1Z4QA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with 2',3'-dideoxy-2',3-didehydrothymidine 5'-monophosphate (d4t-mp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'(3')-deoxyribonucleotidase
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4qA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4qA01
4HAIA 2YN4A 1TA0A 3U7HB 3N28A 2CFRA 2X4DA 1NNLA 3FGOA 2DQSA 3KOOA 4HGPA 1Z4MA 3GYGA 1RLMA 1WVIA 2QYHA 3U19A 1S8OA 2YJ3A 5AM5A 3U7EB 4BX3A 5ALOA 5AW0A 2JAWA 5IT4A 2GO7A 1XP5A 3MC1A 3L8EA 2JAOA 3J7TA 3OCXA 2W4MA 5AW3A 3NASA 1TE2A 1L6RA 2GMWA 4OFZA 3EF1A 2JAUA 4PNHA 5ALVA 5ALTA 1YMQA 3RFUA 4E88A 3U7GA 4EZEA 3QUTA 3AR2A 1U7OA 3PGLA 2P11A 2ZBEA 1L7PA 3ZTYA 3DDHA 3ZTWA 5ALFA 4NFLA 5AW1A 2YJ4A 4UMVA 1S2OA 4BNDB 5AHXA 3QU7A 4XQ0A 3EWIA 2VKQA 3UMBA 3KD3A 3KC2A 5AW9A 3A1CA 4BX0A 3WK5A 5AKXA 4NABA 5ALLA 2B1RA 2O2XA 4HYTA 3DV9A 5AVYA 3SLRA 1ZD2P 1QH9A 1L7OA 5ALPA 2C4NA 2AGVA 2C88A 3W5AA 4EELA 4KNVA 3SHQA 3ED5A 3E8MA 2B8JA 3NRJA 2B1QA 3QUCA 1NF2A 4RESA 5AKJA 3W5BA 5ALJA 1K1EA 3VAYA 3QX7A 2HHLA 5AW5A 3KBBA 4C4TA 2HO4A 2HSZA 5AICA 3DAOA 4L6CA 3KDPA 3BWVA 1U2SA 2YY6A 1CQZA 1ZRNA 3OCZA 4I9FA 4DW8A 3AR6A 3WKCA 2IOFK 3B9RA 5AVZA 2YMMA 2HCFA 3IRUA 3QU2A 2I6XA 3L1UA 4KX3A 4CF4A 4MWOA 1RDFA 3L5KA 4YIHA 1RKUA 3ZX4A 4XE5A 4GXTA 3A1DA 2G09A 4JB3A 3AR4A 3PDWA 1TJ3A 2I34A 1Z4KA 3L8GA 2RB5A 3E84A 1RPZA 1O03A 2GFHA 5AK3A 3SF0A 3WKDA 2FUEA 4G9BA 4AP9A 3L0YA 4XOUA 3ZWDA 2OA0A 5AK4A 4UAVA 2BY4A 3DNPA 1N8NA 3OCWA 3W5DA 2NYVA 3QU9A 4HGQA 3OCYA 4Y2YA 2CFTA 4DCCA 5A3SA 1EK2A 5ALEA 3ZVLA 3QYPA 5AI4A 1PW5A 2AH5A 1WR8A 3SKXA 4DWOA 1VJRA 1SU4A 2B0CA 4QJBA 1ZD3A 3ZX5A 2FUCA 2WF9A 1Z5UA 3CNHA 5AVVA 2WHEA 3SKYA 5AW2A 3L1VA 3UMCA 4UMEA 1O08A 2NO4A 1Y8AA 4ZEVA 5ALUA 3QLEA 5ALZA 5AM1A 4Y2PA 4NWIA 5AVTA 1ZRMA 5AI5A 4BX2A 2HEGA 3ZVNA 1U7PA 2CFSA 4YCLA 1L8LA 3A1EA 4YIKA 1TJ4A 2FI1A 4Y2JA 3NANA 5AVSA 3ESRA 3AR5A 4EX7A 2C8KA 2PR7A 5ALKA 5AVXA 5A3QA 5IS2A 1XPJA 5ALMA 3QNMA 2FPWA 3OTQA 3WK8A 3PGVA 1J8DA 5ALXA 4BBJA 1RKQA 3B9BA 1Z4NA 1WPGA 4IG4A 1NRWA 2FPUA 4CF3A 2ODAA 1Z4JA 5AKHA 2B8EA 4G63A 5AKGA 4YCNA 3ESQA 2I55A 2G1AA 2WM8A 3I76A 5AVWA 1T5SA 3EPRA 4L57A 3SD7A 4OHFA 1J97A 4C4SA 2YBDA 4F71A 2HX1A 1RQLA 4HGRA 3U7FB 4YCMA 4I9GA 2C8LA 3MMZA 1ZJJA 3K1ZA 4ZEWA 1XVIA 4Y2RA 3ZUPA 2EAUA 5AW7A 3A3YA 1Q91A 3P96A 3WKAA 3U13A 2WF7A 5AM2A 2BDUA 2G06A 1L8OA 3QU4A 1Z4IA 1YJ5A 2P9JA 1AQ6A 1RMTA 2BDEA 1RQNA 3F9RA 4HGOA 2YJ5A 5IT0A 5AK5A 3ZU6A 4BEVA 3UM9A 5AVUA 2HDOA 4GIBA 4Y2XA 1IWOA 3I28A 5AKKA 4UM7A 5ALYA 3OCUA 5JJBA 3B8EA 4OD0A 3ZVMA 2HF2A 2YMPA 3WK4A 1X42A 4UM5A 2R8ZA 2G80A 4QQFA 4O8CA 4EEKA 1LTQA 3PCTA 5ALQA 2RBKA 4BKMA 1Z4QA 4UASA 2ZBFA 2HI0A 1RMYA 1U2TA 2I7DA 2QLTA 2WF5A 1RLOA 4UU0A 2R8XA 4H1WA 4MUMA 5ALDA 2B30A 3AR8A 3N07A 1L7NA 4C4RA 3OPXA 1LVHA 1JUDA 4Y2SA 3N1UA 3R4CA 2G08A 3ZI4A 3AR7A 3ET5A 2WFAA 4Y2TA 1QQ6A 4J2TA 1T5TA 2B82A 2YJ6A 5ALWA 1RRCA 5ALSA 2Q5EA 4UW9A 2NO5A 4AS3A 4BYGA 3L8HA 2RAVA 4UARA 2FPXA 4NV0A 4BEWA 4BNDA 1RC8A 3SMVA 3EF0A 2JARA 3HYCA 2PQ0A 4UATA 2EARA 3FPSA 3NUQA 3WGUA 1Z5GA 5AVRA 2D2VA 4XPZA 3I1YA 5AI0A 5AI6A 4JDPA 5AM4A 3NALA 1SWVA 2I33A 2YFYA 5AESA 5AVQA 1FEZA 1RMQA 3WGVA 1CR6A 1T9ZA 1YNSA 2AMYA 2IYEA 2R8YA 4RETA 2RARA 2YMQA 3FM9A 1Z4PX 5ALIA 2OYCA 3AR9A 3CZ4A 5AKEA 1F5SA 3ZWKA 5AIAA 5AI8A 1YDFA 2Q4RA 2EATA 5AKYA 3IB6A 4CF5A 4L6AA 1N9KA 3NAMA 5AKLA 4OCZA 2W11A 2FPSA 2O9JA 3QUBA 2FPRA 3MPOA 3ONNA 5AI9A 4UMFA 5AM0A 4Y2UA 3FZQA 5ALHA 3W5CA 4B6JA 1ZD5A 1Z4LA 3QGMA 1ZD4A 2IOHA 2GHQA 4FYPA 3TLMA 2WF8A 3ET4A 3R09A 1ZOLA 1YV9A 2AUTA 3MN1A 5AW4A 1MH9A 1TJ5A 4KX5A 2W43A 2ZBGA 3UMGA 2FEAA 1WZCA 5AKZA 4J03A 2ZG6A 3M9LA 3NIWA 3L8FA 4KYTA 3RF6A 2C9MA 5AW8A 4Y2VA 2HF7A 1U02A 3WK9A 3D6JA 2P27A 5ALNA 4UU1A 2YMLA 4UAUA 3HLTA 5AK6A 1QQ7A 1L7MA 4KNWA 1QYIA 4EENA 2WF6A 1RKVA 2ZBDA 3M1YA 4YGYA 4FE3A 3U26A 3QU5A 3FPBA 4F72A 5ALRA 5E0OA 2JGAA 2GHTA 5FP0A 4HGNA 2CN1A 1SWWA 4NAVA 3L0BA 3ZW7A 3R9KA 2I54A 3QXGA 1Z88A 2ZXEA 1VJ5A 2G0AA 3WKEA 2MSNA 4YH1A 5AM3A 3WK7A 5AIBA 4IFTA 4Y3UA 2ZOSA 5T41A 4UMDA 1YS9A 2IOFA 2HOQA 3S6JA 4CNQA 3WK6A 4AS2A 4DFDA 3E58A 1EK1A 5ALGA 2IA5A 1KYTA 4CE6A 5AKIA 3N8GA 2OM6A 2R8EA 3IJ5A 2PKEA 1RLTA 1Q92A 3N5KA 3KZXA 3E81A 1VFPA 4Y2QA 3WKBA 4KN8A 2G07A 1ZS9A 3OCVA 1QQ5A 3AR3A 2OBBA 3I6BA 3L0CA 2FDRA 5AW6A 3BA6A 3L7YA 2MU1A 2P69A 3QUQA 4EX6A 5A3RA 1Z4OA 2Q4TA 3FVVA 4FFDA 4ZEXA
chains in the Genus database with same CATH superfamily
3W5JA 4EG1A 2BSXA 5JMPA 3NO9A 4LVCA 4RAOA 5ECDA 1YACA 3QSGA 3SYNA 3NR2A 1D7AA 4BN5A 2MMGA 5KJFA 1OB2A 2PV7A 3C7KA 2FFBA 5MGNA 1M8JA 2JL1A 5KYVA 4NL4H 4RMHA 4W8OA 3AEQB 5KSPA 2PJDA 3RYHA 3ZGXA 3ONEA 1G8JA 5EHZA 4BO4A 2FSHA 2OV3A 1CY1A 2VYQA 3NEPX 2BEJA 4Z5XA 5C8VA 4ARCA 4UHBA 1E2IA 3BMCB 2I7XA 1QBGA 1HYBA 2VJLA 3T7JA 2PQMA 1JI0A 2P65A 1MU0A 2IKQA 4YP6A 1TO1E 2WHQA 4B73A 1F8YA 4HP8A 1TM4E 3FBTA 3ABOB 3SJUA 1NG1A 1Z6QA 2F7SA 2QV7A 5KSWB 5LCXA 4Z7QB 3DH0A 4GI2A 5HRCA 4QUBA 4H3KB 3OLQA 1IPHA 2GEFA 2SKEA 1ILWA 1RYFA 4GLJA 5F7OA 2IZ5A 5BR7A 3RI3A 4GM4A 2M6KA 4O0LA 1L5QA 3ZHUA 3RADC 2H07A 3IBGA 1TTTA 1QF7A 1WUJS 1J0CA 1X8XA 2W6OA 4NK4A 4BL5A 1XL0A 2VYNA 4C4PA 4EEXA 4Z4IA 1IN5A 2Y4OA 2PBFA 4GI5A 4YRKA 1A4RA 4HXFB 3KFXA 4X5OA 1JAHA 1LX6A 4NU0A 2B9VA 5ALFA 4YRMA 4QDTA 1KMNA 4LVNA 1NU8A 1J8FA 2B37A 3GEGA 621PA 3TGLA 2X8WA 5KYTA 3IO3A 2QUHA 4MW2A 1PT6A 3LD9A 2W6ID 4N6GA 2EQBA 3ZG6A 2GN2A 4QC2A 4DQXA 1T0UA 5HEKA 1RHRA 1EHYA 1Y7IA 3T12A 4LOAA 1QIMA 4FFOA 2AS0A 1C0EA 3T7KA 4P5DA 1J8YF 2BFCB 3I83A 5AKXA 4CCYB 3H5OA 1XE3A 3JY6A 1GYPA 1P39A 2D1RA 5FPKA 1I94B 5FB3A 1BU5A 5BSRA 5HOEA 2B69A 4CTMA 4KU4A 3OQNA 1MEOA 2MINA 2C4NA 1BJRE 4M0UA 4DC0A 2CKMA 4DN6A 4HWSA 4REOA 5D3KA 4GPTA 3RIEA 2E3JA 3E8MA 2BJVA 2Z1MA 4XFDA 3LOQA 3N2NA 4R01A 1DAKA 1YAJA 3VAYA 1E4EA 3UMFA 2HA3A 3RSOA 3KBBA 2A88A 1SFRA 9ABPA 3WGQA 4HLQB 3B20A 2QF7A 3UJ3X 1G7RA 1U2SA 1Q7RA 2QSUA 2E37A 4IKEA 3W4IA 3EULA 1AX9A 1QDLB 2G71A 1Z28A 3P7MA 4KMMA 1UJ6A 4K6KA 1P2UA 1TIBA 3M9WA 4ZMSA 3PTAA 1SCNE 1C7JA 1U0RA 1V4NA 1ZIOA 3FCCA 1JAXA 4LJ4A 1TEZA 2I6XA 3FDZB 3VU9A 2QD2A 4B17A 2FZKA 1DWUA 1PJBA 1K8RA 2XUHA 1DPGA 3ETDA 4MKRA 1WCXA 1X86B 1WTAA 1QUEA 4UHJA 3ICCA 2DUMA 3WIUA 3ZDDA 2AK2A 1GJRA 1RYYA 2AEEA 2XB8A 1OKKA 2QSYA 3HEBA 2H63A 2ZTMA 1VLMA 1GAQA 5C35A 1RPZA 5CA1B 1GTRA 1ZU4A 4WI1A 5EAIA 1ZHOA 4XR9A 4EA9A 1C9NA 1BW9B 4JOBA 4I5DA 4XUGB 2IUUA 3IPCA 2AV6A 1VE1A 4GQBA 1WKCA 3C4JA 4JKYA 4O1MA 3HCFA 3ISVA 3SR4A 4BQNA 5M29A 2QMEA 3GLVA 1A9YA 3HG7A 2V5UA 2IGTA 2QAGC 3A7DA 4PZZA 3DEJA 4Q3AA 5TB5A 1FTYA 1R6UA 3K1YA 2CUTA 3C43A 2V54A 3RV4A 2G0NA 4ARZB 4IDBA 4YXWA 5AOCA 1F8FA 3QU9A 1E7YA 1L2TA 2W2KB 4M88A 4WKNA 1DDIA 1U7UA 1H9AA 1OLXB 4LJKA 4XVUA 1DELA 2WFZA 2HRQA 4QFMA 5F4BA 2R65A 2NQ8A 1H69A 3DTTA 3C1AA 5E0KB 2YXBA 2IHTA 3LQ4A 1CDZA 1PJ2A 3DZIA 5K6TA 1QHHA 1A9OA 1KAGA 3KVYA 1M1YA 1N5LA 1NJSA 5AJHA 4ZVNA 5P21A 4GEGA 3DOIA 1EGQA 1SHUX 3V4VB 1I5OA 3JQCA 4A26A 4MGIR 2GZMA 5KTTA 1FBNA 2Y6UA 4BC0A 3PDJA 3UMCA 3BXFA 2HY7A 4CKXA 1QLHA 1TZJA 2YYAA 2P9QA 1NI3A 4Z9YA 3FR7A 4QGFA 2H7CA 4QATA 3GZ4A 4HLUA 4GICA 2JFBA 4JODA 3RVSA 2JGKA 3R6GA 5HF5A 4ITUA 4KL8S 1GRNA 3LCJA 4QNRA 1E79A 2FLVA 5CG1A 5AM1A 3BEDA 4YUAA 3A4YA 4JQOA 1HEUA 5AVTA 4MTCA 3A0UA 3DWEX 3GEPA 1P75A 1BFDA 5JNVA 2P6UA 3GZNA 1MC4A 4NEQA 1R0RE 2VXCA 5CLFA 4YCLA 1KZ7B 2WSYB 4F6LA 4NZOA 3MRTA 3ESRA 4D6XA 4GKKB 1AV6A 2G4CA 3VJLA 3PQ5A 2FG7C 2C8KA 2VJQA 2F1KA 1MC1A 4GX0A 1TCBA 3CO5A 5EVCA 1DXOA 2FPWA 4TV9B 2I1VB 4U2EA 1I9GA 4RVFA 4ZYVA 1Q3TA 3FBGA 3HBLA 1JKJB 2DHCA 4BLVA 4BVEA 3W8FA 1RWXA 4UUNA 2ZJ5A 5FL7D 4EY3A 1QG0A 2QLMA 3TZ6A 3IL2A 3EZYA 1SRRA 1GO2A 2R6DA 4F97A 1S2MA 5HS4A 5JATA 1FURA 1TVKA 4M9XA 3VSDA 1U0LA 2J6IA 4CKBA 1YK1A 1F9EA 1FX0A 1YTLA 2C2XA 3I76A 3BRSA 3PRHA 4GYJA 4MPTA 4PBTA 4YNBA 3RJ9A 3RV3A 3CLVA 1O94D 3C41J 3L2OB 4KQ2A 3UXYA 4RX1A 4EJFA 4CF7A 1GU1A 3FYHA 1JVSA 3KOXA 4XTRA 4E11A 5B57C 4M7WA 1X7YA 1RQLA 1CQIB 3W04A 4GSKA 1TUEA 2C96A 2Z6QA 1BGWA 3V9AA 5CBKA 2Y71A 3K1ZA 4M6WB 1Q7EA 2V65A 4PRZA 1LSOA 2GN9A 3F8SA 1W49A 2BV3A 1IXRC 2XODA 2DM6A 1V11B 3QXCA 4A2CA 3L9XA 2HJVA 3OEHD 3VOAA 3PX2A 5G0UA 4MYHA 1US8B 1IIRA 1W34A 3CEAA 4HDCA 1GRVA 1KORA 2Q2NA 5F9HA 3MG9A 3K8ZA 4H0NA 5DGXA 4D9GA 1PG0A 2YRWA 2FN3A 2I29A 2FXVA 3G8YA 4TXHA 3PLRA 1Z83A 1RQNA 4WV3A 3G2IA 1ULZA 5DHAA 4A3SA 3F4BA 1K88A 4WD3A 4P4TA 3L8ZA 3AUKA 3C3AA 1SB8A 2GKGA 1SOMA 2PUWA 3A9TA 4DOMA 5JZMA 3KUXA 4MAMA 4J16A 1AGRA 2OESA 2RHCA 3QKRB 3N2KB 1A88A 1XMVA 3II6X 4LX8A 5LB2A 1LDEA 1QWSA 1P0PA 4QPPA 2PL5A 1SVNA 2P7HA 4XPIA 4BU0A 2QLBA 3H5IA 2FUKA 3WGTA 1KQFA 1YF3A 1CBUA 1T2VA 1F2TB 3QELA 2PMFA 3WQBA 1PFQA 2SNIE 2JKYA 3PEYA 2H5LA 2ZWMA 3OZDA 1ZM9A 3ZXUB 3N8DA 5KTPA 1QGDA 1W4AA 3N5CA 4GBGA 2R8ZA 3UJ8A 2BISA 4M1SA 4B33A 1L4YA 3BOSA 3O8OB 2Q1TA 3DBRA 1UZMA 2JD1A 4IJ5A 4MCIA 1WSBA 5DNUA 5JAOA 4XB1A 5A4DA 3FYUB 1OXUA 1KA9H 1H3FA 4YP0A 4J7AA 3O38A 2WHRA 3ROPA 2F8TA 1WHTB 2A30A 1Z29A 1KY5A 1MN6A 1XKQA 1WDMA 2ISQA 3FAKA 4RPKA 4J2HA 5DKFA 4ZVUA 5TT0A 5B37A 4FB4A 1FQWA 1G7CA 3FWYA 3RQIA 1D6MA 2AEFA 1V8ZA 1Z75A 1QX4A 1I7SB 3GPIA 3PUXA 1FL9A 4RKQA 3RFCA 3AETA 3UPTA 4X3CA 1JMKC 3PQEA 3FUTA 5H4HA 3H5TA 3A14A 3U61B 3I52A 4QQKA 1QQ6A 1RE5A 2JW5A 4MARA 4BVJA 1A76A 2C3UA 3RVRA 3D8TA 5T4EA 5TQ2A 1UWVA 4ZDJA 3CLTC 3UQZA 1IY0A 2WM2A 3SZ3A 5K8IA 5HUQA 1IK4A 1PS0A 5BSUA 9MHTA 1J0BA 2I4NA 4UARA 2W2PA 3JYOA 3UMRA 3TW6A 2PUGA 3PYMA 2HADA 4GPIB 2B4QA 4HGYA 1ZUHA 2NUBA 1ECJA 4TZTA 4CTJA 1U8TA 4IF6A 2R2GA 5L6LB 3OMWA 1SKAA 4EDHA 4ZI3A 4MPPA 3EF0A 2CWDA 2ZJZA 3OA2A 5CYFA 2WIFA 3F7OA 3SI7A 1R0LA 1T29A 1UBRS 2H8KA 3WGUA 1AGNA 1IEQA 1O89A 4RJLA 3UOGA 1OXXK 1OSNA 3DEHA 4QHYA 5BV8A 5FFNA 3I1YA 1OV4A 5KYXB 4H7DA 1KPGA 4D9HA 1L4MA 1ES9A 2BGKA 2LXNA 3HL4A 4QXAA 1JG6A 3ZJVA 3IUPA 4YJDA 3A4TA 4M0CA 3QBVA 4RVNA 1TJNA 1WCIB 1MAUA 2NO1A 3ZZMA 4HF7A 2COEA 5DHRA 3WGVA 4DEXA 1NUHA 2OK7A 4GO1A 3GRZA 3G9XA 2VJYA 2W6IA 3PR2B 4JYPA 4RETA 5DM1A 3ZDQA 2Z6UA 1DC7A 1LBSA 2PKYX 4DAOA 3HMQA 5C0OE 4MWGA 2Z4SA 2WIKA 4RSMA 4UVEA 4Z0TA 5FJIA 1SU7A 3K0AA 4FJ1A 3T41A 4A03A 1C9YA 2I8AA 2IQIA 2Q50A 2A59A 4NTZA 2ZAOA 4MLPA 5IAJA 4C0BA 3DUWA 3AF6A 4NENA 3R9XB 5EMKA 1NVAA 1AQLA 1GP2A 1N0HA 1CUSA 1T15A 1YU9A 1KYIA 1M6HA 1SIOA 3G8BA 3EZ7A 1KDYA 1OJ7A 1J5XA 5IDWA 3ZIDA 3T06B 1CTQA 1BEZA 3EXIA 1YT5A 2YVLA 3MPOA 3QQ5A 4FR0A 4X61A 1UBSB 4MRRA 5AUQA 5L3ZA 2GZAA 2WICA 4MWEA 1VM6A 3RR2A 1W9MA 5LBUA 3CM0A 4O1IA 4RVCA 1RYDA 1ZD9A 2EG9A 1V35A 2GF9A 3A6LA 3DBLB 4MX8A 5CPBA 2HWWA 1DAMA 1K6MA 3CWQA 1SQ0A 5I9NA 3HY4A 3F5FA 4NCIA 4MI1A 4XAQA 3RVLA 1RJEA 2RI1A 3AHDA 2LUOA 3LSYA 3TLMA 2IPLA 4D9KA 2WA1A 4D3FA 1SOAA 4LN1A 4WNAB 3W6UA 5H9WA 3R09A 3AY6A 4BWGA 5HJ7A 2DQZA 2IYAA 3A26A 1CZOA 4PWZA 2GSWA 5HQ3A 3IQEA 2GBFA 1P73A 3UT5A 4WASA 1EGAA 4Z8XA 2K2QB 1WZCA 2IL1A 1MAAA 3TXXA 4EQ6B 5KOJA 1T25A 5JXWA 2HSEA 1UKCA 2VQDA 2EBHX 3PQ7A 4CTOA 3H9BA 2XNDD 4TTQA 2NPIA 1S3FA 1TJUA 3IPYA 4HDNB 3G8CA 2E4UA 4MPRA 5F51A 4JBXA 2H0QA 1NN1A 3PFBA 1U02A 2XH8A 4MHTA 1G17A 4YA6A 1R7RA 3ME5A 2P27A 3CW8X 3FNFA 2HHAA 4LC1A 2FG6C 5LIRA 3QLTA 4BFZA 1BXKA 1WF6A 1YJAA 2BSQA 1W73A 1P2FA 1QSGA 3T3PB 2Q6VA 3B1KA 3OA0A 3U48A 2FXIA 4NP6A 5EJ6A 1KK2A 4YCDA 3EPLA 4WLFA 3EPJA 1BQ3A 2YWEA 1HNNA 3I04A 1Y8ZA 4IX1A 1GLVA 1KYQA 3HA7A 2FPMA 5LP6A 2XCLA 1Q0UA 4R0VA 1ABEA 3PEFA 4V0LA 1C0KA 3RS7A 2PXXA 3HGTA 5MFZA 4GNKA 5E0OA 1RHUA 4Q03A 4KQ6A 3RRZA 2C7VA 3M6AA 3HYNA 5F77A 4NICA 3WNVA 1DTSA 2AQKA 2WWTA 3MTGA 3AY3A 3QMMA 3RAFC 2H5EA 3M1AA 4MS1B 1FUOA 2XE4A 4P4GA 1F7UA 3NWBA 1RLIA 1IZZA 3L40A 3M6FA 3EDRA 2OHVA 3AF3A 1XD2A 2GYVA 3LO8A 3LYLA 5FTKA 2R1TB 1M1UA 1Z88A 2Z5LA 3B2NA 4JDUA 4KGVA 4LV8B 4U39A 1GNTA 2BEWA 1FUEA 4ZAFA 4NCNA 3RC9A 3ZLBA 4V1CB 3UC9A 4MQEA 1HE5A 2IE0A 3TMAA 2ZWPA 4J0IA 4KVGA 2ZRLA 1C3EA 3KDSE 2P6PA 4HPXB 5FOVA 3TOCA 4IRXA 3CR3C 3WVNA 3F67A 1VL0A 1T6ZA 1ULSA 1I24A 2PRSA 2GJ8A 4QO7A 4ZQEA 5BWNA 2VL7A 1TTQB 3D7NA 1J3UA 1J22A 2ZS8A 5GZ1A 2ZRGA 3RYFB 2IOFA 1PQUA 4L5CA 4R69A 4H35A 3S6JA 4B09A 3FF1A 5IM5A 2UYOA 4MULA 4RIIA 3D4OA 1WEHA 4IX9A 2OCYC 2B6HA 4K6HA 2C20A 1P91A 3ZHVA 1EK1A 4E33A 4FM9A 5JCOA 3H6HA 4TLAA 3IQDB 4Q9IA 5LDHA 5C8ZA 5IVDA 4IEIA 4NVRA 3K0HA 2A57A 1DCFA 2ZAGA 4U2KA 4D25A 5GMOA 2FRVA 5IJAA 4L7QA 2BGJA 5FEMA 5BUQA 2D2XA 1DXQA 4WN3A 1L3IA 2H92A 4LF8B 1JNYA 2FE1A 4R51A 5FL7A 5H7XA 2L42A 4TUYA 4OSEA 4DIFA 3BK1A 2H4FA 4UQLA 3WZLA 3BJRA 3DMPA 3ROFA 2F8SA 3MOIA 3N87A 4DNXA 3CRZA 4YRGA 4YP9A 3BXXA 1VFPA 2D2FA 4MQ4A 1KZHA 4R2KA 3THOA 4KN8A 2QE7D 3KPJA 4EFCA 4DIBA 2DJ5A 2QTRA 1QQ5A 1ODCA 2ZIWB 3BERA 4UE6A 3S2FA 1O94A 2ECOA 1NNEA 1IL0A 4EFNA 4M4SA 5IBRA 1HDYA 3V80A 4ZC8A 4GXQA 2XCQA 3PUYA 1WB9A 5IVHA 3FN4A 4WQMA 1ORWA 1DAIA 1EA7A 2YNMC 4C03A 2ANBA 4RY9A 5A5DA 1FQOA 1JMVA 5HUHA 5J23A 4X97A 4HGPA 3AXSA 4KH1A 4QOFA 2BKVA 3OEHA 3AUXA 1VJ1A 4TTTS 4KV9A 1JKFA 4OV6B 1L5GB 3DR3A 1U1GA 2I66A 4PG7A 3EVTA 4N1AA 4IFEA 4B3GA 1V9CA 2IZ7A 2A84A 3ULKA 4IIUA 2GWHA 4P7BA 4YC7A 3FPFA 1ZZEA 1RJ9B 3PL1A 1NC3A 1Q0SA 1XCPA 3CH5A 2WTMA 3FUWA 3JALB 3WQHA 2FZVA 2UZ1A 1F51E 2ZB8A 2ZPAA 4KOAA 5GVRA 3SQLA 3NB0A 5A4FS 3A1NA 4C2UA 3GA7A 1HX7A 1G3MA 1IUOA 3LUCA 2RHDA 2WJGA 2I6QA 1VI6A 2BRUA 4K7JA 4HAVA 3Q2OA 4IDFA 5F1OA 1TJPB 4BLSA 3WL4A 1KU6A 5LA6A 1CZUA 1Z63A 4E88A 2AFHE 2NG1A 4K3UA 2QRKA 4A73A 4YJ2B 1BAPA 1CZRA 3DV2A 1Y7HA 2EC5A 1JKIA 3NJRA 4TYWA 1E4VA 2WSSD 2J8ZA 2QYSA 3G2NA 1Z5WA 3B60A 2K7ZA 1OZGA 2NW6A 4ZYTA 2HAEA 5KWVA 3H8SA 1B8OA 5HE9A 4HTAA 4AJOA 4EFMA 3T1QA 1Q74A 3A0RB 4JEUA 4J43A 4LBWA 2EBWA 4QEKA 4X3PA 1XAIA 3ZJTA 3KUDA 1R0CA 2AF4C 3F6BX 3RC3A 1FQJA 3L7LA 5AJVB 3OQIB 4FXPA 1HBJA 3A1CA 1JEQB 3R7NA 3I39X 4X95A 2VR1A 4CIXA 2JKVA 2DWQA 5ALLA 3WB2A 4M8IA 2QRJA 3LA8A 1JT9A 1OREA 3AOGA 3GVHA 5DYWA 4D74A 4EVSA 1SQ5A 1YIOA 3CRRA 3TZLA 4YV7A 2FR1A 4N65A 2CDCA 5B1YA 3AJRA 5DX1A 1PJSA 4U63A 4P4SA 4RACA 4C7BA 2AI1A 2PX4A 4JEIA 1L3BA 3ED5A 2DTXA 1RRFA 2Y1DA 4MPJA 1ZMXA 1QOQB 2FR8A 3BL5A 5EJ7A 4BVGA 4O6VA 3EZNA 4OA5A 5AJYA 4EF6A 5IMBA 1UOEA 4FHEA 3U37A 1HSZA 4LV6A 6CHYA 1FZTA 2J3JA 2NPOA 3KHKA 1J39A 3KDPA 5I7EA 1Y0BA 2GLXA 1XZAA 2Z5VA 2YWGA 4GOXA 1LTKA 5JY6A 4F12A 1IEVA 3B9RA 1T9HA 2X3YA 1YZNA 1IJEA 2HN9A 2XTJA 5LMNB 1WZ2A 2G1PA 5FTWA 2O3RA 2R60A 3IH5A 3PFCA 1FMCA 2YWRA 5JROA 2XCRB 1VMIA 1R12A 1RDFA 5FUYA 2WR8A 4M49A 3ZDXB 1VPTA 4DUYB 3HJAA 3H1GA 1Y9EA 1GEGA 3GR6A 3RUEA 3ZCXA 2PTQA 3MCWA 3KETA 4J1TC 5EKUA 4LHSA 5BOVA 5AK3A 3KJGA 3E48A 3VSCA 3VC3A 1OTHA 1TUIA 4BCBA 4UOEA 2WD9A 4MK4A 5CJ2A 5LYJF 3UJCA 1AQYA 2EX1A 2OA0A 4JLSA 1DE0A 3JTMA 4L8WB 4LW8A 4L73A 5G0VA 4UU7A 5HF8A 2IV2X 1BWSA 1NBAA 3GMSA 1ZC4A 4WLVA 3LXMA 4MDHA 4UAVA 3DDZX 4UUQA 4B46A 1KH3A 3NBAA 4TMXA 2DBQA 5EP1A 1FLVA 2NYVA 2RBGA 1J9EA 2VRBA 9GPBA 4RH3A 2HUPA 5REQA 1LVGA 2PYZA 1C2TA 2HRBA 5I9TA 3BXHA 2VXBA 3CJRA 1WABA 4URZR 3JARB 3M1LA 3PPVA 2CXQA 2W6QA 2GAFA 1SVKA 1GQFA 3D4LA 3TIXB 3X0DA 4Z7JA 1QCDA 1GZVA 1VIVA 4NLLA 1HETA 2RGGA 1YRWA 3U31A 2WF9A 1PAUA 3TSWA 2I80A 6Q21A 2H2GA 3HP4A 1O97D 2JIMA 3QEKA 3UOAB 2AOXA 5DV9A 3VYUB 1O08A 5ANRB 4UFOA 1HDCA 4QAJA 1SCUB 4IJWA 5P8WA 2KB0A 2R7NA 4KOEC 5ERXA 3RBZA 4BLOA 4AMZA 1PDVA 1FU4A 2VUHB 3DLCA 1X0XA 2P2NA 1FFHA 2XUJA 4IY1A 4B34A 1GZHB 4YMVA 5BWMA 1OH6A 2DEUA 2AEMA 3O21A 3J7AC 2GBLC 4LK2A 1WMBA 2FZLA 4KQ9A 4NWIA 3HWWA 3CLRD 2WTAA 1TKAA 1Z45A 1T1GA 3GGSA 3O3NB 4FKZA 1Q77A 4KQKA 3TQSA 5GADl 2XNDA 4OX9B 3WAJA 1ID8A 1M7GA 1PCXA 1JIUA 2HEGA 4GEKA 1MIHA 4NOLA 4OP2A 3QBDA 1ZEMA 3OZUA 3P9KA 1GKYA 3R0XA 2WTNA 5C37A 4DQVA 2NP6A 4YMLA 3WMRA 4TMZA 4HQ6A 4MLZA 1Q1QA 1YQTA 5ALKA 4MDEA 5DNVA 3ZY6A 1LSSA 3FMFA 1KZYC 1PFKA 1V0JA 4QODA 1LF5A 1CR1A 1SIWA 1NMYA 3FPKA 4PTZA 3EYWA 5CDGA 1NBEA 3ZE7A 2FRDA 4UCFA 1JDNA 3K0SA 2J7PD 3HBJA 1UOPA 4DCNA 2FPUA 2Q8PA 3L1JA 3AW8A 4G23A 1CUAA 3NI2A 3UB4A 3RC8A 2WT4A 1T5SA 3EPRA 5DHSA 3LWBA 1KJYA 2JIRA 5C5EA 2XGOA 4LF4B 1OA0A 4OHFA 2X8JA 5LQJA 1CY6A 2BFOA 2EU8A 2VPZA 3TW0A 4F71A 1U11A 4PN7A 2IPNA 4XX1A 5JASA 3R5XA 2GZSA 5HZGA 2FZWA 5FTMA 5TVGA 2QD5A 2HH9A 1OYOA 3P9IA 2R84A 4FHGA 4LDQA 4O1HA 3UOWA 1G21E 5B3JA 4RVGA 1AJEA 4RW0A 4F2WA 2ZUTA 5IT5A 5E3IA 3RUIA 1HLDA 1O6ZA 2GPWA 2OOKA 4ALKA 3JQDA 4DCJA 5IDVA 1GR1A 1O4WA 3FRHA 5DSTA 2OAP1 2PKQP 2QQ0A 4DA8A 2VK2A 4ENUA 3I9LA 1W5FA 3LMKA 4GYKA 4ID9A 3G9ZA 3REQA 2A1IA 4Z1MD 1CUZA 4U2CA 3P2JA 1GDHA 2G9ZA 1FX1A 2QZ4A 4PYRA 3VDQA 2HK8A 5ER9A 1P0QA 2WYVA 1GL9B 3HCBA 2OBLA 3D2AA 4KLZA 4ZYLA 2PRKA 1B1CA 3EDOA 3S7ZA 2YC4C 4ARVA 4S2UA 5JALA 1I36A 3PVSA 1VBMA 3GRFA 4UM7A 1S02A 2E4VA 4D44A 5A4AA 2N0SA 1N2OA 2Z43A 5ALYA 3UH0A 4D0RA 1YR2A 3DZKA 3A10A 4GVLA 3GT0A 1HE2A 1YS1X 1AK1A 1GZUA 2D0IA 3KSRA 1JIKA 1SPBS 2JASA 1RSZA 3L02A 3DL2A 3GJQA 3O8QA 4KYIB 2Z3ZA 3TH5A 2ZS9A 4TS1A 2FEXA 4YAOA 1TB4A 2G80A 2VEDA 4QQFA 4X54A 4EI2A 1SZJG 1Y1QA 4QRIA 1GKKA 1NJFA 2J9FA 2POQX 2QE7A 1ZIDA 2QN2A 2YV3A 2D5IA 4YI3A 1SH7A 4KQXA 5HIMA 4UHKA 1F8GA 2OORA 2C9YA 1ZJWA 1THGA 3AI2A 3DXYA 2QROA 3LE8A 4QYSA 1EXNA 4S3MA 3SYLA 4JVOA 4MKIA 4FUQA 2SCUB 2OQ2A 2BJWA 4UUPA 1RXYA 1WD5A 4AICA 3AR8A 5C53B 2J4FA 3AFIA 4F7DA 1LVHA 1FYEA 2AL7A 1T5DX 1H0SA 5DGHA 5J2TA 4XW2A 3F73A 3ET5A 1LDNA 4U9UA 4M7RA 3G0CA 2PKCA 3FMGA 1Z3IX 5D85A 1KMIY 1XRLA 3JAKB 3LXXA 3ZD8A 2WTUA 1Y6QA 4QUEA 2ZIUB 5E4FA 4ER5A 3N39C 4OBXA 1LCIA 1R0SA 1RWBA 2R6CA 4QUHA 5JNTA 1N1GA 3DSRA 4QDZA 5EIOA 2QPLA 3MIZA 5KTNA 2JIBA 2ZYIA 3L8HA 1YQQA 1NM5C 3S2YA 5L3QA 2C2GA 3F3KA 4NV0A 3ROZA 5JVDA 4XQGA 4FT2A 2C1EA 3C3MA 1BFUA 3C3EA 3ZGVA 1NJ8A 1SUSA 3J81A 1F2DA 3NGXA 1SXGA 1YQXA 2C3YA 4O2AF 1W5BA 5KVAA 2WNHA 3A37A 2NZUG 4HLNA 4P0TA 5D3QA 4C0QC 1N5DA 5E6RB 5C80A 3H7IA 3IXQA 4L5AA 4RK4A 2Q4EA 1AQJA 5SZKB 3TSAA 2TMYA 2D27A 1W87A 5I47A 1MVLA 2W2OA 1UDCA 3LECA 1AUOA 3G0BA 1PKEA 1SWVA 3HV0A 1D03A 2GM4A 5DTRA 2JJMA 3L79A 4FTWA 3M3HA 1B2RA 2AMYA 3NKFA 4PHCA 3ZVKA 4E5PA 1MVOA 1Z4PX 1ISPA 3A7EA 2ZETA 3C24A 4MINA 4ZPJA 1OXTA 3DZDA 5JSFA 1MC8A 1RAEA 5BOSB 2X7HA 1MX3A 5B7QA 3DONA 2OBYA 3HA5A 1I2BA 2DXIA 5CIWA 4RIEA 1WSAA 1J1IA 1HOXA 4NMHA 2O0HA 1E6WA 4KITB 2GRJA 2JRCA 2WIJA 1XQ1A 4Y9SA 2BP7A 2FPSA 1P9RA 5A3VA 4EGSA 2P8JA 1A9QA 1U8YA 3GJXC 2XNJA 3HCCA 4IS2A 4DR7B 2RGEA 1YKSA 5IKXA 2C9BA 2VWPA 1P81A 3M4YA 4MLCA 1X7XA 2Y27A 4YALA 2BMDA 5T6MA 2X5KO 4QGHA 5EZ6B 3VM6A 3BSYA 1JEOA 3PT9A 2Y8EA 2A0XA 5BNTA 5F4ZA 3V6LA 1JPVA 3OFND 5M34A 4EY8A 1AA6A 2YWCA 2PZLA 3BHJA 3EARA 1KO5A 2H6EA 1U8CB 1UPTA 4IDGA 2AN1A 3K6JA 5J40A 1QPGA 3FRIA 3G17A 4E4YA 1JQBA 3OTOB 2AUTA 3GRPA 2C29D 1AZLA 2EOAA 2YICA 3JQ7A 4MKGA 4RSGA 3P9ZA 4DV3B 4J7CA 2K5UA 4W9NA 3KKOA 1M7BA 3DV0B 3GFRA 3MGCA 5AKZA 4D4JA 3A2LA 2PUDA 3LUBA 5AJTA 2PA3A 2XOEA 3LLCA 3RF6A 2V59A 1AD2A 1N77A 1GQ2A 3E7XA 2GXQA 2JIPA 4LYGA 1QCYA 3IEUA 4OH7A 4KLNA 5HZHA 4MEJA 3C74A 2GCGA 2R44A 3PQ4A 4H0FA 1DBIA 1UC9A 4P34A 3UJDA 5JIBA 2VFAA 3K05A 4IHQA 4EVQA 4DYDA 3AYXB 4NV3A 1X14A 1A9XA 4BRUA 1DJLA 5CVDA 1JPNA 3L43A 2D0DA 4OMDA 1VGQA 5AK6A 3KLOA 3CVJA 4FGSA 1VOTA 3OJLA 4IHJF 5HS6A 4D9CA 3BSSA 3LPDA 2XNHA 1RKVA 3OH8A 4REQA 1V1MA 3PGXA 1FU8A 5KNDH 1QANA 1DT5A 2VRWA 1Z0ZA 3GRUA 4FDUA 4JITA 4QULA 1P5RA 2ZYVX 3FPBA 3IKJA 4Z9AA 5TGZA 1BS1A 1DIAA 1Y7TA 1Y98A 3QJYA 3V00A 4KG7A 3LCRA 2JGAA 1VL2A 3DFZA 2Q5HA 1J0XO 2XTAA 4DDMA 5FI3A 3ZHTA 4FSXA 4DSOA 5HIJA 2X5OA 5C4MA 2X5NA 3IOYA 4JVMA 3GUZA 3W9SA 3DWGA 3HWSA 1AIPA 3F2VA 3QPCA 4HFRA 5EYPB 3TXAA 1XO1A 3Q3EA 3ORRA 1R8XA 3OF2A 1DFHA 3I42A 3FB4A 4NMMA 4FK8A 2E4AA 2JATA 1CK4A 3NVAA 1Z15A 2GARA 4FX2A 1VHWA 3P19A 4I1OA 4IILA 4KAJA 2YOHA 3LA6A 2R4UA 4MWCA 4HV4A 2VNAA 3GEHA 5IVPA 2VUIB 1J99A 4XDZA 2QS9A 3GNTA 2HU7A 2JBWA 4Y2HA 1E1RD 2NYAA 5I8PA 4A27A 4UPEA 4NK5A 1RCUA 3KYBA 4Q9JA 3B70A 3W06A 5JZOA 1EVKA 1T9BA 1QGOA 1XU4A 4JXXA 3MTJA 1MDBA 2GFQA 5D3MA 4X92A 4KR2A 4OY3A 4DJFC 5G4LA 1MHTA 1DRVA 4D8TA 2ECPA 5FQNA 5CRIA 1M67A 3H9JA 3QXJA 1UWKA 2VLBA 1KS2A 2WPNA 2ZRMA 3OQJA 1CZHA 4FEGA 4MRMB 3QX8A 4B2LA 4B3IA 3ZJUA 4G0OA 3TX2A 3GPLA 4FZ5A 4QX6A 4N0PA 1YSCA 2XB2A 4YVFA 1CQWA 1KE2A 5DMHA 2RH4A 1R0XA 4E5VA 2FP3A 2MINB 3EGXA 4QE3A 1BVRA 1OH5A 4O4LB 3G02A 4XIJA 4RM3A 4RK7A 2R8EA 2I3DA 1ECCA 1YCDA 3IUQA 4BJHB 5CFNA 4BFUA 4I1YA 3P0EA 2J7PA 3TL2A 1FLNA 3KZXA 1YB1A 1X0VA 2CDNA 2Z2YA 2R97A 3ZY4A 3IS3A 3GZHA 1VHLA 4TWBA 4QBIA 4EPRA 1EVYA 3DYBA 4H4CA 4R9NA 5G4KA 1QTNA 3OP1A 3O3OB 4HX5A 2QE6A 1QAMA 1LDBA 2OZKA 5GVSA 4K9RA 5K3DA 1AO0A 4CUZA 3EHEA 4J2OA 1PR9A 1GVNB 1HXHA 4D41A 4KLAA 3PGA1 4WFIA 1M2WA 4XCXA 3LIPA 3DAPA 4QJ4A 5G3ZA 1R0YA 1ZJ6A 3CN9A 4KN5A 1E6UA 4OQMA 2Q0XA 1WMEA 1EWKA 5B36A 1FTSA 5JISA 2QIOA 1FLAA 3WMFA 2DFTA 3FJOA 1SXJB 2RKOA 2F43A 3Q88A 4KRGA 5AM5A 3TF5A 3EA0A 3LOUA 1E1CA 1RXSA 2WP8J 1OBCA 2QNBA 1SCDA 4Z1MA 2EX0A 3ZZ0A 1PK8A 3O31A 1DZIA 4PGGA 4IWNA 5BSGA 5CDFE 4BDSA 5IF3A 4G2TA 3NW9A 2Q3MA 1EFKA 1FS6A 4KBFA 1G8FA 3AKZA 3DFFA 3I1JA 5YASA 3PC2A 2WWWA 4HR7A 5ADVA 3NGLA 3JSXA 4LNAA 3T7TA 3V7FA 1NT4A 3TINA 3TRJA 2WAAA 2ZVDA 4P0QB 1NSFA 2IEZA 4A0FA 4PSUA 1WS6A 4IH1A 4EEZA 4F3TA 1I10A 4IP0A 2G5CA 3W2FA 4BE7B 4E2WA 2PD6A 3U1VA 3PDIB 3VYTB 2VO1A 4JVNA 5M5BA 4K9SA 4H1HA 3EBPA 5DGIA 4E1VA 4NYMR 2O6LA 3D02A 3O84A 2GXAA 2PGLA 2XHZA 4YTEA 2YJ4A 1T0JB 1PSWA 1WU8A 3KB8A 3LHDA 4M7PA 3A4IA 1ZCFA 3O2NA 4RL4A 4TLCA 5AVJA 5LXTF 2N42A 4AI6A 2CVPA 4JH0A 5EMLA 3DDUA 2BZSA 4YJFB 3KC2A 3H5VA 3COZA 3ANMA 1XLTC 5BVGA 2RC5A 1UANA 3M2TA 1YA4A 3GCDA 3IJEB 5DGCA 3DP7A 2CYAA 1FTQA 5AVYA 1FJGB 2QPAA 4NAHA 1MQ9A 2BBWA 2RDMA 3PC6A 3K9QO 2Q7XA 3GGDA 3L6EA 4OK5A 5BURA 4KNVA 2VP4A 4DQUA 5H1YA 4CF6A 2AWOA 3OLZA 4ZVMA 2A9FA 3QVLA 1R4ZA 3DVAA 1BH2A 2DU8A 5H0IA 3ZLUA 1JIQA 2EDAA 3KEFA 1SCIA 3KHTA 1VKZA 1WUYA 1RM4A 2OC4A 3LPMA 3DAOA 3LT0A 2VZEA 3LVBA 3Q85A 5EPEA 4URFA 4BNZA 2YQ5A 3WB0A 1GTJ1 1YR6A 4E21A 3E7PA 5SICE 5BUZA 1JQLB 3A6FA 5G1OA 2AR0A 3RNOA 4WN9B 3U9TA 4MZDA 4M36A 3R7WA 2VNJA 2K4MA 2OV4A 2CLDX 3GJ5A 4I08A 2Q0QA 4FDMA 1IJKA 1A72A 2XF2A 4OJQA 5CLIA 4ZOEA 1JWAB 4QASA 5KYUA 2AKAB 2PD3A 2H2IA 3HBAA 3IKLA 5DGDA 2R85A 2HK9A 1J00A 3G1TA 3GIDA 3GLUA 3UK0A 4CFSA 2BC9A 3O0TA 4GXTA 1Y4DE 4ME6A 1K2VN 4QPCA 1SKYE 1TJ3A 3O83A 4UEJA 5JPCA 3WL7A 3E84A 4ZK6A 4PS0A 4L5JA 5HNKA 1EDOA 3FPLA 3EGCA 1OOEA 1NASA 1X1DA 2OG2A 4DLNA 1EX1A 2QD3A 2I4RA 2RK3A 3BKWA 4BQIA 1M0WA 1T5IA 2JFYA 1E9RA 1WMFA 1ACLA 2H31A 2VK4A 3OHMA 3PFIA 2J0UB 3TIFA 1LWOA 3ORQA 3PNLA 4L95C 2BEVB 3DJFA 4D3DA 5K0ZA 2YHAA 3SX0A 1E18A 4AJPA 4HGVA 4BYMA 1T6BY 2HQ1A 1DP4A 4DJ5X 1G18A 1YBHA 2D1SA 1JR3D 1M54A 3ML1A 5AT1A 4Z3OA 4DPMA 2ZT8A 4C4OA 4Q39A 1QE3A 2FK7A 1JDUA 1P2SA 1S2IA 4LDAA 1VYUA 5K0SA 3I61A 3RE1A 4C4YA 1PW5A 3R3VA 4BEJA 3EIWA 3WWDA 4LRTB 1XAJA 1YZ3A 1VPDA 4G97A 5BQXA 4MR8B 1YCHA 2ZXUA 3S2UA 2ZZNA 4OLAA 2ZTLA 3RASA 4F4HA 3TQFA 4EY7A 1PQWA 1XVLA 4KFSA 3KAJA 5IDXA 3OFNA 1RXEA 3HFJA 1JLKA 1T1RA 1JJVA 3L6UA 1D04A 4J7UA 5CNKA 4F4JA 3ACBA 3FPJA 3R0IA 1ZRHA 1KKLA 5AW2A 1B00A 3RVMA 2FFAA 4G6ZA 2VJPA 4QTZA 4YRTA 4ZYUA 3MTEA 4HXYA 1E3WB 2NPFA 3WP0A 4UTRA 4PXYA 1O95C 5BV2P 3S2GA 4PZ9A 5LUAA 1UM9B 3M4JA 3FIJA 5GV7A 2J9XB 2PXHA 1NURA 3IUJA 2YBEA 4LFBB 2EL7A 1QRUA 4MIOA 1ZGHA 3IQIX 4JP1A 1V5EA 4YWJA 4WNYA 4BLTA 4DT1A 1ECLA 2G40A 4AG3A 1KEVA 1CJVC 4OFWA 3AR5A 2CLFB 3NEJA 2OWDA 3L0ZA 1VDKA 3WL5A 1IZ8A 2OOSA 1C30B 2WMDA 3F96A 3LY8A 1NFRA 3RS2A 1XPJA 2FYTA 3AETB 3FCEA 4RA9B 4ZXPA 5C51B 1XF9A 4DLZA 2H06A 3VYSB 2VBIA 3IP3A 2QTTA 3R5SA 3BXOA 3JATA 1D2NA 1N0WA 1VLVA 1CJSA 4A0QA 1PSDA 3HDHA 5TQ2B 5U4XA 3ONVA 4CLXA 2HMYB 5DYIA 1KY3A 3ADKA 3FD8A 2ODAA 3OUZA 4I8XA 3PZRA 5AKGA 4B3HA 4ZQBA 4JOCA 2AMLA 1TRHA 4ZEOA 1Z7EA 4FYKA 1HQKA 4LNUA 2VSXA 3M34A 1PZNA 3EMDA 4K05A 5GONB 4E3ZA 1N9GB 2FPIA 2WIAA 4W5QA 3BJIC 1LBQA 3WZMA 2ZJOA 1GT91 3E9YA 1NW3A 1TDJA 3VVBA 3D8RA 3F4LA 3OPYI 1EMDA 1ADCA 1H2XA 4FMDB 4MV8A 3RYIB 4GR5A 1I3NA 2Q3HA 2P9FA 1IIBA 3ZWYA 3CA8A 1VGRA 4Q4JA 2JA2A 4XIFA 1II8A 4S0ZA 4WOCA 4BUCA 3F7TA 4FGLA 1E2PA 2HL6A 3FKJA 2NO6A 1B6GA 1AT1A 5BNFA 3OZFA 1E1RA 4YJHB 4OSPA 2W5UA 3S81A 1LEHA 2QPOA 4B5KA 2EFJA 5PGMA 2OPBA 2CZGA 4HGZA 3RVKA 3FVWA 4DM3A 1TL7C 3DXZA 1L6IA 1L5LA 2X6QA 1S7GA 1X2BA 4YJGA 3E4CA 4WOJA 3L7DA 2XDQA 1TJYA 2II6A 2IPMA 1HM5A 3E7DA 5FRDA 4NBSA 2GUGA 1I8TA 4KPGA 4US0R 5BN4B 1G1AA 2ISCA 4F3CA 5L9AA 3V8VA 2YIDA 5HBGA 1X1BA 2QX4A 3LF2A 5A0VA 3CU5A 3M70A 1UP4A 4URVR 4RGVA 2QUKA 4DLSA 2VKTA 1K5HA 1SXIA 2ZBQA 1S1MA 3U4MA 1SZDA 2WG2A 2H1FA 2XUZA 1N33B 4EMBA 4BQOA 5KCZA 2GILA 5CT5A 2QVXX 1WDKA 3B7PA 5E4TA 4RDIA 2YR0A 5EHGA 4P4UA 5JBNA 4OQDA 2XVXA 4OXNA 5FKJA 2VJAA 4FIZA 1QX3A 1BX3A 3GBPA 2FPKA 4TSRA 3HKCA 1Z4QA 1IW7D 1UBTS 3CVWA 3CRMA 3M6XA 2ZJ8A 4YCSA 3OZCA 3ZTTA 4OQLA 4RWEA 3T0GA 2XMDA 3IODA 2ZI9A 4JSTA 1T3TA 2AOTB 2YHIA 4CLOA 2P5YA 1U7DA 4L8FA 3RKUA 1UAGA 4KPUB 4X94A 4XRGA 4FCTA 1U3VA 1TGVA 5SY9A 2VF7A 3RSGA 4PZPA 2B2CA 1GXSA 4NNOA 2QTCA 3OFSA 3ZWVA 3B1ZA 3DE2X 3LLUA 4F92B 4YMGA 2BTEA 1EJ6A 1YVEI 3WZ2A 2QTVB 4I55F 4A1OA 1FFXB 2HJWA 2Z8XA 3Q2KA 4XWGA 1C3LA 4MS4A 4Q48A 3R8CA 4FW8A 4IIVA 3O3CA 1L7QA 2M9MA 3R6LA 4I1UA 3WRXC 3EXAA 2CJYA 3ZE9A 4KFCA 2BR4A 5CT6A 2AD1A 2OCPA 4WW0A 3IO5A 2CJWB 3FRJA 3UENA 5DWDA 5BW8A 2NGRA 3WYNA 4JEHA 2GNPA 5KPJA 3HYCA 4AG5A 3ESBA 4PTLA 1I2MA 4YAWA 3SMQA 1IMOA 2JIDA 3OIVA 3T5GA 3FI0A 3KE8A 1DJPA 1G20E 3AOEC 1MQSA 5JNRA 4RTOA 4A8JB 4PG4A 3OJFA 1ZHHA 2TECE 3EZLA 4DV7B 2DR0A 3QVOA 3A4VA 3G9UA 5JSHA 3UMSA 4MROA 3UIEA 4LYJA 1KSHA 1IONA 1QYWA 1VL6A 2OGTA 2WFLA 2ZREA 3DZ8A 3TZKA 2RARA 4M86A 4DIMA 1N2GA 4OU5A 4KLRA 4PSAA 2I6FA 4LRUA 5F3RA 3PWKA 3K71B 3BFPA 4RTNA 3DHEA 5I8WA 3E3LA 3AVUA 4UEOA 3BWYA 2O8CA 4LG1A 4NBUA 4BEBA 1GUZA 2XSZD 1WJGA 1YONA 3BS4A 3P45A 4DLUA 4RE5A 1P5FA 2VXOA 3OPMA 4U8HA 3WX0A 3JWJA 1Y7LA 5EL0A 4PYNA 4R8VA 1W47A 2VTDA 1U2PA 3OBBA 2IYLD 2Q21A 3AL3A 3EIQA 2V74B 3AEYA 3NIGB 1H1LB 2WBLC 5U4QA 4LY3A 4PZYA 1EFCA 3T4UA 1HRDA 3P32A 4YBZA 2R62A 4DCMA 3C3YA 2J0QA 4QM6A 5BN5B 3ZEIA 1NE7A 3AQIA 3KEQA 1BXZA 1SIBE 3VO8A 1PQ4A 3FZQA 1M2NA 4J75A 1RAFA 1VCNA 3EYAA 4F3NA 4MS3A 1NF3A 1IZ9A 1CVIA 1TRKA 4U3JB 5A2GA 5FA6A 4XPIB 1V48A 1G3UA 4NRDA 5KTOA 2PRJA 2HA7A 3BXEA 1BGXT 2O2SA 2KWIA 1PD0A 3VBEA 2CXNA 4MYSA 3T7SA 3ZU4A 1PWZA 4JELA 5B12A 3E9DA 3HN2A 2EJWA 1NLZA 2Z2XA 2R7MA 5DF1A 4QXOA 3TLJA 5IUJC 2PE5A 4D7AA 2G6TA 4ADMA 1ISFA 1PDOA 1ZUNB 4FEYA 1GSOA 4ZOLB 1ZJYA 3D4BA 1M5UA 4L3VA 1PZHA 3SZLA 1KYWA 3V46A 5TEWA 1UMCB 2GM3A 2R47A 5EQDA 2P35A 4MKHA 1UZLA 5BNZA 4YMIA 4ZCLA 4YRBA 4DMGA 4WEOA 2VDQB 2VPWA 4UEQA 1RCTE 4JOSA 2LCIA 3RLFA 4CEJA 2PLRA 2GN4A 3UAXA 1GEEA 3C6BA 4CKWB 2TMKA 4QXPA 5CFOA 3URMA 2EG5A 3CCBA 3H5AA 3MERA 3N7UA 1UKBA 1JMYA 1A8QA 1DG9A 1N75A 1S5PA 1TJ7A 1X7ZA 2PQ2A 3NONA 3DG9A 4QZVA 1JR3A 2O3JA 1F60A 4S1OA 1WU7A 2C03A 2YXLA 2Z4RA 1FRNA 1FP2A 1ZK1A 3CZ9A 3MTDA 5IC6A 4BNMA 1LQTA 2ZPTX 3H8JA 3EEYA 1Z74A 5HTKA 1W35A 1CVLA 4WUTA 1HORA 1SWWA 2JHGA 5AK0A 2YYYA 3DFMA 3FMVA 3KALA 2OHHA 2G76A 3R9KA 2E85A 4PC2A 2HDHA 3VR3D 4RH1A 5AHOA 1PNQA 1VG8A 1C4XA 1YI8A 2P1DA 2BE7A 1AN0A 2PVPA 5KTYA 1DCKA 2G0AA 4FZVA 1OIVA 1RAHA 2PFSA 3LYAA 3S1AB 1CDDA 4YH1A 3B1VA 4RJ2A 4W5RA 2GCEA 4RKEA 1Z6TA 2QRNA 5FAXA 4BVKA 3LHIA 3DA8A 4H1UA 4F2PA 3AFNA 1PJRA 1NZDA 1PEKE 2PRYA 3EXFA 3CLKA 4M54A 4GKAA 3CUUA 3OX1A 4Q9LA 2B35A 1A2OA 3ZDYB 1HR0B 3KTDA 3MYRA 2RH5A 5FWNA 2VDJA 1J9ZA 4IBOA 3CZPA 2IEYA 4G5HA 3JQAB 3QFRA 3BMQA 3THSA 3UHFA 5HX7A 2OQRA 4OAQA 1NDUA 1RNLA 2H18A 1KR5A 3TM5A 5CU7A 2VAPA 2YWHA 2PSEA 1OCEA 1P1JA 2BI4A 3ZCQA 4C14A 1ZQ9A 1DIOB 3RBXA 1D9XA 4QG3A 1QDUA 3ZHCA 4UZSA 2NYUA 3D3WA 4FKMA 3OC6A 5EXSA 4PNEA 1OXVA 1OZ0A 2VHWA 1DBSA 1RE0A 2CEAA 3G1WA 2LNDA 3L1IA 4MVJE 4YGXB 5HDBB 1U81A 2PEYA 2PKWA 3KKMA 3K70B 1UOOA 2Q1YA 2O8FA 4PLPA 2OCGA 4OI2A 4CEHB 1IBRA 1L5YA 4BBZA 3IIKA 3BGWA 4ZGBA 4Z4GA 3PA8A 2WJAA 3I2IA 1CY0A 3RU9A 3W9YA 3CTMA 4MJLA 3KM0A 4HRYA 4IUDS 3AR3A 3LRXA 1T9KA 1XEAA 3NP7A 4PBRA 5FLKA 5AW6A 1M5RA 3BD8A 3QNWA 3NLLA 3OOJA 4MA0A 3O94A 3F7MA 1Z5NA 4P83A 3PCXA 1KHTA 4ZEXA 3IHLA 5C8XA 3EGWA 1GA1A 2YN4A 3F7NA 3VC7A 1P62B 1SXHA 1H2BA 1KI3A 4ZO4A 1W4ZA 3A6EA 3KOOA 1FFAA 1SQSA 4EO9A 4BQFA 2PZGA 2CB0A 4B3FX 2XLBA 1UDBA 1WVIA 3TPFA 1GGMA 4RD6A 1P61B 1X70A 1JDSA 3AVXA 1SU6A 2VCYA 3Q1KA 4AY3A 3LKZA 4H59A 2JFWA 2R11A 3PNPA 3U3DA 4E30A 3VR4H 3EOBI 3PL5A 3H9EO 5AQ1A 5KVSA 1P6QA 4LSWA 1NSYA 4UHFA 2BZ0A 3KZMA 4YRLA 4XIIA 2A0YA 1LZLA 3IURA 4ZZ3A 1YTUA 3COWA 2X9QA 4NFSA 2X0DA 3I4FA 2CUKA 2W4MA 3CY6A 2VQEB 3LWZA 3NASA 3B6IA 3INGA 2IVZA 1I9CA 2YX1A 2X9NA 2VHVA 3BQMB 4CWAA 1L7AA 4UNNA 5DVZA 4EYSA 5DLYA 1VCIA 2E0IA 1JLLB 4EUNA 1L5WA 1WETA 1Z8FA 1HT2E 2GHRA 4IOKA 1DAOA 2OHOA 1TUGA 5IABA 3VISA 3ABZA 2PX3A 2IHNA 1UWCA 2YJTD 5EC8A 3ROEA 4MI9A 3Q1LA 2JK0A 2AZXA 2H1HA 4S1NA 1YU6A 3JVDA 1IN4A 1JIJA 1RAGA 2DWUA 4N8DA 1E9BA 5TV2A 5AW1A 3C14C 3DWFA 1QFMA 1OFVA 3PQFA 1ZXLA 4XJTA 2E7ZA 2CVQA 3HLKA 2DP4E 4FNAA 4V2UA 4R3NA 2JFZA 4R2WA 5LYJA 4KGZA 5L3SA 3FOEC 4O4HB 2QORA 2WHYA 4BX0A 1E5VA 5AW9A 2BHSA 1ZOPA 3D9QX 2CVOA 3PUZA 2W4QA 1WQ4A 1UJ5A 2R8RA 5B1HA 1R8JA 3DV9A 3GRRA 3I0NA 4LHVA 2WKSA 2YXPX 4CV2A 3DD5A 5TS3A 2QHXA 5LBTA 4X91A 4D8WA 3UW1A 4RZXA 2ZM6B 4BQSA 4HBZA 1H1TA 5DLPA 3HR7A 4FW9A 4G1FA 5EFZA 4C5CA 6REQA 3JD2A 1DRKA 3RHSA 4BQEA 1JHPA 3IEIA 4ZAXA 5BSKA 2PVCA 1MT0A 1I4LD 3E8XA 1DMSA 4XARA 4C4TA 2FZEA 2XI4A 3GJSA 3BWVA 1CQZA 3KR2A 4KEAA 4M60A 1CUEA 4X1IB 4CTKA 5JXHA 2AMFA 2DFPA 3BB3A 1GD1O 2GCNA 2EKDA 2IPAB 4PZ0A 5FOSA 3K72B 3ZKWB 721PA 2OILA 2ZBUA 2CBZA 1BHJA 4PZUA 5KYYA 4RM2A 2Q49A 5JS8A 1GIAA 1W5SA 3W5VA 3WGGA 3ZZTA 5LOVB 4HN9A 5AXDA 2AC7A 1F7VA 3FGPA 5DISB 4YAIA 2Q1SA 3SSNA 1I80A 5J2UF 5JSZB 1Y8RB 3NG1A 4R05A 2VA9A 4MQFA 3DKVA 1K27A 1HTTA 2J08A 3ERCA 2OFWA 2XQIA 3FHOA 3TLGB 3WLJA 4ETMA 3C5WP 6YASA 4EECA 4FC6A 2JGRA 4M0MA 4XOUA 3UGQA 2YDYA 3NVKI 3IV6A 4YDQA 3QVWA 1JFTA 1J2RA 3M49A 4MLDA 3VJKA 2AUMA 3TZEA 2XSZA 3EQ2A 4UVDA 4F21A 5F92A 1RKXA 3FJYA 1L4FA 3DKIA 2PFKA 3GJTA 3IPAA 1LK5A 4LBYA 1ATZA 1UL1X 3PNBA 5DNWA 2ZVQX 3SHVA 3VNAA 4AQDA 2CFTA 3EBOA 1K8QA 2QSZA 5CB8A 1EJ2A 5JNWA 1NRIA 1O5IA 2ILVA 4UD6A 3VZPA 4AZ0A 3H0CA 3PUWA 3KQTA 3IE0A 1ZW6A 2G4LA 3DTNA 3DAHA 2RJ3A 4RTRA 2XT0A 1ZAKA 1QAQA 1PFUA 1Y4UA 4KXMA 1M8KA 2O8DA 5BMVF 2WJHA 5EHQA 1O6FA 3PQ6A 3FYUC 4V0SA 5HPYB 4MGHA 4KKVA 5JS1A 2AJ8A 2QVGA 1N7JA 1R9NA 3G5UA 3UJ6A 5BR8B 1CSEE 1MGPA 4OJNA 3NNNA 1WOYA 3EUEA 5EESA 2WHEA 3W79A 3K9HA 4M1WA 3A70A 5AO9A 5KOIA 3ZWMA 2HSWA 5E6UB 2ZJ7A 2KSQA 1QG2A 4M8SA 5BQ3A 2IDKA 4U7PB 3WOVA 1QVWA 421PA 1M6VB 5DO9A 3STWA 4EPVA 2A1TS 3QXHA 4Q9DA 3ZNOA 2RBEA 3MBKA 1YA6A 3RRPA 1NN5A 2QP4A 2MSCB 3SHWA 7REQB 5LLDA 1SBNE 4WA8A 3WB1A 1HE8B 2ZE8A 4UCXA 4LSGA 1E2KA 4TVKA 4AVYA 4BLUA 1UQUA 1Z7BA 2FOIA 2WV9A 3LDFA 3G59A 4U7HA 3ZXIA 3KSDO 3NS7A 1KBZA 2EERA 4R31A 3IP1A 5LMZA 3KNZA 5EIEA 5IF9A 1LJUA 4YT5A 1EP9A 4EBFA 4GQAA 4LCBA 4MWBA 4LISA 4EX7A 4POAA 4WFJA 1KFBB 2Q3JA 2O7SA 2YJZA 1JHQA 2FP4B 2O5VA 4ISBA 4IVQA 5K4GA 1MB0A 1ZD1A 3TMYA 3WK8A 3ILYA 2X0IA 3P4XA 2C4VA 4LMBA 4W5JA 5KAPA 2O1XA 3KUCA 1VP9A 5HCUA 1M1ZA 3MZ0A 4OHMA 3ITNA 2HFJA 3A1SA 4X20A 4EGCB 5C2JB 4WINA 1FNMA 3B1FA 1Z4NA 5TQ0A 3LCUA 4AP5A 2DFNA 3R3JA 2X1LA 3AZPA 3KB6A 3O0DA 4WWHA 3V42A 3ER8A 3T9EA 1XV5A 4MR9B 5LUBA 4MUKA 3Q7PA 4ALJA 2NP7A 1OZFA 1PP4A 1DBQA 1JAIA 2AXNA 1KS9A 1UT6A 1E6CA 2R86A 2V6MA 1Q44A 3ENKA 4YRPA 3B89A 5DM70 1RIFA 5F12A 5KQRA 2E5WA 3IC5A 4LJ5A 1P4HA 3DBOB 4ZI7A 5D84A 4BTLA 4B80A 2J3HA 2O8BA 1Q20A 4KV7A 5HKLA 3VR3A 3M7IA 1AHHA 4EVIA 4ZJYA 2C8LA 4R7ZA 2GTHA 4JT2A 1CDOA 2IYTA 4G0VA 5KYWB 2QD1A 5A7HA 3OZTA 2GYWA 4FN4A 4Y6OA 4LMRA 3UK7A 3H84A 3JSAA 4IWYA 4WKPA 3P96A 1YOVB 3B1YA 3TUZC 2PJZA 2WW8A 4DV5B 2VTBA 5BVHA 5AM2A 1W0CA 2ID9A 4S35A 1RBMA 3ZWPA 4JUBA 1AQ6A 3BUSA 1JZSA 2MJLA 3IUBA 3LC7O 1O6BA 5FBQB 3KAQA 4BECA 2HYIC 3F9RA 2FWNA 5A5GA 3PC3A 2ZUWA 1Z6ZA 3A32A 4AZVA 5IZCC 2WJYA 5J43A 2RCYA 2HM7A 5K6RA 1DBPA 3Q2IA 2IIBA 4UUMA 4WA7A 2G9RA 4RVDA 4JX9A 4WCFB 2HA2A 2HDOA 2WKRA 4G0MA 4R84A 2OPHA 3KQLA 4ZYWA 3U7RA 1ISGA 2XKAA 3ZW8A 1FUYB 3OCUA 2B4KA 3ASYA 3P2MA 4QDOA 3U40A 3PBKA 1R0BA 2GK6A 5F1YA 5FNVF 4LQLA 1RWMA 3G85A 3OI7A 1Z6XA 2BP7B 4C05A 2K7FA 1QH0A 4O2AA 3MINA 4P93A 1B76A 1W75A 1HLFA 4R9SA 3IEXA 2WNSA 2R8OA 2H9IA 1VCHA 1JX6A 1SPXA 2AG5A 3IXMA 1CE8B 4Q9AA 4JU8A 3QYFA 1LTQA 3LQRA 4FYHA 3MXTA 4MVJI 4ZREA 3RJMA 1TUBA 1BMDA 2ACVA 5JWRA 5LMCA 3JQFC 2CMKA 3K9BA 5K0JA 2I8CA 5LKAA 2WHPA 3CX6A 2OR3A 3DZGA 1USIA 4KQJA 3Q7SA 4OGFA 3B12A 1R9JA 4HC4A 4UU0A 3TQHA 3CNBA 4HEJA 4MUGA 4D5GA 4K6GA 4L5BA 3KQOA 3SFZA 3HJTA 3I6QA 3N1UA 2P90A 2ZYTX 4POOA 4M9ZA 1H8HD 1V3TA 2AD5A 4PNZA 4ATNA 3HCOA 1A2QA 1OLUA 2QMUA 1NI4B 1ESCA 2BKXA 3B6EA 5FR2A 1FDIA 1AS3A 2JZOA 3NHYA 4FDTA 4RYLA 4XGQA 5EWLB 4GLOA 5K3BA 5K6AC 3GLFE 2DR2A 5JAQA 1WW3A 5I51A 1CEQA 3Q3IA 3HKEB 3KXLA 4UW9A 3TD9A 3K0KA 1G19A 2RAVA 1KI7A 1SUIA 2C07A 2V9ZA 3RJZA 1EBFA 4WERA 4JLJA 1U2RA 4LJSA 1N32B 2VDPB 1E7WA 1LY1A 4HK4A 3ED1A 4UREA 3OZ7A 4RKWA 3KPUA 3QW2A 3C0KA 4YN3A 4YFYA 4K2HA 1WZUA 3DE1X 1KVQA 2BVNA 3QX9A 3T7EA 3TMKA 3ZXSA 3ER9A 1LC0A 1VKOA 4Q7MB 3TDKA 1L4KA 9ATCA 1Z13A 1SJ9A 1PE0A 5CVJA 3TR5A 1GA6A 1A5AB 5DB4A 1SCAA 2PR2A 5AI6A 4L4SA 1PQPA 4JJEA 2GD6A 4L0DA 4G67A 4QG7A 3NALA 1RE1A 2QTFA 4QRHA 2ZRIA 2CJXA 4XM0A 5D7NA 5TX7A 1RMQA 2UVDA 1PZEA 1Z12A 1D4OA 1OW3B 1T36A 2NT3A 1PVVA 2XYRA 4OB6A 2OQVA 1K98A 3B78A 3CURA 3KLPX 4JXZA 1KO8A 4G36A 3QLUC 2N1BA 3W5SA 3AR9A 1EUQA 2CDBA 2PWZA 1ZR4A 3CXRA 3QG5A 1MJNA 3EE6A 3KJQA 5T4HA 1BX0A 3DUFB 1OX4B 1USKA 5AI8A 3V1KA 2Y0CA 1SVLA 2D1TA 2GD0A 1XTQA 1GZ5A 3KYIB 3OLYA 1XB2A 4IHJA 4JR2A 4MVJM 4X9XA 3HRHA 2DRIA 1GSHA 2JGFA 4M21A 3ESAA 3Q4GA 4KB5A 4QGAA 1KXJA 3V4SA 1JG2A 2EW1A 3LT4A 4LE0A 3K2BA 2QRLA 3EXHA 3FMIA 2WAXA 4G26A 4BFWA 5JMTA 2IHUA 3BWBA 4HWGA 4MVJG 3A58B 1VL1A 3PQDA 1IZYA 2EP7A 2Q41A 1Z2DA 3JRNA 5J63A 4YR7A 2G67A 3DXFA 4AKTA 5CJPA 4DA0A 4DJDC 3W5CA 1NVWQ 2XMGA 1KY4A 1Q5NA 2F59A 1NL3A 3FFTA 4MICA 5LZ9A 1WTCA 1PTKA 3ZBQA 4OGKA 1SC4A 1XR3A 4BLPA 1P5JA 3HZZA 1CDEA 2HNBA 3PDHA 4NLEA 2ZBGA 2IYPA 2FF7A 3MMXA 3WAKA 2QX6A 3EWAA 1UPUA 1T13A 2W4IA 1JILA 3KOMA 1YVDA 2YN0A 3G88A 4K81B 2CJPA 4OIMA 4MEAA 4QA9A 5T4FA 1JJ7A 5IAAA 1OR8A 3VYVA 2VDLB 1YNOA 3WYGA 2ZJBA 3EXG2 1JRLA 1ZC3A 2F48A 3IEMA 1ZUIA 5DCUA 4ZZ1A 2IDJA 4WBSA 3UB2A 1YDMA 1QK3A 3OX4A 2GLUA 3SX2A 2PNFA 4NKRA 3H11A 2AYXA 1SA0B 5KVCA 1AKVA 3ZBUA 3WSVA 3JV7A 4GWLA 5C5CA 2D6FA 1Z0KA 1YR9A 2WJJA 1GG8A 2IQ5A 3RARA 1ICEA 3UCEA 2CGEA 4ND4A 3H19A 1OGIA 4ZU1X 3VUFA 3WJ7A 3RK1A 3RWOA 5EUQB 1GPAA 3DPUA 1Y48E 1GV0A 4O3FA 5FHRA 4EENA 3AK4A 1FNNA 1UBGA 4EG6A 5BPFA 1E1CB 1U2QA 1Y3FE 2FWPA 1USGA 3I1FA 2XA2A 4YCCA 2PSSA 1HE3A 4EK9A 4TWZA 4JLNA 4GPD1 1O54A 1HT0A 4H6XA 2WJ3A 3T4PA 1AXRA 2XKBA 2XZDA 4FDVA 1M8PA 1J8QA 5JBQA 4Y1RB 3G2QA 1EAYA 2H54A 4P92A 3CUKA 3AUTA 1DX6A 4TLBA 2OV8A 2ZE5A 5LD2C 3JRXA 1USWA 3E15A 3ILHA 2QM0A 2N47A 3BE5A 3VI3B 3PI6A 1F0NA 5CAEB 2JVIA 4F5DA 2AKEA 1UXGA 2P3OA 2G82A 3BTUA 3TOSA 5AUNB 1P9LA 3RWBA 4F9FA 1EGMB 1P7PA 2YWFA 2ZSIA 3PUKA 2HD4A 4M22A 2XMZA 4GX5A 3TG8A 2ERXA 3GQBA 3NHSA 3N8KA 4PM4A 2NN3C 2J5XA 2BSAA 2QLJA 1S2LA 5ICSA 3E1KA 2GT1A 3V3TA 5ES3A 2BLLA 1YS9A 4RQUA 3LG2A 2D3TA 5CT4A 2XT9A 4MI3A 4JYZA 1N3YA 4CIVA 1CZLA 1Q0ZA 1TK9A 3E58A 4R2LA 4N47A 2FZGA 2LCFA 3ZE1B 3T9FA 1UMDA 1AB5A 2BM9A 4G24A 1X80B 1AN9A 5C8YF 1SUDA 4UUBA 5F7ZA 3TW8A 2JCVA 2QMHA 2Y1KA 4CLRA 3BSWA 4H7HA 2NZ8A 4IDQA 2V9PA 1W93A 1WV0A 5JHHB 3B2EA 3WGJA 5CVTA 1T10A 2NQTA 1JHVA 5CDSA 1ESEA 2FJPA 2XZTA 2PKEA 3K0BA 3BBLA 1SHKA 2C2ZA 1IQRA 4GMGA 4P82A 1EINA 3F6YA 4DR2B 1W52X 3BB4A 4B7XA 1Z0FA 1R9GA 1WCYA 5FADA 2DOKA 4JQCA 3P1JA 2VNKA 1ODIA 8OHMA 5H3CA 3I6BA 1OLSB 2QM3A 3SXUB 1YI0A 3GJ8A 4RADA 1X1CA 2H2WA 1E94E 2XB9A 1YIDA 5CGQB 1RBYA 1G0OA 5KKNB 1P19A 4W5HA 4FFDA 4ZQIA 3VKGA 1HL7A 1H3EA 3P0HA 1YOBA 4JNKA 4OL0A 1DCTA 2AUNA 4NXNB 2W7TA 1XI2A 1XZQA 4DBLE 3KJIA 1GQRA 1I2ZA 4BO6A 4AZ3B 3AIKA 3RABA 3C6YA 4KIFA 4Z7OB 5B2FA 2HK7A 2QW1A 4RIFA 3ITDA 1U31A 3A3NA 2XMPA 2XW6A 2NZ2A 3H99A 4S24A 2NUTA 1VE3A 4F46A 4IIEA 1N1DA 5E9AA 1DAHA 3FSEA 4Q19A 4OKIA 1XDGA 3VH2A 3K9CA 4CUJA 2YXNA 2ACKA 5DEIA 4BKRA 4CN9A 2ZK7A 1ISHA 2C7BA 1YJXA 3O92A 4IOMA 5L6MB 5IT4A 1ZHFA 4XEHA 3H1FA 1G55A 3BCRA 4ARAA 2QV0A 4AG6A 1U2GC 1FW8A 1XD8A 2VNIA 4ZQFA 4A2PA 1O0BA 1K5PA 5GINE 4BGIA 3RD5A 4BVBA 5AW3A 5LPNA 1YJ8A 3IKMB 3OZBA 1VPVA 1XRSB 2O0MA 3EF1A 4FOPA 4OUDB 3BQNB 1XTRA 4S1TA 3NDPA 3OQBA 3WLPA 4F9TA 1B41A 5BUSA 1O57A 3EA4A 5EQJB 1E6EA 4PCUA 1XC7A 5LR6A 2RONA 4BJ6A 1OVGA 3O1LA 1UDWA 1JGTA 3H2YA 2CKDA 4MKXA 1XTZA 5F5NA 3C8TA 3CLSC 2P11A 5B1DA 3EVEA 3EWNA 4INZA 1NN3A 2W83A 3WGLA 2JCGA 1AKRA 2GEDA 2MYPA 5K99A 1WQ3A 2ZJFA 3CH4B 2YCLA 2JGNA 3FNBA 3U4QB 4I1RA 2DWCA 4QTXA 3R7FA 1G6HA 1GG2A 3Q8XB 4XB6B 1FPMA 2X4IA 4XB2A 4D4IA 4DNFA 5EIBC 3HDJA 3V32A 4BNDB 1JXAA 3ZDBA 1QIHA 4NCXA 2NTJA 1WZIA 5FFFA 3QHQA 4D4GA 1MCZA 1TMOA 3LBIA 4CM3A 2VKQA 3M9XA 3OJOA 3M4ZA 1IC6A 3GFGA 3V8RA 2KW5A 1KDPA 4GAEA 2QVBA 2WTXA 4NABA 2FQYA 5K0EA 2W2QA 5FL3A 4F6CA 2EEPA 2W2TA 3G5LA 1H8HA 4LYHA 4EA6A 4KRFA 1EFHA 4XGRA 5BV7A 3KQPA 1OTXA 3F4KA 4GOND 3W5AA 3OP4A 4G25A 4F86A 4TTRA 4AX8A 5MDHA 1LWNA 4I9UA 4FC7A 4WKCA 4CM8B 2CD9A 1AGYA 1IYZA 1DKUA 1ULUA 4JBGA 3V7YA 3PRJA 4F6RA 1UC4B 2EQAA 1W2WB 1ML4A 4UJ3A 4XJVA 2CD7A 2OMEA 3OE5A 3S2ZA 3ZE8A 2OFFA 2OSBA 2WIBA 4P9NA 4OVKA 2ZITA 3P9SA 1ECGA 4HADA 1NWCA 4Z3DA 4AK9A 4TYNA 1M1YE 1AKNA 1NXWA 1WDLA 4GBMA 2XYPA 4IV8A 3SOZA 4IMIB 1AO3A 4AP6A 1BA2A 5KSZA 2D62A 2AYYA 3P20A 2UUAB 1U99A 2H4HA 2JJ8A 2H2HA 2WQ7A 1WE2A 4ERNA 4MIEA 3TFOA 4EPWA 3F6RA 4LNUB 3O1HB 2JLAA 1DFIA 1JQDA 2H1RA 3H9UA 3PUHA 4HDOB 4KUEA 4R9VA 1BRTA 2XUFA 1K7WA 1JQ3A 2ZUSA 4RD3A 1W85B 1ISMA 1P3Y1 4AB1A 2WKPA 2HO5A 1X77A 2GXUA 5JSYA 4A5OA 2B92A 4N0QA 4PG5A 2O14A 1Y1LA 1CUCA 5CM8B 3TNJA 1U1FA 3H0EA 4ECAA 3W1VA 5J5VA 3VDXA 3R24A 5AK4A 2PMDA 2RG7A 3FETA 2FCRA 1RJWA 3LGXA 5CG2A 3LUDA 1EX6A 4ZQHA 5UKDA 5ECWA 1KEPA 4OHUA 3AXTA 3LDUA 3O7WA 1VB5A 2ORED 4CLHA 1SBIA 3TNYA 3ICWA 4MO9A 3TLEA 4ZYZA 4V0RA 1Z8HA 1NDHA 2FPGB 1L7XA 3CCFA 2AH5A 3EC2A 3D3NA 3L05A 2OLEA 3BX1A 3EZGA 1A97A 4G5RA 4B76A 1NVVR 2E87A 5E7IA 3K30A 4UBLA 2IYRA 2FSPA 3AYZB 3TBFA 3M81A 1H2HA 1FMJA 3VAZA 1MJGM 4NFYA 5CIYA 3N70A 2OHJA 2NZJA 2YTZA 4MWDA 1QE0A 3I23A 2LW7A 3QENA 2QZPA 2I9KA 3GCWA 2WWYA 5IEBA 1BYUA 3O90A 2JK1A 3UPUA 1EVEA 3FOFC 4JB2A 2JH9A 4DRXB 4HWPA 4WXMA 3OPVA 3L93A 2FSSA 1JTFA 5CT9A 5ELXA 5K5EA 1WZNA 1E1LA 3DHNA 1I6KA 2B3DA 2Z58A 4E7PA 1PLKA 4G85A 4HY3A 3CGGA 4N3CA 1IOZA 2ATXA 1WL8A 2RIRA 2P4EA 1NXOA 4DCVA 5A9RA 5IPFA 1U8XX 2WU3A 3E9QA 4Y98A 4DB2A 3KR0A 1SNYA 3R75A 3UK2A 3NHLA 3PENA 2IIVA 3ADPA 4UD2A 4IGFA 2OUKA 4CN8A 3WXMA 3HA2A 3F4TA 4FFBB 4OYHA 1OIXA 2MSDB 1BHQ1 3JTEA 2PK3A 1XL1A 4CMAA 1EXDA 4DDWA 4N0EA 4PVCA 4YCAA 2FMHA 1OJLA 3JCZA 5JU6A 4P53A 2P9GA 5BPHA 2HEIA 5A3QA 5IS2A 3GJ4A 4TL8A 1ULHA 4G5GA 2IU3A 1QAOA 3X1JA 1MMFB 4YQYA 3VKVA 4EAQA 3W3ZB 4A8TA 4JCCA 2WABA 4K46A 1UFVA 1DHTA 2VF4X 3O8LA 2ZWAA 4J90A 2P3SA 2AFIB 2R7LA 2I55A 2X8AA 3BWCA 4TXJA 5I9BA 1YRQA 2CW5A 2ZQZA 3RRFA 3VX4A 4L57A 1KK3A 1QGUA 5EKTA 1M2OB 3Q41A 4R3WA 5CLJA 3K0EA 3LBAA 1G5FA 2AXEA 5KTRA 5GPBA 4CMKA 3WLFA 4HB2A 4Y67A 1Q91A 2B1JA 2PHZA 1KJWA 1DNPA 2D06A 2NO7A 3I92A 3E05A 3MTAA 3QK7A 4TSFD 2GAOA 2PSDA 3F71A 1FTWA 4ROSA 2MSKA 2IRWA 2RH9B 3G5TA 4BB6A 4CQMD 1J1ZA 3R5TA 1PYDA 4KACA 1BCRA 4NI5A 1VHJA 4ZVOA 5ICMA 3OFVA 4OXRA 4A7PA 2QM7A 4PE5B 3ZGZA 3N0XA 2HT1A 4IPTA 5G0WA 3ZU6A 1LNQA 3ZOZA 4U7WA 4OB7A 1WF3A 1ORVA 3UM9A 1KH1A 4GIBA 1IWOA 4QD3A 1PSZA 3AHGA 4RZQA 4E22A 4DIDA 2F1JA 3KTFA 1YBMA 4ZCMA 3B8EA 2HF2A 5JCPA 1DADA 3UB3A 1U15A 3EX7C 5KOYA 5B6PA 2OXEA 4JIMA 1FS5A 4D4MA 4FZRA 4JP2A 4WGFA 2FN7A 2B5WA 3F47A 4HQFA 4WECA 1T0PA 4ZJUA 3OICA 3DOUA 4LSZA 2AG1A 3ROKA 3CF4G 4BNTA 3W8EA 1X74A 4P8RA 3BE6A 5ALQA 1DL5A 2RC6A 5KNLA 3FZYA 5DIZA 3JD3A 3EXEB 3UUEA 4D0GA 4V0QA 2DETA 2G28A 1K3TA 1W4CA 4FXOA 4E08A 2RD2A 1VDMA 1GYRA 1U2TA 2QLTA 1L7EA 2WF5A 4TL9A 3TBHA 1E9AA 2B1IA 3HPRA 1HDEA 3MXOA 4BP1A 3HXMA 3GELA 4IJ6A 3C5HA 1OVMA 1MOZA 1AMNA 3D8NA 2B30A 4L8GA 2VEOA 3M3DA 3WIDA 4P3PA 1ZBDA 1KI6B 1I3OA 3FDJA 4RK1A 1S6YA 3WWOA 4Q4HB 3EMKA 4UNIA 2EKZA 3CCCA 2MSLA 2V6JA 4KYUA 4J2TA 2UYCA 1XNRB 3AH8A 3PHJA 4O0MA 4RPGA 1HE1C 2MCFA 3RC2A 4EJ0A 5LMUB 5KOHB 2ZEJA 2Q5EA 3G0IA 4TXLA 4XYBA 4YRDA 3SEQA 2ZTSA 4DB4A 2EDCA 2PWBA 3TECE 5FIUA 1SUBA 5GM2A 4B47A 2AI3A 1SGWA 3IDAA 4ZV4A 3CW9A 1V1RB 2VPYA 2QR2A 1SBHA 1G2PA 4OKNA 3DM5A 4QDXA 4LBVA 2R4TA 3FCYA 2C4MA 4ACAA 4KMRA 2FFQA 4BFTA 1WZEA 1RS0A 5TPWB 4AIIA 1UT8A 4C0LA 1MR3F 1NT2A 2VYVD 1NVUQ 1MHPA 4M1TA 4UVIA 1L3CA 4DBVO 2YUIA 3DCNA 4MYCA 3X2FA 2YN2A 4XDHA 4WTOA 4O2RA 4WK2B 1J1UA 1IVSA 1GG5A 1AHNA 1H6CA 2CBXA 3LOPA 3PQ3A 2Q4OA 3S2EA 2J32A 4MEBA 2NAFA 4QLBA 4P3XA 4RC9A 2P9YA 1SXQA 2B94A 3KKPA 2C31A 2PIDA 3DDOA 3SC2B 2FB9A 1OGJA 2GBIA 4NZNA 4DYHA 4ND8B 1Q84A 5J58A 4X93A 3CJQA 1GTL1 2LBPA 4JYCA 4N4AA 5FBKA 2F64A 1PUIA 4BE4A 3WOHA 4KREA 3BHMA 2CFIA 3MUFA 4KUHA 2PZJA 3O4VA 4GE3A 5EUBA 3SY8A 1I6WA 1XZNA 4AJ4A 4X90A 4C21A 3M2PA 2C0QA 1JIIA 3BCSA 2O07A 1G2OA 2Z30A 4COKA 3E61A 2ZSJA 4OHZA 3RYCB 4C7OA 1FUIA 1EE2A 3EXFB 1M72A 4I4TA 1N8TA 3C7AA 4B3TB 4L15A 5EN4A 2OYRA 1UBFA 2B78A 2OBFA 1T2FA 3NHBA 2D5BA 1FF9A 4JGBA </