1Z4MA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with uridine 5'-monophosphate
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
194
structure length
194
Chain Sequence
b'RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 63
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4mA01
3AR8A 2HSZA 1RQNA 2AUTA 2CFSA 3ZTWA 5ALKA 3FM9A 4MUMA 4EEKA 4OD0A 4YH1A 3L8HA 5ALSA 5AVWA 2HOQA 3BA6A 2CN1A 3WK7A 2GFHA 2NO4A 2WF6A 3J7TA 3HLTA 1VFPA 3EPRA 3QLEA 3AR5A 4Y2JA 2G06A 2GHTA 2HF2A 3WGUA 4UM5A 2MU1A 3WGVA 4MWOA 4UASA 1ZRMA 3R09A 4XOUA 3U7GA 3MC1A 4FFDA 5AESA 2HO4A 2YN4A 3SMVA 3ED5A 1ZOLA 3CZ4A 2FPUA 1QQ5A 3N8GA 3A3YA 3WK9A 2G08A 3ZX5A 3FVVA 4GIBA 3AR3A 1PW5A 3L8EA 5AVXA 3W5CA 2B82A 1L7OA 1TJ5A 2RARA 3D6JA 4O8CA 3U7EB 5ALNA 1ZS9A 2CFTA 3FPBA 3MN1A 1RKUA 1T5TA 3ESQA 4DWOA 2R8XA 3OCVA 4CF3A 2QYHA 3WK8A 1ZD3A 4Y2PA 2NYVA 4UAVA 2FDRA 3W5AA 3A1DA 2P69A 3ONNA 4F72A 2P11A 5IT0A 2VKQA 1ZD5A 3NALA 1RMTA 5ALDA 2I6XA 1QQ7A 2GO7A 3QU2A 2ZBGA 2WF5A 3QXGA 1XP5A 4Y2VA 1WPGA 1Z4KA 3OCWA 4KX5A 3UM9A 1L7NA 4UMEA 1TA0A 3NUQA 4YCMA 4KNVA 3QU7A 1CR6A 2I54A 3SD7A 5ALYA 2CFRA 3PGLA 4ZEVA 5AM1A 3CNHA 1MH9A 1IWOA 4I9GA 5ALIA 5ALRA 2X4DA 2O2XA 3A1EA 3L8GA 3OTQA 5ALUA 2AMYA 1Z4JA 2YY6A 2W43A 5AKYA 1YS9A 2P9JA 3M1YA 5AVYA 4Y3UA 2I34A 1Z4PX 1RLTA 4NABA 5AW3A 4UARA 1Q91A 4UW9A 3E58A 4AS3A 1Z4QA 4BNDB 3ET5A 5ALLA 2WF9A 4L57A 5ALVA 2IYEA 2PR7A 2YJ4A 4JB3A 5AI0A 4HYTA 5ALWA 2IOHA 1FEZA 5ALJA 1L7PA 1U7OA 1VJRA 5ALPA 1ZJJA 3IRUA 5T41A 3WKDA 1YNSA 3NAMA 2ZG6A 2Q4TA 4HGPA 4IFTA 5AVQA 1RDFA 3ZUPA 3KOOA 4QQFA 2FPWA 4Y2RA 3F9RA 5ALEA 4CNQA 2MSNA 3WK4A 2C8KA 1TJ3A 2R8EA 3ZWDA 5AK3A 5AW1A 1YMQA 3N28A 2ODAA 3I76A 4EENA 3ZVNA 1L7MA 4OCZA 3S6JA 1RMYA 5AK4A 5AVUA 3UMBA 4C4SA 3SF0A 1RQLA 5AM5A 1ZD2P 3WKBA 5ALXA 3B9BA 5AI8A 5AW0A 4BNDA 3U7FB 2WHEA 3EF0A 2YMPA 2OA0A 4BEWA 2I55A 2HX1A 4NFLA 4B6JA 1T9ZA 2WM8A 1N8NA 3ZI4A 3A1CA 2G80A 3WKCA 3FGOA 5IS2A 1TE2A 4HGNA 4Y2SA 4BKMA 3HYCA 1Z5UA 1J8DA 3E81A 4YCLA 3WK5A 1YDFA 2QLTA 3E8MA 4KYTA 4UM7A 5AVTA 5AHXA 2D2VA 4Y2TA 1O03A 1XPJA 1CQZA 2C4NA 1S2OA 4Y2YA 3DV9A 4KN8A 3AR2A 3QU9A 4XE5A 3FZQA 3P96A 4Y2QA 1N9KA 2WF8A 1O08A 3W5DA 2B1RA 5AW2A 4C4TA 2FUEA 3WKEA 1Y8AA 4KNWA 4YCNA 4BX2A 1KYTA 3U7HB 4PNHA 3FPSA 2RB5A 3W5BA 2IOFA 3ZVMA 5IT4A 2ZBDA 1VJ5A 1WR8A 2GMWA 3N1UA 3M9LA 4G63A 3ZU6A 1WVIA 3B8EA 1Z88A 3K1ZA 2YJ3A 5AKIA 3N5KA 1U2SA 2JGAA 2ZBFA 3L0CA 1QYIA 5AKXA 3GYGA 2HEGA 2HCFA 3R9KA 3ZW7A 3E84A 2O9JA 2HHLA 2YFYA 3N07A 1F5SA 4JDPA 4J2TA 3OCZA 3L0YA 5AI6A 2ZOSA 2EAUA 2ZBEA 4BYGA 3RFUA 4DFDA 4NAVA 1AQ6A 2ZXEA 3QUQA 2FEAA 5AW7A 3BWVA 3QYPA 5ALOA 5AVSA 2G1AA 2R8ZA 4XPZA 3KDPA 5AKEA 2FI1A 1SU4A 2FUCA 2EATA 3L8FA 2AH5A 2HI0A 3MPOA 5AK6A 1SWWA 2I33A 5AIBA 2G09A 4L6AA 4F71A 4XQ0A 1RC8A 1QQ6A 3KZXA 4BBJA 1J97A 5A3SA 1XVIA 2Q5EA 2OBBA 5ALFA 2WF7A 4HGOA 1Z5GA 3EF1A 2WFAA 4UU0A 5AW5A 3IB6A 4UMDA 2I7DA 3KC2A 3QX7A 4YIHA 3ZTYA 2FPRA 4BX0A 4DCCA 3NIWA 5ALQA 4CF4A 3PCTA 2R8YA 1EK2A 4CE6A 2JAWA 1RRCA 4FYPA 2GHQA 2YJ5A 3SKXA 5AI4A 4Y2XA 3UMCA 1RMQA 5AKKA 5AW8A 1Z4NA 2BY4A 4UMVA 5AKHA 2YBDA 4HGRA 5AM3A 5JJBA 5AVZA 1RKVA 2PKEA 4NWIA 2IA5A 3L7YA 4E88A 3OCXA 5A3QA 3QNMA 1YJ5A 3U13A 3AR7A 5AI5A 2BDEA 4ZEWA 2PQ0A 4FE3A 3PGVA 2JAUA 5A3RA 2JARA 3PDWA 3L1UA 4UMFA 2B0CA 3NASA 4RETA 4YIKA 1L8LA 2Q4RA 2YMMA 2B1QA 1RKQA 1L6RA 4I9FA 2G07A 3QUBA 5AM4A 3VAYA 4CF5A 5AVRA 4AP9A 5AKJA 4H1WA 2RBKA 5FP0A 1Z4LA 3QUCA 4OFZA 2B8EA 3TLMA 5AM2A 2OYCA 4G9BA 2EARA 1SWVA 1NNLA 3I6BA 5AKZA 5ALGA 1EK1A 3SLRA 1Z4IA 4YGYA 2C88A 5AW9A 4HAIA 3DNPA 3B9RA 3L5KA 4ZEXA 1LVHA 2G0AA 4QJBA 5AICA 4EX7A 2FPXA 1T5SA 3QUTA 5AIAA 2W11A 2BDUA 1U2TA 3ET4A 3I1YA 1U02A 1QH9A 4DW8A 4GXTA 5ALTA 4EELA 1LTQA 1K1EA 2FPSA 1L8OA 3WKAA 2RAVA 2B30A 4IG4A 5AKLA 5AW4A 4AS2A 4UAUA 3U19A 3DAOA 1RLOA 1ZRNA 5AVVA 5AKGA 3IJ5A 1U7PA 4EZEA 1NRWA 4UATA 3RF6A 2AGVA 5ALHA 3OCYA 4Y2UA 4EX6A 2YMQA 3NRJA 4OHFA 5AK5A 1JUDA 1WZCA 3L0BA 2YJ6A 2OM6A 1TJ4A 3AR6A 1Z4MA 3DDHA 3WK6A 1NF2A 2W4MA 4NV0A 4J03A 3SHQA 3ZX4A 2B8JA 4UU1A 3SKYA 2HDOA 3OCUA 3QU5A 3ZWKA 2YMLA 1X42A 4BEVA 5AM0A 3L1VA 2DQSA 3ESRA 3QU4A 2NO5A 3KBBA 4L6CA 3QGMA 2C9MA 3AR4A 3NANA 4HGQA 5AW6A 4KX3A 2HF7A 2P27A 1Q92A 1RPZA 5E0OA 5ALZA 3U26A 4C4RA 1ZD4A 1S8OA 1Z4OA 3I28A 4RESA 3AR9A 3MMZA 3ZVLA 4BX3A 5ALMA 3R4CA 2JAOA 2IOFK 3OPXA 1RLMA 5AI9A 3EWIA 3UMGA 1YV9A 3KD3A 2C8LA
chains in the Genus database with same CATH superfamily
3AR8A 1QO9A 3KXDA 4NEGA 4BO2A 2TMGA 2XQGA 1TK9A 1TUBA 3WRWA 3EG5A 3O3NB 2BOVA 2OUIA 2DWCA 2BL4A 4OXIA 2A0UA 3G2HA 1XU9A 3GEHA 5IM4A 4NRDA 4H77A 1EYZA 1QONA 4KE6A 1VBMA 5IDWA 2XLCA 2ZE6A 2HQOA 3MWJA 4YLEA 3K9WA 4MZDA 4OMUA 4MVWA 1Z36A 4RE5A 1QZUA 2W22A 3WRYC 5CMLA 4I08A 3T5MA 3GR6A 2PKCA 3RS7A 3PWSA 5EESA 5H59A 4AURA 1OWNA 4JSRA 2OZPA 1H1LB 1VMKA 1Y34E 3GCDA 2PS1A 4NOLA 3FCUB 1QPBA 3K92A 1QB8A 4OXNA 1QMGA 4PZYA 2O52A 3HKEA 3GLIB 5LFAA 3NP9A 1J5XA 1MC8A 2WSYB 3UB3A 3RW9A 3H4TA 3Q7TA 4YBRA 4GUAA 4BKUA 1JQ5A 2ZJFA 1SUPA 4MV5A 5B30A 3O0DA 5LDGA 4X1IA 4ES6A 4BVBA 2IODA 1JBQA 2WWRA 5J59A 4TKUB 1KDTA 1UEXC 4L0MA 1Y1LA 3F97A 3LO5A 1U2GC 4G4GA 2GAAA 1DKQA 3KAJA 1KE2A 4BCCA 1UPFA 4Y6OA 5C7OO 3FVVA 5ES4B 4E5PA 5KU1A 1ZCZA 1PDOA 5BR8B 2HK6A 2Q6TA 2JLWA 1WW3A 1EX9A 4Q1CA 2INGX 4PRZA 4GMDA 2YVKA 1EJ0A 1U6JA 3H8WA 3T35A 1VJ1A 1KSJA 4MROA 1G5FA 4P3XA 3WK8A 3ZNNA 4G65A 5L51A 5TQVA 3X1DA 5DEOA 3HADA 4MUKA 4F72A 1Z5PA 3JQQA 2WWWA 1K6JA 1NU8A 1K08A 1BWQA 2G5TA 3IB3A 3Q6MA 2HBZA 2X8JA 4I9HA 3UBMA 2XSZD 4EMSA 4GXNA 3NALA 4B5KA 1P8JA 2GO7A 2ZB8A 4JJAA 1PIWA 4BP3A 2IW3A 2D0PB 1JPNA 2WC1A 5TJHA 1U7XA 5I9IA 1KO7A 1J7JA 1MAWA 3OU6A 4Q3LA 3THXA 4DB2A 4BWGA 3RU9A 2I80A 4HRAA 1MO5A 1V16B 3NGMA 5DN6A 2BT4A 3A3NA 1PGNA 1AKRA 1TVMA 4RH3A 3X1MA 1XNQB 1RM4A 3L2OB 3CBQA 4C5BA 9GPBA 1CR6A 2NZ2A 5FTMA 2IYFA 4TLAA 2P6OA 4KRYA 4MAFA 1B2RA 3MUFA 5HILA 4GF5A 1JTFA 1EB8A 1YE3A 2Z30A 3LZDA 4W5TA 5AUOB 1E2BA 2XUZA 3PFFA 4OQEA 2HJWA 4X8OA 1H5NA 4IW3B 1XHEA 4IGFA 3UK7A 2R87A 4OH1A 1G3RA 1XMXA 2ZGVA 3H86A 2QGNA 4JENA 1AKNA 4U7JA 1HT3A 4TWAA 1GV0A 1LF5A 3QLVC 2CL5A 2WW8A 1N0HA 1QZXA 5AVYA 1CQIB 2I34A 3MMXA 2ZYHA 3GA5A 4IQ8A 2RMKA 3CRZA 3BJIC 1EX7A 2IPXA 4XKJA 4NF2A 4BB9A 1BSVA 3E0QA 4TV8F 1K97A 4CLOA 4B3CA 4EB6A 2LIVA 1FDOA 2OESA 5E4JA 3A7EA 2JLVA 4GZ5A 3GFFA 1GGMA 1XRPA 3L8CA 3ZZUA 2IXTA 4GMHA 1IBMB 2DFPA 3TS1A 1XTVA 3ZV6A 5J40A 5BNZA 3HGMA 4GOMD 3SNHA 3LX5A 2W2KA 4HUQB 4COKA 3IRUA 5KAPA 1JJIA 2ONZA 3FYTA 4LEIA 3TPZA 1W4LA 2WYWA 3U7QA 3V97A 4N0PA 5DW0A 2VIIA 2VJLA 5AHOA 1OBHA 1W1IA 3VSCA 3TFOA 1D4FA 4ML3A 1C1XB 2HK7A 2VK2A 1WU7A 4B34A 2JFUA 4OK6A 2J4CA 3JZDA 2PJZA 4YP7A 3VJLA 1FPQA 2WINI 4TQ9A 4YRFA 1BHJA 1G7TA 1D03A 1X92A 2H65A 2V3VA 4R3NA 4M0UA 4UBIA 5IH3A 5BT9A 3T3MB 5KMGA 5BV0A 3AY0A 1CPYA 2QSJA 1C4KA 1I4OA 2O2SA 4R71A 1L7MA 1HC7A 4QDTA 2EP8A 4YMSA 2FWBA 2PD3A 1FOEB 2WFMA 3HWRA 3CY6A 3G9ZA 3R9IA 2A4KA 3AM1A 2HCRA 4EKYA 1SUCA 3JTMA 2HSGA 1Z3CA 4UHJA 4FLEA 4MYRA 4ZYUA 1GRCA 3U17A 2YZ7A 4DPMA 3BUSA 5JZ9A 1PLJA 2B4RO 3LOQA 3LX6A 5ESDA 3PTLA 5EMJA 3S1LA 2A1IA 2J5XA 3USCS 4ER0A 1IONA 3VKVA 1K8ZB 4KIGA 1YKSA 1F38A 3OC6A 3E3LA 1C3VA 4JD5A 4NMXB 5DHUA 5BSUA 2UYGA 2G80A 4IKEA 4C01A 2IIQA 1QIKA 3D3NA 3DMTA 3RO7A 1G60A 1QTQA 4RTSA 5K3DA 2P7IA 1JQEA 3KKZA 3EGDA 3BK7A 3MOIA 4I36A 3W2EA 4NCJA 4RTLA 4D8XA 1U94A 2XWJI 4DWJA 1QTNA 2OCAA 2QT9A 2IU3A 2PEZA 3BCSA 1JDUA 3HM9A 2W8BA 3OETA 3H97A 3OPYI 1Q50A 2W0SA 4BKPA 3TSWA 4LX0A 1ECLA 2FF7A 3NIBA 5AOAA 5AVTA 2QVZX 2D2VA 1LRJA 3S1AA 1MB2A 4Q37A 4PRYA 1JDBC 1ND5A 1QK5A 3L8ZA 5KJEA 1EIZA 4L8WB 3UXEA 1QV6A 4YXFA 3KJFA 4X00A 2FP3A 4LOAA 4MYHA 2PWYA 1C1DA 2YJZA 3DV9A 3I30X 3U31A 4PG8A 4RLFA 3VOBA 1MJGM 1NP3A 4QDXA 2LVBA 3A2MA 1M6WA 2PL9A 2PXXA 3A31A 2V54A 4MB2A 2RHGB 1YB4A 4NVRA 4WCVA 1LV8A 3ETJA 4WEOA 3TBHA 1QOPB 2E4ZA 2EF1A 1KERA 2OB2A 1D4OA 3ZH2A 3ZEIA 4QT4A 4B6QA 4FDLA 4PSUA 4U7FA 4M46A 4FYVA 3WKEA 4XUEA 2J07A 1RE0A 3K8YA 2R6CA 4KNWA 4V38A 3UUFA 3WLFA 2IV3A 1TI7A 4B9EA 5JD6A 4M49A 3RK0A 1T8TA 2G1KA 5JECA 1JMKC 3W06A 2HSWA 4Z4GA 1KRHA 3MGCA 1Z3IX 3SX2A 2EJUA 1KBZA 2O4UX 1U1GA 2Q3BA 2ZW9A 4R3UC 5EPUA 2ET6A 4QU8A 4EPXA 3MELA 3L18A 3L6UA 2PZEA 2PRZA 1EUZA 3B8EA 4Z7JA 1UFRA 5JCOA 2PPLA 1G291 1CZOA 5FI0B 3DAYA 4AJ4A 4GSKA 3IUQA 5IK2D 5EWMA 4FVTA 3RS4A 2ZM6B 1T15A 2I4LA 3D59A 1Q95A 4TKLA 1KQGA 4LGMA 5I4BA 1MQ8B 2PLRA 2RONA 3ILVA 4UTVA 2YXDA 5JMPA 1TYBE 2J0UA 3H1EA 5ABPA 5AI6A 1ZGJA 3TXAA 2ZBEA 5BRNA 3WGYA 1CZHA 1NASA 3HBFA 4BYGA 4W1QA 1NXWA 1FYVA 1RXEA 3PDUA 3KTAA 3CZ9A 4V1CA 4E94A 3HXQA 3D6HA 4BNHA 4MDEA 4ZT7A 1XK7A 2DKNA 2XY4A 1OX6A 3TW8B 3MAJA 1A88A 1MX1A 4WUVA 4E13A 4S04A 3FB4A 2E55A 1OFGA 5A1JA 2Z3ZA 4F71A 2QG6A 5LU9A 3N5CA 2IYNA 1A5BB 3OE1A 4BBJA 2X8AA 1AK2A 3IQDB 4E5SA 3R6GA 1T8YA 2Z2KA 4R41A 2QPTA 2A0XA 2OO3A 5A3SA 2ZRHA 4M86A 5J4KA 1Z8HA 2LW7A 1OH6A 4M8NE 4FIZA 1NKSA 4KGXA 2BEJA 1JXOA 2SCUA 4AU1A 3CSSA 1FFAA 2FMIA 4Y1GA 2A33A 3Q88A 4OUDB 4RZ2A 2QTHA 2R2GA 2RC5A 4UMDA 3KC2A 4HZUA 4RVSA 3JQGB 1F51E 1LS1A 2QM3A 4NICA 4OLJA 4PFQA 1KDVA 2XUHA 3ZKWA 4CF4A 4CFYA 3FWKA 4S24A 4K03A 1PWZA 1BDIA 3Q9SA 2O8FB 3JZFA 2EIHA 2RHRA 3U4AA 4NI5A 1T4GA 1FFBA 4KQEA 5AQ1A 4EI8A 4DXDA 1BE0A 1W49A 2XYVA 3KYJB 1OI4A 1JPJA 3ADOA 1HKUA 1MGPA 3IIIA 4TTPA 2IC5A 4BTLA 3H9QA 4JEMA 3KZ1E 2XD9A 4JOQA 4ARZA 2G1JA 1U3DA 3AFMA 3S2FA 4ZT4A 3TIFA 5LL6P 2IL1A 3OPNA 1PRYA 2VDWA 4WOKA 2JANA 2EIXA 4CJXA 3HFRA 4H6VA 3KB6A 5TX7A 2JBAA 4QEDA 5ECGC 4JFAA 5G0UA 5JC8A 3X2EA 2P9HA 2PWBA 4KIUA 1HQKA 2OMEA 4HB0A 2P2NA 4NZPA 1FNSA 3I9LA 1RXSA 4FE3A 3PRHA 5H3CA 3TMKA 2YQ5A 5FHQA 4ARVA 3BXHA 4I5DA 1E5LA 3IBYA 1P6XA 1Y5RA 1YT5A 4TS1A 1QGDA 1COZA 3CF4A 3OE5A 4PZCA 5MN4A 2YWBA 2VHQA 1YL6A 2C9CA 2R86A 4DY4A 1LLUA 2PZJA 5DM70 2QTGA 1WCV1 4KN6A 2Q29A 3IEVA 3KUUA 3EMDA 4J0HA 1CDZA 3QUBA 4EVQA 4JUCA 1P31A 4ESHA 2XB8A 1XCLA 1EE2A 5SZIA 2VHYA 4PLFA 3KELA 5AKJA 2WM3A 1V8ZA 2CF5A 2I29A 3BMCA 2JIBA 3OM8A 3HB0A 4M8LA 4QQNA 1ABEA 3C8ZA 4Q9HA 3KOXA 3S2SA 3PQCA 2VTDA 2ZYVX 3GT0A 3M82A 4KAJA 4OFZA 2VTBB 2B3DA 1JGTA 4MHSA 3TTTA 1YR2A 2Y8EA 2DY0A 1GN8A 1R6TA 3A6EA 3BK2A 4G9BA 2AB0A 3I6BA 1IXRC 3STHA 3BIXA 3FWNA 1ACMA 1UWKA 4X45A 4BEBA 5LU8A 1P18A 1MABB 2HLNA 3LUKA 1UBUS 2BFEA 4YDSA 5EZYB 5A02A 2NZXA 3R7WB 5AW9A 2FW1A 5HVNA 3K1JA 4JC0A 3W8NA 3E53A 5B2FA 2Q2VA 4HQRA 5AICA 3PXBA 2QD4A 2EWMA 3OUTA 3H1AA 3M6WA 2QRHA 4I8XA 1YCFA 2PNFA 5ITSA 3TZ6A 1WPRA 1IBRA 1CZLA 3I3SR 1A2BA 1T2DA 3DEFA 1KDRA 4F4HA 3F2VA 4LSMA 5CAEA 1U2TA 1S2GA 4RH0A 3ZVKA 3AI1A 2FZVA 5LDHA 2FLKA 3B51X 3MQ4A 2IS1A 3GARA 3GT7A 1YULA 2BF7A 1WF3A 1YQDA 4WKNA 4KOEC 5CXQA 1W4RA 2FUKA 2RAVA 3AEKA 3DMPA 1A4XA 2C1XA 4R1PA 3ZXUB 4C07A 3PC4A 1MMFB 4IG4A 2KI5A 4YRAA 2XGOA 3AL2A 3DO8A 4JOBA 5D3ZA 5KWVA 2H18A 4R01A 2VPXA 5IAGA 1P1HA 1Y4UA 2KHZA 2LKDA 3D5TA 3HEMA 3QVOA 3RIMA 3W04A 4BLOA 3M6UA 3FW1A 1DQRA 1FUYB 1VYHA 2P67A 4ND6A 2QF7A 2Y71A 2YQ4A 3AGPA 3KQWA 2OM2A 4I9NA 2QVCA 3UGQA 5E2BA 3ZDEA 1U9ZA 4L72A 1AH2A 2VN8A 1JA0A 3P2OA 1TJ4A 5JLAA 1UC4B 1X86B 2R6HA 4EL0A 3U3XA 3E7XA 5CA0F 4BO8A 1JHXA 5JXIA 4NOMA 4LYYA 4YP1A 4JYZA 4DN6A 4EHBA 2PIAA 4M0DA 1TRHA 1MEEA 1K8YB 4B73A 5BQOA 4X1KB 4ZJUA 3NOVA 4ZI2A 3G2PA 2O19A 5DM2A 4AULA 1P19A 3DOEA 3W0LB 1H2AS 1NF9A 3A6ZA 2O2YA 3VU9B 1GR1A 2CLIB 2ZULA 4RGYA 2W37A 2C7RA 2ZE8A 1XZJA 3BK1A 4C0BA 5DXJA 2HJ9A 3ANYB 4MPTA 3IP1A 4ZVMA 2XE6A 4GO1A 4BDTA 2IZOA 4CFZA 4E4TA 4WKOA 5FQNA 1YDHA 3KUKA 2JD1A 1GNTA 2OEPA 2GK3A 3P9QA 1KQNA 2HM7A 3SHOA 2XX3A 1GZHB 1QHEA 1E1RA 3LIIA 1SG0A 1Z29A 2P0YA 5FO1A 4FK8A 3KVNA 3RRXA 2QD3A 3CZCA 5BVGB 4MVJD 2OQVA 5JYBA 2JLSA 4FFNA 5E0OA 5KYWB 1SH7A 2Q1TA 3PZRA 2V6BA 1R0YA 4GE3A 1PU2A 3UG7A 4U2DA 2OCXA 3N2GB 4BJ5A 1H6BA 4Q21A 5I7HA 5CLQA 2COUA 5BW6B 4HH4A 2BV3A 1QBGA 1ESCA 1G42A 1TD9A 3G9XA 5G1NA 1QOZA 4U7WA 1UBFA 2Y9PB 2ZTSA 3FD8A 2EKQA 4MGEA 4RXTA 4C0KA 2CUNA 2HMUA 3F78A 2NIPA 3DZ8A 3LMKA 2ZTMA 4UZEA 3TCNA 3D2BA 4A2CA 1U0HC 5DHFA 3F7MA 4E2XA 1PBTA 4D4HA 4DMLA 4F6LA 4CMAA 3K4PA 5CJJA 4Z1OA 3KD3A 1MQ9A 3MILA 5JXHA 3D8TA 1QQAA 1J2UA 3C1UA 1M2NA 1WSAA 4EBFA 2JRCA 2HWXA 1N7HA 3NNSA 3H9GA 3DUFB 3GG9A 3H4VA 3L46A 5EIOA 3PC7A 4CUKA 1KMHB 3T3NA 5SYNA 3KT6A 3MA0A 4MI9A 4WINA 2B9EA 1V3QE 2QXYA 4KGDA 3MWYW 4F4IA 2XUAA 3U3OA 2H63A 3AOEA 2XTMA 4LA4A 3QSYA 3AQ4A 4DLZA 3VH1A 3K9LA 4F4DA 2C4KA 1OXUA 2HPAA 3QKIA 3WGUA 1OY1A 1MJHA 4L7QA 3RUDA 1C81A 5F51A 4CF7A 5G3ZA 4BO5A 3PZBA 3VPDA 4M38A 2ZUDA 1VE7A 1S2DA 3MSXA 3NM4A 2JB9A 3MLAA 1II9A 4FPXA 1N1MA 5BSVA 1WEHA 3GLHE 4TVSA 3UYKA 1TA4A 2R68A 2WAXA 4I0WB 4B74A 1LLDA 4AWAA 1N33B 1S2MA 3RROA 3NC1C 2RHMA 4EDHA 4Z5XA 4TSFA 3KB2A 3FWHA 4G0UA 1AXRA 1ODFA 3BAZA 2VPYA 1DAPA 4IR7A 4MVJP 5F2EA 4WXEA 4XYMA 1YJAA 2WIAA 5EIXA 4PWYA 1IOVA 2AWNA 2C99A 2G08A 2VYCA 2XEDA 3EGVA 5CXUA 5BN3B 3M2TA 5AVXA 3KT3A 1VC2A 3D7KA 3I2JA 1PN3A 3WGQA 1EKXA 5E1OA 3H5LA 3HB4X 4I4TF 3MN1A 1SQ0A 4YWHA 1NJ8A 1T5TA 1P7ZA 1XALA 3K0EA 1Y9EA 1GU7A 2FNAA 3P71T 1P4GA 4L6IA 1L7AA 1C7EA 1J1ZA 1K8RA 4YP6A 4MKZA 4AYXA 2XTAA 1ODJA 1WHSB 3HZRA 4L0CA 3AWDA 2X8WA 2ZUVA 2J0QA 1AMNA 1BXKA 3EMVA 5BMVA 1O97D 4RCVA 3R3WA 3H5TA 1HY1A 2WF5A 3D2AA 3EQ8A 1B7GO 1J5PA 3UKJA 4B6PA 4QLBA 4JXJA 1AKQA 1PO7A 1DC6A 3WAKA 1OC4A 1QHIA 4XSHA 1KQOA 3UPUA 1PF7E 1R0KA 2GA8A 4G5QA 3S40A 3JQFA 3IAUA 4IEIA 1P1JA 1UZLA 3P4UA 4PBRA 1XZQA 2EG5A 4N65A 3O38A 2ILVA 2ZJ7A 4FFMA 2OFWA 1ZKMA 1BRMA 4HDAA 4I66A 1AKEA 3FKQA 5IVDA 4UXIA 5JSFA 1F06A 1Z0KA 2C8VA 3VR3D 5DM60 1E4EB 2V6MA 4GQBA 4AJ9A 4BE7B 3SG0A 4FMBB 2ATVA 2VJDA 1U80A 3EIXA 3UAZA 2AMYA 2IELA 4LXQA 5F4BA 5HIKA 1Y5LA 1H2WA 2OCIA 4BAZA 1SVIA 2QZ4A 1BN7A 4ETMA 1IPHA 5C9ZA 4HRVA 2R65A 2QMZA 4K0KB 3HKDB 5LUAA 1PUJA 4TYYA 1W6RA 3W6ZA 1P4JA 4CYMA 3WQQA 2JLQA 5DGCA 1SQFA 5FPSA 3W2TA 3ADKA 5TS3A 1EXVA 3WQSB 1CZRA 1JHYA 1KETA 2GCIA 2H2IA 2WLTA 4Q4CA 1XHLA 3EQ6A 4URFA 4LE2A 1UQTA 4HEA1 1N34B 4PQGA 4ZV4A 4K26A 2P3OA 3N05A 1DU4A 1TZCA 1Y1QA 1EJBA 3TQFA 2JW5A 3COYA 1Z7YA 2RC6A 1L5SA 5EIBC 1FEZA 3TO5A 2VNSA 4EHHA 4A5SA 4IFBA 3GAAA 5A04A 4XVCA 2C96A 2XOKA 3D7RA 4I6JA 2NXCA 3FUUA 1OBFO 1EFRA 2VAPA 2VCYA 2YIVX 1XZLA 4G4IA 4LZNA 4ZU3A 3PQ3A 5B1IA 1QO7A 1S3SA 1ZW1A 1HLDA 3K09C 4GP6A 3C5WP 5E1DA 1Y42X 1LPAB 2AQ8A 1QYWA 1EZZA 4Y2RA 2ENUA 4G24A 1FNCA 1GYPA 2D06A 5CITA 4BMZA 3SJCA 3DO6A 4RZUA 1Z38A 4JXKA 4ZTBA 2OYRA 3ZGNA 3ZWDA 3GLTA 1SBHA 4MNTA 3HL0A 2ODAA 4DRYA 3DL7A 4Y6RA 2ASEA 3L1JA 5B37A 1E2NA 1GAJA 4PX2A 5COBA 3KOZA 2G4VA 2PT9A 4TVOA 1SB9A 1VKNA 4G1CA 4D8YA 4QKQA 4TTVA 2AUNA 1GILA 2V7XA 1DC8A 4FDVA 1Y9ZA 4RPKA 3HRKA 3O3MB 4ZT5A 1KIAA 4OJMX 2IHBA 4QQ8A 1GRQA 1OFUA 4FNOA 5HYVA 3OJOA 2OC4A 1X0XA 2GBGA 3ASUA 3V00A 5KJ1A 5HCUA 3PFCA 1NXVA 4M1QA 4MX2A 1NN0A 1IWPB 1RQGA 2FU5C 2OGSA 3BB4A 4JOSA 3PHIA 5LYYA 1XMPA 3IUJA 5KI6A 3QE9Y 2J9YB 3VR6H 4E70A 1QVZA 4LYGA 4CEHA 3IJRA 3B6ZA 4WK2B 2WKRA 4TV9B 3HCRA 4W5RA 4ACAA 4MWGA 3UIEA 1LSOA 1G6KA 1RPNA 3N74A 1Z5UA 3FLEA 2YZKA 5D6NA 5KCMA 3AX6A 2QQEA 4NPHA 3WOVA 4MWDA 4E14A 5BPFA 3D5QA 3IYLW 1S6YA 1E5TA 2AOTA 2Q5IA 2QMUA 4AY4A 5JAMA 3AESB 3GEGA 3NBZC 4M9RA 4EJ2A 1PGJA 3CE9A 1XNGA 1MFZA 2HCJB 3HVJA 5HBGA 1COWA 5DYTA 3VO2A 3ZV3A 4N9QA 2EW2A 1PKEA 1XPJA 3VR0A 1N5IA 3F5SA 4WCFB 1CQZA 3U40A 2C4NA 5M2QA 2YNMC 5FWYB 4WJKB 3UOAB 3EVCA 4DKJA 1TJNA 5A5FA 1EQ2A 3BHNA 3QU9A 4B3TB 2NU6A 3FZQA 4B4UA 4Y2QA 4LC9A 1Q20A 4QREA 2FTKE 2OCBA 5JXGA 3P97A 3KQYA 2VSNA 1R6UA 3LX8A 1YQ9A 1JMYA 2VJBA 4FOLA 4R7TA 1O96A 4C7OB 4L4XA 2CDAA 3GH3A 1NVGA 4CDNA 3GHHA 2FZEA 2V7PA 1RQXA 3FDZA 1X2EA 5TB5A 4EG8A 4MKIA 5K0GA 3SC2B 3SM9A 3UEOA 3WYFA 4ERXA 2PZ8A 1V6AA 1DOHA 4MRRA 1IN7A 4HDMA 3FKSA 3G59A 1QFMA 3H75A 2J3QA 3JQAA 4FFBB 5CVCA 1TAUA 3KB1A 1F9EA 1AX9A 1GG5A 3I5AA 4UVIA 3QI7A 1KO4A 2FGKA 2JIDA 5A9TA 3Q0TA 2CHVA 3EH2A 2Y2VA 2YCBA 4GKKB 1VKOA 4BWFB 1F6DA 2H85A 1JAYA 2FJUA 3LECA 2A5GA 2HEGA 1UIRA 1XR3A 4KIWA 3UH0A 4BNJA 1BFKA 1DX6A 4YJ3F 1JFRA 5FWAA 4ZHQA 1GM5A 3E84A 3P9CA 1C7IA 2W00A 4J2TA 1XSEA 3S99A 1RCUA 2ZIEA 2ZYRA 4AF7A 2DUNA 5JZOA 3DEKA 4B85A 1UXJA 2CBGA 3HJCA 1A69A 1DT3A 1P29A 1Z6XA 2NAPA 3Q9LA 1ADGA 2H52A 3DV0A 5AJXA 2EZ9A 2BYTA 1JAIA 3LFUA 1GPLA 1XRQA 1KYQA 2QU7A 3C4VA 3D0KA 4JEIA 4UZSA 3WZMA 1UDXA 1MTOA 1U1DA 3PJFA 4RKFA 3HU1A 5BSRA 3PX2A 2BMEA 1X7XB 4G0QA 1NQAO 2CWDA 3IAAA 2BHTA 1V4NA 4LVNA 4RX1A 1XTQA 3ZZMA 5KINB 1FL9A 5LP6F 4QTZA 2XGJA 5TGZA 5CG1A 4DARA 4URUR 1YL7A 3OUZA 2YASA 2JCYA 3OT5A 4AW9A 4JL5A 2PUJA 5F98A 1OD6A 4L3OA 4RV4A 1Z7WA 3A9WA 1LB1B 2E4WA 2RG7A 4XDYA 2O06A 4AIIA 5F23A 2WTAA 1TQ4A 3WADA 3WIBA 2AXQA 2VYND 3DFZA 5JZBA 1JDNA 3NIWA 1BJRE 4II2A 5ALQA 2XZPA 4V24A 4CUJA 3PCTA 2R8YA 2YV1A 3OIVA 3ZGYA 3SICE 5CBPA 5J47A 1W4CA 1TUGA 4XQGA 5H7XA 3ZZ0A 3MPUA 4OJKA 2WY2D 4CG3A 2BZ1A 1N3BA 3MT0A 4KXFB 1GAEO 1S9DA 2QLBA 5C7LO 5K05A 1NX6A 1H2XA 4EJSC 2QZPA 2Y99A 4ENSA 2ZI5A 1J2TA 2WMOB 3KOWA 2COEA 4DPKA 5A2GA 3TK1A 4URXR 2J3EA 3F6BX 3JQCA 4GX2A 2UZ4A 2O2GA 3AEYA 3OLCX 3TFWA 1QZTA 5TR9A 4E88A 2FB9A 2Z1MA 3C6MA 3CT6A 5E7IA 1REQB 2OECA 2ZRNA 5TMEA 4JLPA 4LOKA 3U13A 1NRJB 3BTVA 3PUZA 3QUSA 4ZVLA 3KJXA 1P62B 1UXGA 1F2UA 2H0RA 4J43A 1F2VA 2A67A 2W6ZA 1LVGA 5TRTA 1W36C 1EU1A 1HWYA 1JU3A 3EIWA 4K3VA 5JXWA 2OQIA 1ZD9A 5EJEA 1CRLA 3Q0IA 1K88A 3V2UA 2ZJAA 1I36A 4UMFA 4DR4B 4KWIA 3KTFA 3QG5A 3DPUA 2OR3A 3LPLA 3R40A 2QLFA 1I0ZA 3PYLA 3GPBA 3RU7A 2GN1A 3WLJA 2JCGA 4ZZ3A 4ZI3A 1RRKA 1NQTA 3IP7A 4Y67A 5HUHA 4EW1A 1NI3A 4YRSA 4AP9A 2H5EA 3AJEA 3OTHA 3H3FA 3MD0A 4OEHA 3OMXA 2WP0A 1SCIA 1MHTA 1O2DA 2W2QA 2EEZA 3MTJA 3B12A 5LA6A 4LYFA 4ZQGA 5EAIA 3ENNA 3DHYA 1N3LA 1W1WA 2G9NA 3C3AA 3CE6A 1KJIA 3T4UA 4RADA 5LQKA 1MP0A 4NG4A 4QYIB 4UE6A 1UM8A 3H5WA 3V8RA 5EP1A 4EA6A 2EG9A 2XHEA 3AIOA 1E9RA 1WHTB 1HE4A 2PT5A 4TN5A 5FF9A 2CVPA 4Q93A 3RYHA 5HEKA 3H2BA 1EHYA 3H2JA 4EGJA 4Y30A 1HDOA 3CB4A 4LF7B 4M0CA 4C5CA 1XTBA 5CTAA 1UOEA 2ZI7A 4MSUA 2HSJA 4KLAA 4NEQA 4ZOAA 2PUWA 1JDTA 5D5QA 3Q7IA 5FL7D 4O2AB 2CLKB 4RGBA 4J2HA 4RGVA 3MJRA 3U48A 5HQTA 5J4VA 4O3MA 3NEAA 2Y66A 2ZVPX 3T54A 3HDHA 2R1VB 1PK8A 2QRKA 4N40A 3GPCA 2GZMA 1LCIA 4OHMA 3VR4H 1GPKA 3QUAA 3DMYA 3GRUA 4C0AC 1CY2A 3H17A 4YJGB 5D5HA 4ABTA 4DXAA 3RRZA 4F6RB 3PL5A 5KQMA 3NPAA 1B16A 1Z5NA 5DIZA 3TD2A 3L7CA 1IAVA 2B92A 1KFKB 2CNOA 3L41A 3PCXA 2PRSA 3PP8A 4O4IF 4FHGA 3DF9A 1HDGO 2BMFA 4L8FA 3F3YA 1ZP6A 1CUWA 1VMAA 3ORSA 1JQKA 1US8A 1KFCB 1XT6A 4KFCA 1XI2A 2WSIA 3UENA 4HGZA 1SCAA 4AS2A 1SVSA 1CERA 1U7WA 5EZQA 4RKEA 1RXVA 3I45A 3GLKA 4E08A 1KR5A 3OZVA 1OZHA 1QR2A 2JJ1D 2AGVA 1JHZA 2X14A 4QNRA 1FPMA 1EM6A 5LKRA 3G5TA 1L8XA 1VBNA 1E5QA 3HNRA 2JAPA 1BXGA 1AXEA 1YZHA 3HR7A 1QDUA 4OHFA 3TZQA 1P9NA 1PL7A 1T4MA 1Y7HA 1JFVA 2GNPA 1TMYA 3MTBA 1PJAA 2OM6A 4EQ6A 5C46F 5FA5A 4ZRMA 3F8WA 2R0QC 3NUGA 4X6XA 2JKYA 1V9CA 2P3LA 2Z0MA 1ILEA 3OIUA 1E7YA 3PX3A 3LL7A 4EHIA 1YK1A 4J4BA 2ZSIA 4LJLA 3VOAA 3QSGA 1NVBA 4HDCA 2CEKA 3COSA 4HAWA 1WLYA 3LWZA 1DG9A 4NLLA 2DKFA 4WT7A 4QU0A 1YE5A 3CT4A 5LZ2A 1CY6A 4YT5A 3WX0A 4H31A 2XW6A 1YIOA 4Q7QA 2O8CB 5EIWA 4P7KA 1XO1A 4JBYA 4BFUA 1WXXA 1Q11A 4MR8A 4YRZA 2YIJA 3UUWA 3R3XA 4JIMA 3DBRB 2O20A 2D4HA 2HPZA 3IQZA 4M3NA 3ABSB 1OXTA 1AF4A 1SXJD 2P4HX 2QD2A 4KQ9A 2CWWA 4CM9A 1HY0A 4APBA 3GCGA 4M0LA 1DXOA 2Z8XA 2P27A 2CMGA 4CWAA 3LUHA 4YRBA 5C7IO 3AZPA 4NP6A 3ZLJA 3N7UA 4NESA 1ZGBA 4P4NA 5A05A 2Z9CA 3ZH9B 3DDCA 1GKKA 3GDGA 1ZC3A 1BKYA 4KDEA 3ZS9A 3U56A 1XELA 1D1TA 3KXPA 3A4LA 4KWHA 3JV7A 1LLCA 3VR2A 1YR8A 3DA8A 4C7XA 3DKKA 2Z2IA 4MEJA 5IKPA 1ZMOA 3JALA 3ZGXA 2XD4A 1XA0A 4QJ5A 3VPAA 3RM3A 3D4OA 3ZDBA 4D3XA 1PGPA 2BMJA 3EWIA 1U2RA 3D02A 4PFSA 1SIWA 3DWGA 3WBBA 1JP7A 3UMGA 1K5HA 1O1YA 1XRNA 1YV9A 1I30A 1MO3A 2IYAA 1VE3A 2YL2A 2H5IA 4FNMA 2YWJA 3VRHA 1PWXA 3LW7A 2CF6A 5DRYA 2ECFA 1Z33A 3L8HA 1W75A 3HO1A 1V95A 1JALA 2RI6A 3GA7A 4D79A 1O94D 4YQFA 5C32A 4M1MA 5A0VA 5JD5A 3QKSA 1BQ3A 1QE3A 3ZCTA 1N2IA 5K6RA 3SR3A 2R8OA 2W6CX 4D8UA 1AKVA 3RVRA 1QVVA 1B6TA 3UWDA 1YC2A 2FSHA 3QWFA 3ADCA 4XJXA 3ANLA 2X3FA 4A8JC 3JWJA 2GHTA 3QV1A 3T94A 3OBBA 4WLNA 5AUQA 3OO1A 3DZGA 4DR7B 4CKYA 2J9GA 2P90A 3H87A 2IHVA 2DQKA 4FYIA 3OZSA 1VLLA 2H0QA 3RG8A 5GIOE 2O7NA 2DP4E 2QXTA 4IDQA 2FW0A 2GQ0A 5EKDA 3CURA 1ANKA 2J5QA 1CW2B 5DCWA 1G5IA 5IDQA 4DR6B 1RTKA 4A15A 2HO4A 3UBTA 1L3CA 3AKYA 4K7JA 4DEYA 1URPA 3K5HA 1IIBA 4C14A 2PUEA 1CV2A 4MP6A 1BMTA 3RS8A 2R6GA 5ADHA 1BZYA 3CZ4A 4MMXB 3JQBC 5B2ZA 3FOWA 1B8UA 2Z56A 2XXJA 4PHCA 1GAWA 4O29A 3VZRA 2H11A 5AJTA 1G20B 3CBGA 2O2IA 1EVIA 4NE2A 4AMBA 3L8EA 1AHNA 1DJMA 4UZFA 3A70A 4XCXA 4BVHA 5IJ0A 3BSSA 1NT2A 2BCJQ 3SQNA 4DB4A 5HJ7A 1C0LA 4BZXA 2CFTA 1GQQA 4Q7MB 3CW2A 1KZ6A 5CM9C 3OCCA 3JAKB 3H19A 2JLCA 4O1MA 1YFZA 2IWHA 1T5BA 4OV6B 4NYIQ 2Z83A 4A03A 2L19A 3CXRA 3DULA 1RJWA 4MHTA 3H2SA 3ILXA 3EC7A 3ZXXA 4P34A 1HDZA 1GNRA 1FFXB 1UMDB 2HF9A 4RC9A 3WTCA 5CB4B 3L7BA 5JQGA 1R6VA 3VC3A 4PLYA 1D8AA 1MAHA 1V8FA 3BA1A 1E2UA 2QRJA 3EHEA 2QQGA 3AW9A 5KYYA 1DQNA 1SCQA 1FFCA 3L4KA 2C7VA 2CW5A 1KYWA 4G0ZA 3JZAA 3IA7A 2C03A 1WPGA 3I58A 5ELLA 3ZU2A 2B78A 4KX5A 5CYPA 1QX4A 1VB5A 1T35A 2NZJA 4B35A 1TA0A 5A5EA 4U3JB 2PGXA 2QQ5A 3FSGA 4XSGA 2WIDA 1SKMA 1L5RA 3GLUA 1RRFA 2ZFUA 2EXXA 3Q6NA 2WD7B 4QBGB 4BJHB 1Q0TA 4AKGA 1T34A 5F78A 4HL6A 2CBXA 4YRDA 1AN9A 1NFRA 1Y33E 2M98A 3O91A 4ME6A 1A9ZA 3E9DA 3CLKA 2HYDA 3SD7A 5KTOA 4BVFA 2ZU0C 2PK3A 4HXEB 1XVTA 3U60B 4UUOA 4N3GA 2HJRA 2YV2A 4NMLA 2J08A 1FK8A 2J5BA 4N8DA 4QUIA 3RUEA 2VP6A 2RSLA 3OX4A 3OKFA 4ROSA 4D43A 2JZNA 3WRYA 4PAMA 2B1GA 2W43A 4G23A 5BMVF 1ODCA 4ZJPA 1YS9A 5DI9A 4RTRA 4IHAA 4PLCA 1FDVA 1CY4A 3B52X 3VNUA 3IXQA 4G6ZA 4BC1A 1R8SA 2CDCA 8OHMA 3PWKA 4HT3B 1CUUA 1VGVA 3AM5A 5A7GA 2ZE5A 1I4TD 3FFWA 1ZVQA 3NM5A 3PEFA 1HQDA 3RAGA 1V3UA 3SYKA 4TT3D 1EFAA 4GM4A 3BHIA 1U2GA 1G3IA 1Z18A 4QUDA 4FQ8A 3WA7A 2A84A 3EUWA 3QELB 5BQ5A 3UWKA 4BY9E 3LT0A 4JBXA 6CHYA 1D07A 1E69A 2W6JD 2C1ZA 2Q4TA 4HMOA 1OTHA 4N9WA 1RDFA 3F67A 4E4RA 4DQVA 2PT7A 4D0LB 2Q1UA 4L5AA 5IC4A 1VDMA 1AHIA 1PX2A 2G5GX 2PTGA 5ALEA 2GTPA 2XVZA 3V7FA 3FTNA 2G36A 1XLUA 3U4QA 1FRVA 1O5OA 2KB0A 1I6LA 2JD0A 1KK3A 2P9BA 3JQ8B 3NCTA 4LMPA 4MQEA 3RPEA 3IP8A 1HLPA 4G1UC 4J1TC 3ZV5A 1Y4DE 1GQYA 1WKBA 3I4CA 2ZETA 4IXNA 5EPOA 1OI2A 2H08A 3RF7A 2CC2A 1UDCA 2AQKA 1N4AA 4LVUA 1E4OA 2KX7A 1ORTA 4JB0A 4BMSA 5K0JA 1JG3A 2FWNA 3MTEA 4KE8A 1Z6TA 3DVAB 3LUDA 4UPVA 3S8MA 4MLCA 5AK4A 2V74B 2R25B 3N7TA 4X7MA 3WDLA 3MINA 3HYRA 4A16A 2BKUA 5F35A 3Q8MA 3U44B 1GTRA 1JILA 2DH6A 2I7XA 3AKDA 1P17A 3MGAA 1YOVB 1J2EA 2BGNA 3F90A 3GY0A 1BGVA 1U7TA 1NWCA 3OQIB 2Q9AA 3KU4A 3G2NA 4C22A 3B2NA 3HLKA 3TFQA 2GLUA 2OA0A 3WB2A 4Z99A 1VHDA 3GLRA 3NS7A 4LPSA 5JH7F 3SWWA 1H3EA 2EJCA 2JLYA 1PKXA 4WZBA 1SOMA 3N0XA 3CW8X 3PSAA 2HA3A 5KSPA 1YASA 5EERA 4RS4A 1NQVA 5CDFE 3E8MA 3QLVA 1K8XB 1LPBB 1H0RA 4BGVA 5IYZF 4GH5A 3TB6A 3CIFA 3CMMA 4WQMA 3HGQA 2E4YA 5AHXA 5IJXA 1MB4A 2VK1A 2N1BA 2NSDA 5FOXA 5L6MB 1TVKB 5K3SA 2BLNA 3I2IA 2NPOA 2HO5A 1DADA 1X7WB 1NBIA 4K2HA 4QRIA 4NMHA 3ONVA 1C3XA 5JDIC 3GFVA 1M34A 1RCFA 4L8VA 5C1DA 2QQFA 5B4VA 3CKMA 1NC3A 1N9KA 2XECA 3A4VA 1X74A 3EZLA 1I51A 1W5SA 3ZIDA 5AW2A 5FWXA 1NXTA 4E07A 4PO3X 4JS0A 2WTUA 2Z4RA 3V9AA 4DIBA 4D26A 3W9SA 4BU1A 4HDOB 4RK7A 1PFGA 4OB7A 5F77A 2EJBA 3HZOA 1SC4A 4M7PA 5JMTA 1VIMA 1MXHA 2GJKA 4MR7A 4FSHA 2SBTA 3WBJA 4KPEC 3KPWA 3G6KA 2UUPA 1D9XA 1O97C 1L9XA 4WW0A 3OQHA 3AP2A 4OSPA 2CKDA 4IUDS 4M76B 3LP5A 1OASA 3GROA 3LKVA 4Z7QB 4CMEC 2G9ZA 3ODPA 1WB4A 1WDLA 3LNTA 3M6AA 4I2NA 4OK5A 1NAHA 3RT9A 3SIXA 4DDUA 4QRHA 2PKRA 4AZ0B 2IZ0A 4FC6A 1ODSA 4KYUA 3SX0A 1DC5A 1X1TA 1ZJZA 4FM9A 4CI0B 2JGAA 2R5WA 3R0XA 1YH3A 4DIEA 2A2ZA 4TZ0A 4F84A 4ESOA 1C8VB 1GKUB 3MRXA 3RKRA 3WYBA 5B4TA 4XIIA 4CGZA 3C7CB 3L6OO 3BDIA 2XQJA 1YUBA 4V0QA 5ELMA 1LFDB 1OWMA 4K5QA 4HPXB 1QFZA 3W4IA 3VR1A 1L7EA 1DPFA 3QITA 3EH1A 4BATA 5EVCA 4OIFA 1UMBB 2Z8YA 5TQ2B 1G3UA 1T6NA 4BZQA 2I2DA 3K5PA 4R98A 1Y5MA 1DRUA 1BAPA 1T29A 4M1ZA 3LKDA 4R8SA 4H9GA 4X9XA 1U63A 1LK0A 1M1YB 1XKTA 3GJQA 1T4CB 4TL9A 3DF7A 4OG2A 5TVGA 4QGSA 4LC1A 3AI2A 5AKEA 1OROA 3LYLA 4R2WA 5M3BA 4HVAA 4RBNA 4AZTA 2XWSA 3QHQA 2I87A 3HP4A 1F8GA 1XVLA 1M73E 4UCWA 5E6UB 1ZK1A 3R76A 3TXYA 3QTTA 2FAXA 1N6LA 5GOZA 4E2ZA 2AFIB 1ENPA 4D6PA 3ZCXA 3L7NA 1KKLA 1TJUA 4HDSA 3BXGA 2J7KA 1R0XA 1EUDA 2JGDA 4IIJA 4HGOA 4MP8A 2WUEA 1DZ3A 1RCTE 1UFVA 2P7HA 3VR5A 3ROMA 4EUEA 1Z6YA 1ZIPA 3DP7A 1F2TA 3IAM6 4QOEA 4URYR 8ADHA 5FORA 1TZKA 3E1GA 1EXWA 1LQUA 2HLPA 3LBAA 5DBEX 1XTRA 1D2EA 1M2VB 4E5YA 3VJRA 1ZUNA 4K88A 4KO4S 2V4UA 3BMQB 1P1RA 1V2GA 4BQQA 3AI7A 4OK3A 4A8PA 1CJBA 1V96A 3DAGA 3LDFA 1DJOA 3QFHA 1NUAA 4L2IA 4L50A 3S29A 4R9RA 3NHBA 1FRFS 2FFAA 2CXHA 4UMVA 2X0FA 2I62A 1K3TA 1XYGA 2ISQA 5FD8A 3UJNA 5F7JA 3NOXA 4I3GA 2JCVA 4JXZA 3ZNOA 4R84A 3OCXA 1SXIA 2WUFA 3LFHA 2ZANA 3U6KA 1Z6PA 2WE7A 1P4SA 1E1NA 3OEWA 4G81A 4YP9A 5JAOA 4FMDF 3U39A 5LKAA 5G4LA 2JGMA 4R6XA 2VHWA 3FBWA 3IDSA 4LZPA 1H8HD 1RI5A 4P4SB 1MVLA 2XVMA 1L5HB 1OIWA 1S0UA 4HYEA 4LVCA 1KE1A 4R9SA 4YCDA 1B42A 4YJHA 4MICA 1QIIA 2O3SA 3MQ2A 3AH8A 5BO5A 2ZR7A 4J4TA 5MDHA 1OREA 2GAJA 1HL3A 3S55A 3ZXSA 4BLQA 1EVEA 3MWGA 4FNAA 1CKEA 3W3ZB 3FPEA 4FHDA 1C30A 2RGRA 3V32A 4EHDA 4DREA 3KK0A 4I55A 4FLFA 5ICSA 2ZWVA 3EOBI 4TLCA 4AKIA 1O7JA 4L9RA 1U9IC 5A4JA 1JECA 3QUCA 3VDXA 2H29A 4PONA 3GLFE 4QC2A 4CW7A 2PUGA 2HA0A 2CVOA 3BIJA 4WY2A 1TMOA 1XXHB 1W1UA 2Q9CA 5F64A 2BMAA 3IHLA 3KLOA 3RSCA 3IAEA 3UY4A 1E20A 1SWVA 1TT7A 3BE4A 5FI1B 4P7BA 4RHFA 2DR0A 5M29A 3VSEA 3TQHA 3VU1A 3C85A 1YS4A 1ZAKA 2DFKB 3F4LA 1YL5A 4D80A 2RFLA 2ZVQX 1ZN7A 5KREA 3OJCA 5CIYA 2VAWA 3GRRA 4KN5A 2YVUA 1PNVA 3RBAA 2JPDA 4LKRA 1QC5A 2PMWB 1KMQA 3OFND 1VG0B 1ZCJA 4S2EA 1Q2UA 4MB0A 3CUTA 2WVJA 4XRRA 2R6R1 3VDNB 3FPGA 4NFSA 3RHZA 2Q45A 4GBJA 2Z2YA 1YQGA 3UMYA 3BN3A 2HCTA 1RR6A 1XQVA 4NTZA 2D6FA 1P75A 3KJNA 221PA 2G25A 2VDJA 1BXZA 4O3FA 5CYGA 2FX3A 1D4AA 3OTOB 5EHGA 4XGNA 2AD5A 4JLDA 4OYLA 5F5NA 3JU3A 1WXDA 5KOHB 2O2JA 2C4TA 2FPSA 2XJ4A 4AUNA 1V5IA 1EDOA 2NT4A 4LI0A 2O6LA 4ZZIA 4JZYA 1BDHA 3U4MA 3JR7A 3PDHA 2AI1A 3M49A 1P2UA 2A3RA 2RGNA 5CH3A 1Z26A 5H0IA 1WXIA 3WMRA 1GT91 4B83A 1PS9A 4UAUA 2H9AA 4QXAA 4U2KA 1RHRA 4RA9A 1HMPA 1KJNA 1HRKA 2D1TA 4MUXA 4PR0A 5JAZA 1Z2OX 3IELA 4EZEA 1N1EA 1ZBQA 2AI3A 2C04A 2ECQA 3O7WA 5JY1A 3R8FA 2FDXA 4N3CA 2BM8A 5KHAA 3ZE6A 2QPAA 4LHVA 2X6TA 3P5SA 1U2QA 4RK0A 4JHLA 2PS0A 4OGKA 3DXYA 2G70A 5LYJB 4ZDJA 4YMIA 1JG4A 4RF3A 4DMUB 2GF2A 3E4CA 2BKXA 4UVDA 4BWYA 1KO1A 2GEBA 4G5RA 4MW4A 1C29B 4IPTA 4B45A 1ZA2A 5KOIA 1T9AA 1A1VA 4IV0A 3KLPX 5CFLA 3CO5A 2DGDA 3WL3A 5BQXA 1AUXA 5IZCC 2CSXA 3LXMA 1EXNA 3DW3X 2FUG1 1SXJE 2C9ZA 3BREA 2ZYUX 3D7NA 4C87A 3F6YA 4UU1A 1TUBB 2FOIA 4IHKA 3KFVA 3BORA 4G67A 3WWZA 1KC1A 4GL4A 4D9NA 5KHOC 2FX5A 3QU5A 1EEXB 4BE9A 4AIRA 5BV8A 3RSLA 2YMLA 4R8MA 1NKTA 5F91A 3RIGA 4DMGA 3WR5A 3OQ1A 4OSEA 1UC9A 3FLAA 2DQSA 3NJRA 2AX3A 2X2FA 3W8FA 4AK9A 4E15A 1B0UA 2O50A 2ORVA 2HTFA 5CB4F 4YAUA 1KGSA 5MFPA 4WH0A 4D0SA 4HWRA 4N7MA 5FNVA 1CYDA 5C31A 5NLLA 1N77A 3TRKA 4S1PA 1TC1A 2B7LA 4GYJA 4C4RA 4DLYA 4R7ZA 1A0OA 1M7HA 1U4NA 3CEAA 3GG2A 3HKEB 3NHZA 4BEJA 5K6AA 3TJRA 1QP4A 3ZLVA 2B4TO 1KI3A 3O9VA 3KQUA 3FDXA 5U4QA 3ZHCA 3I72A 1K7WA 1O95D 2WUGA 1NW4A 4X1IB 1G2IA 3JYNA 1KTVA 2B25A 2I1VB 4UULA 4GMGA 1SCUA 5EGSA 4DCMA 2O1EA 2ZXUA 5CT9A 5EYPA 1E7RA 2P9CA 1IWBB 3ZU3A 1KOGA 2PTSA 4NZNA 3GIDA 4XPIB 4BGUA 5L8VA 1F3OA 3AF4A 2YX1A 3KSZO 2CFSA 4FFSA 3MUNA 3NETA 4G4JA 4ZHSA 3FM9A 1M6HA 4FS3A 4ZK6A 4YDHB 4RXUA 2ZZNA 1EWVA 2C3PA 4HQFA 2CE7A 5GZ1A 1MLDA 3ZDXB 1GVNB 2Z8YM 3V7UA 3OI7A 4CCSA 3KAPA 3DLCA 3I42A 1XZEA 1G8YA 1N2XA 1VBKA 1KZ9A 2AXPA 3F4BA 3KFLA 5BNFA 3UAWA 5KVVA 4JLJA 2JFXA 4JDUA 3SDBA 4BRWA 2C2KA 1J33A 3VPSA 4DC1A 3UPTA 2GYYA 1U31A 2X8JB 2D2IA 2QX4A 2XBUA 2YWCA 2Z9BA 1CTQA 4MWOA 4IIVA 3REGA 2IZ6A 1MC5A 5FWDA 4BCDA 2CE2X 3QA3E 4JL8A 3THXB 2WFZA 2H16A 4IJ6A 4HLCA 4KQMA 5ANRB 3TDKA 1NV8A 1DLIA 3TW6A 4NBRA 4F92B 1RYHA 1TO2E 2V7QD 3T4PA 1X8XA 3COPA 3GBSA 1N7GA 3SZRA 3IV6A 1QQTA 3CPSA 2J48A 4ROTA 1JHUA 1EE9A 2XLBA 3N2YA 2LCIA 2QVLA 5HKKA 3RYCA 1CYEA 4UUAA 4PLPA 1XZFA 3F6EX 4P08A 4AROA 1TJWA 4J0GA 3RG2A 4ETNA 2X23A 4DBLE 4I7EA 1U1CA 1EVLA 5TEWA 4EHLA 1C5KA 2D0DA 3AR3A 3F98A 3QYAA 2IY7A 4GIBA 5F1YA 3RBXA 3AERB 3AINA 3NTLA 2R7AA 1KH2A 2VEOA 3HPRA 4KE7A 2R79A 5KNLA 4QJ4A 3DTVA 3K4HA 4RQAA 1NDQA 3UK1A 4BQFA 1GU1A 1TO1E 1WOMA 1B41A 1W2WB 2RH9B 2YVLA 5IX8A 4WZZA 4B33A 2X7HA 2ENWA 2OAEA 2RGUA 3CFYA 3NHRA 2QYHA 2VVTA 5IWAB 3D4PA 3GGGA 3T3IA 4RTJA 5D1HA 4LXTA 4BQNA 3RSGA 2CDNA 2J3HA 2O5VA 2OZLA 1T3SA 5KPDA 3ZI7A 3DNMA 4GYWA 4EA9A 4S35A 4LZAA 2QL9A 4CLOB 1QMPA 1GL3A 2IXEA 4G5HA 5ALDA 1R8JA 1RLUA 1D6NA 1BC5A 3H1FA 2OWEA 4IOLA 2WQZA 5EUBA 1RIIA 2XNCA 1BG6A 5EN4A 4B32A 1UM9A 2P2DA 4G56A 3NBUA 3E9NA 4LXXA 1FDTA 4XUCA 2W2KB 1DIBA 2AJ8A 2P5YA 1RBQA 2CHQA 2ZEJA 2W4IA 3U3DA 2GZAA 2EKDA 2VEDA 3AV0B 4QHYA 2PL3A 2XNDA 1B3RA 1JR2A 1KZ1A 2HU2A 4PC3A 4DLRA 4HNSA 1MQAA 1IQUA 1NRIA 4NBUA 5J1SB 1G4HA 2CFRA 1QO0A 4HJRA 4NZ9A 2V1XA 3LF1A 5FEUA 1MH9A 1W6UA 3K5IA 4I9GA 4O0MA 7MHTA 1KOJA 3AONB 1PT9A 1JHRA 3RTEA 2IEAA 4U5QA 5JI3E 1O6ZA 2ZVDA 1Z4JA 4KQXA 4MLDA 4K9QA 2YY6A 5DCLA 1W581 2HU5A 2OC9A 1QJCA 1G17A 4BGDA 1S2IA 5K8UA 1K4YA 3F71A 1H0HA 4GWKA 2C2BA 2V7VA 4NSNA 3RD5A 3DMGA 2VYQA 4UARA 2K2QB 1FXWF 4D3FA 3DHNA 1NQOA 3PGMA 4OQMA 3ZQJA 1WOYA 3ID6C 1PJ8A 4J7AA 2DCUA 5ALLA 4TVBA 4UE2A 4D98A 4F4CA 4UXHA 2RBGA 1KSFX 1GPH1 5AI0A 9LDTA 2H06A 2DECA 3K2QA 2FA9A 4WBXC 5GWXA 4ZKEA 3EPKA 1DKUA 1U7OA 1X9GA 3QNWA 4YCSA 1O54A 4FKZA 3UW1A 1UK9A 2BFBB 4YAEA 4MMYB 1R88A 2C61A 3SGLA 3EGDB 4MV8A 4IFTA 4YROA 2EZ8A 5DHAA 4B80A 4EG3A 2HHHB 1XJWA 1XWIA 5I7RA 2P5SA 1Q0SA 1RM3A 2FPWA 4I50A 1DCTA 1Y6GA 4WBNA 5F2OA 1G3QA 3OTGA 1S8FA 1DFGA 4NS1A 2C59A 4JXXA 5EFZA 2ZREA 1VIVA 2HRRA 5D7BA 5MF6A 3S1AB 3PVZA 3TE7A 5ECYA 2E4VA 4E1AA 3RKSA 2VUTA 5JCZA 1MO6A 5A7FA 3C14C 1SRQA 1HE8B 3AHIA 1TQ2A 1I1HA 4REQA 3I1IA 3CH7A 5HTKA 3K0CC 5FULA 1Q12A 3PWZA 3TZHA 2B1IA 5DW3A 1CLEA 2QY9A 3UMBA 3VC1A 2ZR9A 2V0GA 2YZGA 3R6DA 3COJA 4DA8A 2OCGA 2AK3A 3KO8A 1SKBA 1W9MA 3QTBA 2JEYA 1EBFA 2H92A 2BFOA 2E1RA 2X4LA 3GBVA 3LC7O 3FCAA 4MPRA 1G38A 3MYRA 4MRPA 2O14A 1M8PA 5DN6D 1FFDA 1MD9A 4IP0A 4HF7A 1POXA 3WKCA 1OILA 1MEOA 2WM2A 2VQ3A 1F4VA 2AG8A 4FGUA 2D1QA 4FHEA 2CNWD 4P3KA 4Y2SA 5GZ6A 4D42A 5DNCA 3NHFA 3PFKA 4L74A 5HDQA 3GD7A 4F5ZA 2GSWA 2XAAA 4ZVOA 1XZMA 3PIDA 4A8TA 4EW2A 2GEJA 4YJ2F 4E5NA 3EXHC 1XTZA 1X7ZA 1E79D 3S68A 2DMRA 1I1NA 4ZVPA 1NMEA 3A2LA 3I9NA 3UMRA 4Y2TA 3E1KA 5JV5A 4KREA 2DLDA 2ZSDA 3OEED 1CJTC 1OKKA 2DFNA 2E4UA 3LLVA 3PQ6A 4NBWA 4OJTA 3K9CA 2J9XB 3PHGA 4YRTA 1U8UA 1SHZA 3KNZA 4S1NA 2HNBA 4B2IA 3PC8C 1TXGA 3T9FA 4CZ2A 1U5AA 3KTAB 1TYAE 4QE3A 1HI9A 1A72A 3WQBA 3FI9A 3QZUA 4V1CB 1J70A 2OUKA 5FDFA 5HQJA 1XAGA 2NW6A 4Y0VA 1MT3A 1APBA 1SHTX 1WUHS 2M6LA 1PJLA 4ZI7A 2B1RA 3V4VB 4RY8A 1Q0PA 2E18A 3IMGA 4LFCB 1ZL2A 1VHTA 4ARBA 4FGKA 1M5RA 1PQ4A 4LZJA 4ZVNA 3PEWA 4BX2A 1ZOIA 3K09A 2FETA 5KWEA 3OICA 5CX1A 1LRKA 3FPSA 2A9FA 1Q1BA 2BHLA 2ZR8A 2IOFA 1YZQA 1YU6A 2EFGA 2GMWA 3WMGA 1UBRS 2ZTHA 2HNAA 1S8AA 4G63A 5K4GA 2ACKA 1ZN8A 3K1YA 1Z88A 2D13A 2GZ1A 2SCUB 1T5IA 1D2AA 1ZD8A 1WM1A 2VHTA 3NYIA 3OOWA 1Z0AA 4N5LA 3GUYA 2IP1A 1J0CA 3T3DA 4AY3A 5D87A 5E9WA 1GRVA 1GT6A 3D6VA 1QYIA 5EE3A 1QIFA 1ZOSA 2KYRA 1BGXT 2O7VA 1SG9A 3GVHA 4GSLA 2JGKA 4NU8X 1X19A 2RGEA 3D81A 4XM2A 3ZWPA 2C42A 1SC3A 5K8CA 2AW5A 2FR1A 3LTEA 3DLTA 5I9MA 2D7DA 1JE0A 3QLTA 3VO8A 1F5SA 4ZYYA 4KMMA 5LQRA 2CVZA 2EAUA 1NUPA 1ZEMA 4X3OA 5KYUB 3TLXA 3HCFA 1T1RA 1XTJA 3RVOA 2B99A 3HCWA 3D7SA 4IUYA 5KWSA 1EHIA 4ARZB 1TIBA 1CCWA 2N3ZA 4CLHA 3OJXA 3PXCX 3UNXA 5JCJA 1JVBA 2D3WA 4QUBA 3UMFA 2NTYC 5IKXA 2VDWB 1R6XA 4NH0A 4YECA 5L6LB 1GGHA 1Q22A 4YASA 1AKMA 2DFTA 2JBAB 2AJCA 3LQFA 4PW0A 3WLQA 3DV2A 2OV2A 4TWZA 4B8YA 4WNCA 4OXXA 3IGFA 4RTQA 1QORA 2YRXA 3PD1A 3F3MA 2ZYDA 1CQJA 1VI2A 1CS4C 1FS6A 4DIMA 2BFFB 4IH9A 2Q5EA 3FPJA 4GOXA 2PLNA 2WJJA 3UC9A 1P2BA 5LXTB 1Q7TA 3Q5GA 3HABA 2C7OA 4P4LA 4DLKA 1Z5GA 2YNMA 1JQJC 2WJIA 1R5JA 3HA7A 4K6FA 4QL3A 1KO5A 4EL5A 3QX7A 3UTCA 3D7LA 3UCEA 1NSYA 2IHKA 3DE4X 3ZGOA 2CNBA 1CU1A 2NZUG 1N6KA 4OFWA 3W90A 4UREA 4WE3A 2OV1A 2QM0A 3IFSA 1Y6ZA 2J0VA 3CRQA 2VZ0A 3EZGA 3G6WA 3RHSA 5C7YA 3SLGA 3B3FA 2AF3C 4WZ6A 2O8VA 1JFSA 1ZGGA 2JJ8A 2HJHA 2XSZA 4H1UA 5CVJA 4EUKA 5C8YF 1EGHA 2QU8A 2EJTA 3IMFA 2PXCA 3OTWA 2IX9A 4FHFA 2W6NA 1E2IA 4KZPA 2LCQA 4LBWA 3RRBA 3TR5A 4ZTZB 2V45A 4GLJA 1E0JA 3CMCO 1UJ2A 2EC5A 1NWHA 3T1YB 2PH7A 4KK4A 2BFEB 1KY2A 5IC6A 2GVNA 3I2FA 3TEMA 1T3LA 2PRIA 3LCMA 3LRXA 1QH1A 1KTIA 1NN3A 3T1OA 3T61A 5JWOA 5LQUA 1HPLA 5LYJF 4RTOA 1V9SA 1SNYA 3CNEA 1AXGA 1ZJ5A 3MEQA 4D9CA 5HX7A 2XCQA 2Q3DA 2AEMA 2GJAA 3A9SA 5DYGA 2E87A 4QOSA 2QM8A 3NT5A 2Y1CA 3K94A 1M1XB 5DZSA 5JS6A 5D85A 1NDHA 3ERCA 1JHDA 1K0UA 2GBLA 1F60A 4RORA 4O4JB 2CB0A 4PIVA 5I48A 3STWA 4GR4A 2B0CA 1EK6A 1L8LA 1LPPA 3IQEA 2YMMA 2PQMA 4ZVKA 1Q0QA 1WPXA 3H05A 3V2HA 4D7AA 1C8BA 5KC9A 4TL7A 1VSQA 5JFOA 3HSYA 3OC0A 4OHBA 1J8FA 3FFTA 1I3CA 3IULA 4IGIA 1WW8A 4ZWNA 2QOEA 1SC1A 1OE0A 1MDBA 2W2TA 3EA0A 3WS7A 4B6GA 2BFWA 4HD8A 5L3VA 3AVTA 1X9IA 4F9EA 2FSGA 3S2UA 4NMWA 5JS2A 4BPRA 2KBFA 2KSQA 2ABWA 1Y63A 4N7BA 4CV3A 1RADA 2WVAA 3OECA 4Q1EA 4F60A 4WJLA 3X1WA 5C35A 4MGHA 3MTQA 3R5JA 4JC8A 4FNGA 2I8AA 2QIOA 4DBZA 4NONA 3U62A 3L5KA 3V3KA 1SUIA 4ZEXA 1XAHA 2PFKA 3T06B 4EX7A 1PWEA 5B3LA 5CLLA 4B75A 3NIFB 3DYVA 1RS0A 5SZHB 2VZLA 1XJCA 3ZZNA 1RLJA 3PYMA 3E9EA 1A5SB 1W0JD 2Q6KA 1OZGA 4TKZA 3D6NB 2PS3A 3ESBA 4JJKA 3RRYA 1CRZA 3K30A 5LOVB 4RD1A 4ISCA 1GG9A 2KMLA 4C1NA 2N9UA 1PJCA 1M1YE 1ML3A 2ZSHA 3C16C 4PR3A 1K1EA 4EJSA 3FOFC 5CW2A 3R3UA 1RWKA 1LSSA 3ZKAA 3DLHA 1OV4A 4WDQA 1W59A 3GAMA 2CXPA 3ETCA 1E59A 5K0TA 4J4HA 3CEMA 3VUFA 3CVXA 1O9BA 2CMFA 2GUGA 3H3JA 1P1FA 2Y2UA 1FTYA 1ENOA 2C7BA 2EZ4A 3WXBA 3H04A 1H93A 5EL0A 5AVVA 1UDWA 4TKMA 1YJBA 2R1ZA 2IYXA 5CJPA 4OL9A 1DIOB 1NRWA 1TCAA 2YRFA 4B82A 3ONDA 4MQ6A 2WIGA 4B2PA 4GPTA 5TJ9A 5G0TA 1GL6A 2L2QA 4W5NA 1LPMA 3AEZA 3GFGA 4QYMA 2IHJA 3NHWA 4B4WA 2F9LA 4QTUB 1WZCA 3C6YA 5EE9A 3OQOA 1ZUWA 3GV0A 2QIPA 3C5EA 3GZNB 4EY8A 2X5XA 3WWYA 4KUEA 3U09A 3HSSA 5I5EA 2VHVA 1F4PA 2WWHA 3MZ0A 4NDAA 3T95A 1WXQA 4NV0A 5D6BA 3SZLA 3INNA 2PN1A 3OZDA 3CX7A 3H1GA 4JCCA 4G0WA 1YZUA 1WQ1R 1T6XA 1YTUA 4Q34A 4BRUA 1WPQA 2OAQ1 3KM0A 2BGUA 1XU4A 4PXYA 3PIIA 3DC7A 1NQXA 1VZ2A 1IHDA 4GD3Q 4MUHA 4ZP1A 5FYDA 5HSGA 1AMUA 5KNBD 1G64A 2YFKA 3LLCA 4E21A 3S81A 1G5QA 1IE3A 1NRXA 1NPYA 4PNPA 5BUCA 1WNFA 1W5AA 3WYEA 3N0RA 5HDBB 2QRVB 3RVMA 1VPWA 2KLHA 1V71A 2NYAA 5DJ5A 4HNUA 1UCFA 3L84A 3PI7A 1JBKA 2PD6A 2WOJA 1IY8A 3MWDA 3MCUA 4MWTA 5ERXA 3ROPA 2WT4A 2PAAA 1UP7A 1NNUA 2QI9F 3OX2A 3AU8A 4ZOEA 3DQZA 4K9DA 1L1EA 1KWGA 1H65A 1NR1A 1JNXX 3ZD9A 5AXBA 1DAEA 1XAJA 1EUYA 3C3JA 5ALZA 1E5VA 3V4FA 3TLJA 1UUFA 2LD4A 3HV2A 4KFTA 4WK4B 1O4VA 1BFUA 1VL8A 4U2GA 4R5MA 2EBWA 2OXEA 3AR9A 2OP1A 3VOTA 5EJ4A 1IQ0A 5KKNB 1DKMA 1KJWA 3AVXA 2QENA 4C6SA 3L7JA 2MSDB 3EEQA 4EHJA 3MOGA 3TLZA 4JC5A 4FN4A 1WS6A 3EWNA 4Y0NA 3Q6IA 4RWZA 4B79A 1C7JA 3NONA 1MOPA 4EW6A 4LY6A 1WCXA 4XFJA 5LMCA 3WLOA 5IK2A 1EWTA 5KS2A 1ZHOA 1YB6A 1QU2A 3GAZA 3W78A 2BE7A 3EGXA 3FUTA 1XXHE 3E9RA 2H4ZA 1CUIA 3EBOA 4KBYA 1W73A 1IZ7A 4OD0A 4QYXA 2QN3A 2ZJ0A 3RRPA 1CDEA 4NG5A 1AV6A 2YWGA 1EI9A 2OQ2A 1RXWA 1ZRHA 1N9GA 1UZUA 1VG1A 2NO4A 4K3UA 3KZOA 1N25A 1NL3A 1JNYA 5A6VA 1P9RA 4BVEA 1JEYA 1KU6A 5C4IA 4UM5A 1GITA 2QL5A 2MCFA 4Q7EA 2GAOA 4JR1A 5CT5A 3QMPA 1DBRA 3T41A 4EA8A 4IIEA 1NMSA 3DE6X 2ZT5A 3D5EA 5EP2A 4HNRA 3V6LA 2R1TA 2IV7A 1TEHA 5FQOA 1M2WA 2D54A 3JD3A 4EKDA 1DEHA 2M6SA 1MRZA 3JQ9A 2ILTA 1KZ4A 1V47A 1XMSA 2XYQA 3AYXB 1A76A 4HFMA 3WGOA 3WZ2A 4BZWA 4ZFNA 1GPBA 3JRNA 3PJRA 1L4NA 2IDZA 4HNAA 5MGNA 1Z5OA 2BI4A 2W90A 4I8DA 2P2SA 2NXJA 3VU0A 3U3ZA 3PTAA 3OPYA 4O08A 4G0VA 2UUOA 3VDQA 5GVSA 3HVHA 3EJ6A 3HUDA 3D6JA 3MFQA 2P3QA 1K98A 1YCHA 3DNFA 4D41A 1YZNA 5ALNA 1LXCA 3C48A 3NNDA 4CKCB 2JRLA 4KKVA 1J8VA 5EFOA 4DV3B 1MHPA 1Q1NA 2P6NA 4GT1A 3CLRC 3VTFA 1C3JA 4W8GA 1NFFA 3W79A 4K8OA 5FOWA 7GPBA 3F4TA 3VHXA 2HT6A 2IP2A 2PWPA 3NTVA 2WB2A 1D6SA 1TC2A 4J90A 3HSKA 1K5PA 2BHNA 3WL7A 2OHFA 4DG9A 4BX9A 3GOQA 1G5HA 3TECE 1QQ7A 4IBOA 3K5WA 4ALNA 16PKA 2EKBA 3QFRA 1E6EA 3R0IA 3ABZA 5BSMA 3BL6A 4MMZB 1PR4A 1P2FA 1U99A 3AF3A 3K6KA 5KVQA 5I9BA 1PD1A 2VXYA 3HCPA 1I3KA 1ZH6A 2A7XA 2EWVA 1VL5A 2Q5QA 4EEXA 3KYDB 1RHJA 4M9SA 2VHJA 2LIPA 5IN5A 1SUBA 4AD8A 1DHRA 3NT2A 1DGQA 1C3CA 3QLUC 2IH4A 4HDKA 1HRDA 3BL5A 3JVIA 4G5XA 4B09A 4ZEVA 2POCA 2B37A 3SKVA 3GP3A 4BFYA 2ZB4A 2DPHA 4HKTA 5DM4A 3FZYA 4RL4A 4EHNA 1ZCAA 2G9RA 4U9IS 2CYBA 2GZ2A 1EZ4A 2BTQA 2LKCA 4RHYA 4HX5A 1BXRA 4LOLA 2G82A 1OLUA 2WDPA 2XOXA 3HWSA 3WMFA 3A1WA 4TLLB 2Y1XA 3P94A 1XROA 4WXMA 4DSUA 3RYFB 3TSYA 1MQSA 1SPBS 3E3MA 4KLCA 2V59A 4N8SA 1OHHA 3B36A 3HFSA 3WTBA 4YV0A 2PG3A 1EXDA 4Q9LA 1XAIA 4OHCA 1C3EA 3L6BA 1U0GA 1A04A 5CPBA 3PPWA 2QUZA 4IVRA 4KL8S 5ECDA 2XNKA 4YRKA 2M1ZA 3TZCA 3T1QA 3VHLB 4KHZA 3BCRA 3E8SA 3K6SA 2KM1A 3JQBA 2QTAA 1JZSA 3AVOA 1PFVA 3WZLA 3B7PA 2FQYA 2DWPA 4LWOA 1T6YA 4ADLA 4MAAA 4KODA 5K0CA 3ED1A 5KQRA 2HR1A 721PA 1G55A 5KTTA 1RWBA 4CKWB 3R9XA 4HGPA 8AT1A 2NV0A 1UKAA 2PNJA 3ZE9A 1KH3A 4C0HA 2HMTA 2QMHA 2XUPA 3GNQA 4KNYA 3RIXA 1RBYA 1O95C 1EDDA 1E2DA 3TOXA 2O05A 3VYVA 3IDQA 1GNQA 2AOTB 3RQSA 3R74A 3WNCA 3VH4A 1E3DA 1ZKDA 4QUJA 3V4PB 1YBAA 2WKWA 2WMDA 3I12A 3VH2A 3QWIA 3QQPA 3WYDA 3S2ZA 4ENRA 3TDNA 3CA8A 5KNCH 4ILEA 1RM0A 2V9ZA 5BUZA 1CVIA 3DDUA 2R6FA 1N57A 2JI6A 1E7SA 4QGGA 3TLGB 2GKSA 1CX9B 3SHFA 2NU6B 2Q07A 2Q1XA 3ICPA 4HX2A 4NOKA 2VSOA 3RRMA 3U81A 4AO8A 1KRXA 4RABA 1P9WA 1RQLA 2GLXA 4H4DA 5CRIA 3JQ7B 4KXVA 1IXSB 4H3KB 3WKBA 2C82A 3ETLA 4P0PB 4BLVA 3IPXA 1O96B 3IPYA 2GD1O 1WUIS 3KHSA 4JKYA 4LQ4A 4LJYA 1E3JA 3KWMA 1CULC 1ND6A 1ZMXA 2PO7A 2RHLA 4JA0A 1VLQA 4PQFA 4A82A 4DMRA 4I50F 1XPRA 1JEOA 1KQFA 3JQRA 3KLMX 1OGIA 2HX1A 3FLMA 3V55A 5C3UA 4AM8A 4PG5A 5IS2A 3VSBA 1GNLA 4HDMB 2DF8A 1TE2A 1XJ0A 1U3UA 2V8OA 1Y4AE 2FKNA 3C3YA 4HRXA 2CL7X 1I8TA 1KH1A 1I2ZA 1Z28A 2PSSA 3I6IA 1JXQA 5CPFA 5IKOA 3RFCA 3TTYA 3ZWBA 4YCLA 3T7SA 3U1BA 3E3OA 3ZY4A 3C6XA 1PZXA 2GO1A 1X7HA 2C5HA 1G4UR 3KKPA 3ANMA 3PPXA 3FUCA 3JZIA 2O5CA 4BMNA 4ZHQB 5ELXA 2JIPA 2WP8J 4ENVA 4EY5A 3W7VA 1O5TA 1QRRA 5DTIA 4ZOLB 5B6JA 2X0DA 2IY9A 5AJWA 3NAQA 1Y3DE 1WCIB 2W2VA 3NHSA 4MVJA 1G1MA 5FBKA 4CM3A 3OFJA 4YGXB 3Q2IA 3DV0B 1Y7PA 2A5LA 4QAQA 2HXSA 4I5FA 4BQIA 4XWKA 1Z62A 3I62A 2Z6UA 5ENDA 1G2QA 3VZPA 4J49A 3ZI0A 4DJDC 3I6QA 1IBSA 1MO4A 2OVFA 3BL8A 2QUBA 3K2EA 3H0CA 5AUNB 3ZE7A 3IVAA 4JELA 1V7QA 1OUMA 5J3JA 3CTPA 3F7TA 3I04A 2HY7A 1Z74A 4FTWA 4Y6GB 4F5YA 4DIFA 1R7RA 4I1OA 1SOAA 1NW5A 3PUWA 2Z57A 4AXBA 4PLVA 2EYQA 3ESYA 3OIYA 4CIWA 4J1TA 2J32A 2HHCA 2CXOA 1Z68A 2HXGA 3LA6A 3SAJA 1IL0A 2Q5OA 1W36D 2IEYA 5AKIA 1DKLA 3MBOA 1DQZA 1GA4A 3DZBA 3N5KA 5EUCA 5T6BA 1O0SA 1NXPA 1L4GA 4PSCA 2HQSA 1EP3B 3I9JA 2VJYA 5HF6A 3UAOA 2Z6QA 2Y0EA 4L5IA 3BQ9A 3A6GA 3MCTA 3DL4A 3R9KA 2E6KA 1V39A 4QXOA 3UJDA 4DV2B 4Q47A 3N07A 4DQ0A 3I52A 3LPDA 4F96A 4QG7A 1DPGA 1QKKA 4LIPD 1FCJA 2QK4A 2PDAA 1DX9A 4H1TA 4RZ3A 4BV9A 3A6HA 3DB1A 3CWCA 3D4NA 1JEDA 1AB5A 1ZM7A 3HHPA 2FZLA 3L06A 4JLKA 4Q6WA 3BXZA 5E2AA 4RF2A 5D5PA 1KEKA 3N0WA 3QYPA 2I9KA 3NW9A 1W4AA 1TPYA 2CUTA 1TLFA 3BVPA 1K3UB 2A57A 2NV2B 2VJQA 3DWEX 3NQ41 4P1ZA 3AHCA 2IH2A 3EG9A 4NARA 2FI1A 4BBAA 4M83A 5SV2A 2G09A 5GJCA 3SBEA 3HUUA 4XQ0A 2OZKA 6REQA 3UJ7A 3Q1KA 1F2UB 1I3OA 5DTQA 5BSEA 3AOGA 2B7BA 2EJWA 3GDHA 2O0HA 2FPMA 3AHHA 1I7LA 3NBMA 2XUOA 5B1YA 5YASA 1RYZA 1NGSA 1AC5A 2HJSA 2Q9UA 1GUDA 4A4DA 4Z3KA 3SX4A 3V2IA 3QPAA 3IB6A 4CQMB 5JDIA 3OCFA 5AMXA 1FTQA 1EBUA 3G13A 2L82A 2YINC 1KGDA 2Q3FA 2AI2A 2VDUE 2XOEA 3BGVA 3FBGA 4PTYA 1Y3CE 4OUKX 2PSDA 2DXIA 1AGRA 1X1BA 3LHDA 3PFNA 4JLUA 4N39A 3HDTA 4FYPA 5DISB 5DCYA 4A27A 2W48A 4KIJA 1TM5E 1AURA 5FFFA 2NSYA 3SKXA 2O2DA 3HY3A 2XB2A 1N6HA 1GDHA 3OU2A 3RK4A 2XNHA 4M6WB 3TAUA 1R00A 3I3OA 5LA6B 1GWNA 4C08A 1X7GA 4NV3A 2DT8A 2QN9A 2Z04A 2YFHA 4HVTA 4GPIB 3DHEA 4HGRA 3UG6A 2WFLA 1X80A 2ZRQA 3QM1A 3P5BA 4IZ6A 3KR9A 5JJBA 2JFPA 4CMEA 1RKVA 4EPYA 4ZDIA 4MIEA 3ZJUA 3PNKA 4JY7A 3A4MA 4PAGA 5BR1A 3RYHB 5KKCA 3CZQA 2EBHX 3OLXA 1K6IA 4KQJA 4YUVA 4BOYA 3PC2A 1YJ5A 1OMOA 1L2TA 2VQ6A 4NE9A 5AI5A 2JLBA 4RAQA 3FKSD 4GBMA 4D0RA 2PQ0A 3N0VA 2EGHA 3JQAD 2WIJA 1ZM9A 3JWGA 3L3BA 3ZHBA 5CVTA 3NDIA 1NVUQ 2HCBA 4DA6A 3BCHA 3NBYC 2ZIUB 1W8DA 3U5TA 7ABPA 2REBA 2ZRDA 4UVHA 2LBPA 4YI5A 7REQA 4YIKA 3GNTA 2ZVJA 3AUTA 1H1DA 1LLFA 1P77A 1L6RA 1R0BA 1M8JA 2QM7A 4MR9A 3X2SA 2ORWA 3KAKA 1DWQA 2GZ3A 1DLJA 3HS3A 3IVXA 3TB4A 5A4IS 3TE6A 1Y7IA 4H1WA 4GLBA 4QBFA 3L6EA 1US8B 4O02B 4QXMA 1A9OA 3IVGA 1IQRA 2BKAA 4BQPA 3R23A 4N82A 3SIRA 2AIRA 1WDTA 2O2ZA 4MKGA 4XYBA 1M72A 3TF5A 1NN1A 1Y1SA 1V8BA 5LLDA 2F7SA 4TMKA 3M4YA 4HC4A 2BMWA 4B81A 5A1TA 4KVZA 2D2EA 2ZPAA 3KFXA 4PRLA 4YGYA 2C88A 2XKBA 5ITWA 1NF3A 4BMCA 3M9WA 1JHQA 1E58A 5LD2C 3A6PC 4EQ6B 1N5MA 5ICGA 4RFLA 1KF0A 3KB8A 1BWSA 1J20A 4BKRA 3GF4A 4R2IA 2ODWA 3ZIAD 3VHQA 1CHDA 1HTWA 4JVSB 1A95A 1CJSA 3GPIA 1MVNA 2HDWA 1HZZC 1OA0A 1VRVA 1XRSB 2VUIB 3G2LA 4QHSA 3QUTA 5TVKA 4ZC1A 3WRXC 1V5FA