA 3RPEA 3IBCA 1Y4SA 4ME6A 1UJNA 2BEWB 4I6EA 2CV2A 4MKXA 1QWSA 3K5PA 3UJDA 4JUFA 3I9KA 3UB2A 3MTQA 1RPZA 4W9MC 4DRXB 2FYTA 3IXLA 5IEBA 4RIGA 1VECA 2DFPA 1Y37A 2Q46A 3N5CA 2DF8A 4LVUA 2JLSA 5AVRA 5H83A 4Y2JA 3NDJA 2R8BA 4LX8A 2YOFA 4N3CA 1JF8A 2G71A 2H1LA 2P2NA 1CDEA 1J5PA 3WGNA 1P1HA 5BNTA 1E79D 3V2IA 4PO8A 2DZDA 4LISA 5CYFA 3SGLA 3ND8A 2FFRA 2HQSA 2R1ZA 3HDHA 3R3JA 1Z9BA 4RZUA 4BQNA 3SYMA 3BCRA 3R5KA 1JHYA 3CN9A 1OU4A 3IODA 4M4SA 1AE1A 1G38A 1DV2A 2DECA 4KTTE 3RJTA 2XWQA 3QNWA 1G3IA 3DVSX 4I46A 4WVLA 1C2TA 3U19A 1MH1A 4YLGA 5AK5A 3QMPA 4XQEA 1JAZA 4KRYA 4MVJI 1DCKA 1U65A 3P2KA 2IKQA 4DVGA 2JJYA 4IX9A 1P33A 1FMCA 2CD7A 1H8HA 2FPXA 2QROA 4XWTA 4TL8A 1T4GA 3DZGA 2HEIA 3PZBA 2W2KB 4GOLD 3VU1A 1F3LA 2AK3A 2V03A 1CQXA 4HGNA 1YVPA 2XGMA 2XZTA 5AKEA 1UAAA 2FB9A 4QLOA 4DY4A 4RFSB 3ZDRA 1GCAA 1SK9A 1C8LA 1VA4A 3OEED 5JI2E 3GLFE 1TPZA 3KPJA 4QGHA 1GUZA 1V1MB 2YINC 2A86A 3PDWA 4Z7NB 2QXUA 1E9EA 3TG8A 2AYZA 3WRXA 2H65A 3NUZA 1C3XA 1QZTA 2GZSA 2ID4A 2ZT7A 4J0CA 2NO7A 4L5BA 2VZ8A 5KYVA 2D0OB 1VP9A 4C0KA 1FFEA 2AQHA 3H4VA 1XCPA 3ITDA 3LDFA 2HSGA 2CK3A 3QBTA 1IHUA 3IDZA 1AXRA 3ORFA 5EJ9A 2R66A 4EITA 2YVKA 2H2GA 4WBNA 3CNLA 4Z9BA 1DG3A 2ACEA 1C2YA 3R24A 4UAUA 3DLTA 3AC0A 1T0BA 1Y3CE 2IU6A 2QMZA 2IX9A 3JYOA 1X7YB 3TNYA 2IGTA 3NGXA 3QIVA 2ZTUA 4M60A 4Q1BA 3BPSA 1U3WA 2V7UA 2Q9UA 3HG7A 4ZAWA 5AVJA 1P31A 5I7UA 5K0GA 1N4AA 2ZUFA 5BN4A 1JT2A 2X8AA 4RHUA 3TD2A 4LV8B 4MV7A 1M2VB 3CIOA 4HI0E 2HQBA 3COZA 2Y66A 3CWCA 4LWZA 4BMYA 1ID8A 1BDMA 3N8HA 1KFJB 1L4MA 1A5TA 1NBEA 1HORA 5FLYA 5HRUA 3TMYA 3HBJA 4KSYA 4DV4B 3M81A 4M21A 1BMQA 1D2HA 2VK2A 4GH5A 2FR1A 4UREA 1JNYA 1PJQA 3DBIA 4I6GA 3KB1A 4ZT5A 5AYVA 4AFNA 4D46A 2OQIA 1GQOA 2H1IA 4ACAA 3VNRA 2H0AA 2BGIA 2V7VA 5IJ0A 1TZKA 3JQDA 4UVDA 1EX6A 3O4VA 4OIFA 4HN2A 3NTVA 1UAYA 2A1TR 2VYND 4JJAA 2C98A 2IXFA 3S99A 4EGJA 4XFDA 1L8OA 3G9XA 2V7GA 3DGFC 3G6WA 3UUEA 3FVRA 2I6UA 3UK1A 4IH9A 4KQWA 3OPQA 3ASVA 5DTJA 5BWLA 5AVSA 3T1YB 3BRSA 5C5IA 1A9QA 1EAMA 1HI9A 1VI5A 3NKLA 4UCFA 5AI0A 1HYBA 2Y0EA 1UPCA 2ID7A 3LX4A 4HQ0A 2CLLB 4H7FA 4PLZA 2FQXA 1N7IA 2C5EA 3MGGA 3QX7A 4E08A 2XY4A 4UC0A 3BEOA 3L7OA 2GJAA 1ZUHA 1L4NA 3FOBA 4JKIA 3C6QA 1ZJYA 2JFXA 5CXSA 1TLTA 2VSQA 3OZIA 2IPOA 4KXUA 3WK9A 2FWIA 2I4RA 3MC1A 3U44B 2R2GA 3QXXA 2K4MA 4ND7A 3FOCA 4FUTA 4ZFNA 1C7FA 3DGEC 2H11A 5EE0A 5DX8A 1TA4A 3LPAA 1SZCA 4QICA 5JAPA 2X76A 2HR1A 4GQBA 4OLJA 1DI0A 1WDTA 4BNUA 1J7JA 3GGSA 5BO5A 1ZZGA 1GEEA 3ZTYA 2G9VA 4EJSB 4Z53A 1L5RA 2YWDA 4WUVA 1GRRA 3O26A 3OMLA 4BZZA 5A4JA 3GLIE 2GPWA 1E0AA 1V6AA 1Z56C 1ZIXA 1ZH8A 2QRMA 1KYTA 3GZ4A 1ZGZA 4L4SA 2HLDA 4ACBA 1X7HA 4TWBA 4TPKA 1E2PA 5THXA 2X7HA 1NVWQ 2Q50A 4HPXB 3V7WA 1E5LA 4LDPA 3CRNA 1WMBA 5BQ5A 2PUWA 3ZN2A 1VIMA 3FW1A 5ITZA 3SYNA 5F3WB 2J5QA 3RSLA 2GJKA 4H7PA 3N6VA 3KB2A 2WB4A 4WACA 2G9NA 1DJQA 3V4FA 1LPBB 3WDLA 3CNNA 5JR3A 4IZOA 4DR3B 1QIJA 1E9BA 1TJVA 2XHZA 3ZV4A 1SIUA 1T24A 2BMAA 3K5HA 3ESXA 2GZAA 4J07A 5IAGA 4C14A 1HETA 1QGOA 1MU0A 4Q1CA 1G8HA 1KI4A 1Q0HA 2V6MA 3P32A 3NVDA 5CJ2A 3SS9X 2AJTA 2EDCA 4KBYA 3T99A 5IF3A 1G64A 2V96A 2P2SA 4I8IA 4NNOA 3FUWA 9ATCA 3OJWA 3A2NA 4NBRA 1K68A 2BHTA 3U61B 2HW8A 2OHFA 3LWBA 2G5TA 1OYYA 3QMVA 5JNVA 1USVA 3HJCA 4MUJA 4HLUC 3CSSA 4OB6A 2JCVA 3HXQA 4QQRA 3EAQA 5U1PA 4CU2A 4PFQA 5TE9A 5FBHA 1QYVA 4GLLA 4OH1A 3ZBUA 2VI5A 1CY4A 2VL7A 1QV9A 3SF8A 2Q5FA 1U04A 5E1DA 1JR2A 3GHYA 4IMPA 4G26A 5FA5A 5IABA 1TYEB 3ETGA 3EPLA 2ZT8A 4LECA 3AWIA 3W79A 1SBHA 1O6ZA 2BFEB 1GN9A 5DP1A 3FUVA 2B35A 4PCUA 4ZAYA 5B3AA 3V6LA 4N5NA 4MKGA 2QN8A 2FLWA 2FZEA 5SZJA 4TTRA 2MSEB 4L5YA 3QEMA 3VH2A 2VXBA 1PV2A 3RSOA 1GAXA 5AW5A 3OQOA 1JIKA 4UCQA 2YXEA 2GEBA 2FW8A 3PYXA 4EYQA 2C07A 2J1LA 3O84A 1L1EA 2NV0A 3ZTWA 5C1BA 5CTAA 5FBWB 1AZLA 4OHZA 1N5JA 3ISTA 4OGWA 5C7IO 1HEUA 4F3TA 2VDOB 4G4IA 4D8XA 1W75A 4ZO6A 2RKOA 3U1TA 3EJWA 3H9GA 3QWHA 4C21A 5JARA 4Z4EA 3C3EA 3R8FA 1WTAA 1M34A 3M6IA 1NWHA 3NM4A 3G0HA 3UJ3X 2I87A 4HKTA 1LW6E 2OFOA 1JSZA 1K1EA 3NBKA 2N46A 3DOUA 4U0JA 1K89A 4MQFB 5ENZA 5FX2A 1FEZA 1GTL1 2GN4A 3ODPA 4OHUA 1BRTA 1UZLA 2IEBA 3AX6A 3IHLA 4JP1A 4NK4A 5LZ9A 1S02A 3H97A 1JE0A 4P2GA 1QKIA 4YAGA 4MV0A 1Y1QA 4RSMA 3PK0A 3REOA 2AOUA 3U3JA 5HWSA 1QORA 3I1FA 3QVGB 4OA5A 1F2UB 2R4QA 1LRJA 2DB3A 4J4BA 4MYUA 2IZ6A 2BELA 1SKYB 3I0ZA 1POWA 4MW0A 4RTKA 2GYUA 5LYJF 4UUBA 4HTFB 1QE0A 2ZOSA 4TYWA 4HP8A 3G02A 3W2IA 1HURA 3BE5A 3IEIA 4BRSA 2DWCA 4J7XA 1NZFA 1DUSA 4DC0A 3SR0A 1PR2A 2DKNA 3JQ8B 4Q21A 4ZVOA 2PV0A 4I55F 1RAAA 3R7WB 4BCBA 4Q4LA 4DHEA 3R9XA 3CF6R 3RS2A 1E89A 1BVUA 1I0ZA 1U4SA 1ZVQA 3L7MA 2PXAA 1A96A 2C7BA 3FH0A 4MIKA 4BB6A 3AF6A 1Q21A 4PFSA 1E0DA 5DHPA 2XUGA 3B3GA 4ZC8A 1HGXA 2HD4A 2IITA 2IEAA 1A9YA 1U2GA 3P0RA 2PLWA 4CBVA 4CCYA 4PHGA 2RK4A 5EZ6B 4BZXA 2QN9A 1K6JA 2FQYA 2UVDA 1FYEA 5LP6C 1DPGA 2M6LA 3SHTA 3ZVNA 1KY2A 1JALA 1XQVA 4J16A 2XB8A 4XLTA 4DCSA 3PJRA 1K3TA 3OM9A 3ZWWA 2BR3A 1CQJB 4CM9D 3DFMA 1S3FA 2SNIE 5ELMA 2JASA 1W48A 3FM9A 5F1KA 1DAPA 2XWPA 1YZNA 4UAGA 2XE8A 3O8OA 2QU7A 5K0CA 2ZI4A 2A92A 5KDLA 3ZR4B 1BN6A 1JU9A 1C4OA 3BXOA 1FFGA 6ADHA 1I7DA 3O31A 2G3YA 3GLTA 4GPBA 3G2NA 3DEIA 5FQNA 4BUZA 4HDRA 4HWPA 4ZJZA 2OR3A 2VH5R 1TRHA 1YBVA 5F2NA 1N3BA 2VBFA 4LJ4A 1XN4A 2WUVA 3D2CA 5AH0A 5JH7A 3IVRA 2Y4NA 1A98A 1QOZA 3HRKA 2Z0MA 1E6KA 5CA1A 5JROA 2A59A 1Q3HA 3G8BA 2GWHA 3FNGA 2I8CA 1H0KA 5EXTA 1AH2A 2VXYA 1WXGA 4Q5IA 3D5EA 3DTYA 2ODNA 1NJFA 2Q5IA 1KORA 1NJ1A 2C2ZA 3NBYC 4LFCB 3BB1A 2FFJA 1DTEA 2DULA 4G1UC 3HA7A 1JBEA 4OM7A 1IWOA 1YCFA 2CXTA 3IDSA 5G0WA 1NW9B 4QEKA 5DBFA 3A3NA 4JCCA 1ESZA 4F86A 4D97A 3BFXA 3GXOA 1PZMA 3GGGA 2PEZA 4X8HA 2PY6A 2GH1A 2VDLB 1DCMA 3DZFA 4M9XA 4LHYA 4CG1A 4DFDA 2VJYA 4P58A 1SU4A 4GECA 2PX0A 2ZR8A 5H8WA 4LRSB 3WLJA 2YWFA 4DGSA 1N36B 1V5IA 3EULA 3DVLA 4D4JA 4NZZA 4IEEA 1GZ7A 4IJ6A 1H94A 1XAJA 4NYIQ 1J90A 3L18A 3E1GA 4K7JA 2P2GA 3V2GA 1VXOA 4M7PA 4OQYA 3TSAA 5EJ7A 1G17A 1EZZA 4AG5A 4G1EB 2P2YA 2H1RA 3O8DA 2JIZD 3AIKA 1XCGB 1Y1RA 2BFWA 2WUFA 2LR0A 4C78A 1WY5A 4C7MA 2HBYA 4LQLA 3UANA 1YCDA 4GL4A 4JQOA 4IEFB 1ZQ1A 5A6SA 3F5MA 1YTLA 2I03A 2JZCA 5IJ9B 2YIDA 2P9YA 1JVNA 5JW6A 5ESRA 1OQAA 3G0DA 3FKJA 2Q6TA 4C0LA 3L04A 2H5LA 2ATXA 1SG0A 2J45A 4G89A 1MFZA 4CL8A 3WYAA 1RPNA 3W4IA 4JL6A 1M8FA 2J31A 3CXRA 4RPCA 5F73A 4DXHA 1OXVA 2XNHA 1WR8A 2X1HA 2ZJ6A 1KZ6A 4NMHA 4X91A 4WZAB 4H35A 1JHXA 2PS1A 2K87A 2IVZA 1RRFA 1H9BA 3MIIA 2HTFA 4IIGA 3KHKA 1L4EA 3H04A 5AJWA 7ABPA 5FOQA 1JG3A 1RLTA 1P5ZB 5HUQA 1CXZA 2FSVA 1CJMA 2NQTA 3NB0A 3Q5GA 1XTBA 3QPDA 5KX5B 4KR3A 5FPPA 1PFGA 1U90A 1PNTA 3JVUA 1DIHA 1RBMA 3BA6A 1Q91A 3JQQA 1Z5PA 2YN2A 4HEJA 4UVIA 3SC6A 2HGZA 2PRIA 3GRYA 1AQJA 1CRPA 1A8SA 4PLYA 4TTAA 3OP4A 2NP7A 4B3IA 3BXPA 3OIDA 2FFQA 4WCFA 5B1EA 5FTJA 1R6DA 1B93A 1SKYE 1NW4A 1N5KA 1U2TA 2B7CA 2CFTA 3DLBA 1BS2A 4JYAB 1OBHA 2ZJ3A 3T6KA 4URZR 4BO9A 5CHEA 3GBVA 1OYWA 1UPBA 3SP1A 2Z8ZA 3IR5A 4RXTA 1LWOA 2O8VA 3TQRA 4NOKA 1KJZA 4IOLA 4HZGA 1ICEA 1ZC4A 2W6IA 4DLBA 1DO8A 2QI9F 3DAYA 5CG2A 1RRVA 4L5IA 4XB1A 1EESA 1G7TA 1CZLA 2VKTA 1X2EA 2PLRA 4KFSA 4DLAA 1LCIA 3SJ7A 4L7QA 5IS2A 1XRLA 3KFLA 5IT5A 4E2ZA 5ARDA 5K0LA 3H2ZA 3GJ7A 4UVHA 3PYMA 3QGMA 5CLHA 1UC9A 5FNZA 3ZDCA 4DUGA 2VNSA 3VYRB 1MAHA 2G1UA 2X4LA 4Z4IA 2HU8A 2DQKA 3K8QA 2DY0A 3V2UA 2AFVA 1HZZA 4EYEA 1G1MA 3SVLA 3OO0A 2G6TA 3DE5X 2VATA 3JATB 3R4CA 5EERA 2AXPA 3VDNB 4W5NA 1GR1A 4EY8A 3HO6A 1H5NA 3ZNNA 4DQLA 1JN0A 1PR4A 2P6UA 3KZXA 5CVDA 1ZJZA 1DX4A 3VOTA 5A04A 5KMGA 2JAPA 3A06A 4GXRA 4JCOA 1JFFA 4M7WA 4YFVA 5D85A 3V00A 4V1CA 5AW4A 1W87A 1UJBA 1REQA 2FQ1A 4KR2A 3KAKA 4UEOA 4HFRA 5ALMA 4A73A 5I4KA 1N7JA 1TU0A 2ZI5A 1P5HA 3GAMA 1VCNA 3I52A 1M74A 3PFNA 4PO1A 4ID9A 4R41A 3KLMX 3ZE1B 1GGFA 4E07A 3I0MA 3N28A 2PO7A 1X1CA 2AG1A 4ZQIA 3NM6B 1ZSYA 2J9FA 4TMXA 3ZKWB 1J2TA 4ZJUA 5CLQA 4B81A 2VP4A 3WP1B 3NONA 2GBPA 1QQ7A 1COWD 1WEKA 3KYJB 5I01A 2RK3A 1A9XB 1U94A 3QVJA 4KAAA 3UFBA 3R6DA 3ZZUA 2FK8A 4ZN6A 2UYYA 1VG8A 4Q3EA 2IF2A 3FG9A 2H7XA 5CEFA 1SQ5A 2WZBA 1CR2A 2NSHA 3PUXA 3VOSA 3FIUA 3RG2A 2WG2A 3S1AB 4ZD6A 1DQNA 3TOCA 1U7TA 1MF7A 1OJ7A 1OZAA 4YV1A 4QFDA 2OCGA 2B99A 4LDAA 3QYAA 2Q9CA 3FPCA 2DWPA 4TT3D 1O95A 4BNLA 4BWFB 4BZQA 4G9BA 1J9GA 3HA5A 3RF7A 4OG2A 1IY1A 2GTHA 4AD8A 2JF0A 1IEXA 4BFUA 1CY2A 1Q22A 3L6RA 3WOHA 2OT3B 2BHRA 3QU5A 4NU8X 2NTYC 3W04A 1WPRA 2XNDA 3I6IA 3CZ9A 1NHWA 1TKAA 2EP7A 2H5JA 3AF3A 3GUUA 4HLDA 2KJQA 3K0AB 3I5XA 1XWIA 3D43A 3LECA 1G20A 4FSDA 1H5UA 1AXGA 3O6VA 1XRSB 4CM7A 5K0JA 3HBNA 5JNRA 2PUCA 4B0OA 3M3DA 3Q8LA 4D6YA 4LK3A 1I2CA 1UT8A 1VFNA 2IC5A 2C03A 4D8UA 1MA0A 2YWRA 4OL9A 5KQPA 1M2WA 5TRTA 1H2AS 3RJ5A 4C3ZA 3AM4A 2PGAA 2SKEA 4RVGA 1QRRA 4EKDA 5A4DA 4EG7A 4MAMA 5K1ZA 1TJPB 4Q7JB 3A04A 2XTJA 4XRGA 1BGXT 1EAYA 2WUWE 1JECA 4R01A 1XPJA 2CC2A 2ZB2A 3DF7A 1BKYA 3FCEA 2ZVJA 4W8OA 5AK6A 3BICA 3FI9A 3B1ZA 5GONB 1IUKA 3LL7A 4YAFA 1EHYA 1FQKA 1UXKA 1QS0A 5DM2A 5CK4A 4ZYVA 1W4CA 4GP6A 5ELXA 3HVJA 4EHDA 3V55A 2P1RA 3MJHA 1H2XA 2P6RA 1CCWA 1DBIA 2FP4B 3EEOA 1XPOA 3NOOA 1T13A 1X2BA 1JPJA 3I5UA 4AP6A 1I1HA 1P2UA 1T1RA 3F3YA 3LT4A 5D84A 2JJQA 2CFRA 1EUCA 1JDPA 4LUCA 3JASA 3P96A 3R76A 1BD3A 4QOJA 1U2PA 1NI4B 1YI8A 1ISFA 1OY1A 3OJLA 5CUQA 2BEVA 1TIBA 4XGIA 4KQ2A 1XVLA 2GD2A 2PS0A 1LUAA 1LS6A 1O1YA 4GYWA 4CKEB 4OGKA 4DM7A 3R9WA 3ZHOA 3CY6A 4AJJA 5HXAA 4EHBA 4Q03A 1DU4A 4MS3B 4QEDA 3LA8A 4MIOA 3VNUA 2I2CA 4QDXA 3B70A 2R4UA 1ZGCA 2Z1MA 4N5HX 4GLBA 4ZJPA 3BZBA 3DMTA 3O92A 3QLVA 4QUDA 4DWVA 2F43A 4RV5A 3UCXA 1U8EA 3L7JA 3IAXA 4WNCA 2JFYA 1U0HC 4PLCA 1LI4A 2BJHA 3L9XA 2QY6A 2W6NA 4AQYB 3S8YA 5A0TA 1LRKA 3TE7A 1CJUC 1GSAA 1K0UA 1Q16A 1Z5OA 2Q07A 4TWZA 2Z2ZA 5KDOA 4RTRA 3KQVA 3ZOZA 2QKYA 4NABA 3UMCA 4JLNA 1DARA 1KVUA 3IRVA 4WECA 3TTSA 5FR2A 4L6CA 3OCFA 1PD0A 2ALJA 2R11A 2C2YA 3EK2A 1QYCA 4YCMA 4HL6A 1A97A 2HOQA 2A9QA 3BHNA 4BKOA 3U4DA 1IN7A 4I50A 1WUHS 4KE7A 3VH1A 4MS4B 1RXUA 1SG9A 2H57A 4Q9JA 2XUOA 5ECGC 4TS1A 2P65A 1Q1ZA 2R2AA 3DONA 1QXSA 5WRFA 6GPBA 1KMMA 3EARA 5K6AC 1WU7A 2RAFA 1PLJA 2B1QA 5E4TA 1DKNA 2QUJA 3EXIA 5F52A 5CDFA 4DLNA 1GSHA 1A4IA 5FNVA 5A9SA 3N6XA 1K6MA 4HRXA 1Y8CA 2WR8A 3PC8A 3IXMA 3O93A 4QARA 1RYYA 5TY0A 4LRUA 10MHA 2BCGY 2DFKB 4NH4A 2WFZA 4U6NA 1WOMA 3RSCA 3SN6A 4ENRA 4NAVA 4JKOA 2R25B 3MJCA 4ATNA 5B4VA 3SXPA 1FB5A 1USWA 1V47A 3GU3A 5DNUA 1PK8A 1DQSA 4BO0A 3RSSA 3PXDA 1FNDA 5TGDA 3M83A 2YOGA 4OQZA 3QVOA 2PTRA 3CKMA 3EPPA 3A6KA 1CDDA 1IC6A 2W7TA 3FMFA 1I4WA 2Z5FA 4FMPA 4ICIA 4IV0A 4QA9A 4Y2QA 1BDBA 3WK5A 1GTMA 2C99A 3CA8A 3FTQA 2MDTA 1C5KA 1AMNA 3TLCA 3QBVA 2V0NA 1GDDA 2UVQA 3CX4A 3SDSA 1WPQA 1UPUA 3LKVA 5FOXA 3SMVA 2B1IA 3HRIA 4B3FX 3K09A 3WQBA 1X39A 2EG9A 4DLKA 2R87A 3V4OA 1M1YB 4CLDA 3TMKA 3RTEA 4NSLA 2OBLA 4YPFA 5JSZB 3C6BA 1QFJA 3DCJA 2Y1DA 4F5EA 4KGDA 2ZLBA 2VQ3A 4GQIA 5E6SA 1QH9A 1RIFA 2BR5A 5F35A 3ABRB 2M98A 4KQXA 5U4XA 3TFQA 2ZR0A 1XZEA 4ARZB 2HRZA 1NT2A 1T0UA 4CTKA 3RAEC 3PXXA 3QJGA 1FU4A 2YHIB 4H3KB 3WYEA 1ACMA 5CH3A 1GFZA 1KTVA 2GN8A 3RUCA 2LKCA 3W8FA 3AF4A 1JDSA 2X23A 3F5FA 3I6BA 4L4XA 4QBKA 4J1QA 2GYYA 2F1HA 1W2GA 4YP5A 5ALRA 1VIVA 3K8OE 1W59A 1SKMA 1U9IC 3ADKA 1RWMA 1WTCA 1YFEA 4HMQA 5CXXA 3TECE 3ISJA 4X63A 3EEYA 3VR6D 3W5DA 1RTTA 1SCKA 1TJ4A 5KYUA 2QLTA 1TAUA 2HIMA 4WXMA 3FPEA 4CR7A 5HKOA 16PKA 1MJNA 4XWAA 1WB9A 1SVKA 1UBCA 2VJQA 4GOXA 4OXKA 3BBPA 4RY0A 5ERYA 1WOYA 2GEDA 2RSLA 3FWKA 3K0KA 2OA0A 3U39A 1VBMA 4BTEA 2H00A 4BFXA 4FQ7A 4M9CA 5MGBA 3OTOB 5JTUA 4FC7A 3PKIA 1I9CA 3EUWA 2HSWA 4IUDS 1HA3A 5B1YA 3SBEA 2IPLA 4I5FA 3EGCA 1KHHA 2ID8A 3SNHA 3VYWA 2JBHA 2VLBA 4A6DA 4QUGA 1YSCA 3H0KA 2JGLA 4Q4HB 1KK1A 3PEYA 3HY4A 1E61A 4G8BA 1R0SA 2P9CA 3KV1A 5E1OA 3D8RA 4DMGA 2V58A 1BS1A 4JH0A 3FPHA 1P7ZA 4U02A 3TJMA 3ZWOA 3UHJA 5HZKA 2BZ0A 3QXGA 1XK6A 2P62A 1YGPA 2QAGC 1JKJB 3MZ0A 4N82A 1GCIA 2HHJA 1DBRA 1C3VA 4LE2A 3W2GA 3OPNA 2Q7DA 4AG6A 3F2IA 3D1LA 2H6EA 5A5FA 3P9KA 3GDGA 4YRAA 3R41A 1KK3A 3PFWO 1CUHA 1FYXA 2F3SA 2IHBA 2W2LA 3Q8WA 5CVUA 4E03A 4Z3OA 4U2FA 2MINB 2VWHA 1E6EA 1W88A 2ZZKA 3NYIA 3S8MA 4GNKA 2PRKA 1W4LA 3MM4A 1RLOA 2UKDA 3FPKA 3T3GA 5LLSA 1P75A 4US1R 2YMMA 2FSFA 1P3DA 1P1JA 3B6KA 4G2TA 4N3BA 5IW8A 4BNNA 4QLBA 2J48A 4TZ0A 4EX7A 3JSXA 3MUNA 5DBIA 3CRMA 3ONVA 1OI3A 2QMYA 2CY0A 3BIOA 1F8FA 5AVZA 4UBKA 4KODA 4LY9A 1NLFA 1W52X 2AZMA 3A1TA 5E2IA 1UBNA 4W99A 2BHSA 2CMGA 4PAMA 3RYFB 1RXEA 1M3SA 5AHRA 4P4NA 3D4BA 1NF8A 4GOMD 2ENUA 2C9CA 3Q1KA 3DXYA 2JI8A 4IRUB 4ZCMA 1EK0A 3U9SA 3W5CA 2AZDA 2IYPA 3IDQA 4FGJA 3WYBA 1Z0DA 1BVHA 1L3IA 3R0ZA 3R9IA 1ETUA 5JUWA 5LLDA 5HCUA 2ZSAA 1FTWA 1YQEA 3A6ZA 1J8DA 3OU6A 1V9LA 1RJEA 1Q20A 5AJHA 4NZ9A 4TMKA 5HMMA 5EP4A 1P62B 2DQSA 3ECAA 5DTMA 3V4LA 2UVPA 2W6QA 1ES9A 1T2UA 5KQMA 2V7PA 5FPQA 5GZ3A 1RXWA 3F9CA 5IYZA 1WSBA 4QU5A 3QLUC 2NSJA 4NBUA 2YJ6A 2O52A 1CTQA 3ACCA 3DEHA 1DXYA 3E2MA 3GFSA 3HLTA 4CE6A 2WAAA 1IJFA 2JKVA 1ZD4A 2QRZA 3LDHA 1KEEA 3VR3D 4J49A 2ZUSA 2VQFB 4P4SA 3C3KA 4KMOA 3GLIB 5FUWA 4NYMR 3BMCB 2G5CA 4L0QA 4CV0A 1LSSA 2JIMA 4HGQA 1SRQA 4PR0A 3KD2A 4UBOA 3BM5A 2QUAA 3JYQA 4F21A 1T43A 3OPXA 2L17A 3CBGA 1XQXA 2E1RA 4LI0A 3MUEA 1CYDA 1OZ0A 1P7PA 4V0QA 5EWMA 4DV1B 3RU7A 3OUZA 1CP3A 3PF9A 1XO1A 1Z37A 1ECCA 4D02A 4MVJG 5KYGA 1QHIA 1I2AA 2JAUA 2UZ1B 5HZMA 1MCZA 2K2QB 4BOYA 4M8KA 3L6OO 3VPGA 3CZCA 4K81B 3O8NA 1X7XB 4IGKA 1Y4UA 1N32B 3TNLA 4G56A 3PQDA 3FAZA 2GBGA 1DOHA 3H4IA 3VR5A 3FTCA 1YZGA 3HJGA 2V1XA 4G1MB 3NHLA 4MI3A 4RIIA 5HE8A 2XYGA 3ZCPA 4UTXA 4JQCA 3STTA 1O6GA 1VI2A 3BWEA 4R1OA 4K6GA 1NVMB 1PIWA 5TB5A 1OH6A 2IY8A 5L4SA 3EXAA 4PQGA 1K6XA 2XVMA 3AHEA 4BFCA 1OILA 3RODA 1XALA 4MDHA 3F6YA 2JLZA 3EW9A 3LL4A 5EJ8A 3PTZA 4LDQA 2HMWA 2RGGA 2Y2VA 3C14C 4HLCA 4DARA 1BXGA 4ED9A 2D2IA 1WG8A 2CLKB 3B6EA 3I53A 4D7AA 3Q87B 1WULS 3C8ZA 1ZMOA 4ER3A 5K20A 3UO8B 5MDHA 2Q3BA 3CLVA 5GZ1A 5AT1A 1U99A 3B1KA 5KYKA 5FBLB 4KPUB 1CC1S 3C6MA 3GB9A 4M89A 4XAQA 2WP0A 3QBPA 1Q1GA 1EFKA 4MQUA 1Q19A 1IN4A 2FUEA 4N9QA 1ZIOA 1I33A 3D0QA 1CB7A 4DJEC 5BSHA 1Q3KA 3A9CA 3RBAA 1C3OA 3BWDD 3FB1A 3K53A 2E5FA 1ODTC 2GZ2A 2QRVA 3R4VA 4YBRA 3HCAA 1BMFA 3N2LA 3FTNA 3JU3A 2IYXA 4OYLA 5DGCA 3S7TA 5FPKA 1GVNB 5FO1A 2AYYA 3Q8MA 2RDMA 1NTRA 3M4XA 4M7RA 1J39A 2K7ZA 4D80A 3KTAB 4EMUA 1HY0A 4HTAA 3DDHA 5EPEA 1JDZA 3SE0A 2Q4EA 3T34A 2XB4A 4FDUA 2I7VA 1C3JA 2FVYA 5HKBA 5HIAA 4BCCA 5I9LA 4AMVA 2XCOA 4LK2A 3KLOA 3D8SA 4G4SP 4H4DA 1VLZA 4DJJA 4EGCB 5DGIA 1V48A 1OX6A 1YFKA 1C0KA 2C88A 2JGDA 1QYXA 2RHWA 2CNLA 2C8KA 3IO3A 2AC4A 4I5DA 5CU7A 1JHPA 5FTLA 3W5AA 2DPHA 4ZK6A 1YDMA 4HR7A 1DJMA 1V1RA 2XE7A 1UZMA 3M0EA 3QXCA 3RD5A 4OQXA 3UTDA 4MI6A 3D0OA 4HDNA 5CTJA 5AO9A 4TKUA 5KCMA 4CGYA 5F3DA 1T6NA 3KYIB 1CZKA 4D9MA 4NR0A 6REQA 2E0IA 1VYVA 2FP3A 2UV8A 1YR8A 3S44A 3WKDA 2HJHA 3KXLA 4KSBA 1NXQA 3FPSA 2R1UA 1CY7A 3K96A 1RZUA 4YAOA 4LJAA 5HILA 4CEHB 3O7WA 1ZH6A 1B3BA 4L4UA 4HQ6A 2WZQA 1W85A 5L45A 1HNNA 3X2EA 4NBLA 3EVGA 3ZWQA 4C07A 3I01A 1JG2A 1OE0A 3AWDA 4G1FA 2PX2A 3ZV5A 1GAWA 1MJGA 2C5AA 2D13A 3JVIA 4ND8B 4NMWA 4ZI7B 1IK6A 3GJ0A 4LHXA 2MR6A 5FBZA 3AEKA 3TSYA 4UZFA 2XYVA 2DHCA 4NE7A 1CRWG 1DBSA 3ICEA 4ENSA 1UDXA 4I3GA 5AOVA 4LGCA 4OQNA 1GQQA 1WD5A 2FR8C 1BWRA 3PA8A 4GI5A 3HA2A 1UMCA 2EKBA 2GK3A 3QHAA 1KEUA 4DYVA 3W3AH 5B36A 2XGGA 3N70A 2F55A 3BFVA 2YUIA 1N6RA 1IEVA 2B1JA 4MRMB 1J8YF 2RGNC 3C6XA 3RFCA 3B2QA 4B4DA 3MIZA 3CRQA 4L0CA 5B55A 3CF4G 2ZRQA 5BVHA 5LMZA 2QWXA 1VHDA 5HIIA 1BE1A 3VU3A 3HJTA 4B4KA 3HBAA 3LDAA 1KAGA 4IO0A 4LXQA 3NW9A 1PT5A 3L4BC 5ED4A 4KU4A 4JHLA 1NPDA 3TF5A 1AKEA 3HYCA 1A8HA 4ZQBA 1B0PA 4MWOA 2Q9BA 2YV3A 3KR2A 4BJHB 1WZEA 2GPTA 1F0NA 4ENWA 1N0IA 3V8QA 3PHIA 3FDJA 2HX1A 2P3SA 4MGEA 2AFHB 4RDIA 5TF4A 3BK7A 1QVAA 3A37A 3VH3A 3LW8A 3ZV3A 3FHJA 2QUKA 3GP8A 1BH6A 1BHQ1 5K4AA 5MGNA 2GI4A 1B6TA 2WU3A 1X19A 4Q05A 1TMGE 2FW1A 4DN6A 2H1WA 2J30A 3EGWA 3HKDA 2P6OA 1RW4A 4DV6B 2ZDHA 1DOFA 1H1LB 1UK7A 1YRWA 5J2UF 2NVWA 3F6RA 3L05A 3PUWA 3L6EA 3TR5A 2GBLA 2BTQB 4PWYA 2E89A 4DNXA 1QH8A 3DTNA 1QC5B 1IUNA 1XRRA 1DGQA 2DR0A 1T0JB 2PX4A 4FYKA 5DBEX 1R8SA 2EKZA 3FZNA 1W6UA 4FK8A 4UU7A 1R0CA 1K6EA 4HEHA 5C31A 4C7KA 2GCOA 1Z7WA 2CEKA 3HI6A 1Q1EA 1T9ZA 3F7MA 3IIIA 5HA5A 1XFDA 2BGMA 4ZI7F 1IG0A 3OC6A 5B4UA 3HEBA 3BGWA 4DJAA 1SULA 2E3JA 3PXAA 1DXOA 4WGGA 3HVUA 3PC2A 5E6RA 4EKYA 5HBRA 5KTNA 1R0RE 1X6VA 2J3DA 1IXRC 2Y67A 5JMWA 4IJWA 4AX4A 3JQBC 1JXQA 3ND6A 4FMCB 3LY5A 4F46A 3IUEA 1FRVA 1GGNA 1KZHA 1WDLA 2DFTA 1D2NA 1S3IA 2M9MA 4N7RA 5AD1A 5HJEA 1RZRD 2E5LB 2I71A 1HMYA 2AQ8A 4RYDA 3RF6A 3G68A 1QHYA 4FFRA 5D3MB 1KE1A 2FUKA 4BDSA 4CETA 3A4NA 3DKPA 5FTNA 1GPMA 4U5QA 2Y0BA 2NYRA 1YZVA 3PC7A 1Z68A 1O89A 2IYYA 4FBGA 3RJZA 5IBQA 4OI1A 3LC7O 4JLPA 5HKLA 3SC4A 5KJFA 1W0KA 1NVTA 2VXCA 3LKDA 4YS6A 3CWQA 4F9FA 5F2EA 3KKEA 2XSZA 3NHKA 3ZHRA 1TRKA 3TCXB 4Z3KA 4MVJD 4FFSA 4P7FA 5DK4A 1OKKA 4G25A 5TQ2B 3PNQA 3M6XA 3ZW7A 2R5FA 4LOAA 1DC4A 2B2CA 2PVPA 1EX9A 2PZFA 1DAHA 3IKLA 4NX2A 4TSFD 3W6UA 5KWVA 1TTPB 1R8QA 1IWBB 3OZEA 4BUCA 2YV2A 3MRTA 1T35A 4PSAA 3ITNA 2GCPA 2G25A 1NBMD 1OWLA 2IZOA 3GMDA 1SIBE 3OQ6A 4J7AA 4MB0A 5JG7A 4BNDA 5JV5A 4F38A 3WIOA 5ALQA 3ENWA 4A1OA 3G23A 2GM9A 1PL8A 4XUDA 3OZWA 4DS3A 3KJNA 1F6WA 3N0TA 4WD3A 3GLVA 4A8JB 4CLRB 2UYCA 4JJ8A 3V80A 2CWWA 2YXDA 2AXNA 1NXVA 3JZFA 3COPA 2BN4A 5K3AA 4AJNA 4GZ6A 4M0KA 4ZIRB 3QNMA 4YRIA 1ZU4A 3E4DA 5EMMA 3JQCA 2COUA 2P4HX 2DRIA 2XGOA 4E2XA 2FEPA 1IK4A 1XZBA 8GPBA 2Q2NA 2ZG6A 3BYZA 3PBKA 4XVQA 2ZIUB 4A91A 3EVAA 2F9FA 4R5HA 4BUJA 1FFXA 2RG7A 5J2TF 3GTDA 2QF7A 4KLAA 4TV9B 2CXPA 3PENA 3LTNC 1BXZA 1PS9A 2BZ1A 2WM9B 5A7HA 1I4DD 2V9ZA 1XAIA 2F7SA 3R7LA 2J6IA 2QG4A 4Y6GB 3H05A 4W6QA 1DKLA 1JPUA 1R10A 2QRKA 2Y2UA 3S27A 3UGJA 3OKPA 4AROA 4DTIA 4FOOA 2FW0A 5TMPA 3PICA 2JEOA 3L49A 4JODA 4LJ8A 2VQDA 5JASA 4BX8A 1GJRA 2C9MA 2H54A 1Z4QA 2QVYX 3MJDA 1ULBA 3DBLB 4X20A 2CEAA 1YXMA 3AKCA 5EIBD 1KE2A 4BQPA 1MO2A 3TLMA 3HZHA 1SBCA 5JMPA 4F4CA 2YXLA 2NT3A 4DE5A 1H1DA 1ENPA 4J1TC 4RNCA 2R68A 1KJ8A 4EB6A 2XVZA 3QTBA 3HFRA 3IOBA 1XA0A 3P9CA 4UNRA 2NPIA 4FKZA 4OFXA 5IM4A 3QG1A 2Y1CA 3F8SA 4NEQA 3WB1A 2BJVA 2I4MA 4XWKA 1AV7A 4BAUA 1G42A 1B6SA 1XTVA 2CNNA 2J4FA 4JELA 4K26A 4E5PA 2AFHE 1EG2A 2VEDA 4V0SA 3O91A 1ZCZA 1W4RA 2ZYUX 3FD8A 4HADA 5D2CA 3UYLA 4GX1A 4WZBB 4XWOA 2OFXA 4QGBA 3MJVA 1MOSA 3NBZC 2JH9A 4R1MA 4TM8A 2DR3A 2SHKA 2OAGA 3C8MA 3MMSA 4WXRA 4EFMA 5CJPA 3QFHA 3VQTA 4QHYA 4DF3A 4ZOCA 2AD1A 3PUIA 2NW6A 3CTMA 1KARA 3UGKA 1G60A 3LG2A 2ZYRA 3TAUA 3PGA1 3UWDA 3K9LA 2NAPA 4WJLA 5L9AA 2QW1A 3OX4A 4D26A 1YVRA 2F1KA 3V8PA 4D82A 1JZQA 4A8TA 4TV9F 3TB6A 1S4QA 4J03A 4UQLA 4KUEA 4RD1A 5LZ2A 3WZ2A 1Z29A 5BVGB 1RBQA 4EMTA 3BMNA 4F3YA 5K3DA 5JO9A 4NV1A 4A82A 3NMUF 2PANA 3QELA 2IHZA 5KTOA 1PJAA 3LHIA 4CKCA 4RH1A 4XDGA 2EYUA 2B0CA 1URPA 3HKBB 1WO8A 4I5GA 4RSRA 3IEMA 2WUEA 5A3RA 3UOAB 2H92A 4Z5XA 5EJAA 5AIBA 1TT5A 3WR5A 4EH1A 2G0AA 2YR0A 1LC3A 1NSFA 3NDRA 1Y8QB 3DDOA 1ZW6A 3G0BA 1XLTA 3MJFA 5CNIA 4BFWA 2P9TA 1JHAA 1FOEB 4JK3A 1RMTA 2C4HA 2VP5A 3IULA 5KYWB 1JVBA 5KOHB 2AOTA 3OU2A 1K7CA 1Y5MA 3KR9A 4IIUA 5EJIA 1YFJA 2A88A 1POXA 4BB5A 1USUA 3DE7X 2CCKA 3HYTA 1X8JA 4LRYA 2NO5A 5HFNA 3U81A 4A0RA 1ORVA 2NSLA 1XEFA 1NYLA 5IHPA 3A4LA 3SJAA 2XCIA 1ZCAA 4G3XA 5HMLA 4CLOB 5IAOA 3P45A 2UXDB 1P2SA 1EBFA 2YXNA 4LE1A 3VZBA 2ZJZA 1CX9B 2ZBFA 1I01A 3STXA 4EPWA 3FBGA 5LA6B 4ALKA 2W2XA 1Z5GA 3U4QB 4L2IA 5CVTA 3T5AA 2JIRA 2ZI9A 2J3EA 4IUYA 4ISCA 3IAUA 3L0IB 2ACWA 1JEJA 1NVEA 3KWJA 4NOMA 5LR6A 2PSSA 2DT5A 4KQFA 3N2IA 4N6GA 2CBGA 3RKRA 4W63A 5DO9A 2EP8A 4HWSA 3PNLA 3BMOA 2ZSDA 3ZZ0A 4JT9A 2Z08A 4NF2A 3LZ6A 4WAUA 2F3QA 4CQJA 3L6BA 3VVCA 1TCCA 2GKGA 3CG4A 3FSJX 3KZKA 5AW7A 3TGPA 4QBIA 2VAXA 1AO0A 4KR0A 3N0WA 4Z99A 3V8RA 4ABYA 4C4OA 2YHAA 1Q7EA 1VL8A 1ODIA 3NCHA 4RTSA 3D5TA 4V0MA 4AB1A 3PX7A 4HB2A 1J42A 1WA5A 1SNYA 3EVZA 1SB9A 4PGGA 4RMJA 4JFAA 2ECOA 4P4LA 2JCBA 4M53A 1ZU5A 4X1KB 4XGNA 3JWGA 2GSDA 1YDHA 3BKWA 3GAAA 5T6BA 1L7NA 3KQKA 2XRYA 3IH5A 4M88A 4BKMA 4E4YA 3SHVA 1U7XA 2RHGB 3RUHA 2WMNB 4JXJA 4YXWD 3EXEA 1UBJS 4UUAA 4AZTA 4WWHA 2BRUC 1KZYC 4CM6A 4MUEA 5JCOC 4RZ2A 3DG9A 1PS8A 2X0NA 3GVPA 1DAFA 3RIXA 1QCDA 3PPVA 4O2AA 1O8CA 2B5OA 2IYUA 1OT3A 4RIHA 4WW0A 5A3VA 1FW6A 3SIRA 1UMDB 4AT1A 3IR6A 4BMOB 1FDUA 5I7OA 2XQKA 4HFJA 3U13A 5CK5A 3AKEA 1XRMA 1YUBA 1RWOA 3BDVA 1NU8A 3CLRD 4JGIA 1E9CA 1VLHA 2PL9A 1WW8A 3OC0A 4P36A 3M6VA 4PF1A 4A23A 1BH2A 3C6YA 3CNQS 4MUMA 4RZHA 4YUVA 3K9WA 3TQTA 4BP1A 1R4NA 2NXEA 4C4AA 2XIJA 3Q9LA 4UATA 1EJ0A 4XGRA 4DR1B 1UJ2A 1NG1A 3PNMA 4OK6A 1QH1B 2JW5A 2QV0A 2H16A 2C9YA 3KUXA 2VP6A 4IDEA 5GWXA 4LN1A 4ZO9A 3NEYA 1RXSA 2QQ5A 2ATCA 2PXHA 3D7RA 4TMTA 3IAHA 1MOQA 5G41A 4EHJA 4WNAB 2XMSA 1IVSA 5FULA 1BVRA 1I7NA 1JP7A 5FCDA 5TPWB 3RIEA 2D54A 2FG6C 4D6XA 4OXYA 4WTOA 1M8JA 2D2XA 2NPOA 1J8MF 5AOBA 5DN9A 5LFAA 2GMWA 2LP4Y 1XZHA 1O6FA 2H1VA 3BD9A 1P29A 3E6AA 3WGTA 5JDIA 2GO7A 2FPRA 4N4AA 4UOEA 4CTMA 1H0RA 1V6SA 4RTQA 5F2OA 4MXDA 5B2EA 1PR0A 1PFUA 1WB4A 2DCUA 2VDWA 4KXNA 1I7LA 1XP8A 2RAUA 4EP1A 1KK2A 1SWWA 1OBOA 3EWNA 4X65B 1ISSA 3ZOKA 3LNCA 3ZQJA 1OLXB 1K75A 1JJAA 3GJTA 4BDTA 4CFZA 1C9DB 2QU8A 1T8WA 1XEWY 2HB6A 3EYAA 4YTEA 3PZRA 3IPRA 3TFWA 3V8MA 1L8QA 3K6RA 4L75A 4GLOA 3N9IA 2AMJA 1T9GR 2I22A 4U3JA 4H4CA 3WYCA 4CDGA 1QYWA 3CJRA 1UCFA 2X9LA 3SDBA 3VJMA 4XTCS 2Q4RA 1P60A 1CE8B 1NUHA 1PGJA 2BGLA 3E2IA 1C3EA 3FRIA 3KZCA 3MELA 4L4ZA 1QP4A 4G67A 4ZQGA 1JMVA 3EAGA 3KELA 4I1PA 4MHOA 3PIDA 3CLRC 4RVCA 4ND1A 3GLGA 1PDOA 1A1SA 1E20A 5CYOA 4L8VA 5ALIA 4JP5A 3Q6MA 1OFIA 2XHEA 1E98A 3B52X 4IEIA 1EWYA 3SXUB 1G63A 2NV2B 4MW7A 3BRWA 5H16A 2IYFA 4WKNA 1C1DA 4GD3Q 2FDCA 1ONSA 4NDAA 1NW7A 1N2CB 4YMUA 2OD7A 1RBZA 1ULTA 1ISIA 1IBCA 2C4WA 2NYAA 4JP2A 4K6CA 2QJOA 4C0BA 3K20A 3DOOA 3ICVA 2PU7A 3Q7RA 4EEZA 1UOQA 2J7KA 3NJ8A 1N3YA 5KS2A 3W4JA 4C5AA 1RQNA 4LVOA 4GICA 1QPZA 4YJFB 4PQRA 4ARAA 3P0IA 2BMVA 1NMEA 3D3JA 3QJYA 4XJTA 3GVIA 1VHLA 1R7RA 2IQIA 2QP4A 4IMRA 2Y77A 1J2YA 4PFJA 1M5TA 4M6WA 1C8VB 2IVFA 3OF5A 2OHJA 3UXHA 4BRZA 5BN3A 5K0ZA 2YXBA 3ZY3A 4ZMSA 5IT0A 3AB7A 2G77B 4I19A 4KDRA 1DDIA 1TYCA 3U7HB 4JJ4A 2OCLA 4Z0HO 3UNXA 1MJFA 3RSQA 5LP6F 1PYGA 1ZC3A 1N9GA 3TQSA 4EJ0A 1RI1A 3H1AA 1X80B 4YPVA 3UATA 1MABB 2YQZA 4YVFA 2HDNB 2CXXA 3U3KA 3EVCA 1CR1A 3I2IA 4GMGA 4GMXA 3DPUA 2ZFUA 2ZR7A 1KZGB 4JMPA 3WGOA 4R6WA 1KL7A 3F8WA 1LSOA 2H9IA 5FO0A 3DTVD 1ZUWA 4BAZA 4DQUA 4EG1A 5LWQA 2C20A 2I1VB 2WFAA 4K3UA 4EPVA 1SUAA 4M1KA 4HGVA 3C3XA 4IQFA 2JB9A 1VKJA 2PUBA 2BUBA 1CJBA 1UJ5A 2IJGX 3IOCA 3N8GA 1XE3A 4EF4A 1W4AA 3DOIA 1U1IA 3VGJA 1LSUA 4HUTA 1LI7A 1GT91 5KHAA 5KNCD 4M37A 4UM9D 1GZUA 3FOZA 1DG9A 4KGVA 4PBTA 2AEJA 3F6CA 3WAKA 1GIAA 1QIHA 3JQ9C 4Y0VA 4MO2A 2OCPA 2PX8A 4GKVA 5TT0A 3Q0TA 3B36A 1GPJA 3EXHC 3MOSA 1H6AA 1T6YA 1I3LA 2RB4A 4F04A 3N1UA 4KPGA 3L41A 3C6KA 3CX8A 2XGJA 1EBUA 1GZHB 2YC4C 1MA3A 2HRCA 3GLUA 3ZZ1A 2W42A 5KTYA 4H6WA 1AUVA 4DLTA 1WP9A 3NHYA 4B17A 5E38A 2X3YA 3TI7A 2FNAA 1CBUA 3HKEB 4QUIA 3OSZA 2I9PA 3L0YA 1E1QA 4AF8A 3OKAA 1YB6A 4EUKA 3NS7A 4EO7A 2BI7A 1FYFA 3QF7A 2XTNA 3GJ4A 1I4EB 5C1PA 1KI7A 1VL2A 5IPFA 2QRHA 4O5AA 2ZBEA 4B3BA 1J8VA 4MVJE 3GCZA 1U3CA 2O9JA 3QOWA 3ZHUA 3VC3A 2VJCA 4N41A 2P0EA 3B9RA 1LTQA 4NZNA 2R1VA 1X87A 2O50A 3GEEA 4J9UE 3ZWAA 1C7EA 3JQRA 5IC6A 3RADC 4OI0A 4BYMA 3K05A 1DPFA 2H07A 1XOIA 1PQPA 2ZE7A 1A4XA 3LKZA 4NS1A 1LH0A 3TDNA 3W9YA 3RFUA 4RWEA 3RT9A 2BKAA 5CLFA 2GKOA 3U3DA 3FGZA 5JPIA 2X1VA 3F4SA 3MN1A 4ZI2A 1O94A 2BMDA 2IIPA 3TUJC 1EZ1A 4UUQA 3LUAA 3ZWDA 1JT9A 2Z95A 1X13A 2E55A 1VRCA 3V7FA 2GXSA 1JSRA 3EZ9A 3OA0A 3WA6A 2Z6AA 4UHEA 3G1UA 1Z0ZA 3E15A 1ZYUA 2VSNA 3DEAA 3ID6C 3E9DA 1CJVC 1LV7A 3WXMA 4ML3A 3STYA 4AP5A 5G0UA 4W7IA 2B7BA 2UDPA 2YWHA 5DN6D 1E77A 3IT2A 1EKXA 3AM1A 3FTFA 4GI1A 1J3UA 1V37A 3IGFA 5B3JA 5BN5B 5K3CA 4PGMA 4F6LA 1P5FA 2AE1A 1Z88A 1NJ5A 1T1JA 3BTSA 5F51A 4JC0A 5E0KB 2IV7A 3TLKA 5CPBA 1XZFA 1N8NA 2JGAA 1PNQA 3QY9A 4H18A 8ABPA 4HLNA 4D8YA 3EXG2 5MFPA 3T7IA 4PGFA 3B6IA 1C9NA 4CJXA 2E21A 2BGKA 3NH9A 1PK9A 2BEWA 1I1OA 1XQ1A 1MRSA 3ABIA 1NNSA 3EZYA 4HBZA 2ZAMA 2VPTA 4FZJA 4K6FA 4F2PA 2ZSEA 4HNVA 3AVWA 1XTKA 1N2CE 1WXHA 4UBLA 3SHOA 4IIJB 4DRXA 5ILOA 2A9JA 2GK7A 3TSOA 4C7BA 2ESRA 2FN4A 2WM8A 1GZ3A 1IBLB 1CKEA 5FYQA 2QTCA 3IURA 1L5YA 4BXOA 3ZVKA 4MEJA 4BL5A 4GBMA 1RP7A 4BB0A 4QBHA 3ET4A 4RQUA 1JAIA 1SKQA 4EJ2A 4XD7A 3R23A 5EKSA 5JS1A 2XQJA 3Q15C 1ZH4A 2PR2A 1II8B 1UBUS 3GBPA 5FWNA 2YW9A 2B2XA 3LYUA 2HF8A 5JZSA 1Q2XA 2BISA 2JI9A 1T2FA 2B3TA 3IIMA 4DIEA 3LP5A 4G0MA 4CL2A 1XRNA 4KXLA 1E9DA 4EGSA 5C81A 1E4YA 4Y2XA 4A6XA 4DMCA 3U09A 2OESA 4R7ZA 1XELA 5GZ6A 4EI2A 4ZYWA 2ZIWB 1UXOA 3EIEA 4LZNA 4ARCA 2J08A 1IZ9A 2OSBA 1OBFO 4ZOEA 1N8SA 2GRUA 1JAHA 2D7CA 2W2KA 1XYVA 4U7FA 4E1VA 4YHHB 4Q3AA 1UKVY 2WTUA 2PMWB 1Z3IX 1GSOA 4QUHA 5FOWA 5IXJA 3EF3A 5NULA 1EP3B 2YJ3A 3MUFA 4TMYA 5E7JA 4QNNA 4RFSA 5IJXA 3RHFA 4BV3A 3FHLA 3ZKAA 4IZ6A 4HH0A 2PQ6A 3JQFA 3DV9A 2CK3D 4MMZB 3VKUA 1CUWA 4AKSA 2QN6A 5F1YA 1DDGA 3CCBA 5K3OA 5DRYA 2PX5A 2C2BA 3IAM1 5HKKA 4QTUB 3SJCA 4ETWA 2PXCA 4QAJA 2VH1A 1UINA 2Z4SA 4W9NA 4RY8A 3TBKA 3T7CA 1J0AA 2EERA 2RGCA 3G0GA 1UK9A 4FJ1A 4YRDA 1E2KA 4CYMA 4DAEA 5JIBA 1SXJB 2PLFA 4IIJF 4OHXA 2ISSD 3CB4A 2XB9A 3PRJA 1CQIB 5FJIA 1FJHA 5D8DA 1X7YA 3UMSA 3OOYA 1S2IA 5D1HA 2XI4A 1IUOA 3SU8A 3LIPA 2UAGA 1QANA 2ARKA 4HOYA 1M2VA 3S2SA 1B8PA 3ACDA 3C7TA 1PNVA 2CV0A 4TLCA 1IOLA 3R3VA 1GADO 1XTZA 1RYEA 2O2GA 1N2IA 5JCZA 1TJNA 3NTLA 3D6VA 4LA4A 5KTRA 4XWWA 1CR0A 1Q17A 1I4LD 4KO3S 3MWYW 4ROTA 3UMYA 3WLIA 3MAGA 4IBOA 1FUYB 3WSTA 3NGLA 4QLAA 1YONA 3DP9A 4GWGA 2HT1A 1SCAA 3WK8A 1W5FA 3PC3A 2B5VA 4UXJA 3SF8B 5C5CA 3F98A 2UZ4A 1I32A 3KPYA 3L8FA 4PLGA 2FZWA 2R6GA 3WRXC 2BHNA 1R6XA 4RD6A 4R84A 1CLEA 4UHFA 4C4SA 1UWVA 5DXFA 2KBFA 2XZLA 5HP4A 2IOHA 3FVTA 3JQ7B 3AF2A 5KWJA 3OZRA 5IHXA 2WA1A 1C4WA 4ZPXA 4BEWA 2VSYA 3PSHA 3MJEA 1XCBA 3GRCA 4I3FA 3UV7A 5B3LA 2NVBA 5KINB 1GPNA 3GUCA 1QUEA 5J1TB 2FSGA 4X5OA 4A03A 4AXXA 2JIPA 2QPTA 2AX3A 3OEHA 1ZR2A 1W0JA 3EGDB 3BFJA 2HWWA 3L0SA 3SEQA 2QIPA 3FOEC 3WGUA 1J1UA 2F9LA 1VKRA 1NT4A 3HXLA