1Z4QA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with 2',3'-dideoxy-2',3-didehydrothymidine 5'-monophosphate (d4t-mp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 62
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4qA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4qA01
3U26A 1TE2A 4DCCA 1Z4KA 3SMVA 4J03A 5AK3A 2ZBGA 4CE6A 5AK5A 3KBBA 3OCYA 5AVYA 2W4MA 5AI4A 4KNVA 4CF3A 3W5BA 3SHQA 4UMVA 5AI8A 5JJBA 2P11A 3F9RA 4AS2A 5AW3A 2HEGA 5ALIA 3OCXA 2CFSA 3AR8A 5IT0A 5AVUA 2YJ4A 3HYCA 1L8OA 1L7MA 3PDWA 1VJRA 5ALYA 4EZEA 2IOFA 2YN4A 3VAYA 3ONNA 2WM8A 5AVQA 2FPSA 4Y2RA 2YFYA 1YS9A 2WHEA 3EWIA 4Y2JA 3ZWDA 3A1EA 2ZBFA 4FYPA 4UM5A 5ALFA 4ZEWA 5AW0A 2ZBDA 3OPXA 2YMLA 3A3YA 2IOHA 2R8YA 1Z4PX 2G07A 2JAOA 4Y2UA 4AP9A 3QU2A 3BA6A 2G80A 2HSZA 1S2OA 4YIHA 3PCTA 3I6BA 3ZTYA 4L57A 3EPRA 4EENA 5AKJA 1J97A 2YMPA 5AVZA 3TLMA 2BY4A 5ALJA 2MU1A 2B8JA 1L8LA 2I33A 2RAVA 3NASA 2FI1A 4BYGA 2YJ5A 1J8DA 1PW5A 4EX7A 3AR2A 3QXGA 2B30A 5ALUA 4XOUA 4Y2PA 4C4RA 5AKKA 1Z5UA 3OCWA 3WK7A 5AIAA 2BDUA 2Q4RA 3R4CA 1K1EA 2G06A 1RLMA 3E58A 5AM1A 2C8LA 2ZXEA 4YCNA 4MWOA 1RLTA 2HDOA 1Z4QA 2NYVA 4DWOA 4HYTA 5AW4A 4BX2A 1RKQA 3UMBA 3ZI4A 5ALTA 1QH9A 1ZD3A 2HX1A 3QU9A 3WK6A 3SKYA 4UAVA 3N5KA 2YJ3A 3B9RA 3QGMA 3MC1A 2CN1A 3L8HA 5AVWA 3NANA 1WPGA 3KOOA 2R8ZA 3ET4A 1Z4JA 4JB3A 3W5AA 2HO4A 1TJ3A 1YV9A 2EARA 2YMQA 3DV9A 3ZVNA 4O8CA 2QYHA 3EF1A 3QYPA 2NO5A 1NRWA 2HCFA 5ALWA 3WKAA 3E8MA 4NWIA 1XVIA 4B6JA 4Y2TA 4MUMA 2FUCA 2FPWA 1T5TA 2AUTA 4OCZA 3QUBA 4KX5A 3U7HB 2D2VA 2ODAA 5AK6A 1U2TA 1EK1A 1F5SA 2AMYA 3I76A 3EF0A 4IG4A 4J2TA 4UM7A 3ZX4A 2YJ6A 2FPXA 3K1ZA 2OYCA 4NABA 1U7PA 2W43A 5AW9A 1L6RA 3IRUA 2HF7A 4UMFA 1YNSA 3RF6A 3B9BA 2BDEA 3WK9A 4EX6A 1Z4OA 4KYTA 3QLEA 1O03A 2FPUA 3DNPA 3I28A 2OA0A 2GFHA 5AW7A 4C4SA 3QU4A 3KDPA 1FEZA 1JUDA 5AM5A 5A3SA 2C88A 4KN8A 3WK5A 3L7YA 3L5KA 3B8EA 2RARA 4OFZA 1QYIA 5A3RA 1SWVA 5AKEA 1QQ6A 5AM3A 2P69A 4JDPA 4UU1A 2R8XA 3QUCA 1QQ5A 4QQFA 3WKDA 1YMQA 2GHQA 4CF5A 1RMTA 5AICA 3NAMA 3AR4A 4HGQA 3FGOA 5T41A 4EEKA 1RDFA 2AH5A 5AIBA 1ZD4A 1U02A 3AR6A 2G08A 3E81A 3PGLA 2B0CA 1VJ5A 1ZOLA 1RMQA 4UU0A 4Y2XA 1RC8A 1Z4IA 2O9JA 5AM2A 4YCLA 1WR8A 1YDFA 5AKHA 3NIWA 4NV0A 1T9ZA 1TJ5A 2OM6A 1Z4MA 2I7DA 2WF7A 1VFPA 3WKBA 3QUTA 1Y8AA 3I1YA 4XE5A 4UMDA 1ZD5A 3A1DA 2I6XA 5AI0A 1QQ7A 5AI9A 2RB5A 3U13A 1Z4NA 2FEAA 3KZXA 1LVHA 4EELA 4I9GA 3WKCA 3S6JA 1TJ4A 4UASA 2YBDA 3RFUA 4UATA 4F72A 4FFDA 2W11A 3FZQA 1RQLA 5AHXA 3AR3A 5FP0A 1YJ5A 1XPJA 2ZBEA 4UAUA 4L6CA 3L8GA 4Y2VA 5AKLA 5AM0A 4BX0A 2GMWA 4NFLA 4DFDA 2WF6A 2R8EA 2CFRA 5AI5A 3SD7A 2G1AA 2YY6A 1CQZA 4BEWA 3E84A 1U2SA 1Z4LA 1WZCA 4UMEA 2JAUA 3BWVA 3AR9A 2C9MA 1Q91A 1RPZA 5AK4A 5IS2A 1KYTA 2HOQA 4HGRA 3ZW7A 3ESRA 3M9LA 2WFAA 5AKIA 2ZOSA 2IOFK 4PNHA 3SLRA 2I54A 3ZVLA 5AVTA 2IYEA 5IT4A 4KNWA 2GO7A 3M1YA 5ALKA 2PKEA 2YMMA 4BBJA 4FE3A 2QLTA 5ALGA 2FPRA 5ALNA 3D6JA 3IJ5A 1SWWA 5ALZA 5AVSA 4H1WA 3ZTWA 3ZUPA 4BX3A 4ZEVA 4UW9A 1L7NA 3IB6A 2B1RA 3UMCA 4HGOA 1L7OA 4OHFA 5AW5A 1Z5GA 4BNDA 3R09A 3W5CA 2I55A 2B1QA 3UMGA 4CF4A 1RKUA 3AR7A 5AKZA 3QX7A 1IWOA 4Y2YA 3QNMA 4GIBA 3W5DA 1ZJJA 3ZX5A 3L0YA 3GYGA 4XQ0A 4IFTA 1LTQA 3N07A 5AVXA 3QU5A 3U19A 3KD3A 1ZRNA 2FDRA 1EK2A 5AESA 5AW8A 4AS3A 2P27A 2MSNA 2JGAA 2DQSA 1L7PA 2C4NA 5ALEA 4F71A 3QU7A 1ZRMA 4NAVA 5AM4A 4CNQA 1O08A 2JARA 4GXTA 2Q4TA 1X42A 3R9KA 5AKXA 5AW2A 5AVRA 5ALHA 3CZ4A 3DDHA 1S8OA 3MN1A 1XP5A 2NO4A 4KX3A 3U7GA 2FUEA 3HLTA 3L1UA 2WF8A 2HHLA 3P96A 4C4TA 5A3QA 2VKQA 3L0BA 3L0CA 3WGUA 2OBBA 3OCUA 3NALA 4ZEXA 3DAOA 3FPSA 3MPOA 1RKVA 3WGVA 2P9JA 4RESA 4Y2QA 4RETA 3SKXA 4BNDB 3FM9A 1RRCA 3J7TA 3UM9A 5ALVA 5ALRA 1TA0A 3CNHA 4E88A 3L8EA 2X4DA 2Q5EA 1T5SA 2EATA 1RLOA 4YIKA 2EAUA 1ZD2P 3WK4A 3ZU6A 1U7OA 3ET5A 3FVVA 4QJBA 4UARA 3OCVA 2PR7A 3PGVA 4YCMA 3FPBA 1Z88A 3N1UA 1CR6A 3QUQA 5AW1A 4G9BA 2WF9A 4BKMA 4HGNA 1NNLA 4DW8A 2GHTA 5ALPA 4L6AA 2HI0A 3ZWKA 3NRJA 3WK8A 2AGVA 1AQ6A 4HAIA 2CFTA 4HGPA 5AVVA 1RMYA 5AW6A 4OD0A 3L8FA 4Y3UA 3U7FB 2O2XA 3SF0A 1MH9A 3OCZA 3MMZA 4G63A 4I9FA 3NUQA 5ALQA 2I34A 2WF5A 4YGYA 2PQ0A 5ALMA 2G0AA 1RQNA 5AKYA 2B82A 2ZG6A 1ZS9A 4YH1A 2IA5A 3WKEA 3OTQA 3U7EB 1WVIA 5ALXA 3A1CA 4Y2SA 2B8EA 2HF2A 2C8KA 2G09A 3L1VA 3ESQA 4BEVA 3ZVMA 2RBKA 3N28A 5AKGA 5ALLA 1N8NA 1Q92A 2JAWA 1N9KA 4XPZA 3AR5A 3KC2A 3N8GA 1NF2A 3ED5A 5ALSA 1SU4A 5ALDA 5E0OA 5AI6A 5ALOA
chains in the Genus database with same CATH superfamily
3S40A 1Y1RA 2O14A 4JHXA 2GVNA 4DCCA 3BGVA 4CU5A 1R50A 4OHBA 2ZB7A 2FZVA 2BV3A 5CLGA 1EX9A 3MTAA 4BQSA 1JFVA 2ZU6A 1TJYA 4MW5A 1LU9A 5I8ZA 3SZGA 2VUTA 1OU0A 4ENVA 1GSHA 3F4BA 1AKRA 1ZL0A 3W5BA 1YB7A 4JBXA 4BKQA 5LMNB 4DLRA 4ZT5A 3DVSX 4EFMA 3ZLTA 4AS2A 4G2TA 4GHWA 1G6KA 3X2EA 5AVUA 1NLZA 1X15A 2WWRA 1IXKA 3HYSA 1CUEA 2JGDB 2VTKA 4NEQA 2CXRA 1QF7A 1EVIA 4OQDA 5EZSA 3FCOA 2KJQA 2QVGA 4RGYA 4YLEA 4YAUA 4YHBA 2H4XA 3IEPA 5MGBA 1E2GA 1G8MA 2JLSA 3C43A 1N0HA 3T34A 3TW8A 3WE7A 5AVQA 1S3FA 4N5DA 3H5AA 3ENKA 1M0EA 1T43A 2MMGA 3C8UA 1W96A 1OB2A 3ZWVA 2O8FA 4F3YA 4FUQA 4MB2A 2Q07A 2PIDA 2FHSA 4RD2A 3S8YA 3AO0B 3N2IA 1ADFA 1UBUS 2ZJFA 4IJKA 4KN5A 4BZXA 1JSWA 1PZFA 2AQIA 3TD9A 5F7JA 3PCRB 1RYFA 2XV1A 3ZDZB 4FMCB 4ZCLA 4CM3A 4G0PA 3EZLA 3TGPA 2OD9A 2PBRA 2Q3FA 1OT5A 1M72A 4FWBA 1H94A 1CY2A 3A6JA 4PHTA 4TLBA 1T1SA 1FDRA 1E69A 2HA0A 3QU2A 4Y9DA 2C7OA 4DDKA 2DBQA 2EF0A 4IIVA 4Z3OA 2JGKA 4HJXA 4LIPD 4EYOA 3WNBA 1C4XA 5LU9A 3JQBA 3BHJA 1MJFA 2RGDA 4Z0PA 3I9FA 2DY0A 1U8XX 1KYVA 2UZ1A 4ALKA 1E4EB 2AFHB 3GH3A 4O25A 5CLLA 3TKLA 2WG0A 4Z1OA 1E3TA 1J0BA 2JC3A 5DF1A 3R20A 1JDZA 5DK4A 3HZZA 5M04A 3H9EO 1U4OA 2X1HA 4H7FA 4M83A 3AKEA 1XDWA 1AS2A 1BDMA 2FI1A 1TCVA 3JY6A 3QXSA 1J2RA 3QPCA 2DMRA 3CZQA 2E5LB 5DXAA 4I50A 3HB9A 2HIHA 1K7YA 5ERXA 5JCPA 4CEJB 2F17A 1JA9A 1G8HA 3ELUA 3T5GA 4ZI7A 2ZJAA 3PEUA 2J9GA 4PLHA 4Q7KA 1NW7A 5DBFA 1SA0A 3CISA 3AVOA 3F98A 3R3WA 2V3WA 4NAUA 4QFMA 4IZOA 4YS6A 1SIBE 1DC4A 4P4TA 3D8BA 3FFTA 3D31A 3FWNA 4MR7A 3UHAA 4IDFA 5K3SA 3DOHA 1YQDA 5ITSA 4P4UA 1TVMA 4OFXA 1EFTA 1JHQA 1P9OA 1V8DA 3BGDA 3IOMA 4WJKB 4WKNA 1Z7YA 5EKUA 1SIOA 2GN9A 3K2QA 1N2HA 5BR4A 3QF4B 4APAA 2PNJA 3BAZA 4DIMA 3KG2A 1FDSA 4K46A 1QH9A 4W5RA 1ZMRA 1EFPB 3EBLA 3BTVA 1N92A 4M7RA 3QU9A 5EE1A 1CF2O 1BN7A 1E7WA 3AUFA 3KQQA 3IT0A 1FFBA 1E1DA 5BXYA 2XYQA 2Q1WA 5CEJA 4OIMA 3MWFA 4LN1A 3QXXA 3NANA 3GP8A 3AVXA 1ADCA 2QGAB 3PXCX 4PSDA 4DNOA 1P60A 2A6PA 4P22A 4E70A 2ZUDA 1SCDA 2OESA 1RYNA 3HFRA 1L3BA 2NNWB 3N2GB 4UUNA 4ATNA 4ZCRA 2GR9A 3KYDB 4TRRA 3VPXA 4ENWA 2OOKA 5CH5A 4ZT2A 4D99A 5KNDH 2A0WA 3WYGA 4M99A 2BEJA 4N3GA 2HCFA 3R3YA 4QBKA 1MO3A 1U0JA 1ZGCA 3E22B 4H77A 5ALWA 5A7HA 1V6AA 2RHBA 3B13B 4NWIA 3CZCA 1X3LA 3OPMA 3A2NA 4LY9A 4B6JA 4Y2TA 1NBME 3X1JA 2OZEA 1J0EA 1FC0A 5KVAA 3OZCA 2D2EA 4DCPA 1XMPA 2OHOA 2Z6AA 3RBZA 3VKHA 1NJ1A 121PA 3IAM6 2GTPA 3WJAA 1UBSB 3VX4A 4OB6A 4RGBA 1O95A 1NE7A 2H1RA 5BN4A 2FRDC 2H4JA 1U94A 3Q11A 4LE1A 4B44A 4CM4A 4A0SA 4D81A 4FQ5A 4RM3A 3T4XA 3N0TA 3VKWA 3K2EA 1RPZA 1ST2A 1R0CA 4RJKA 3EF0A 1I2CA 5K8IA 4D3SA 3ETJA 3WBFA 2FPXA 1CX9B 3T1QA 5BSTA 2PUGA 4RMNA 3D6AA 1ZKMA 4H3VA 1FDTA 4L8LA 4P81A 4LOHA 2BP7A 4RHFA 1E3IA 1G8JA 1NW8A 4L15A 3GDOA 2VWPA 5E38A 3RAJA 5JQWA 2XXAA 1MT0A 1JKXA 1V48A 2J87A 4QUBA 2IWRA 4ZALA 4K9NA 1KYWA 1A8UA 1K68A 2ZRBA 4BMSA 2Y27A 1TGVA 1VPEA 2Q5JA 1BJTA 1QIDA 1T24A 2ZT7A 1XAJA 2HC9A 3CUEF 4J2OA 4CCAA 1W85B 3QFHA 4RCYA 5HS6A 1JPUA 3F5MA 2VIIA 1B0ZA 2FSSA 3SLGA 1MMFB 3LCRA 3RC8A 2IHUA 3RU7A 3RHZA 4ZOLA 3RDPA 1KS2A 1XTBA 2F6RA 4F85A 5ANRB 4F5ZA 3CTPA 1WPQA 4F1JA 1WY5A 2FDXA 5IG2A 1NP6A 1PFQA 3P9ZA 1NN1A 1A76A 1SC9A 1N2IA 1N0UA 3OUTA 3PCXA 4LUCA 1Q14A 4JEUA 4P31A 5I7OA 1QTNA 3SLKA 1ONNA 2ZSEA 3PU6A 1E1QD 2ZZNA 3GD5A 1QQ6A 3TI7A 1F60A 3NBYC 4BHTA 3BCRA 4KB5A 3EWAA 5CFPA 2XNCA 1KQPA 1PJ4A 4GI7A 2LE0A 1E63A 1HRDA 1KVQA 2GCIA 1FP6A 2H2WA 1E99A 3IT3A 2OD2A 5BV7A 1Y6GA 1RAAA 1Y6FA 3FWZA 3O84A 2NUAA 3Q8WA 4RPKA 2PY6A 1PWZA 4YJHB 4B4UA 4DLVA 3PRHA 4BO6A 3DBRB 1XCLA 4V3BA 1USVA 1R5BA 2RHOA 2CDRA 4OX9Y 2M6LA 3H9QA 1J07A 1OAOA 3NGMA 4ARUA 1GN9A 2EV9A 3OHMA 5IJAA 3RIHA 3IPRA 2B1GA 3DDZX 1VSTA 3CN7A 3KYBA 3N8IA 2ZJ5A 3AUAA 3VNBA 1GCGA 4MWBA 1D5CA 3ZHYA 3A4LA 1I3LA 5DOZA 1RC8A 1YZLA 1GU1A 1YR8A 4JMLA 4MKHA 2WTBA 5HG0A 1YCDA 3VU9B 3FXAA 4FS3A 2Q5LA 5FWDA 2IYYA 5JS8A 2IEZA 1EIZA 1M9NA 2Z1NA 4K1XA 3UWKA 2C2OA 5J9FA 5KQSA 2V8OA 1EGMB 1V16A 1L7RA 2GQ0A 4LDPA 4MMZB 2A57A 5CDUA 2YYZA 4UHDA 4RJJA 3KU4A 4M1TA 2D5AA 1LVHA 1NN5A 1ODKA 3UW1A 2PZAA 2VHEA 3NYRA 2CXSA 3C8HA 2MR5A 4N65A 1FFEA 1UPTA 2M1XA 4MIKA 4AY6A 3S6JA 1AKMA 1I7NA 3ZDXB 3ZCSA 3O2QB 3AIOA 1T2FA 3RRMA 2CUNA 3GNLA 1G6Q1 1RQLA 4O4HB 1P7VA 3IAEA 3H7AA 3BDVA 1R64A 4K88A 1UK9A 1RM4A 3UC5A 1E18A 5K0CA 2OPBA 1YBFA 2FPIB 3T1NA 1QZZA 1VI2A 4RDXA 4H7IA 1YTUA 5B2EA 1J20A 2ZBPA 3F4KA 1JHDA 1ZW1A 1T13A 2CFRA 1RD4A 3NI2A 5BORA 3LA6A 4O4LF 3JD1A 4GWGA 5HRCA 1YQEA 2Z95A 1K6IA 2QTWB 2ZCJA 4CQMB 2JAUA 3SJBA 2ZXUA 2BDTA 4XLTA 2I7XA 2J3IA 5BUQA 3DULA 1RQPA 1KJIA 3JAWA 4XSGA 4IIJA 1CF4A 1O6CA 2D00A 1XVVA 2QI9F 1E2FA 1NVMB 2G72A 5HMLA 1HMPA 3R24A 2DFTA 1OLXA 4N9QA 1V1RA 4U63A 1E4YA 4UPVA 2XUPA 3EB9A 5CB4B 1Q21A 1T4CB 1U0FA 1E89A 1KAMA 2AFHE 2VUSA 2Z1MA 3JPWA 3OPVA 4DRZA 3OZRA 1KL7A 2DLCX 1ST3A 4QGSA 3USES 3G88A 4KNWA 2W2LD 3MW8A 2QOEA 3ZCUA 1KJNA 4DR3B 4BNHA 3OEHD 2V65A 1DWPA 1LNZA 2X7XA 4MLCA 2JJ2D 1R6DA 3CHYA 4ND5A 1LDBA 1L5VA 3K1TA 4EQZA 2XBLA 1N32B 2QUAA 4UFNA 4RQTA 7REQB 1H42A 2GK6A 4GPIB 4AKGA 2GEFA 1HGXA 3LDUA 2NXNA 1EFHA 1ZD8A 1BFDA 1JDUA 1B42A 4WSOA 5JAZA 1N2ZA 4WZ6A 4ZICA 3LUGA 1K6XA 2CCKA 5BNIA 1ZI8A 1J8VA 3KVVA 4JUDX 4F3CA 1KXZA 2C2HA 4IUCS 7GPBA 1DELA 3GW8A 5AW5A 2C5BA 3LUPA 3ZDQA 3WNCA 3N53A 3Q3JB 3WBKA 2W0MA 3HLKA 1QHSA 4JVSB 4MKZA 4OXYA 4R2JA 1YVPA 4FKBA 4JEMA 4EY7A 3SJAA 4M8SA 1PD1A 5KSYA 2B69A 2WA2A 1Y7HA 3A04A 1V1MA 3DEAA 3RBAA 3RK0A 1NQTA 5BN3B 1W4CA 2AMJA 1GA1A 5DX1A 3FAKA 4ASUA 4C2BA 1S3SA 1JKMA 2FX5A 2FDCA 2NV6A 3COWA 1R16A 4HO1X 3QU5A 4FEEA 3TIIA 2MWMA 3IT2A 3QKRB 2GNOA 3H1AA 2ANCA 2C94A 2L18A 4F6RB 1SUBA 1DCTA 4JYAB 4FXPA 1SURA 1SOVA 2WU4A 1DC8A 3EN0A 1ZSYA 1WUJS 2WHXA 1QIEA 4HAOA 3U4HA 3VR0A 4WK6A 3KKNA 2W42A 4NSNA 2E6KA 3WB0A 5K01A 4MMXB 2Q4TA 2IBTA 3AUTA 5IAGA 1MBZA 1V16B 3GJ3A 5AVRA 1ULTA 3H2GA 4IIUA 1P72A 4DE5A 1Z2OX 1XWOA 4XGIA 2FSVA 5FNVA 4QPPA 1SBNE 1BE1A 1E3JA 4UNQA 3TQCA 4AB1A 4LF7B 2PMKA 3AF4A 3BIXA 3HL0A 1RM3A 4B40A 1Q7EA 5HIJA 4RSGA 3ROEA 4N48A 3TL6A 1B6GA 4NI5A 4TMVA 5GJWC 1J5PA 1JTVA 1MIOB 1O58A 2RGYA 5L3ZA 3RU2A 3WGUA 1KI4A 5EZQA 4YCBA 5F98A 1A5BB 2QTVA 4L4RA 4A0QA 1BEUB 1PG5A 3F2VA 2YHIB 2W22A 2X14A 3I01M 4TKVB 4DM4A 4EPTA 4RVSA 2PQ2A 4E5NA 1FZTA 2E4VA 3L07A 5HWSA 3SIWA 1RRCA 3ILSA 3UWOA 1UBNA 3AW8A 3HTXA 3IIJA 2WFMA 4GR5A 3FUXA 3IL2A 4AJKA 3OEHA 4RV5A 4JODA 3MZ0A 4L08A 4FQ8A 3HMKA 3TAHA 3AJEA 3L8EA 2NWQA 5KAMA 4CODB 1DZIA 1GGVA 2V6MA 2GPSA 2P5SA 3B53X 4ENUA 1XCGB 4WASA 4BL5A 3FGZA 4Q16A 3B1FA 5FI1B 1T4GA 4E6EA 3DZIA 1IEWA 4DCTA 4IG9A 2A14A 4LY3A 1RWVA 4F9GA 3OCVA 3DKVA 4AMGA 3D0OA 3E7WA 2ZAYA 1ZIYA 2AFRA 3HB4X 4RLSA 2XT9A 3TRFA 3ND7A 3KJEA 1PSDA 4UEWA 3KOXA 3GLVA 4UJ3A 4BOYA 4L6AA 2NUTB 3M1AA 3MD0A 2INGX 3JQ8B 3VYUB 5I4KA 3ROKA 2C0QA 3V80A 1OA0A 2ST1A 1OXMA 2CBXA 1XRLA 2CYCA 4RSMA 1W36C 1FSFA 2DBVO 4YJKA 3EGOA 1QGYA 3ZIAA 3JQFC 5C37A 5L4SA 4LNUB 3OBBA 1LX6A 2UVPB 4QLAA 5GGYA 1L5SA 3DEFA 3PD7A 4FX5A 3GLFA 1GNTA 3U44A 4PXAA 2IS6A 1NX9A 5EJ4A 1T4BA 1BZYA 4YGYA 2NSYA 5E8RA 1NQWA 2Q6IA 3GAFA 3QE2A 1XCBA 1NVFA 4HQNA 3U6BA 3P2OA 1G4UR 3NTLA 4LA4A 3UANA 5HF8A 4I1SA 3TFOA 5JDIC 1FF9A 2VR1A 3TUZC 3O4HA 3IPAA 2HLPA 1K86A 1A8QA 1KDTA 1Y6RA 3WXMA 1E1RD 1C30A 1NVGA 2XEDA 5DE3A 4A5OA 4CM4B 1KR5A 3MCWA 3NH9A 3ZWMA 2X4GA 1K7SN 2G09A 3FGPA 2UZAA 1I3OA 2W6CX 1G7CA 2Q2OA 1GFWA 2YVQA 4WZZA 5H5JA 5ELXA 2JKVA 2QP4A 1ND5A 3AOEA 3CH4B 3DT8A 1H1LB 4UVDA 1XOIA 3RSQA 4PN3A 1KQGA 3A6PC 2CMHA 2C7PA 2ZS7A 2J0UB 1PQPA 5HBGA 4FFRA 1B8OA 2WQ7A 1S2LA 1TYDE 2C1EA 5EI5A 2WIDA 3SIRA 5GP1A 4X1IA 5HZKA 1YRYE 1CZOA 1L4GA 2FGKA 3AF2A 4XIIA 3RG2A 4IQ4A 4TLCA 5K6RA 3GCGA 1TO1E 2FZKA 1KEZA 1W30A 3RYHB 4NEHB 3RYTC 1KMHA 1L7XA 1A7JA 2WWVD 2B1IA 3C45A 5AK3A 3V1MA 3A3OA 3LNTA 5THKA 2OV3A 3HA7A 1Z22A 4KREA 3MBOA 1J39A 1E3DA 3TPZA 3FMFA 1MO2A 3JVUA 2Q6OA 3I2YX 4ZTZB 3VH3A 3KJIA 1AGRA 4IYJA 3TXAA 1MO4A 2QLJA 1ZNYA 2HXYA 1RCUA 4AF7A 4CL2A 2VDNB 3KKKA 3U16A 2OUKA 2VDUE 3OLQA 1KETA 3L82B 3NS7A 1R0RE 4QXOA 1NW9B 4O4LA 1AKEA 3PUVA 221PA 4IDCA 4IVRA 2QPOA 2PDAA 2YRWA 4G4SP 2VJOA 3EDMA 2X8WA 3NHYA 4GG1A 4TTPA 1L8OA 2QTCA 4W5WA 2XMRA 2DBRA 1T9CA 1V5EA 3E3LA 1CJMA 1W2GA 2JANA 1DXQA 3KWJA 3BCHA 1R0KA 4AMVA 4RWEA 2Q5OA 3F1LA 1T1RA 3R6GA 3SJCA 3UFXA 4AO6A 1YZYA 3BFXA 5B2ZA 2X1LA 3ZWDA 5B3JC 4BDTA 1BH2A 1ORWA 2JAPA 1OI2A 5DT2A 2O8EB 1LLUA 4DBLC 1A95A 2Z3VA 3OIFA 4X90A 2F8MA 1SELA 1WJGA 2IHVA 2W4QA 4FJ0A 5FB3A 4YNBA 5A5VA 1K88A 3TZ6A 3OCEA 2H9YA 2JAHA 2IDZA 4ZI7B 4EJMA 1SPXA 1U3TA 4MCIA 2GYWA 4KHZA 1PJRA 2GSWA 2VBGA 1IXSB 2O7VA 3VHRA 4J1TC 5ILOA 4DA9A 3AIKA 1G20B 4QOEA 1NI4A 2PFMA 2WZBA 3TCKA 4J0JA 3UC9A 1XA4A 2B8WA 1IXZA 1N3BA 1FJXA 2MOKA 3TD2A 4QFBA 4KITB 2G36A 4JUCA 3IDOA 4PGFA 4CUJA 2WSYB 4B3XA 3G82C 1IZ9A 3HUFA 3T9DA 1E0AA 3TLZA 2QPLA 3ANYB 1Z47A 2HA6A 3Q72A 2WI8A 3DHYA 2KHZA 5TSDA 2B20A 2FFHA 4MW1A 4WPGA 5T4FA 5KWEA 3EFEA 3HRHA 5FPQA 3V2UA 1I1QB 2I4OA 4A0GA 2GVDC 1YS4A 2WB4A 3IP7A 1GP2A 5KYUA 1E1KA 4DV4B 4GRIA 3S5JA 1WWKA 1Y7IA 1ZUHA 4G85A 4JU9A 4KQJA 1RLMA 3V34A 5M29A 3N75A 2AR0A 3HCOA 4QUGA 1YIAA 4LZZA 2XUOA 1IFXA 4XX0B 3X1WA 4JYPA 3EOAI 2DWOA 3X43A 4BLQA 5K8TA 6CHYA 5HKKD 3I05A 4BX2A 1QYRA 1RFLA 4BU1A 2WWGA 4C3VA 5E2AA 2P3SA 1UMDA 1LSJA 1UPCA 5DT9A 1VYVA 2QRKA 4FN5A 4BV3A 1ZP6A 2DP4E 3RUAA 2OC9A 4UAVA 1AF7A 4UFPA 4CMIB 3EVFA 1WD7A 1B41A 3UK2A 2E9FA 4DQUA 3TYXA 1I3MA 3UPTA 2CJYA 3B2EA 3EGDA 4QU5A 5IEJA 3QTTA 4PLFA 5CM2Z 5CK5A 4JK3A 3DV9A 1C9DB 1XVUA 3A31A 3JVDA 3Q3IA 2WMOB 3EF1A 3C7CB 3U9TA 4BVHA 4N76A 5KUTA 2Y1KA 4FZRA 3ZHXA 2HMVA 4AUKA 2AG6A 1EVKA 2BI7A 3E9YA 1IHDA 2Y0PA 3H83A 3PJFA 4APBA 1XJ5A 1D4FA 4BGVA 1O2DA 4MI6A 4JJZA 1MC5A 2Z3ZA 5DYGA 2G9NA 3SXUA 3KOUA 5F91A 1H6AA 1L4UA 1K5GA 1H4TA 3NTQA 1TJUA 1L5YA 1NXPA 2V7XA 1PT8A 1RIFA 1VJCA 3KT0A 4PAGA 2FX2A 3CUUA 2OGSA 1YGPA 3V8QA 3WX0A 2CMGA 3OUZA 1DQRA 3DBVO 3HGQA 2QIPA 2OOSA 5M3BA 3RODA 5IASA 2FY8A 2ROQA 3GLHA 4IG4A 4Z9AA 1LLFA 3UJPA 4QM7A 2YHBA 4Z7QB 3O74A 5KNLA 3SR0A 1R66A 2XZPA 3T6KA 5KREA 1OHHD 1L6RA 3AL2A 3IRUA 3O90A 5DULA 1WF6A 3DZFA 1W75A 3MRSA 1IJBA 2RKWA 4HJRA 4EJFA 2QSUA 2OGTA 2I9PA 1BA3A 3ABSB 4OGLA 3WISA 1GJRA 3AHEA 1G20A 3OQHA 4A27A 4M1OA 2PCLA 4OG2A 4EZBA 3HI6A 3T12A 4B6RA 2OQIA 1RYYA 2ZZKA 1JUDA 2DPMA 1I2MA 4MX8A 4RPJA 4W63A 5DLQC 2WWXA 4QUHA 2O2SA 5IAAA 1UOOA 3G9UA 2HU2A 1JDJA 1T8TA 2DE0X 1Q0PA 2V98A 2XUJA 4GDMA 4NQZA 3HN6A 4RA9A 2G4CA 4O4IB 4R83A 5DI3A 2X5JO 3CLUC 4S05A 4LHSA 1IUPA 4JLDA 1C7IA 4L9RA 1TOAA 3MBKA 1HLFA 3U4MA 2I5PO 4P5DA 1ODTC 3E53A 1HT1E 2IYQA 4MRPA 3REOA 5L51A 2ZETA 4DCMA 1TCAA 3DV0A 3I9LA 1GRCA 2ONZA 5B12A 4G4IA 3O7WA 4QATA 3ZDDA 3WKDA 4IQGA 3GUUA 2C83A 1V4VA 3AFIA 3M33A 1MVOA 4J29A 1RMTA 4YJ3F 4S2EA 2JZOA 5SYAA 3VR4A 2D2FA 4CTMA 2ZI7A 3FGOA 3P9PA 5KNCD 4AZWA 3L7LA 3W8RA 1AKVA 5DGHA 1NOJA 1PNTA 1A4IA 1RDFA 3EXIB 4BMVA 3BDAA 3WV5A 1J0CA 1PEYA 2AW3A 1HDXA 3NJRA 3R0QA 5KJFA 1Y8CA 1P1BA 2MT9A 2RMKA 1JQBA 1ZO8A 3WGNA 2V7EA 4HDSB 3TOZA 7MDHA 4P7KA 3IEUA 1R9MA 3OLYA 3NYWA 4OXIA 3EGXB 3L8ZA 4KE7A 1E8NA 3TOCA 4D8WA 3AOGA 3K6RA 3QJGA 5A05A 4AMBA 3VPFA 5E7JA 1TQDA 3KKEA 3ITDA 2FEKA 3FROA 2WD8A 2P1DA 4DSAA 3DVAB 3ZDCA 4KW7A 1B3BA 4MW9A 3SVZA 2G7ZA 5MFZA 3Q1LA 5CXXA 3N7UA 2B25A 2QRMA 4JOBA 1M7HA 1ZIOA 3I1YA 4Q3NA 3UCXA 5DYTA 1ZD5A 1CY8A 3ANSA 4L5IA 1R4NA 2I6XA 1Y8QA 3UT0A 4DLSA 3G2OA 5JNWA 1E9BA 2QTRA 3W7BA 3DLBA 1ECBA 5JANA 3D6TB 5CCXA 2P6RA 1N6HA 5CFQA 3HC7A 1HO3A 4FXOA 5DN9A 3I8SA 3E15A 4J1TA 2G4VA 5JCJA 4ETIA 2SECE 2ATIA 4UATA 8ATCA 4KNYA 2NYRA 2R1TB 4I4LA 4IOKA 3T5BA 2B2NA 1BX3A 3BKXA 3OBIA 4LJYA 3ZZTA 4KU4A 3T3HA 3OU6A 2YWDA 4JJ8A 5EWLB 5FJIA 2UYHA 1XPJA 3BS4A 3K1YA 2EFDB 4KXQA 2DKFA 2Q8NA 2QE7A 1KDPA 2C2WA 1QCCA 3NEJA 5IVIA 1OROA 5IDQA 1R10A 2CLLB 1SN7A 5HUHA 2XKKA 4B6GA 3SC3A 1AUXA 1WZNA 3TRDA 3C7TA 4AN1A 3GAMA 1NWCA 2XNHA 1NI3A 3RT1A 4DR7B 5A6SB 3DMYA 2PTRA 1XF9A 1OW3B 3E5HA 2Q3LA 4FINA 1XDBA 5K9ZA 1OKKD 3B12A 4ML3A 3OMLA 1YB6A 3DLCA 2HGZA 3DZ8A 2VWGA 3C98A 1POWA 2P4HX 5A7FA 5I7AA 1PKXA 1HFEL 1QKKA 5TPZD 1CDOA 4JQZA 2QMUA 3M9LA 1XMSA 3HB7A 4FSDA 3S2ZA 1VPTA 3VH2A 2RAPA 5FQNA 3TM5A 3NCTA 3I9KA 3P9NA 4HZGA 1CEEA 3P5BA 1M8GA 4IMIB 1HMYA 4YT2A 3ADPA 3NHZA 2YVKA 4M1WA 5DHFA 1IZZA 3A9CA 2HK6A 5FA6A 3PXBA 1E6WA 3I23A 4ND8A 1NHWA 2Y9MB 5IARA 1VBKA 1IPEA 3CV3A 4PTLA 5ALGA 4QVGA 5F5XA 4D0LB 4NBSA 1Q2XA 1G2QA 1X7YA 3ZVRA 5MN4A 1UCFA 2Q5HA 3R2JA 4DAOA 8LDHA 1Z7BA 2VJAA 4JFRA 1W0CA 4TLLB 3H1GA 4GICA 5EVJA 4M86A 4EHHA 4TXMA 3WJ2A 2WSSD 2XQVA 4ZEVA 1J42A 2G88A 2OCLA 1WZUA 4LJ9A 3C16C 3F78A 3K5WA 5AYVA 3NC0C 1QBGA 2FAXA 2WY2D 3DUFB 5I9BA 1JFTA 3A1TA 3LWNA 2YVUA 3IOBA 1FYVA 1JYEA 1CY4A 4RORA 5MFPA 1ZM4A 1EBUA 2MDTA 4DA4A 5I7SA 1ENOA 2O59A 2I7CA 1K8ZB 1PHPA 5COBA 1YJXA 1HDIA 4W6QA 1I3NA 3AYXB 4KMMA 2HKIA 1SC6A 1CRQA 1L5FA 4V02A 2Q3EA 3X2SA 3OX2A 1IN1A 3F97A 5FPTA 3GFQA 2ECOA 3JQGA 3KPUA 1J8MF 4HNQA 3A7DA 4DCGA 5BVHA 1QH0A 4LJ7A 5IDWA 2GKSA 1Q50A 2ZAOA 3QA9A 5AFSA 1ACLA 5IXYA 4OJYA 4EHNA 3D7NA 3T7KA 1H9BA 1H2AS 1LTQA 4TQUS 1GG8A 4XFDA 4E2FA 2QPAA 4R84A 1F0PA 3ZE2B 3SQLA 4PHFA 2QG6A 4CIBA 3HJFA 3HCRA 1TF5A 3A1UA 3IPCA 2B7BA 5L7YA 2DF8A 2HU5A 3EPPA 3JQPA 4B4DA 4MQUA 4LXYA 4M0MA 3S28A 5EJ9A 2D5LA 1D03A 1G8KA 3CZ4A 3T06B 1LLCA 3M6AA 5I4CA 1ZONA 4EA8A 1X0VA 2O57A 2X58A 3H1TA 3LRPA 5DHPA 1KHHA 3G23A 4ZAFA 5G0TA 3ZTTA 4D8TA 3OIVA 3ZCQA 2VT2A 4LJ4A 4Q4JB 2PQMA 4WN3A 3VZBA 1AJEA 4GXQA 3CN9A 1U3DA 4N0MA 4I3FA 1R9NA 1A5AB 1D3AA 5EMLA 3WDKA 3RROA 1J0AA 4CMAA 1TEHA 2ECKA 2OBBA 4JT4A 2ZWMA 4DDTA 4OGGA 1P3JA 3RSSA 1QP4A 3W1EA 2DX7A 3BB4A 3C8DA 1YT5A 3SKXA 2OHGA 5CIQA 2F55A 3A9WA 1DC6A 3B85A 3PE3A 2Q4BA 3AU8A 4YWJA 4C0QC 1G8AA 3Q9NA 1DXHA 3O4RA 1CDEA 3HYNA 4Q47A 3VMMA 4OREX 1ZUIA 2HYIC 5EIEA 5IBQA 4UPDA 2M6SA 2HHAA 4JYMA 5JSHA 5L7TA 1RHMA 1NAIA 3MFQA 1ZL2A 1RLOA 1QLHA 1K98A 1U15A 2F1KA 1R4ZA 2VF5X 3UYLA 1YZKA 3EIUA 4EHIA 1Y63A 4U6QA 1INLA 5J23A 4DKJA 2FQXA 1G9SA 1U7OA 2MINA 1P0FA 2ZUBA 3BTOA 3OZDA 3QHPA 4LF6B 2WMYA 4O4JA 4YAOA 5IX8A 2QTLA 4LECA 1QJ4A 1YZHA 3EVNA 1Y1LA 1L5RA 3L7NA 2P2NA 3VYVA 4YJ3A 3ZS8A 2PXHA 4I4TA 4R7GA 5H02A 2GGSA 3PUIA 2ETXA 1QGUB 2FN7A 2WTAA 2GEJA 1BE0A 1XRMA 2XB8A 5EGSA 4DSTA 5CA1F 3IP8A 1WD5A 3QEMB 1V1RB 2CHEA 5MN5A 4M0UA 2V59A 1MOQA 4HZUA 4RL4A 5LB2A 1Z8DA 5CHYA 2ZIVB 4AJHA 4JVNA 2GA9A 3QMWA 1FFXB 4WZAA 4OXNA 3CF2A 4MV3A 2CUKA 5F73A 4BQEA 3RV3A 2FW9A 3NDIA 1PS9A 1PJAA 1U04A 3TTSA 2O2GA 2JGLA 4PO9A 3OUUA 3GWGA 4J6EA 5GV7A 3SOZA 2GHRA 3GJ6A 4G63A 2V9ZA 2UV8A 2EBWA 2V7TA 1L7VC 1Y89A 1EK5A 4KZKA 4LXUA 1RU3A 2QTNA 1IBRA 2O5VA 5KTNA 3QEBZ 2R11A 1QGAA 2QN6A 3I1IA 3DMGA 4R1UA 3W3AD 4EVSA 1T8SA 4O2AF 4EYSA 5C52B 1R12A 4ZVOA 2WWHA 3JQ8A 4GX0A 5B7PA 2FPIA 1UOPA 2A0UA 3IDZA 2JJYA 4TM8A 3TTUA 2NZWA 3NVAA 4LCJA 1TFUA 5K05A 3CINA 2ODTX 4GPZA 4LWQA 2QVZX 2G1JA 1SVNA 2JFWA 1N5MA 2I3GA 4ZHQB 2V45A 1ZD9A 4UE6A 5BPFA 4A10A 2I2AA 4BFCA 3ZVMA 1V5IA 2OCXA 3DEHA 3ANTA 4BMYA 4ZO9A 4F46A 3ZU3A 1KZ9A 2OC4A 1XTKA 1IQPA 1P7YA 2PGLA 2TMDA 1BW9B 1O87A 3MLAA 2JAWA 1U0RA 4MJ7A 4WFJA 4XPZA 4DXDA 1NVDA 2PEZA 421PA 2I6TA 2VRCD 3I1FA 3LXXA 2O05A 4XYLA 2D6FA 1T9KA 3DMNA 2VDWB 1IHUA 3HCAA 3BMNB 1YULA 1PZNA 2QSYA 1NYLA 4ES6A 1AK1A 1EFVA 1FNDA 3SMVA 4QBFA 1U8UA 4M89A 1Q20A 5D2CA 3VU9A 2VDRB 1DTWB 1DP4A 4L9AA 1NUHA 5JQGF 3QITA 1T3HA 3KB6A 3IMGA 3TPFA 4DZTA 1US8A 2RGBA 3C3DA 3ER6A 4X8LA 3E05A 4OLAA 1IOWA 3R6WA 1V2HE 2NXCA 3N70A 4ER3A 1X70A 3I6IA 1OH6A 2ILVA 4R2HA 4LNAA 2HQSA 3F9RA 5DWVA 5ALIA 3TTTA 2VPZA 1V9CA 1CEXA 3JPYA 3OE4A 3D5TA 3DL7A 4K1LA 1Q3KA 2GETA 2V9PA 2TRSB 4G0VA 4RE6A 4RCZA 1QCYA 2NUAB 4YMGA 5KTOA 1X14A 3BMNA 4XJXA 2G6TA 1Y9ZA 2IOFA 2Z4TA 5EC8A 3VAYA 3ONNA 2H4ZA 3O1LA 2FUG1 1PP4A 1GAXA 3QYAA 4J0IA 5EJAA 3KQLA 4D0SA 5JD6A 3EWIA 3GLHE 1BC5A 3OESA 5LA6F 3U4QA 2O7QA 1UAAA 1II8A 1DAMA 3NTVA 1CP3A 3QKRA 1V5WA 4WLVA 5E9QA 2X5KO 4HATA 1AUOA 4LDNA 1ZIXA 2R7AA 4UULA 3TNDA 4EO9A 3AHGA 4F6LA 1RJEA 5AVKA 1JTFA 3LCMA 5BWOA 2O8CB 2VZLA 3T9EA 1TYZA 2XMCA 3IBGA 1MEJA 1N6RA 1Y3AA 3RRPA 3MJDA 3OE7D 4N4AA 4YJ2A 2DHEA 1QGOA 4DADA 3B5IA 3IOCA 4MGIR 1CZKA 4WH0A 1P7PA 2IFTA 4YRIA 1YQXA 3JZDA 4FYVA 4GE0A 1CY7A 3MTJA 1NP7A 2OE2A 3IAM1 3Q12A 2VS1A 4BLOA 1Q1AA 2AN1A 4YYEA 3O3MB 4BFLA 1TK9A 1BE8A 3EASA 5LXTA 4IV5A 4Q4CA 5BUZA 5I5EA 3WAGA 1FFAA 3LBFA 4GS5A 3RWOA 2P6MA 2XUFA 3GZJA 1KE1A 2MU1A 4MW6A 2VDVE 4C1NA 2DSTA 1AGXA 3KU1A 4PGHA 2JB9A 2A9OA 2LR0A 1VI5A 1MC8A 5J40A 1TT7A 1HC7A 3JQQA 2MSWA 2ZI9A 5FUXA 4Z0TA 3ZGYA 5D3MA 5TLSA 5F3WB 3L5OA 4INJA 4Z9XA 3EVBA 3C0KA 3DPUA 5ICEA 1LPAB 1NLMA 4ZXFA 2VUHB 1RTKA 1SQ6A 1N0VC 3Q6MA 2HA7A 4XQGA 4JH0A 3VAZA 4BZZA 4QDKA 4WA8A 2IV7A 2AKYA 3L0ZA 3NW9A 3R75A 2IYPA 3WLKX 4PLPA 1L7AA 3L8DA 1S3IA 3ZI0A 4EKDA 1YUNA 3MJEA 4PVCA 1R0WA 3ECAA 4WNCA 5TR9A 3WGHA 3ZHSA 3JQ9A 2O2CA 1Z0KA 3OFJA 4XQCA 4ARZB 1KJ8A 2WAMA 4OBXA 1RKQA 4ICIA 3WVNA 1ZRSA 5F3RA 4IX1A 3JAWB 4QU9A 1FPMA 2Z2YA 4HN9A 4EZIA 4GUDA 3BHGA 1E8DA 2IH5A 3M81A 4BNLA 3C74A 4C4PA 3W0LB 4DQLA 4DYDA 1MD9A 5BQ3A 1BXKA 3WK6A 4D44A 2J3JA 4JJAA 5HKBA 3GZHA 4R9RA 1T8YA 4NFYA 3FWYA 3EWSA 4LTMA 2N47A 4QOJA 1T29A 4V24A 5GAJA 3UJHA 4AWXA 4CFYA 1X7ZB 5FLKA 5F5NA 4KXVA 5IJ0A 4WY8A 2IEYA 1WAMA 3G1TA 5A06A 4GQIA 4AROA 3WLNA 4O2BB 4TZ6A 2AQHA 2CWDA 3UGQA 4G8CA 2VTBB 1F7UA 3W5IA 3IEMA 4CWAA 1OU4A 4N5MA 1ABFA 1GKIA 4PSUA 1NRWA 2REXB 4V0SA 5AJHA 1PYDA 3SXPA 4EUFA 4H2DA 3Q0EA 1MABA 2I2DA 1TJVA 1M1YA 3UGKA 3F4RA 3JARB 1NXSA 5G41A 2WMDA 3PC7A 4JJKA 1ELOA 3ASVA 3BD9A 1EXVA 3FTPA 1E58A 2ODEA 1JB9A 1PT7A 1Q77A 5FT9A 1BXRA 1QNLA 2D0OB 2GCGA 2HSGA 2RAFA 1CULC 1OJLA 3B78A 3QHAA 4LDZA 5TS3A 2R9VA 1M6EX 5CK4A 3W79A 3U7IA 4KKVA 3QFFA 1MAAA 2X3UA 3D3EA 2AMYA 4J2TA 5FJJA 3ILXA 2QUIA 4FHFA 1SXHA 4DIFA 1MV5A 4FT4A 4R8LA 1LWNA 5LZ9A 4ERXA 4X91A 4Z2AA 1X2BA 1DC3A 1H5QA 2AXQA 2BCJQ 2GT1A 2VRCA 2PX6A 3BHNA 4JOQA 4V0KA 4DSUA 1TM5E 5CX1A 1JH9A 1FA9A 2J41A 4YLGA 2CNLA 1YHYA 2F43A 3SHVA 1YNSA 1OV6A 1NVKA 1XHFA 3K16A 1ZH2A 2RGXA 3MGKA 2JFGA 1NJFA 4JROA 2YVLA 3ZGXA 4AJ1A 4E32A 3DUFA 3DWFA 2JA1A 3C3MA 3SNHA 4YP6A 1X7XA 3AILA 4HT3B 1GQOA 1PF7E 2O52A 2SKDA 1KMNA 2QM3A 3BEDA 3CH7A 3R77A 5DHTA 5A3SA 3U39A 3W5VA 1AQNA 1CVRA 1W36D 1DAFA 4LCBA 3KWMA 4L95C 1NONA 1IBCA 2E4ZA 3BZUA 3NP7A 1KORA 4CM1A 3CCFA 2WVHA 1QO0A 1NSYA 2OXEA 3B8EA 5IFLA 3JD2A 1NLFA 1TX4B 4EECA 3BGOS 1RJWA 2B6NA 4I7EA 2FH5B 2UXDB 1Y6JA 4TLDA 4NCNA 5K0ZA 2AOXA 4PLYA 3A2MA 3LLCA 3HZHA 2O8FB 5AKEA 4H16A 3QTLA 1WVGA 4MK4A 4TKUA 4KQCA 5A9SB 4PZ9A 3H84A 4HY3A 3ZCVA 4YMUA 4CNBA 4AF8A 4HPJB 3LOUA 2C5LA 3C1TA 1YR1A 1NM5A 3GYBA 4JXJA 4KWCA 3W1WA 3FVTA 2R47A 3N2ZB 4HG2A 1CRWG 1TKRA 3TEMA 2V74B 2BP7B 4B9AA 2A9VA 1ENPA 1YR3A 4H18A 3P4XA 4W5NA 1P44A 4C0WA 2CBGA 5IT9A 3TJMA 1TK3A 3O8OB 4IGKA 3BJEA 5JQGA 3K0SA 1QHEA 1GR0A 1OCEA 3AKCA 1VRCA 1WQ1R 3FRJA 3F6BX 3F46A 3LBNA 1V39A 3OLVA 2VDPB 4X92A 4Y2XA 4ARVA 1WR8A 4HVAA 3CO5A 1TJ5A 1HT2E 1PS0A 3OFSA 2NUPA 3NWJA 4O33A 2FE1A 4RK4A 5E7IA 5BSMA 3V00A 2H92A 1UF9A 4FSHA 3QLJA 1IM2A 1QK5A 1YJCA 2PQ6A 4BVAA 2VP9A 2G8LA 3PDIA 5AI9A 1W48A 5D7NA 3UMFA 3BL8A 1W52X 1N5OX 2GTIA 4QDOA 4RHUA 1G5QA 3R3VA 4F11A 2VPWA 3KYJB 3NP9A 3FSRA 5DGIA 4KVAA 5IAKA 2D74A 4R0VA 1KJZA 2R66A 4F72A 3GJXC 2O2JA 4W7HA 3UAZA 4DLPA 1YFJA 1D0IA 1M10A 3JRXA 4C88A 4BUJA 4MICA 3T0GA 3GFRA 1ADGA 2R6AA 1JP7A 1IN5A 4NNOA 3N2GA 2WVGA 4UAUA 1SVUA 2GVZC 4N5HX 1IY8A 1Q6ZA 4XZ3A 1L5LA 2O6LA 2QY6A 4XM1A 1KMQA 5TMDA 2PLNA 4BX0A 2GPNA 4WBNF 4B3HA 1D1PA 3WP0A 2ODWA 1HDGO 3RRXA 1YZFA 4OMDA 2IXDA 3G2LA 4RVCA 2OPHA 2GPBA 2XZOA 4AXBA 3MTDA 4KLZA 5DNVA 3L0DA 5I9LA 4LMPA 1T1EA 3UPDA 1SU8A 3DE2X 3R23A 3SQMA 1U2SA 3IOEA 1GUZA 1NDUA 4RAQA 5DNWA 3UO8B 1Z68A 3DSRA 3WRYC 5D5HA 3IBFA 4RKYA 1ABBA 2FFJA 2ZE6A 1JB1A 1ZIDA 2QZZA 3VGPA 1JDPA 3CLHA 1UBFA 3LUCA 4I5EA 3CRW1 2FNAA 4LZJA 3MWKA 1AH2A 4RF3A 4CRWB 2W2QA 2IZ7A 3ZW7A 1MAHA 5KCMA 1XU9A 2H08A 2YWXA 4WEOA 2PH3A 2E49A 1U7DA 2R5NA 1FQKA 3JAKB 4KGDA 1Z13A 5TXGA 1C8VB 2WP0A 3EVTA 3L6BA 5BOSB 4V03A 3JD4A 5TVGA 1YRHA 2I54A 4P38A 1R8SA 4WOBA 4RTNA 3IMCA 4F4IA 4FDTA 3WL4A 1YVDA 1SA0B 1ZVMA 1F0KA 2DWPA 2W93A 1GL7A 4B79A 1E3WA 2HCJB 4Q1VA 2X0IA 2GAOA 3T3GA 4RENA 3D6JA 3VR4H 4J75A 3OMWA 4ENSA 4FOTA 4J0EA 2H18A 5K20A 3H11A 3M6LA 3OHPA 4J16A 4HLDA 1H2HA 2Q3BA 3ZTWA 1OGYA 2F1HA 5BSRA 4LBVA 3LZ6A 1FJ2A 1VG0B 1XEWX 1NOKA 2GJAA 3B3AA 3ZE0B 1I7LA 4WKBA 3U09A 4YJ2F 4YAIA 3E04A 2DQKA 1EU1A 4QBGB 1YKGA 5DDIP 3V4VB 3WBJA 3HS3A 4GOMD 3MCUA 3Q4GA 5KTSA 2IYWA 4AJPA 4BUZA 2R0QC 2IH2A 2XQFA 1Z15A 4GGMX 1C7EA 5BXQC 3CWZA 4D3DA 4D3FA 1X80B 5JZVA 2BZ1A 4MROA 4AZVA 1EBFA 4YQZA 3QUSA 4GIBA 1EB9A 3SM9A 3ZX5A 1N6LA 2HCTA 2AN4A 3ETLA 1EG7A 4KPUB 4LJRA 4XQ0A 3SDZA 3P9YA 5TVKA 2ZSHA 1T1GA 2DR2A 1O5OA 2FMFA 3C7AA 3PNVA 1GIAA 3KETA 2XTAA 1UBKS 2ILTA 3GJ7A 4Q1DA 5E6RA 1RWBA 3KJHA 3NHAA 5EXDA 5ESDA 3RCBA 5I7EA 1RXWA 2I8CA 2G1PA 3D6MA 2KQUA 1VSBA 3L2OB 2IYNA 2WMNB 3CNBA 3F5QA 4NAVA 4CQLB 2PUDA 1UJ2A 1FFHA 2D0IA 2ZSUA 4C21A 4CKXA 4MWEA 2B7CA 5AKXA 2EW1A 3T7RA 3KEGA 3F5SA 3ECCA 3VZRA 3L46A 4CCYB 3DDHA 1JHPA 2P9YA 5BUCA 1EDOA 2Q6VA 1XLWA 1MG5A 3U48A 5KKNB 3KS9A 3L1UA 1YRLA 2CHGA 3GJSA 3BF7A 4KTTE 3UKDA 4JZYA 2D27A 1CIPA 1UP7A 4OYLA 1G2IA 4URZR 3VX3A 3ZLBA 5J1TB 1WB4A 2AFIA 3K7EA 1SVOA 2JCBA 2EFEB 4GNRA 3QV2A 2QA5A 2PFGA 5LD2B 1FYXA 1TF2A 1Z83A 4KO1S 3V42A 3AI2A 2F3QA 3WQSB 4RETA 4BMZA 2GBFA 3D8SA 4KL8S 4ER0A 2DXIA 4F9TA 3M6IA 3MWEB 4RK0A 4YEDA 2PH7A 2OO5C 4W8OA 1C7FA 5H83A 3W5JA 2IYLD 2VHZA 3A6GA 4J7CA 4JP8A 2QD3A 4G3XA 3KYCA 2QX9A 2PX3A 4OQEA 4ZYYA 1M6NA 3QE9Y 3AUUA 1W93A 1IPHA 1U6JA 4DZZA 2OFPA 3QJYA 3BQ9A 5EEHA 4PFKA 4GDFA 4O1IA 2P2LA 4EY4A 1Y3CE 1TQHA 1ZD2P 3AEUA 1XXHB 2Y05A 5AXDA 1FRQA 2ID7A 1VHQA 3FVVA 4H7PA 3H65A 5DTMA 3FRIA 4GPTA 1TYBE 2HFJA 2PR7A 1N5IA 1HTWA 1JBKA 1ESCA 1GZ5A 2XDWA 3L9XA 4TYNA 3L40A 5A9RA 4FT2A 4HDMA 4UTRA 1KEEA 3QIVA 3HKCB 1LLDA 1T8WA 2IDMA 1PJSA 3QIAA 4M0FA 4UDNA 4BE7B 2B61A 5KTPA 4G84A 3T3IA 4ZAGA 3PEVA 3D3NA 3DFIA 3EZ9A 3R9IA 2HI0A 4IIYA 4EPRA 2JHFA 1VRVA 3K3PA 4R16A 2NQ2C 2QP9X 3OJWA 4BVJA 1FMTA 1X3SA 2NTVA 2CNOA 1EHYA 4PO1A 5CVCA 3VPSA 3HK2A 4NL4H 2I4LA 2FLKA 2RH5A 1C2TA 2GEBA 3DBLA 3HCNA 5TT1A 4Y3UA 2NNLD 4JI0B 3AHFA 1J21A 4XIGS 4I4TF 4Y1RB 4RTKA 3JATA 5AD1A 4QGHA 5A4AA 1QO0D 2PGIA 1HEYA 3I0MA 5ARDA 4EB0A 5L40A 3D4OA 4CETA 3USCS 3VH4A 2ZUFA 3VO1A 1XO1A 3HDQA 3KTOA 3HKEA 3GX1A 3KZCA 1ETHA 1JQLB 3L6CA 3LVQE 3EXHC 4QX6A 3OC0A 5CX1B 1TM2A 5JJCA 3M9XA 1BCRB 4B82A 5ICGA 2CLKB 4OQZA 4E46A 2GCOB 4NYMR 1Y81A 1GITA 5KINB 5FD8A 2H2FA 1H0RA 2VQDA 3B9PA 2YFQA 4IOLA 1OLOA 4JZKA 5TQ2A 1MPTA 5H81A 1CWUA 2A0XA 5DHRA 2Y1OA 5DLYA 4E5YA 1YZGA 1ZICA 3KDSE 1LPPA 2C8KA 3E1KA 4A91A 3FTCA 4UUOA 3ISJA 4W5OA 5HJ7A 4OYHA 2EDCA 3ZWYA 3RRFA 4MYUA 5BV2P 3EXAA 2H0RA 4Q1CA 1RPJA 2AXEA 3UFXB 2M6RA 1C3EA 4DG5A 3N8GA 4E13A 2FZLA 2C5HA 3REQB 4MVYA 1T3GA 2W90A 3SAJA 1GEEA 4YMLA 1ZR4A 2RKBA 2Z4SA 5JECA 4CE6A 3O4VA 1V7CA 1AXRA 3DT9A 4QEDA 4MA0A 2AVDA 2ZI6A 3ZHBA 3G13A 4XH9B 4H15A 1A8SA 1WLYA 4UTOA 1NA5A 2QRPA 4Z4HA 1FP7A 1ZM7A 4YASA 1Y4SA 4UMVA 4ZQFA 1AV6A 2CVFA 2HQOA 4U0JA 4CR6A 4ZT7A 1VP3A 5CXUA 3QVJA 2O2YA 4I99A 1Y7PA 2VYND 3KQPA 3VVBA 1SVLA 2OWEA 4N12A 4BE9A 3K0KA 4FCTA 3KLBA 1Z2PX 1ZG3A 1N1EA 4MUXA 3QK7A 1U6IA 5LQNA 3U40A 4IGAA 4F2WA 1EUYA 4R01A 1JHYA 3GZ4A 2WIJA 5IT5A 2BFEA 1FQOA 1DV2A 3FNQA 5SV2A 3VHLB 5JNRA 4TTJA 5B64A 2ADMA 2QDKA 4DCVA 2ZBFA 4B3RB 7MHTA 2X0JA 1ZCFA 1N1GA 1JBEA 2EBFX 2HK7A 3W2EA 4QJIA 4CIVA 1H2YA 2D06A 1FTSA 2W6MA 4YVFA 4YJDA 3WO0A 6GPBA 4E5PA 1U2ZA 1EINA 1AV7A 4URWR 2WYWA 4HLNA 4PZPA 4R2KA 4URYR 4B75A 5JRJA 4D26A 5K8VA 3CZAA 1G3IA 3I2HA 3M83A 3D4LA 4B4WA 4H6WA 3M6MD 5CT4A 4RVGA 4L3VA 3A25A 1YFMA 2ZUWA 4U39A 3T5DA 2EJTA 2R6HA 3NOQA 5CA0B 3NWEA 1UDRA 4AWBA 2HQ1A 5DBGA 2HO5A 3KKLA 1X87A 1LSSA 2NVWA 5L7WA 4QT4A 2X1MA 3G8DA 1TGYA 5L4LA 4K6GA 4O63O 1WF3A 4BFXA 1ZCAA 3AJAA 4JQYA 5E9JA 4F38A 4D45A 5J4YA 4MINA 2B8JA 1OY1A 2C95A 4M9RA 4M37A 4B9EA 4YRRA 3KQVA 2CXPA 4HH3C 2GK7A 3HYLA 4BYGA 3NDJA 3IDFA 3U1VA 1JWBB 4DUPA 1XEXA 3MNFA 4F04A 1XPRA 5BVGA 2GZAA 3M8KA 1ZAKA 4UBOA 3TQIA 4AG3A 1FJGB 1HYQA 1U2GA 1X1DA 3K05A 1YBVA 4QREA 4O3FA 5EZ6B 2D28C 4IVNA 1AGNA 3OCWA 4TXLA 3VDMA 2OZVA 3H0EA 4D9FA 5BP7A 2ZRAA 1RM5A 3I92A 1T2AA 5TJ9A 1ZZEA 3E58A 3S2GA 1JIIA 4NJMB 1TUBA 2HT1A 2PUVA 2AEFA 2FFQA 1S4MA 1YDEA 4XGRA 2QNBA 4QOSA 2ATEA 1JZTA 2XMPA 3COVA 3B20A 5IJWA 4EMBA 3IYLW 4YRLA 3DPIA 1CPYA 3I37X 4EY8A 2IEIA 1XEWY 1EVYA 1I5OA 1YQTA 3A3PA 3DCNA 3FCCA 4HEJA 1SD5A 4TVOA 2VJQA 5EJ5A 4EY3A 3OE7A 1IZ8A 4GMHA 5DOVA 1WB9A 4L7QA 3BBPA 3B9RA 2J48A 3C39A 3DDOA 1A9XB 2IPXA 2QTVB 2HA3A 1HH4A 2Q1TA 2X23A 4YRFA 3STHA 5LUAA 5ENZA 1NDHA 3WV4A 1AT1A 3F90A 4KUGA 1Z4JA 4FNAA 4KE6A 4MOWA 1CUCA 1SY7A 4IIXA 1U2PA 4E33A 2FKNA 3REFA 5KNDA 4DIUA 2JCVA 3I9V1 1JG6A 1SZJG 1VYTA 2HLDA 1UFQA 2QRVA 2RGCA 2V7GA 1PIWA 3UWPA 3ICEA 1Z16A 3JX9A 4RW0A 2NO5A 2OUIA 4CL3A 1EG2A 3PHHA 4M88A 2LUOA 1YU6A 3BB1A 5JEEA 2FPGB 3P9KA 1RAGA 1W2HA 1EHIA 1NBMD 3OTIA 4PTYA 2PT6A 1U2QA 4LVUA 1KOFA 4Y18A 3P7MA 5IW8A 4CIXA 5CEFA 1TUBB 3RREA 4YMWA 1QHXA 3OH8A 5AXBA 3IIIA 2PS9A 5LR6A 4J0KA 4BN4A 4DDHA 5JI3E 3TG8A 2VL7A 4FN4A 3T15A 3QUBA 2B8TA 1SBYA 2I03A 4FCWA 4V0QA 2J9RA 4EO7A 1K3TA 1B3RA 1WSDA 4H3SA 4YK7A 3WIOA 2GYYA 1JZSA 3PHBE 4QTZA 4X0EA 5CPFA 1V6SA 5FFNA 3ZX4A 3I5UA 2GEUA 2ECFA 3A8TA 3CLVA 2I3AA 2OCGA 3LT5A 4G26A 4L5CA 5FNZA 3RM3A 4B2IA 4R98A 4PIPA 3PPVA 1GQSA 3U3ZA 4E7OA 2KBFA 5TQJA 1QMPA 2G83A 1KP2A 3MYYA 3NOVA 4WZBA 4UMFA 4YUVA 3TDMA 2WC1A 4HNAB 3R7FA 3V2IA 1UZNA 3QY9A 5F9HA 3CURA 5EA2A 1HDCA 2FUG6 3HNOA 3VYWA 4RC9A 3RE1A 1KMMA 1O03A 1XJWA 2C77A 2WG2A 2PMDA 2ZR7A 1XZGA 1Y3HA 3I28A 5AQEA 1XTRA 2R00C 4GP6A 4XB6B 4C4SA 4ZI3A 1C3CA 2KM1A 1UKBA 4Y9SA 3UXYA 3VR4D 5I5GA 4C14A 5K6AA 2AG0A 3DZBA 4PAOA 4QUJA 4YP1A 1GXSA 2YRFA 1OMOA 3VO9A 1Y4DE 2OILA 3ITKA 1KJYA 2QT0A 2IUYA 3Q8KA 1MB9A 3OECA 1DKLA 4WCFA 4PX3A 4BLUA 3BD6A 4XXHA 1G21A 3EW7A 1U5AA 4GNKA 5AMXA 2AXPA 2BBSA 5TF4A 1ZXBA 4CQJA 1YI8A 2A9PA 1GXSB 4HPWA 5ECWA 1T0UA 4LVOA 3AG6A 3CXUA 1T4CA 4JDPA 4ZGGA 3CF4A 5TE9A 3U7JA 1P74A 4J0CA 4C22A 4EJSC 5DCWA 4IDBA 2GHQA 3O9MA 1XZDA 1ZI6A 5JDCA 2B5VA 1NFRA 2WSMA 2WLTA 3L3BA 4Z2YA 3CPSA 2DM6A 4IIJB 4M22A 1VIYA 3I5MA 3BFJA 5HF9A 3DH0A 2BFMA 2W2LA 4W1SA 4BNVA 1VPLA 4JENA 2ZIZA 2YZ2A 1C0LA 1U8FO 2XXJA 4D9GA 4D0NA 1LF5A 3Q98A 4O1MA 1M1XB 4BBZA 1PYOA 2GN1A 3K96A 4WGFA 2OT3B 5DCUA 3CO0S 3HUDA 3O8QB 1RZRD 3L7OA 4C30A 3UAOA 3QXHA 4QPZA 4DCOA 2H0AA 2GYVA 4EG4A 3IP1A 3UJ3X 5LL6P 4RMIA 1BU5A 2HVGA 3TVYA 2JZNA 2ZT5A 1T4MA 3HU1A 3LTNC 1N4AA 5JW6A 3BDIA 4TWAA 3WL7A 2FMIA 3ACDA 5JC1A 4IIEA 4EI9A 3PNKA 1PX0A 1GKUB 2J4FA 1JI0A 3OT4A 2X6TA 4XFJA 3SOPA 1LEHA 3RUDA 4OSPA 3REQA 1PE0A 2ZRQA 3O9ZA 3A1DA 1E6UA 3OFNA 2LIPA 4D4MA 1PL6A 1PQYA 4TS1A 4LISA 4MLDA 3FH0A 3A6EA 2REBA 2O06A 4EHKA 4R8RA 4LI3X 2P0AA 2IU4A 3HWRA 1UODA 2Y71A 3EPKA 3HXOA 4TVSA 1BROA 1H2BA 1NP3A 5E6UA 1TT5B 4HAYA 3BMOA 3CNOA 2IXEA 4PFSA 3PI6A 1W88A 1LQ2A 1S1MA 3N0WA 1GPLA 2FE4A 3FBWA 3GPBA 4NFHA 4Q5IA 4XFKA 1A7UA 2QRVB 3FDZB 4IZ6A 2JFOA 4MKIA 1CY1A 4BVGA 1QYCA 4EK9A 2CNBA 3UUWA 4DLUA 5KNCH 4UVEA 3M5PA 4U00A 2NM0A 3IH5A 1VHDA 4JU8A 3ZN2A 4YRDA 1D9ZA 2JD0A 2HPZA 2Q99A 2QRJA 4NCJA 4WKOA 4GWKA 3S29A 1H93A 1VE3A 3DEKA 1U65A 4P7FA 3WWEA 5LMUB 3PTLA 4JY7A 1YD7A 1J24A 1WPXA 3K72B 2Z2XA 2WNIA 4OXQA 1H6DA 3IAHA 5IK2D 5K0BA 2X5XA 3WWYA 3MELA 4W9RA 4IDAA 4IH1A 2CMKA 1THTA 2TMYA 4ZU6X 5HE8A 3TMYA 4Z4CA 1N2CA 1USWA 4TKLA 1Q91A 4PN7A 3F5FA 2IKSA 3LY5A 4YDRA 5DN6D 1CNFA 1XZPA 3HB0A 3MTEA 2OVBA 2I4IA 4R0MA 2ES4A 1KIFA 2R84A 1EA5A 2Q8QA 2R79A 2RHJA 2ZOSA 3L1HA 3B7WA 5CBPA 4MKFA 2AK2A 2XEXA 3L4BA 3V55A 1FDUA 3ZPXA 1PYGA 1PEDA 4B6FA 1E5LA 2JLRA 3OO1A 1XU7A 1D5WA 1DXYA 2PXXA 1KEEB 1G0OA 3JQ7B 3CEMA 3DM5A 4JGBA 2YNMC 4BNJA 1YZQA 4GVXA 4RS3A 1NXWA 1I80A 1ZNXA 2Z9CA 4YCAA 4DJJA 3CZRA 1DBWA 1XVTA 3E27A 1AU9A 5EGNA 2FPMA 4HOYA 4OX9B 5E7QA 4IPTA 2P2GA 3FMVA 4N5IX 3GRFA 4PG5A 3ND8A 2H65A 4UQOA 1DIGA 2BGNA 2DT5A 4W1PA 1VE5A 3W2GA 5JAOA 4OHFA 4RJTA 3NNNA 2YHSA 2GEDA 3MWEA 3P0JA 2GM9A 4II3A 3TOVA 3WSTA 4LHWA 4C0XA 3RS5A 1S1CA 1XHLA 1P5ZB 4E07A 5CVVA 2JH8A 1MRNA 4CEIA 1E7YA 3X44A 1FRNA 4K9QA 2Q28A 3QBTA 4HLCA 3C97A 3HSSA 1SG0A 1SUIA 4I3GA 4L5AA 3VU1A 4DDWA 1Q1ZA 4G1UC 2A0KA 2Z6QA 1KZ4A 3RVJA 1W0JD 1Z38A 2BEUA 1ZGBA 2IHBA 2YY5A 3WLFA 4BB6A 3G89A 1KRHA 2B4KA 1IZ0A 4OB8A 3QOXA 2A58A 3NUZA 4LV8B 1OGJA 2DHRA 2PKQO 2REQB 2FDRA 5FTMA 3CS3A 3V1TC 3ACBA 3W6OA 3TLJA 1R0LA 2ZJ0A 3BL6A 4J3NA 3IALA 2PWZA 4HUJA 4RHEA 4OHKA 1QJCA 4CQLA 1DEXA 3SS8A 3TOXA 2AC2A 2P3LA 1FMJA 2GAJA 2XB4A 4TUYB 4DG9A 1E9FA 4IV0A 4Q3EA 5FFMA 4B3GA 2NACA 3JQFA 1IHOA 2FWNA 5LFAA 4FYIA 3BTSA 3OZVA 5E4TA 4OSEA 4PIVA 1JDBC 3MIZA 2VBIA 4OI2A 1F6WA 4KFSA 2HLDD 1B8UA 1EUCA 2JHGA 3OM9A 3AVUA 3CT6A 2I2CA 2VT3A 3HO6A 3KJXA 3RSFA 3MHTA 4D9KA 3ZQUA 1RYMA 4OP2A 5EIBD 2Z98A 2O3UA 3SE7A 4R3UC 3HJCA 1GT91 1RKVA 1S8FA 4FKMA 2XZTA 5CA1A 1RHQA 3TCXB 3PNBA 2IYXA 4FYMA 5EP4A 5C3MA 2FP4A 3S2FA 4PPQA 5EJGA 1P0MA 4AKSA 1NNUA 1EFPA 4TTQA 1UBRS 5DRTA 5B1DA 3TD6A 3UWSA 4G25A 4DB2A 1RE0A 1TA0A 3TK1A 3UK0A 3U3RA 1PV2A 3ZOKA 2P3QA 4A6PA 4B2PA 3MJCA 2EATA 5A4DA 2ODPA 1TMOA 3SYRA 4CZ2A 1Q5PA 2GJ8A 2ON6A 1TKAA 3F96A 1GVHA 4OU4A 1H2ZA 1B2RA 3RV4A 4B0PA 2A59A 2WIKA 3PUJA 1TADA 2DSNA 3AF1A 4NZPA 2QYOA 4UEJA 3UN1A 4BCCA 3L7AA 2A3NA 3USZA 3SBOA 4QG7A 1NTRA 4B8YA 5CHEA 5DBEX 5IYZA 4AI6A 1U3WA 4KMOA 5FA5A 5IH3A 2QD2A 3FHJA 3K20A 1PS8A 5JVDF 2YYAA 5CYFA 2BN4A 5TQ2B 4DW8A 2WKSA 5BOSA 3FOAA 1J1IA 1TKCA 3RTEA 4NDNE 4YP0A 1R0YA 2NU9A 4E15A 2FW8A 4WOCA 1HE8B 3DXZA 4XARA 1HI9A 3PQ7A 3SQWA 1UKVY 4HAIA 3ACCA 4DL9A 2IYTA 2F9FA 2QXUA 2X0NA 1E66A 1V26A 5F77A 5HS4A 4HWGA 3MMPA 3L41A 1P5HA 3AP2A 4LG1A 4CF7A 1A82A 2BFBB 4GMDA 1H8ED 2YWHA 3F6PA 3JATB 2C2ZA 4EYQA 3ZE6A 5C7YA 5JCXA 2IYFA 2GJKA 4OTZA 2HIMA 3MCZA 1XQ1A 3S70A 1V9LA 2ACEA 1ZN8A 4IXMA 1ZK0A 2Q5FA 2ZJ8A 3Q15C 1Q7TA 2JHPA 3STYA 4TXHA 4H1TA 5IM4F 1EXWA 4NMHA 2AW5A 3IUYA 5BNFA 1N9GA 5ALMA 3WGLA 4NPAA 1PZMA 4XW2A 4B6QA 4C29A 5BV8A 3KVYA 2O0MA 1ZS9A 1Q0TA 2FR0A 1D8AA 4WI1A 4P08A 3BFVA 4MO2A 2VHQA 3MSCA 2CEAA 5KI6A 1SBTA 1E9SA 2FVXA 4QDXA 3RJMA 1RKBA 3BE5A 4MUEA 2OGUA 2QR3A 3D8NA 4DUYB 1Z34A 1R4AA 4UEQA 2HDWA 4U1RA 1KBQA 2BMVA 1HM5A 3BQNB 3TZCA 1J2EA 1FS5A 4M9CA 3PEFA 3N8HA 2PJRA 2PH1A 1L4YA 4BV2A 1GLGA 1VMIA 2EFHB 1SC4A 3WMEA 3E0XA 3O8LA 1OHHA 1AMUA 4YALA 4S35A 1YE5A 2PZKA 1MPXA 4PZZA 4BO0A 2YFKA 3AJ8A 2HPVA 2EP5A 6REQA 2J3MA 2XLBA 3Q6IA 3N2EA 3TZHA 4YMTA 821PA 4G5OA 1UP4A 2XGSA 4ZTBA 1YRQA 1Z8NA 4R1NA 3T94A 4K9KA 1VHTA 3IDQA 3KELA 2BBOA 1OI3A 4LGCA 3DTYA 3E3AA 2FG6C 3HBMA 4BB0A 2CC2A 2GLTA 1GGJA 1U0TA 5FBQB 3DWEX 3TUIC 4CF3A 1K7WA 3A06A 1W8DA 3B48A 4HBZA 5LQAA 2I8LA 4N6NA 2P11A 5DASA 4YACA 3BZWA 1VCIA 3THOA 3OCXA 3LECA 5KYXA 3VNAA 4MGHA 1PR5A 2ZIUB 4PTZA 5EZ5A 4RL6A 1QX4A 1IG3A 3KSZO 3WMGA 3CKMA 3ZXXA 1YUBA 4P8RA 1XDGA 1RYBA 3QLUC 3PBKA 3SX0A 4I3HA 1YRWA 3VM6A 1U63A 2P6UA 5EMMA 3HXQA 2OBLA 1PFUA 3BM5A 3IO5A 2K6GA 4TKUB 1B76A 4HDKA 4HR7A 4M38A 4IDNA 1P2TA 3I2JA 4X6LA 1UWCA 4ARSA 2J3LA 2X15A 3STXA 4DIDA 3E3NA 3QOFA 1WEHA 2WB2A 2IOYA 2G9ZA 3L8CA 4MJXA 4I5IA 4IJWA 4PZYA 5EL0A 2DBZA 3IRVA 4F12A 1EDDA 3JZAA 4KK3A 4E4RA 4QAJA 5TJHA 3MS7A 2BMAA 2GLXA 2OBMA 4K05A 2AN5A 1Y1KE 3HYTA 4IDGA 1YUMA 2OCYC 3AT1A 4KPUA 4A2QA 3ZDAA 1DDIA 4J0FA 4B8ZA 2EW8A 3LK7A 2YKGA 3H16A 4B3MB 4NCKA 1KP3A 1UC8A 2QG9A 2O1EA 2PL5A 3BA6A 3MWDA 2WWFA 3AZQA 4LJLA 3FMPB 4BAGA 3CCCA 2I1WA 3GDFA 1GCAA 5AKJA 5EMJA 4DPKA 4F91B 1O77A 5JCOA 1TO2E 3R6QA 4IXDA 3GP3A 3EUAA 4YPOA 1D6JA 1JAXA 2XT0A 3L8YA 2F43B 4Q3LA 1T2UA 2RK3A 3CR7A 1RWQA 3RASA 2DUJA 3EYWA 1POXA 3LW7A 5D3QA 5CXQA 4XB1A 2GEVA 1G21E 2YW2A 3QVWA 1KRXA 2NU9B 3C1OA 4MRMA 1W9HA 2VUUA 3PXDA 3FWKA 3TOSA 4A3SA 2RG7A 4AXXA 4FIDA 1IDOA 1OBHA 3QXGA 1KYXA 5JS7A 4TUYF 1JWLA 2JZCA 4MVJE 2X7JA 2QRZA 4WXHA 5AKKA 1ZM3A 5GONA 1RR6A 3V4SA 5MHTA 2B35A 4G5FA 4MGKR 1D07A 1Z5ZA 1PK9A 2DFLA 1U11A 2IZ5A 3ZV4A 3VR1A 3R6TA 1IBLB 2QTZA 2WNSA 2GZDA 4E31A 1RC0A 5GJVC 3ED1A 1NVVR 1YBMA 1RBMA 3ZK9A 4BFVA 2YWJA 4ZN6A 1VLMA 1MGOA 1L7BA 1YA4A 1PAUA 2FOLA 2ZBUA 3I6ZA 3QLVA 4LKRA 5DW0A 1DRWA 3RD5A 5K4AA 2J31A 4AYTA 1HLPA 4F9FA 1BSVA 4M1SA 4O1HA 1XZFA 2JFHA 3ELYA 3KUCA 1SJ9A 1UKCA 1FDIA 3NHKA 1ZD3A 3I9MA 4EPYA 1EE1A 2E1PA 2G3YA 4MRAA 4NXMB 1OWMA 3EY9A 4WY5A 3NFYA 2JI4A 4FMDF 4QHSA 4DR5B 3GLQA 3HV2A 3M3HA 4Q3BA 1U3UA 1AX9A 5ESXA 2IHTA 1XWFA 3R7LA 2ZPAA 3AETA 1A4UA 4YECA 5F1OA 1HXHA 5CLQA 3LUDA 1QLJA 4B8WA 4DC9A 1PQWA 1CDDA 4S1TA 4O4IF 4E4TA 2EARA 1VPDA 3O92A 2WAXA 4PSAA 4S0ZA 1KVRA 2AOTB 3H1PA 4DRXA 3P0EA 1CYEA 2DETA 3H04A 1NR5A 2QE6A 1YR2A 3HWWA 4QXAA 2RGRA 4DXHA 2W2TA 2DAPA 4L9SA 2VQFB 2WILA 1ECCA 3CSDA 2H1FA 1CQJA 1JXAA 3F0TA 3OWOA 4G2NA 1E2PA 2FSPA 1MHTA 1WKCA 2KB0A 4F8YA 1DDGA 2B21A 3A05A 1LPMA 1JHRA 2A67A 1AM4D 3VOBA 2QM8A 1J8QA 1FUEA 2AUTA 3C85A 1FDOA 3EMVA 1QGED 3QSGA 4Z4EA 3A1VA 3Q3EA 4H3KB 4IHKA 4JN6B 4OI0A 4WY2A 2G9QA 2D2VA 2GOYA 2E4WA 4W5HA 4BB9A 1UXKA 5AK6A 2X19A 3UHPA 2M6KA 1EK1A 2NO0A 3KSDO 2ZATA 2P68A 1JMKC 1DOHA 5FBLB 4BBPA 5KX5B 1XLTA 4P4SA 4LJSA 3ZIAD 4M60A 2JFFA 1R7RA 1GKLA 2WV7A 2WP8J 1P45A 2CLIB 3AJDA 5JO0A 4HBGA 4M1YA 5KYGA 2CZQA 1R0XA 1CRPA 4TMTA 1SQ0A 4J1QA 4Z4GA 1KO4A 5FORA 4OMUA 3R7BA 5IAOA 2OHJA 2QE7D 4EHLA 4IWYA 2WPDD 3F9IA 5B57C 2OA0A 1ZQ9A 1EM6A 3R41A 4A0HA 5CR9A 3ZY5A 2JEOA 3LTEA 4OXRA 2VP5A 3U37A 1VYUA 3CJQA 3AU9A 4JCCA 1I2DA 2ENWA 2R6GA 3IQGX 2I22A 5EPEA 4AW9A 2A33A 3ZJTA 2AXNA 2BGTA 2BHRA 2PGDA 2WOOA 3RIMA 3SZOA 4ENPA 2YV5A 2Q4EA 1OFVA 3EIOA 4B33A 4ROSA 1KFBB 1FVXA 2XTMA 4X85A 1WXGA 2EGGA 5ISMA 4A73A 5B6JA 2WHRA 2O5RA 3NEPX 1H8EA 2PV0A 4C89A 2GERA 3JW8A 4KFRA 1Z7GA 3IP9A 3BQMB 4Q03A 1NBMA 4RVUA 4UCFA 3V4LA 4EA6A 5K0EA 5A3VA 3DE4X 4MARA 3LF1A 2IUEA 4PINA 1NLYA 3TV2A 5CFNA 1NGSA 3ROXA 4Q1AA 1Q7CA 4OQXA 1GQYA 2JGIA 4C08A 3K5PA 3O82A 3PR1A 1CERA 2H51A 3LZDA 4W1QA 1N2CB 3M6VA 3SR3A 4BJ1A 4LC9A 4UUBA 2ZJBA 3EG9B 2C20A 1E9VA 3BF8A 4N0EA 3PX2A 3D0RA 5BQFA 3AIMA 4L16A 3LBYA 2NSHA 3UA3A 2D7JA 2VWQA 3E81A 4E22A 2FRVA 1NKSA 2IV2X 4B5KA 2X40A 2D62A 4UD6A 5CCDA 2ARKA 1G66A 1US8B 3LPNA 1E3SA 1D1QA 1JH8A 3KP1A 3UV7A 2J1LA 2ORVA 4NV0A 3CNQS 4RVOA 2C2MA 5DTIA 2VSNA 5C7IO 1QQTA 4C4XA 5JXJA 2YIJA 3LGXA 2WF7A 1JEQA 1TC1A 1VFPA 2V97A 2VQSA 3BMOB 3G5UA 5CP8A 4WLOA 4GSKA 4L3OA 1VSUA 1XZEA 2NZVG 1XMOB 1JU9A 1I94B 3A70A 3M0EA 4G0QA 2XIQA 1SB8A 4UHEA 3K9BA 1XRJA 2GHIA 2Q6KA 1BW9A 4G5GA 2EERA 4CTNA 2Z5GA 1TJ4A 3CUWA 3H18A 4NONA 4X66B 1PGQA 3QFTA 2D4HA 1WCXA 2Z3WA 1QCDA 3DDNA 4M9XA 4DKXA 2Q7DA 2HXSA 4DLBA 1H2XA 3CM0A 5T67A 1C3JA 3PDUA 2CUZA 2JKZA 3ZCTA 1FB5A 4KR0A 3MXOA 1A71A 3V5NA 3U5ZB 1LDEA 1QC5B 1MTZA 4JGIA 1L1FA 2WUFA 3EOZA 1ADYA 1D04A 4FTWA 3NO9A 4BNWA 1T4DA 4NP6A 2BGMA 4QRDA 2LKDA 3CH5A 1FDWA 4KPYA 1G16A 3ZDFA 1LGYA 2G1AA 2GD2A 4RA6A 4EL5A 3KR0A 6AT1A 2DFDA 4AY5A 3PFBA 1TM3E 3CEHA 3NJ4A 4LEIA 1Z07A 1ZUWA 1GTMA 2VG8A 1UDCA 5BQPA 3TZQA 4RD1A 4S1PA 3BSSA 1Z33A 2CHFA 3GGJA 2VYFA 5KOJA 4LZAA 5KU1A 5K6TA 4L8VA 4PYNA 3PUKA 4UTZA 1VJDA 3PKJA 2NXEA 4NULA 4KJXA 1T0IA 4B6SA 3J80A 1RZRA 3BXZA 4HZUB 3U6KA 1QMGA 1ZCBA 1WUIS 5J5CA 3M6WA 1JA1A 5JNUA 1OA1A 3CLSD 1H0HA 2XVYA 3KTAB 4FYXA 4J1NA 2HRBA 4KEAA 3IQDB 4JJIA 3RQIA 3OIDA 2ZVPX 2QD1A 3LQRA 4JI8B 1X7DA 3O38A 2SICE 3HSYA 2E89A 3M1YA 4TYMA 6Q21A 5IXSA 4GKJB 3AFNA 1GNPA 5IVDA 4EARA 4O4JB 5KYNA 2FPRA 2OK8A 3O4FA 1IH8A 2J8ZA 3F6CA 1CNEA 5JE8A 4CTJA 5JS6A 4QSMA 2ZRMA 5E8JA 2HLHA 1T25A 3BCUA 5FBKA 3RLIA 4B43A 4MQEA 4I19A 4ECEA 3E8SA 4FFSA 3NT4A 1WMEA 3FIUA 4JJGA 5JHGB 2BHSA 1FX0A 3OTOB 3W4KA 1T9AA 1C4OA 3HVIA 4HL6A 3ZWPA 1WP9A 4WE3A 3VDNB 3FR7A 2QJFA 2QR5A 3BKWA 1IONA 1ZGZA 5EN4A 1FFYA 1I3KA 1JE0A 1H2FA 1HFJA 1UZAA 2P40A 1LZKA 2PS1A 3FYUA 3GVHA 4RIIA 5AKZA 2VOJA 3D2CA 5T6BA 4CGZA 2Z8ZA 1IWOA 2AT1A 1FCJA 5CYOA 4PG4A 1GY8A 1Q0SA 1NY6A 4J0QA 4Q4JA 1DPGA 1R4MB 2XB9A 4YWHA 2Y1GA 3I61A 3UJ9A 1KWKA 1P1JA 4R7TA 3BORA 5JHHB 4G1FA 2JLCA 1CLUA 1VG1A 2WJYA 1K06A 3PDHA 4FFNA 2XD9A 5AW8A 1OX6A 1D8TA 1P9NA 2HSEA 2L0XA 4RHTA 3WB9A 3WBBA 4BO5A 5IANA 1IEQA 1L7PA 2OFWA 5DGCA 1RAHA 3KT8A 2D3TA 1C7QA 1RXIA 2OCPA 3ZDBA 1XLTC 2I66A 5DMXA 3MEQA 1ZBQA 2EOAA 1P4SA 3O3CA 4YP7A 1NPTO 1XUOA 5CDTA 3VQTA 2QN7A 3YASA 1LK5A 4JKOA 4OAPA 2PZFA 3SZ3A 1Z06A 1WDKA 4HFRA 1OREA 1VHWA 4ID9A 1F2UA 4W5JA 3RHTA 3V8EA 3H6GA 1W5TA 1X9HA 2JF0A 4MYDA 4L8GA 1Z62A 3COSA 3MQ2A 4O5AA 1DOFA 1NRXA 1K0FA 3L0CA 2I4MA 5ICCA 4M53A 1Q3TA 2IUSA 4ZVLA 4M0EA 1M6HA 2LXNA 3L84A 3AY3A 1M2GA 3VNVA 2IGTA 2BYTA 2LIVA 3KZ1E 4HQ0A 1NJ2A 2DKNA 1Y8RB 4YT8A 1DBVO 4PC7A 4BNDB 1EWVA 2V96A 4PX2A 5G4KA 2HIAA 4AO8A 2MJLA 4UHBA 5HEKA 3TSCA