1Z4QA

Structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with 2',3'-dideoxy-2',3-didehydrothymidine 5'-monophosphate (d4t-mp)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
194
structure length
194
Chain Sequence
RALRVLVNMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRRLHSWADDWKAILDSKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity of the human mitochondrial deoxyribonucleotidase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords 5'(3')-deoxyribonucleotidase
total genus 62
structure length 194
sequence length 194
ec nomenclature ec 3.1.3.-:
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06941 NT5C 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.40 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Deoxyribonucleotidase; domain 2 1z4qA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4qA01
2YMPA 3WK5A 1VJRA 2R8YA 3N8GA 1U02A 4KNVA 3QNMA 3WKCA 5ALRA 2ZG6A 1VJ5A 2FUCA 3U7GA 5ALVA 4FFDA 5AI5A 3QU4A 2AGVA 4UW9A 2WF9A 3IJ5A 4CF5A 3OPXA 4UASA 2YMMA 4Y2YA 1N9KA 2I33A 2OM6A 2FPRA 5AHXA 3WKDA 4BX0A 3L0BA 5AESA 2HI0A 1RLOA 3M1YA 5ALGA 1TJ3A 3A1DA 2BY4A 1RDFA 3AR7A 4KX5A 3ZVLA 4IG4A 4GIBA 1Z4JA 5ALKA 5AW4A 1T9ZA 3AR8A 3AR6A 4UMEA 3KDPA 1Z5GA 4XE5A 2ZBEA 4UAVA 2WFAA 3NIWA 3W5BA 4YCMA 4Y2TA 2CN1A 2Q4RA 5A3SA 1Z4QA 1ZD4A 3M9LA 2WF6A 3UMCA 4E88A 5ALJA 1RPZA 3ZWDA 2CFSA 2PQ0A 5AW0A 3PDWA 5AKIA 3QUQA 2O2XA 4UMFA 5AVWA 4YCNA 3UMBA 4BNDB 5IT0A 1RKQA 1Q91A 3ZI4A 5AK6A 2FI1A 3EF0A 3FPSA 1L8LA 4F72A 4F71A 2GMWA 4YIHA 4EELA 2PKEA 5AM3A 3ZTYA 3WK6A 3MMZA 4UMDA 5AK5A 5AW9A 4OHFA 3QUTA 3L7YA 2CFRA 3ZU6A 4I9FA 5AVQA 3ZX4A 1MH9A 4UARA 2W4MA 3N5KA 2IOHA 3QU7A 4Y2UA 2FPUA 3OTQA 3ZUPA 3L8GA 1ZJJA 3CNHA 2I55A 3U7HB 3AR4A 1Z4MA 3WKEA 1Z4NA 4XOUA 5AI8A 2G1AA 5A3RA 3A1CA 1LVHA 3VAYA 3ET5A 5AKYA 3I76A 2YJ6A 3PCTA 4JDPA 5T41A 4HGPA 1TA0A 3D6JA 3N1UA 3B9RA 1RMYA 1Q92A 2P27A 5AM2A 1ZD3A 3MC1A 4GXTA 2NO5A 2ODAA 2ZOSA 2RAVA 2YJ3A 4UATA 4ZEWA 2OA0A 3QU5A 5AW7A 5AI9A 3J7TA 1U2SA 3L1VA 2GO7A 3W5AA 2EARA 3FPBA 1AQ6A 1L6RA 3ESRA 4BYGA 3ZWKA 1S2OA 3QXGA 3FM9A 3SKXA 2FPXA 5A3QA 2EATA 3AR9A 1RRCA 2QYHA 2C8LA 3PGVA 4DFDA 4B6JA 5ALMA 3OCUA 4Y2XA 2I6XA 2I7DA 3NASA 5ALPA 5ALXA 2RB5A 5AVTA 2JAWA 3OCXA 4G9BA 4UU0A 1Z4OA 3WKBA 3NALA 1RQLA 5ALZA 2ZBDA 1NNLA 3ET4A 1S8OA 3E84A 3ZX5A 2BDUA 4BEVA 1Y8AA 3MPOA 5AW8A 2HO4A 3L0YA 5ALQA 5ALLA 5AKLA 1L8OA 2O9JA 5AKZA 4FYPA 1WPGA 1Z4LA 3ESQA 1WVIA 1SWWA 4Y2QA 3SMVA 3RF6A 1FEZA 1YJ5A 2YBDA 3L5KA 4BBJA 1YDFA 5AW2A 5ALDA 5AVZA 1QQ6A 2HCFA 2HHLA 3QYPA 3TLMA 4OCZA 5AM0A 5AVRA 1RMTA 3FZQA 2AH5A 2B1RA 4QQFA 4MWOA 2HEGA 2WF8A 3OCWA 4AP9A 3PGLA 2YMQA 3KBBA 2W11A 1EK1A 5AKGA 3OCYA 4EEKA 3DDHA 3W5CA 3N28A 4KX3A 1Z88A 3KD3A 3QGMA 1NRWA 3EPRA 2C4NA 4RETA 2FPWA 2R8XA 1CQZA 3ZVNA 2G08A 3U19A 2ZBFA 3MN1A 2I34A 3A3YA 3KZXA 2JGAA 4AS2A 4YCLA 4UM5A 5AKXA 2EAUA 2G0AA 4KN8A 3NAMA 1ZRNA 5JJBA 5AI4A 5AIBA 3U7EB 1XVIA 1J97A 2YJ5A 4HGOA 5AW3A 3WK4A 4OD0A 2GHQA 5AVYA 5FP0A 1F5SA 3RFUA 1Z4KA 3UMGA 5ALSA 2AMYA 4CF3A 4UU1A 2FDRA 2DQSA 2G80A 1SWVA 1RKVA 2JAOA 5ALTA 1QYIA 3L8FA 2NO4A 5ALWA 2WHEA 5AVUA 1JUDA 2OYCA 1X42A 3W5DA 2QLTA 4C4SA 2I54A 4KNWA 2B1QA 2PR7A 3B8EA 3NANA 2G07A 4L6CA 2VKQA 2HF7A 2HX1A 2CFTA 4CNQA 1CR6A 1T5SA 1RC8A 1L7MA 2GHTA 1NF2A 3BWVA 3WKAA 3I28A 3U13A 3A1EA 4J03A 3KC2A 5AKJA 3QU2A 2IYEA 5AVSA 5AK4A 2YN4A 3UM9A 4H1WA 3SD7A 2X4DA 2Q4TA 3EWIA 2B8JA 3WK7A 2C9MA 2D2VA 5AKEA 3ZTWA 4XPZA 3S6JA 3AR5A 3ONNA 1L7NA 3AR3A 5ALYA 1QH9A 3AR2A 3QUBA 5AM4A 4UMVA 4Y2SA 1XP5A 3E8MA 5ALEA 3R9KA 3QUCA 1U2TA 2AUTA 2IOFA 3R09A 4EENA 5AVXA 3DAOA 1L7PA 3WGUA 1XPJA 4G63A 4HGRA 4NV0A 1N8NA 1O08A 5AIAA 2FEAA 3QU9A 3DV9A 3CZ4A 5AM5A 3L0CA 4FE3A 1ZS9A 4ZEXA 3SHQA 3KOOA 5AKHA 5AW5A 2YFYA 3OCVA 2GFHA 4I9GA 4EX7A 5IS2A 3QLEA 2ZXEA 4HGNA 4JB3A 4NAVA 4CE6A 2JAUA 4HYTA 2WM8A 4NFLA 5ALOA 5ALFA 5IT4A 3DNPA 1TJ5A 2G09A 3F9RA 1RMQA 1QQ5A 3QX7A 4HGQA 3SKYA 4C4RA 4XQ0A 2Q5EA 3B9BA 1Z4IA 5ALHA 3BA6A 1TJ4A 3L8EA 5AI0A 4YH1A 3I1YA 3U7FB 4BX3A 4BX2A 2YJ4A 1YMQA 1WR8A 4Y2PA 1PW5A 1ZD5A 4BNDA 2B30A 2B8EA 3E58A 4DWOA 3ZVMA 1RLTA 3R4CA 2C88A 5AVVA 1J8DA 2WF7A 3NUQA 4Y2RA 3ZW7A 4O8CA 1ZD2P 2WF5A 3WK8A 2RARA 3L8HA 4CF4A 1EK2A 2BDEA 2YY6A 4PNHA 3HYCA 2FPSA 3I6BA 3FVVA 2JARA 4OFZA 2R8EA 1KYTA 2P9JA 3FGOA 5AW1A 5AICA 2P69A 3NRJA 2FUEA 1RLMA 1O03A 1WZCA 2ZBGA 2P11A 1LTQA 1TE2A 2HSZA 3SF0A 4AS3A 5ALUA 4UM7A 2B82A 4QJBA 4KYTA 4YGYA 1T5TA 4UAUA 2HDOA 1YNSA 4DCCA 3EF1A 5ALNA 1YS9A 4BKMA 2R8ZA 4DW8A 3SLRA 4Y2VA 2B0CA 2IA5A 3WK9A 1ZOLA 4NABA 5AKKA 3P96A 3U26A 4ZEVA 5AW6A 1U7PA 4EZEA 4YIKA 2MU1A 4MUMA 4L57A 3E81A 1RQNA 3IRUA 3HLTA 3GYGA 2NYVA 4HAIA 1VFPA 1U7OA 1Z4PX 2HF2A 4NWIA 4RESA 4Y3UA 3IB6A 2RBKA 2C8KA 3OCZA 5AK3A 4BEWA 1ZRMA 2HOQA 1Z5UA 3ED5A 3WGVA 4C4TA 4EX6A 1L7OA 2G06A 1RKUA 5AM1A 5E0OA 4L6AA 3N07A 1QQ7A 2W43A 4J2TA 1IWOA 5ALIA 5AI6A 1YV9A 1K1EA 1SU4A 2YMLA 2OBBA 2MSNA 4Y2JA 4IFTA 3L1UA 2IOFK 3K1ZA
chains in the Genus database with same CATH superfamily
1U5AA 1N5DA 1DEHA 1YCGA 4Q9NA 1H42A 3HBNA 3NJ8A 4E7OA 3QPBA 4HLCA 4FQ8A 2JJ8A 4QUBA 1CDDA 4CCSA 2FK7A 4EHAA 4O2LA 1B1CA 2HDNB 2I3ZA 3N2KA 4KYIB 2WU3A 3U7IA 3A3OA 4LY3A 3C7TA 3RVNA 3S55A 4HYEA 4ROSA 2NTYC 4NJMA 3VOBA 3WMEA 3ZCUA 4DE5A 3GELA 3PB3A 4D79A 5J58A 4J0FA 5KTOA 2PO7A 4ZVPA 2AGVA 3CPEA 1SVWA 1M8FA 4X65B 3ME5A 1N6NA 3DOJA 2OT3B 3BL8A 4P08A 4UASA 2VN8A 3D1LA 3DEFA 4G8BA 4GZ3A 3BRWA 1SBZA 3G2JA 2O2HA 3FD8A 1HFWA 4NJEB 1X74A 3ORRA 1V11A 4WK4B 5SYMA 3A1DA 1VQ1A 1Z33A 2XUPA 1AGYA 2BT4A 5JD6A 2PTSA 3ZZUA 2QDKA 2IW1A 3O6VA 2VQEB 1G63A 3HYNA 3OPVA 1P4RA 3GLHE 8ATCA 1TPZA 1TEHA 4UKDA 3FX2A 2O54A 2H1VA 1HDZA 1PYOA 1TX4B 4AJKA 5L7TA 2WTAA 3I34X 4I08A 2Q5FA 1OGYA 2GCNA 3QA9A 3RAGA 4G65A 4K1XA 1PTKA 1THMA 4AFNA 2FWAA 1YB4A 4JEUA 2EJWA 2AC7A 1O8CA 4CGYA 1M2OA 1OHHA 5GZ3A 4Y30A 1VM6A 1JIUA 5LWHA 3H42B 1M2NA 3KZCA 2XUQA 5LWQA 1TKAA 5C8YF 4MCJA 4AZSA 4EG4A 3EG5A 4PRKA 1E58A 5KJFA 1XNHA 2PSDA 3ZDEA 3VA7A 5AVWA 3WA7A 3VDMA 2VDNB 4D97A 4N5MA 2H2IA 1AHPA 1NI4A 4XQEA 5EWLA 4IIEA 4D9JA 3BXHA 1MC8A 1T3LA 3UNXA 4FCVA 5EHNA 1UBUS 4K88A 3L4BC 2Y1LA 3I9V1 5DHRA 5IVIA 3KKEA 2FI1A 3Q2KA 4PS1A 5TNXA 2VPYA 4AWXA 1ENZA 2G0NA 1XU9A 3DSRA 1E1CB 3BGVA 1ENYA 4ARIA 3HCRA 5I47A 1T0PA 1H93A 1M9NA 2E4XA 3L4BA 5FPTA 4Q1EA 1IZ0A 1FYEA 2H9IA 2R4QA 2V9CA 3P2JA 5BT9A 4ZQHA 5HDBB 4IF6A 2B35A 1YRYE 3SHVA 1SNYA 4RTPA 1EXDA 2ZIVB 2W83A 1PKXA 1RYYA 1G2QA 2QJFA 3AO0B 4MO2A 4EH1A 1UEXC 3D8BA 3IJEB 4FZRA 4QDKA 1XNQB 2BRUC 3F74A 3O0DA 1IN8A 4Z8YA 4CIYA 1K7YA 1B26A 3TUZC 1D09A 3OTQA 1JLMA 3U1BA 1ZJJA 3MGGA 1UXHA 4I1UA 1SCQA 3WKEA 2DFTA 4R1OA 5J40A 1MOPA 2LP4Y 5EHIA 2HNBA 2OXRA 2PRZA 4DLLA 2GKSA 1LJUA 3JZAA 4R5HA 1HTWA 5HJ2A 3R9IA 3R7WA 3STXA 5I9LA 2RGXA 2IZ5A 1Z0ZA 2G4CA 1TA0A 4O5OA 4UJ5A 4MUXA 1R88A 4N9QA 4RA9A 3I62A 4HAWA 3UGJA 1HTTA 5E9WA 3ZZMA 2H16A 3E7FA 3H11A 5LR6A 3AU8A 3KELA 4HUQB 1AM4D 1GQFA 1BXRA 3CLUD 4QDXA 3RIMA 2JFHA 2HADA 3IPYA 4BTLA 2WU8A 4CMEA 2OG2A 3LCRA 1KEKA 1J1IA 2QSJA 2PD3A 2QLNA 4PINA 1PSDA 2FEXA 5HE8A 5IAKA 1RSZA 3OMWA 4J7UA 2CLEB 4IXDA 3ON5A 1TVKA 1N2OA 3JVVA 2FPPA 3ESRA 1NAIA 1WMAA 3PE4A 4UTRA 2GVNA 3TVTA 3BQ9A 3P9YA 2AKYA 3JYPA 2FPXA 2IHUA 2QI9C 2RKBA 3AP2A 1Z63A 2Q99A 1ZVVA 4S12A 2Y1EA 5KREA 1MO2A 2OC4A 2ZIZA 4KQGA 3LUAA 3K0HA 3O3NB 1E2PA 2VT3A 4UHJA 5AQ1A 3UHAA 1JKXA 2EGHA 2XOKD 4NCKA 3M89A 5JS8A 3PUHA 1AGRA 3B53X 4UUNA 3NP7A 4FS8A 3G9QA 4MGIR 3DTTA 4ZJZA 3DNFA 3VR2D 4B4KA 4RIFA 4A82A 5ES3A 1MAAA 3VH4A 4KL8S 3FBWA 3AF2A 1DIRA 1SVNA 2BH9A 3K4QA 4DBLE 1Z4OA 1QHHB 3BUSA 4HAYA 2FOIA 4O4IB 2C5EA 4HGZA 4OXNA 2OWEA 2ZBQA 3N59A 3IA2A 2AR9A 4V3CA 1CJKC 1JL3A 3IT1A 4ZHQB 2O3JA 3MUNA 4QEZA 4OFXA 4P4TA 5HQ3B 3OLYA 2R6DA 2VF7A 2AHOA 4CMHA 1M5RA 1EUDA 4MTCA 5GM1A 3MXOA 2O9JA 5HZGA 5LYYA 3UANA 3LM8A 3P9IA 5CVVA 4Y2QA 3COPA 4FHDA 5TR9A 1GM5A 1YJ5A 4BE9A 2LKDA 4DSNA 1EFHA 1IMOA 2JHGA 3R8XA 1DOZA 3V4PB 2ODTX 4A0GA 4E5YA 4YRPA 1F60A 3HKEB 1F4PA 2AJBA 2CMDA 1QFXA 2IK8A 2V5VA 4N4AA 3ROQA 4EHDA 3I61A 1BFUA 1JSWA 3BMNB 4LW8A 3IV6A 3OM9A 2VJDA 3DVAB 1G5IA 3HR4A 2O07A 5J59A 2PKXA 1DLJA 2E4VA 2NPOA 4WX2B 2ZU0C 4YRTA 4XGKA 2XLBA 5CLIA 3OQPA 3ZWVA 1I9GA 3GFGA 1E9CA 3L40A 4BZZA 3B3GA 1RJ9A 3DDHA 3IS3A 3H2IA 1DXOA 3K6RA 5KTNA 4JJ7A 5JO0A 2X5XA 2FWBA 4P0TA 1JFSA 1JSZA 2VK2A 4AROA 5CFPA 4M99A 4W9NA 4CKYA 1UQTA 1W94A 2G08A 4HMQA 5C31A 4US2R 3KJXA 4AF6A 4FZJA 1YAHA 1SOWA 2V1XA 3U3DA 4C05A 4HFMA 3DE2X 1QP8A 2E55A 1R50A 1Z37A 2WKPA 3KETA 3EXG2 1FC0A 5C1BA 2H8KA 3VJLA 5ETJA 2YJ5A 5DP1A 1GCIA 5LXTF 3ZLJA 3OPYB 3SZMA 2YV4A 2A58A 1XD2A 4YACA 3I58A 4KE7A 3ZQUA 1CUSA 4LXTA 2VTBA 3PUKA 1MAVA 5JANA 4F5DA 2XUOA 2WVHA 2BRUA 2IQ5A 3Q3EA 4WKOA 5HQJA 5BMVB 3VM6A 4JVOA 5AVUA 2GA9A 2DLDA 2C3YA 4RJTA 3N2EA 2SCUB 3BWMA 1HBJA 3W5DA 1OXKB 3IXLA 5JYCA 2H2AA 4QRHA 1B16A 2H51A 4AW9A 1V4BA 3TOXA 5CB4A 1NUUA 1W6RA 3L7CA 2ZSAA 2C61A 1JLLA 2XTZA 3F7NA 4RIIA 2PUCA 1NP6A 3MWGA 3C6KA 4L5JA 4M1OA 3GLFA 2P6UA 3TLEA 4BMCA 1NKSA 4M8SA 3GW8A 2R8RA 2HF7A 2Y05A 1VKJA 3RVMA 4QBGB 3CB2A 1IUNA 3D4NA 3PUVA 4M8KA 4WWHA 3RFVA 5H3LA 2YQ5A 1N7GA 1GPUA 4EECA 5LQUA 1EP9A 5AVKA 1N32B 3DP7A 1P0MA 4DA8A 1W2GA 2GHTA 4ZICA 1RIIA 3P9CA 3PEEA 3RAFC 1IEQA 2DH5A 1TCBA 2JAPA 2HO5A 2PFSA 3H2SA 1W4AA 3PD1A 4N18A 3W8RA 4E5NA 1C14A 3O7WA 2VUSA 1C2YA 1NPYA 4BZXA 1ZK4A 2GZ1A 4ZO4A 2IYEA 4WVFA 3R7BA 4J0QA 1HDXA 1RHRA 1VL6A 1X7XB 2C20A 4GECA 4HQNA 4C3VA 5U9CA 3QEOA 2P40A 1EX9A 1U2DA 4HY3A 4K2AA 1QVWA 4H31A 2VDOB 2WBLC 3EWIA 3IP5A 3BTVA 3P4UA 5LU8A 5C7LO 3I9V6 2D2VA 4DV0B 4GT1A 3RK1A 4MQ4A 1TRHA 3KJEA 5FCDA 3THRA 3DHWC 2P7IA 1UIMA 1WBBA 4KH1A 3AR5A 2C31A 1KMMA 1YQXA 2D13A 1N6LA 1NASA 3FYTA 2W37A 3G49A 2RG7A 2N46A 3KXKA 3QPDA 4O4LB 4RNDB 3TI9A 3ZCSA 2Y1WA 4AQYB 3DMYA 3SXUB 3CJQA 1U7UA 1EBBA 4LC0A 3IA7A 3OQIB 5TY0A 3WGIA 2BEUB 5FFMA 3LZDA 4ER7A 1E6KA 3A7EA 3R9KA 3TSCA 3QUCA 1VHTA 4GR5A 1NYLA 4XGQA 2IYXA 5LJIA 4TYPA 2VBIA 2YXEA 1J20A 2Z58A 4ZZIA 3PFWO 2XVZA 1HDOA 2CF5A 3V8VA 5C80A 2DBZA 2Z09A 4L16A 3WJ1A 1FTGA 1LPMA 3QX9A 2WIKA 1MOZA 2B8NA 5ULLA 1VFNA 3ASVA 4FQ7A 1XEWX 3LL4A 4P3OA 3OECA 1TU3A 1JB9A 2W8ZA 1WQ3A 3DQPA 3LRXA 4QNRA 1KE2A 3T34A 3KOOA 4LIPD 1DUVG 5AUOB 1LFAA 4UOQA 5JYBA 5KINB 2O4CA 3ZU3A 3NFYA 2VUTA 3W3AH 1B0ZA 3ETCA 3JQ8B 2VSYA 3F3YA 4QG7A 1W36D 2WUWE 4QVGA 4Q7EA 3OQHA 5D5PA 1ODCA 5LA6A 4RCYA 2O8FA 3EVZA 1ISGA 3T7CA 2YRFA 2H00A 4B7CA 1LBTA 2OZLB 1D7AA 1SEVA 2CVPA 3G0CA 3PXAA 4FXOA 1UJ5A 2DWUA 4X8OA 2ZTHA 4H7KA 5LYJA 3EPHA 2WM8A 3BL6A 2QMZA 1UKAA 3PDIA 4BVKA 1GDDA 5F4ZA 3SKYA 3RRFA 2N1BA 1DGQA 2R00A 1E2BA 3HR8A 4KQ1A 3R7AA 4CMIA 1LV8A 1BWQA 1ZEMA 3IEIA 1L9KA 2VTDA 4U6SA 4GI7A 1KC1A 3OOYA 3FKQA 3V7FA 1RAEA 1N3YA 1VKRA 3VMFA 1L5YA 4MA4A 5F76A 5GZ1A 1U2EA 4PYOA 4QFMA 1EK5A 1GGNA 1ISRA 4KKXB 2NV2B 1SELA 3U48A 2ZITA 1QF7A 3QVXA 2ZRIA 5DVZA 4MVJH 2HFJA 4B7AA 2FSFA 3C8ZA 1ADGA 5MN6A 1KEEA 4PO3X 4B74A 3NUQA 2UYCA 8ADHA 5HZHA 2GCIA 3QV2A 4MPJA 3Q9UA 4BZQA 1H2FA 2PEYA 1MX5A 2PT7A 3NTXA 4YUAA 5JFTA 4HWOA 1EK2A 3FTEA 2FSVA 1LJLA 2PTRA 1BAPA 4RVGA 5EIHA 2V0CA 1TYBE 5JRZA 2JFYA 1W2WB 3F4KA 1GNQA 1I01A 2H4JA 2JIOA 2R85A 4GLBA 3Q3HA 2CVZA 1KYTA 4N82A 2GAIA 5AW1A 5KSWB 1J56A 4C88A 1SGWA 2P69A 1CRQA 4PPQA 5HIKA 3KSBC 4K6KA 3P0HA 4CIBA 4ZOCA 2R60A 3LC7O 3UK1A 2XWJI 1SHLA 3FDZB 4HJXA 4J76A 2WJAA 3C7CB 2JFUA 3VNSA 1V8FA 1CZLA 4A1OA 1YVPA 3AVWA 4D0GA 1MU0A 2C9BA 1Z2AA 4F21A 3LF1A 4WRRA 1RWQA 1KWGA 4G1MB 5F3DA 5JDCC 4II7A 3K6SA 2B94A 4LISA 1C0EA 4JB2A 1NVVR 1XMSA 1XBTA 3IPCA 3EVEA 2Z9DA 4MRRA 4C0XA 2Q1YA 3BCSA 2NSJA 4CR7A 1KYIA 2A0UA 5DW0A 1OI3A 5A6SA 2RIPA 3GRUA 4YGYA 1X3LA 5JAUA 3PCXA 3QOXA 1R10A 1Q0QA 1LZLA 2IPNA 2BFDA 4LRSB 4X62B 1OWLA 1A1SA 3HJCA 1OXMA 2VJLA 4ZQBA 2P91A 1LC3A 1I7LA 2AXEA 4GL2A 5E6UA 3WIDA 1CJVC 3E22A 5FWYB 4BUCA 3TE6A 3P96A 3LW8A 4FOLA 1V16B 5F5LA 3W4KA 1T0BA 2R2GA 5AXBA 5K3EA 4EZEA 4B0OA 4PVCA 2V74B 4Q4LA 3FOEC 1EE9A 4EB8A 3LVFO 1P8JA 1GAQA 3M5WA 3OJCA 4YMHA 4QG3A 5FPQA 2RI1A 2PM8A 5EN4A 7MDHA 1JYEA 2IBMA 1HY0A 1Z5OA 1OH6A 4JJKA 1I0IA 2HV9A 2WAOA 1P2UA 4MHTA 1T0IA 3LQRA 3PNBA 1L1RA 3HU3A 2QLBA 2W6QA 3RIGA 1AO0A 1DAMA 1PUXA 2QEQA 1FYDA 4BVJA 4CN8A 4BEWA 3BD8A 1SKYB 2H4WA 2IXGA 1PJ2A 3U9SA 1GPYA 3QHAA 1WLSA 4AN1A 3ADKA 2FPIA 2X2PA 4NNJA 3CSDA 1T9KA 4M37A 2W43A 3K70C 3N7TA 2I5PO 3AF1A 5GIPE 1NPDA 2JLBA 1JT2A 3MOSA 3PFIA 4L76A 4RY9A 1YSCA 3FMOB 4JSRA 3BWXA 4MWSA 3KVYA 1TQHA 1EVYA 2XVYA 3AKCA 3I5AA 4S35A 4AYWA 1IXZA 4ZP1A 2FAXA 4QJ3A 4K0KB 4PO9A 2O8CA 7MHTA 2BTQA 1YL7A 3TLBA 4HXEB 4TT3D 1FX0A 3AHJA 4FX5A 1JNXX 4M1SA 2R8YA 3RV4A 4DSOA 3ZGVA 1XAGA 2H08A 3AUUA 2O3RA 4BQQA 5K9ZA 2FYTA 3LT4A 2OV1A 1OX4A 2H7YA 2YRXA 4ALLA 4JEIA 4H9GA 1F4VA 2ZG6A 4E0BA 3JAMA 1TIPA 3AHIA 1GL9B 2FUCA 3TM4A 2ZJ3A 3SXPA 3EGDA 4MB0A 3UBMA 3MMNA 5NLLA 4JZYA 4CLEA 3JZIA 2ZBVA 4AULA 1CUEA 4F04A 1JPUA 5T6MA 3MWEB 2I87A 1T5LA 3BSSA 2FQQA 2ISSD 2WJIA 3GPBA 5IN4A 2O7RA 3KB8A 4PFSA 3WIEA 3OH8A 3K1TA 3H5VA 4ZCIA 2ZSUA 4NK5A 4NLEA 4D0SA 5K8CA 1OIVA 1ZGGA 4MTLA 3ETGA 3MFQA 4MS3B 4FYYA 3WKDA 2WK1A 3LVQE 1G0NA 2FEMA 1VL2A 5C5IA 4J4HA 3GV0A 5KOYA 2VXOA 4R84A 1NSYA 3QYFA 4G0UA 3D5QA 3HYLA 2RHWA 1EB9A 3T3HA 2BELA 2VK4A 5G4LA 2XEDA 1SUFA 2AFHB 3AR6A 2HLDD 2J3LA 3TH5A 1UJ4A 2WA2A 1YTUA 3RR2A 2HRDA 4ALNA 5KOJA 4WGFA 1ID8A 3TBHA 1YT5A 4HYQA 2C4VA 3NBFA 3REOA 1LLFA 2HFKA 4EVQA 3DOIA 3OIYA 5CCEA 1R9NA 3HTXA 2CN1A 4HB2A 3U44A 1II0A 4CT0A 4KWTA 2Z3VA 4XX0B 4AUNA 1HE2A 3PDWA 4KPGA 3FHLA 4BV3A 1MW8X 4YS6A 2Y71A 4ZCQA 4I4CA 4Z8XA 1AHHA 3A6DA 1XF9A 4UXIA 5EGNA 4AZ3B 4I1YA 2PBLA 4LCBA 1IHOA 5KNBH 2Y77A 2JD0A 2WRZA 2GF0A 1P0IA 4UVEA 1QPZA 3HXPA 1T9CA 4OYLA 3UB4A 4DIUA 5JR3A 2X76A 1U94A 3IQFA 4XYEA 1ISFA 1OKKD 2DFNA 3ZI4A 2V0GA 3NHWA 3TQFA 1NLFA 4Q3NA 5EEHA 3M6LA 3KLNA 2IYWA 4MVYA 2BKLA 4NESA 1YB1A 1A9ZA 4ZARA 1LWNA 4RULA 1Y7TA 1U7DA 2FMHA 4YJ3B 5CVUA 1UXIA 2OAQ1 1LK0A 2GJAA 1WMFA 1AN9A 5KAPA 5SY4A 3E1SA 2EKZA 3B52X 5CBPB 4KTVE 1P62B 1NM5A 1QV9A 1R0LA 4DV6B 4LPSA 3KRTA 5AK5A 5LZ8A 4EFLA 1WZ2A 3QUTA 3TAUA 1BXRB 4X91A 2I66A 1UMCB 1JDSA 2RHRA 3BL5A 1XLTC 4WNYA 3MCZA 1BKSB 2QTLA 3HB4X 4NCAA 4CKCA 2HCBA 4G5QA 4E12A 1KARA 2QXUA 4EMUA 4OA5A 3AKYA 4IEEA 4FLFA 3H4MA 2QRUA 2EFHB 1Z75A 1V8ZA 5F52A 3ZUPA 4D9GA 5KDOA 1DWOA 1QWSA 3KYIB 2BEVA 3LCJA 4NCJA 4IS2A 1DJPA 1Z4MA 2YNMA 4I5EA 1TDJA 4RSHA 2YDXA 5IEJA 1DKRA 1AF7A 1XA3A 4ZQCB 3U1VA 1TQ8A 3WLFA 2QX8A 3MAGA 4DDMA 5F7OA 5KU7A 4RVNA 5JU6A 5KS2A 5AYVA 2YZMA 3MCAA 1H2HA 4OV6B 2YS7A 4PAGA 1ISIA 1CUXA 3A14A 3VKWA 3A3NA 1KVQA 4RCZA 5DN9A 1F6WA 3FPGA 2JAQA 2QB5A 2EQAA 1FFXB 4P34A 4UEKA 3TRHA 4CCYA 3S2YA 1S3FA 3H8VA 2GN1A 3EGWA 1ZD3A 3KV1A 3OA0A 1GUAA 3RRPA 5A0FA 3ONFA 1XJCA 8MHTA 4J6FA 4NR0A 3FXAA 4FGWA 4WASA 4E46A 4B7UA 1P4JA 2BGJA 3NH9A 3O21A 4HKTA 2HPHA 5CVTA 2A5LA 3UA4A 1PJ8A 1VB3A 2FWJA 3BJRA 3SS7X 3VV3A 3K0FA 3W78A 1NP7A 2XGMA 3CE6A 4N7RA 3K30A 1RAFA 4KUEA 3LLUA 4WJZA 5LA6F 4KAFA 4FMDB 1S2OA 4IQ8A 4QOEA 4B17A 3DC7A 3O2SB 4JSTA 4FTWA 1LH0A 4KGDA 3C1TA 2OM2A 2C4HA 4AF8A 3T4UA 4E07A 1YKSA 3IJRA 1E2IA 4MYHA 1UODA 3AERB 1UM9B 3WMWA 1IWBB 1G3MA 3WMXA 1W49A 5FUVA 1YVUA 4MLZA 3PEWA 3PX7A 1YAJA 1OPRA 2VJMB 3CONA 4L51A 3WGLA 2IUYA 1IUOA 4E4YA 2DKNA 3NEPX 1U81A 2WFZA 4JA0A 2DY1A 2VP3A 5DNDA 1UKZA 5GPBA 1Z25A 1NMXA 5TQVA 1Q12A 3ICOA 3E5HA 3PICA 3SF8B 3HXMA 3RB8A 4JJ6A 3FNIA 4N0QA 1I33A 1E4YA 3LHIA 3WKBA 4XXHA 3LKZA 4JKOA 3T1VA 3ZV4A 2IWRA 3EDQA 3PXXA 2YC4C 5FPKA 1KI6B 1ABEA 1XQ6A 3BA1A 5FF9A 3II6X 4WCVA 1GGFA 2QVXX 4MW0A 3ZNOA 4ACAA 1CLEA 5GOTA 4CLXA 2AG8A 1NZDA 1K5DA 5DHQA 5J1TB 5L7YA 1ZL2A 1E2JA 3IPAA 2EF1A 1GCOA 4GO1A 1LPNA 2Y99A 2ZATA 1J0CA 4KO4S 5FH9A 4MRAA 3T3PB 1K3UB 2YBDA 3A1SA 1U5BB 3AINA 3JAKB 5FNVF 3WFIA 5J2TA 2IGTA 1ISSA 2E2WA 4K0RA 2SBTA 3PLAE 1UJMA 3BEDA 5ALDA 3N0RA 1VRWA 2Z3WA 3CV3A 1FVXA 4WV3A 2PAAA 1B8NA 3LPMA 1AKWA 4GLFA 5EGSA 3ISTA 3I72A 1WHSB 4X1YA 1VCIA 2G5TA 3G2QA 1RACA 1EA5A 4HH3C 4R8KA 1RMTA 1U4OA 2W6ID 4DAEA 5IG2A 1SG9A 1Z5WA 2HEGA 3BWYA 5CIQA 3L8DA 1LNZA 4JBWA 4KGVA 3RANA 3CZAA 1G9XA 3RHTA 1EPUA 3KQMA 4V0MA 3RIHA 4BNTA 3PD0A 1C3OA 5TT1A 1B8PA 5JQGB 4LE0A 4NBTA 2OGWA 4KX3A 1EXWA 2P1RA 3BK2A 3EPRA 2PE5A 3WMRA 4LXQA 4KDCA 2HIHA 3GRKA 1SK8A 1XZKA 5GP1A 3PRKE 1DQPA 3HCAA 4HV4A 1WPXA 1ZHFA 1KKUA 4LOAA 4LSMA 4AS2A 3T3OA 1NN3A 1P18A 1XCLA 2EBWA 3M7IA 3TGWA 1EJ2A 1N33B 3KQNA 3OUUA 1WOYA 4UPDA 5AI4A 2QOEA 2RCYA 2Z83A 4W6ZA 3N2LA 3KZVA 1L4YA 3TW8A 2GJ9A 2RGUA 3A28A 4FFWA 2J9RA 4KB5A 2I9KA 4K6HA 4OJMX 5HRCA 2WQ7A 2TRSB 3L7NA 5EKSA 4CCWA 2O3UA 3ANLA 4URFA 2W2QA 2QN6A 1Q0LA 4GUAA 4KRYA 1X14A 5G02A 3SEZA 3PZBA 4UU1A 5KJCA 5T4FA 3TZBA 5JC8A 1Y3IA 1XA4A 3AEZA 5EE9A 1KC3A 4WXPA 2I80A 5IAEA 1IN6A 1WCV1 3KALA 5DNAA 5EJ4A 5KJ6A 5HBGA 3GAAA 3UWKA 4E08A 3C3JA 2A88A 5T57A 1A7AA 1Z0IA 4DLXA 1V16A 2H18A 4NMXB 3WADA 4DOMA 1KIFA 3B1JA 1WULS 4OHYA 3JWEA 3V4VB 4TV9F 5FUXA 3TFOA 1PZFA 4RK4A 3MTQA 1QFJA 1BVYF 1QRDA 3B8EA 5IAAA 5EE1A 5FOWA 2XXAA 1XE3A 2JLRA 3MJFA 1ULHA 1DJNA 1BCSA 2WINI 3I1FA 3VFDA 3ITNA 5FA5A 4MLPA 1GTZA 1JSCA 1W0KA 3GXBA 4PGAA 3IOMA 3OZUA 4A10A 4C7XA 4C76A 5BN3A 4D4JA 1U2QA 4B3BA 2OLKA 8ABPA 3I9FA 2R7KA 4FHFA 4JLAA 5JOQA 1JH9A 3ZDQA 4D6YA 4J7CA 4FOOA 5IJ9A 1A98A 2ZBPA 3CBQA 1E1RA 1ZM9A 2EW1A 4B75A 3OT4A 2F00A 3OSZA 1BX3A 2D2IA 3LNCA 1W6UA 3N05A 4JOSA 3SEFA 3UO8B 3WB1A 4HCJA 1A9QA 1K6MA 3OX1A 4A6PA 3ESBA 5FADA 3C45A 3FPAA 3LXRA 1MJNA 2QRZA 4K6CA 4YRQA 4HLDA 2B8JA 4RL6A 2JVKA 4EJ0A 1FUIA 1K7FB 4RGBA 1HX7A 5DN6A 5KDLA 4B3FX 2H5LA 3T0GA 1DKLA 4ENPA 4WZ6A 2PN1A 5F3RA 3ZXXA 4S04A 3U5TA 3F5QA 1U6JA 5A2GA 2H1HA 4GP6A 4HS4A 5C81A 1QH9A 2CGEA 4OK5A 1XCJA 4ZJUA 3AR2A 4YPOA 1JBKA 2CBXA 3C98A 3GVXA 3C5WP 2HREA 3EULA 5HIIA 2X8WA 4FI3C 1IXYA 3WL3A 5CDFE 2D7CA 1LQUA 2BEJA 5AXCA 1G6KA 2KB0A 3K5HA 3GFSA 4C2TA 4BJ6A 5BWBA 1PFVA 4PWYA 2C1ZA 4EHIA 1WXGA 1XL0A 2Y9PB 3MYRA 3ZJUA 5T8KC 1OFTA 3CLVA 2AL7A 1CNMA 3RV3A 4YV2A 4NV0A 2C4WA 4XM2A 2CT8A 4YUYA 5L51A 3HKCB 3PHBE 5E7JA 3ECAA 4LJ8A 1DC6A 3VR5A 5HKKA 4KXNA 1TXGA 5F2EA 1R37A 1OZ0A 2J33A 4FE3A 1MABA 2GBCA 3I0MA 4WZBB 5CEJA 1P1BA 5L3SB 3I9MA 4RGVA 4EI8A 1WPQA 2H59A 1LRJA 3BIWA 4JL5A 4RMNA 4JJ8A 5FFFA 2W2TA 3M8KA 5A06A 1Z06A 1MX9A 1I4EB 3VI4B 4IX9A 2BHRA 2QKYA 1RKBA 3X1MA 4DRYA 2ACWA 4QQ8A 3QF7A 3UTCA 3ZJ5A 1P81A 2IYLD 1T35A 3ND7A 2RGNA 3FPKA 4BMOB 1TJPB 4QEKA 3AHDA 5IDYA 5BSTA 3RS3A 4LMRA 3M6WA 4C78A 4JWKA 3OP1A 1G59A 2Q5EA 2O8BB 1C9MA 3CZRA 3DHYA 1OASA 3RIYA 4YMVA 2BKEA 3Q5GA 2R5WA 4R2WA 4LRYA 5ALHA 3BA6A 1PFWA 4N1AA 1OYWA 1B7GO 1P3Y1 3U7FB 3KQWA 2WLTA 1GGJA 5FBWB 1HYHA 1NJ1A 1O94D 4RQAA 2JHFA 2FZKA 1EYZA 4TQGA 5JYDA 4G0QA 3HB5X 2FQ1A 4DSZA 2FN3A 1VMAA 4JL6A 4JQZA 4GWKA 3RTAA 3TEMA 4F93B 1PEKE 1WAMA 5IC5A 2XZLA 4XZ3A 4J7AA 3NKFA 2CNNA 3G9XA 1HT0A 1Y98A 2YOHA 1XO1A 3Q8WA 1O3YA 5IVDA 2PRIA 3NGMA 4MV4A 1RI1A 1QK5A 4IOMA 4RH0A 4GPBA 1RABA 3PGJA 1ZH0A 2EDAA 4FR0A 2O05A 4M98A 5DSXA 1GT6A 1T91A 2FW9A 3HKCA 4J1NA 4PRZA 5KQGA 2PPVA 4E21A 4IXWA 2ZRLA 3NOXA 4FCTA 3RI3A 4NCNA 1X94A 1NDUA 4OHXA 5BY2A 3B82A 4ENUA 1WDLA 2V0NA 5I7EA 4EYGA 1W9HA 1L1FA 3NKLA 1O03A 1YZHA 4PM4A 4UHKA 1OQAA 3OY2A 5EXSA 5ITZA 4URWR 5FAKA 1X15A 1D5CA 1BYUA 1G1MA 3Q7RA 2VNJA 4HWTA 1E60A 3SF0A 1X7GA 1L4BA 1KYWA 1NBAA 4C2BA 3ZEIA 3AG5A 4D8XA 3U3KA 5INTA 2NU9B 4YT2A 3DTVD 3IHTA 1FDIA 4LMBA 3DEAA 3GUUA 4FR2A 4R41A 2VHJA 4I55B 4LHSA 4QJBA 4TTIA 1HE4A 5EESA 4KYTA 4H16A 4ETWA 5K3OA 4JB8A 4IYRA 3FIUA 3I05A 1T5TA 2ID9A 3MINA 3PHGA 2ZDQA 1H2EA 2IYTA 1KQOA 3MTBA 3OTGA 4LQ4A 4PC3A 2PZKA 2IBTA 1FBNA 3PS9A 4CFYA 1KJJA 3VKFA 1PFUA 1TM1E 3MBOA 4BKMA 1LRKA 3GJ6A 3RROA 3JYNA 4DW8A 3M6FA 5BN4B 4KEAA 1GNVA 4FFMA 4Y2VA 2NPFA 3X1YA 4B82A 4F8EA 1ULZA 1D0SA 3KVNA 3DCNA 2IZ1A 3R3VA 5AUQA 1A9TA 4D43A 5BXYA 2PV0A 1FP4A 2HA6A 4JBGA 4KBFA 5JAHA 2PYZA 3N8NA 1WXDA 2CWWA 2VXYA 4URXR 1Z7GA 3EGXB 3TQSA 3W6PA 1AXRA 2BFNA 4FW8A 1WABA 3NFRA 1MG5A 1P1RA 1BEZA 1R0SA 3ORYA 3S8YA 1E32A 2RAUA 2W6JD 3PQCA 1TZBA 3E81A 4G56A 1KO4A 4HOYA 4RA9B 2JCXA 4ZI7B 1KZ9A 3A1WA 1GZVA 1ZAKA 4YP0A 4CIVA 4KXWA 1YR3A 4ZCPA 4KWHA 2NAPA 3RTDA 2PX2A 3FTDA 5FR1A 4C2AA 2QUBA 4XH9B 3C5HA 4TXNA 4DPMA 4IY1A 5KMGB 1VP9A 3ABQB 2C8KA 1G4UR 3WGVA 4YRKA 3I9JA 3C6XA 1FL9A 5AH0A 2E6UX 3TSYA 1Y8CA 1U8FO 2DP4E 2C3UA 2RHGB 4I4TF 5AM1A 4ZMSA 1I4LD 4YWJA 1KVRA 4XIFA 5DIFA 5KYTA 2G9UA 4M0EA 4R9VA 4N8SA 3BN3A 3W2FA 1SD2A 3UT6A 5HFJA 1N5LA 5SZJA 1FUOA 3NTOA 4HB0A 4WEQA 3ZIUA 3EMDA 1ZKMA 4K87A 4W7SA 2D5IA 2IYUA 2QTHA 5CFOA 3TL2A 4CDNA 1BEEA 3CEPB 4DMGA 3ENKA 2XD9A 4R81A 1H1LB 3QPAA 2XD4A 2PS1A 4QU8A 1QRUA 1AMOA 1CHDA 5EXPA 2O7VA 1ZVMA 2GEUA 4PLFA 3KQQA 3JW8A 2Q5IA 2B20A 4HDKB 5EZYB 5C4GB 2GM4A 2XVXA 4TLCA 2FDCA 2DOKA 2ZTUA 5BQXA 2I6TA 1ZXXA 3WGKA 2O5EA 2A14A 4FFDA 5EZSA 4WKNA 2J7PD 3O8LA 1VGVA 1G2OA 3EVTA 4XD7D 1BSVA 4RKQA 1NC3A 2HDHA 2R6GA 4QBHA 1IUPA 1GXSA 4CEHB 4C5BA 2V03A 1D6NA 3MINB 5I01A 1TADA 4D9IA 1IY0A 4XB2A 4Y2YA 1L8QA 3WIUA 2I91A 4PHGA 2BMFA 3LY7A 2P65A 5LB2A 3WJ7A 1BKDR 5CM8B 3I83A 4BO7A 4BQPA 2NQ2C 3GJSA 4X45A 4OGKA 3EIXA 3WWZA 1N7JA 2DHRA 3EZXA 1TJUA 5CYFA 1HE5A 3ESCA 3HJHA 3NBYC 3TN7A 1M2GA 3IBGA 4KX5A 1MQAA 3VHQA 1TYEB 3FYDA 1QS0A 3SQLA 2CL6X 2F3QA 4TRMA 2UYQA 3BXPA 4C04A 1QK4A 3HM2A 2GVDC 3NNSA 3VJRA 1ZMXA 3E4CA 4UHFA 3TZLA 3UKOA 1A04A 1WY7A 2QTVB 2V3VA 4BFTA 3TNDA 5KYUA 3VH3A 1B2LA 3E7XA 4FEYA 3M83A 2P2YA 2CLKB 1UR5A 4DJTA 1IQUA 3K0AB 3IQZA 1WXWA 3HFGA 4IIFA 4JR0A 4HDRA 1IK4A 1U0FA 1PDWA 3F4LA 1Q0UA 1D2NA 3FB1A 4G84A 3S70A 3UENA 3ZWDA 3FGNA 4ZJPA 4JJGA 3PD7A 4Q93A 1T3ZA 5HW0A 3NRCA 3WOVA 3K8QA 2NUBA 1G21A 3NOQA 4WUTA 5B7PA 3K5PA 4QUAA 2IPAB 1VLMA 3B9PA 1BDMA 5JG7A 1AS3A 3DCJA 3ZYZA 2JLVA 1J2TA 4FFLA 4R1MA 3CZ5A 3GNQA 3I2YX 1QCYA 3U3XA 4LEIA 2REOA 1Y8QB 3GRRA 3QMPA 4ZC8A 1WZIA 4MVXA 1I80A 2VH5R 2IHVA 1T8YA 1KTIA 4IICA 1PR5A 2P3LA 4P7GA 1F6BA 3G79A 3ED1A 5DTEA 1SZJG 4KAJA 3M34A 4HVCA 1DNPA 3WLEA 1NW7A 2PKEA 2VZLA 5F1OA 1YZLA 1Y4ZA 1SVSA 3TZQA 2VAWA 3X1JA 4BVBA 5FPPA 4F1KA 4RTRA 3F78A 4EO4A 3ROKA 3OJXA 1N2EA 3OKAA 4UHHA 4A15A 1XRMA 1MH9A 1BWPA 1XVTA 2IF0A 1QCZA 4UARA 3TB6A 4DCSA 4S1NA 3RYFA 2MYTA 1ZLYA 1Z28A 4R54A 2Y76A 5FBQB 1FFXA 2VDKB 1B74A 3O95A 1S4QA 1JJVA 1YH3A 3QQPA 4JU9A 3T9FA 3COWA 1UH5A 3VSEA 3WLRA 4A0HA 4B46A 4DJAA 4N48A 2HJSA 2DR2A 4PX5A 3VNBA 3MELA 5DLQC 1UKCA 1URPA 1ZONA 4IXMA 4LXXA 4DYVA 3ET5A 4DY4A 1PDOA 1QIDA 2ZRAA 5GWXA 1Y6GA 3CRW1 2ZUTA 1TM5E 4K9MA 1W5BA 2D2EA 3QWBA 4I50B 1M34B 2DWCA 3I8SA 4OYYA 1QS0B 2IHZA 2NAFA 1Y3HA 4NH4A 4NPCA 5K09A 5IF3A 2Y0BA 3OC6A 3P2EA 1EXNA 4KVGA 4DIDA 4AIRA 4RJIA 1N2ZA 4NJOA 3VTKA 1Y34E 4JHLA 3WYDA 4TSRA 2GH1A 2Z8XA 4WNAA 1UJ2A 1CUFA 1IAVA 5F1PA 1I4WA 4QYIB 4LNHA 1ZIDA 3V2IA 1NWCA 3L1VA 4RTMA 4IDPA 1JDUA 1UWCA 4KE9A 2QORA 4W5JA 4KWIA 5A5EA 3MS7A 4LRXA 4OGLA 1UXKA 2RH9B 4JLWA 3OF2A 3FZGA 2Q0QA 1FYXA 4INJA 3E5NA 1OAOA 2A1UB 1XXHA 2QUKA 2VJOA 5K8IA 1HNWB 4YMIA 1N0WA 2P9GA 3WYCA 3FMPB 3SEQA 2ZCUA 2XCOA 3D31A 1AQLA 1VG8A 1L4HA 3EW7A 4PAWA 4LDNA 1Z2CA 2N47A 4LDJA 4MVJE 4NK4A 3E7PA 5HCUA 3L4JA 4E30A 1BN7A 1R2QA 2B8TA 3P9NA 1W36B 1DCMA 3FETA 4AJLA 2FEKA 1Y0BA 2QD2A 4GFDA 3V1KA 3A4VA 4TTSA 4XI9A 1CUVA 1T2DA 5JEEA 1KJNA 3AI3A 4QUJA 1T1RA 3WLNA 3T1TA 1BDJA 1G60A 3OOSA 2PNFA 4OTZA 4QVIA 1JDZA 4JV5B 4HATA 4E5SA 4BEVA 1SIWA 5HA5A 1ZICA 1HZZC 4W99A 4ZCTA 4KHPB 3ESDA 3HXOA 1UFRA 5BNFA 4F84A 1IAQA 4FEGA 2PUTA 2I4LA 4FDLA 2YL2A 1A8HA 1EWKA 3TFQA 2GD1O 3S99A 3KJZA 3I2IA 3EDOA 3STUA 3FUXA 1MC4A 4Y98A 4Q15A 5HM8A 5ISMA 2IU0A 3WIOA 1TNDA 2M1XA 4G3XA 4GUDA 5AR1A 3GJZA 1FEZA 1O8BA 3JQFC 1N5OX 4WNAB 2PPLA 1XTBA 4XIJA 3PNSA 3B89A 1NJSA 5K8UA 1GRNA 1ZM4A 2QLJA 4DBVO 3HN7A 1XMPA 2WA1A 5EP1A 1EUQA 2O57A 1JFFB 2I4MA 2XCUA 3HA3A 4YXFA 3GGGA 4TT8A 5LDDC 1SXPA 1GUDA 1PQWA 3F7OA 5DHSA 1E0SA 4YRAA 1AJEA 1G3QA 1G7RA 1X1SA 2GEFA 3LQFA 3LO5A 3OCWA 2EJTA 3PIDA 1ZJ4A 3ZCVA 4C07A 1KZHA 2J3IA 1A82A 4MWCA 2W11A 1J5PA 3VPCA 3ZTYA 4POOA 5AKGA 1N92A 3C5EA 3B1YA 4CZ2A 3W5IA 1NF3A 2YWFA 3G2IA 3N28A 3KJFA 4FI3F 4ZVUA 3S5JA 2O14A 4BDSA 3UFBA 1GDTA 3BC1A 3OE4A 5CIWA 1JHMA 1JX6A 2ZULA 4QARA 5KQSA 3IQXA 2ZT7A 1CQZA 2IXAA 5ICEA 2A35A 1YA6A 4L0MA 4YAWA 3PIIA 4QEDA 3BH6A 2WZBA 3ROMA 4E03A 4TRNA 1D5WA 4BWVA 4RV4A 3CVOA 5CA0F 2F43A 1OGJA 2CB9A 4I5IA 3GNSA 1U9CA 2HCTA 3TMYA 1UXGA 3QNWA 1ECBA 3DXZA 3P52A 1KOLA 4RFVA 4BNXA 5KNDD 1L7RA 1XEXB 4UBMA 1L2TA 1XCMA 5AW3A 2JD1A 3WX0A 1WJGA 3DFIA 3AP1A 3BTOA 4YJKA 1H85A 5BMVF 4ZVOA 3V4ZA 2FWNA 1SVUA 4G4IA 4R3WA 3W5JA 2WJ4A 2XZOA 4PNZA 3SDSA 3TJRA 4EW6A 2Y6VA 3CBGA 3PGA1 5FTJA 1AS2A 1B3RA 2A30A 2JVJA 5CTJA 5FHRA 4HPXB 4E33A 5IVPA 1HMPA 3UMYA 1XAIA 3KU1A 1J2UA 5AOCA 2GHRA 5DMHA 1HLFA 3HJBA 4FFBB 4R8RA 4F4FA 4NE9A 1GFWA 1G5FA 4BKQA 2G28A 4LSGA 3EVBA 3D8HA 4HNQA 2LIVA 3NYIA 3CN9A 3MQ2A 4YREA 2CBGA 2GZRA 4EYOA 4RXUA 3AB7A 3OZEA 4CQJA 1ANKA 3L8MA 3MAAC 1ZDMA 4DCJA 2PR7A 1VCOA 3IE1A 2ECPA 5G0TA 2XVMA 3PGKA 5EXDA 2R47A 1RJFA 2KHZA 2Y27A 3UMSA 1JR2A 3G6KA 5FWNA 1P0CA 4K40A 3O82A 4FCCA 1VIDA 2PO5A 2WPNA 3BK7A 5I4CA 3VDNB 2CJYA 2FRXA 3OEEA 2HQOA 1NF2A 1DAEA 1XNRB 2WILA 2D62A 2PUVA 1UPCA 1QIGA 221PA 1KQ3A 1ZG3A 3I28A 3LLSA 3V97A 1YFKA 4LC9A 5CAEB 1X7ZB 1KDVA 1KOJA 3R24A 2HJHA 2VTEA 1FUKA 3IURA 2W6NA 2YNMC 3OFKA 4TM7A 4YJ2B 3TQRA 2PWYA 2PS3A 4PGHA 1PZEA 1ZBDA 2YN4A 4N8DA 4Q82A 3WGYA 5EE0A 1TZJA 2GT1A 4JMPA 2OPHA 4B4DA 3Q0IA 3L92A 4YUVA 2Q4TA 4E1BA 4ITRC 4OQNA 2GI4A 4L7QA 4HDAA 2UXBB 2J9GA 2DTEA 3FPHA 4DA0A 2V7QD 4IBOA 3KKZA 3L4EA 3RSQA 3P0FA 3RADC 4MINA 2QTTA 4GMDA 4F85A 1IY8A 2IH5A 3HJTA 4RVDA 4HNVA 4WLOA 1PFGA 1Y81A 5G53C 4A2WA 3N6RA 1RC0A 3GVCA 4COKA 5B7QA 5C7YA 2XCSB 2DRIA 3D2CA 2N75A 2JEOA 3GCZA 2ONYA 1FNMA 1HF3A 121PA 4H1TA 5A02A 4FNOA 1ZU4A 3I8XA 2PX0A 5E9QA 1EDOA 2H9YA 3WQQA 2PKQP 1JEYB 3H8WA 2IUUA 5AVOA 3IEXA 3CVWA 2PLNA 2VYND 2IDZA 3SIWA 2C00A 1J0DA 1P4SA 2QMYA 2VFAA 3HBLA 4JLSA 4LV6A 2FR1A 3KKPA 3WTCA 5AIAA 3DM5A 5AXAA 2FEAA 4YCBA 1Q19A 1T6BY 2MMGA 3HZRA 4AKHA 1CCWA 1XZEA 5D7BA 5AM5A 3T7RA 2AFHE 3UOGA 4A2CA 2EL7A 5A9RA 1VSTA 3OBBA 5EMJA 1DCFA 3ENQA 3G7SA 4JP2A 2XTMA 1UCFA 3H4IA 1Y3CE 4RHXA 3NPMA 1OBFO 3ZHXA 2F1RA 5JJ5A 4W9MC 5D2CA 3LXXA 2RCNA 2I3GA 2J08A 5EMHA 3WQBA 1SVIA 2EFDB 4BLUA 3IBYA 3HA7A 1CNEA 2G8NA 1WPRA 2JIMA 3A6FA 2PZJA 3INRA 3OLXA 4R83A 1W4BA 4YAIA 1GZ5A 5ALFA 1HFKA 4AXXA 1FQJA 1GQOA 3HC7A 2ZR7A 2P6NA 5HP4A 2AOTB 1O0CA 1JRLA 1W2HA 1RJGA 1GILA 5FOXA 2J6HA 3FR7A 1R6UA 5FYDA 5KYNA 2I7CA 1E89A 2Q1UA 4JUAA 1WZEA 5ERYA 4DBLC 2WPDD 4TGLA 2G70A 2P6PA 3R7SA 4ICIA 4TZ0A 1O97C 2V7WA 3NETA 3REGA 3TLGB 1CY2A 3FGZA 3IKVA 4BNDA 4LDAA 2VP0A 4QGGA 3U81A 4DJEC 1II8A 1N57A 1P17A 3A1VA 4B3GA 1PGPA 2IY7A 1FYVA 3T9EA 1JN0A 2EFYA 1R5JA 4G23A 3C7KA 4MKXA 1J8DA 3PPIA 3VHXB 4M9ZA 4PTLA 4PCAA 2GXAA 2PGXA 2XWPA 4NLLA 2YHIA 4KK4A 1ZD2P 2WF5A 3GFOA 4EA7A 2IZ7A 3GCWA 2CE2X 2BDEA 4IXNA 1J09A 4KIJA 1YFEA 1KGSA 4YAKA 2BN4A 4P7KA 1BNCA 4RK7A 1OFUA 4X6LA 5JS7A 4H6VA 4WSOA 3VBCA 1SQ0A 3GR6A 1ZIXA 5ADWA 3PUXA 2JI8A 1AT1A 1YA4A 2NT3A 1WKCA 4QX6A 5IW8A 1HLPA 4LRTB 2W4QA 2Q6TA 4ABTA 1C30A 1TA9A 5DNEA 4PLZA 1TE2A 3VZBA 4LRQA 4QODA 3IXQA 3Q6NA 3FCOA 1ABFA 1T8RA 5HK8A 1JFRA 5BUCA 5DGIA 4BZPA 4PYKA 5EQJB 4AY2A 5DGXA 1IHDA 4US0R 3DVRX 3GRZA 3JASB 3AOGA 3N2NA 3O9VA 1EFVB 3WHKA 4DG9A 5IDQA 3PE6A 5EKUA 1ZN8A 3DWGA 2B82A 4BO3A 4C6TA 1IK6A 5DE3A 1T8TA 2HDOA 3HWX1 3ILXA 2CB0A 5CPFA 1Q5NA 1YS4A 3RT9A 4MUEA 1B93A 1RS0A 1H05A 1UWKA 3B5JA 3EF1A 3BMCB 4DLYA 2HZBA 3RTEA 5IN5A 3G85A 4B6SA 1MAWA 3ODGA 5JJIA 3B38A 3Q2IA 3R5SA 4YJHA 1P1HA 3KYBA 2V6JA 1G5HA 3GFRA 1Q6YA 1E7YA 3MGKA 4NE7A 4XFJA 5AKKA 5L4NA 1ZOPA 1E79D 1VXOA 2GGSA 3L7AA 4JYCA 3CCBA 1VL0A 2RK3A 1DP4A 5GVRA 5KMGA 3AUXA 3TW0A 1S1MA 2VXCA 3I92A 2HBRA 4YV1A 4UVDA 4OHMA 1ZNYA 3NO9A 3K92A 3V7WA 3VR0A 4EZIA 4JDUA 3SFVA 1QYCA 3HXLA 3BHMA 4HB4A 2X8BA 4PYJA 2EX1A 3CN7A 3PWSA 4IQGA 3N8KA 4R2KA 3K9WA 2OVFA 1L5VA 1U7OA 2Z1NA 3DBHA 1U0GA 4ZO8A 1F2UB 4B45A 2V5AA 3FUWA 2X0JA 3IVGA 3FPLA 4XD7A 1ZYUA 1S7GA 1GU7A 1KJIA 3MWDA 3TEFA 4KGXA 1JPNA 2YN0A 4HYYA 2B2XA 2Y0EA 5E0OA 2R1UA 4FFVA 3N07A 5GINE 1DIGA 1JLLB 1JTEA 2FWIA 4EJ6A 3EPLA 3BXGA 1K8QA 1D2CA 2P75A 2GS9A 4TV9B 5ALIA 4ZRMA 3GU3A 4DREA 3MERA 1NULA 1J70A 1UC4B 3R8CA 3VYUB 2P9HA 4RQBA 3BQNB 1Z8NA 4H3VA 1DC3A 4MLDA 3MJRA 4GR4A 3C0KA 3WWCA 1NVFA 2I6GA 3ONDA 4GPZA 1CERA 1EUZA 3CKYA 4FMBB 4U9IS 3ZCRA 4IP0A 3W79A 3E3AA 2UDPA 1MAHA 4O08A 3ZC3A 4ETMA 4M86A 1APBA 4MQEB 4B5LA 1XWOA 4RADA 1ZK0A 5ECGC 4QUKA 4R40A 2NSYA 4PFKA 2V9ZA 1M34E 2ACVA 1J0XO 3P9KA 5JCOC 1H6BA 2GRJA 3JX9A 2JHAA 1X13A 2A0XA 1KDOA 1K86A 3QU4A 4OUKX 3QE4A 2ZR8A 4KGZA 1Q3HA 2F17A 3EUAA 5H0IA 2HY7A 4Q3AA 4ESOA 5BT8A 1NU6A 3V2HA 3KX2A 3GFTA 3UJPA 1YA8A 4EW3A 2FF7A 3HB7A 1NVMB 3BTSA 2IW3A 4WJKB 1P1FA 2QBYA 4HADA 5A0VA 2QWXA 3ZLVA 2BONA 1CPYA 4ZIRA 4HNUA 2HF8A 1GPMA 2VAVA 3DLCA 2C96A 3HEMA 1SOVA 4BKRA 5IT9A 5A0TA 5LXTB 2KQUA 1ZRSA 1ZSYA 3H3XA 5ALKA 4BO0A 1T9ZA 2FB9A 4DR3B 2J85A 3E8SA 5C37A 3OAAD 2WYOA 2RDMA 3HQ4O 4L5IA 4L4SA 3KEFA 3PPVA 4RJJA 3ZV7A 3O4HA 2E4ZA 5B1IA 3LZCA 1H3NA 3D6VA 3GJ5A 5B53A 3K73O 1TF5A 5F2KA 1C8VB 3AUYA 3RRXA 1FJGB 3VR4A 4MHSA 1DOAA 4DLTA 5KNBA 1R66A 4HTFB 1N3LA 1IY1A 2ZIAA 3FWKA 4GKJB 2COUA 2WJZB 2XHEA 2LCIA 4MOWA 3PI7A 3ST7A 2HJVA 2QRMA 3I6IA 4ED9A 5AW0A 3ZGNA 2K7FA 2VYFA 1BIFA 4CETA 1BU8A 4LTMA 5BSRA 2L0XA 2OHXA 4EHLA 2F1JA 4ON9A 5LN1A 4QELA 5JMPA 4C0SA 4QGHA 4TXMA 1U65A 3DQZA 3UMBA 3A1TA 4MZDA 2VRBA 4C3OB 5CEFA 4FKZA 2ZEJA 3Q88A 2XCLA 3F8TA 2GDZA 2B83A 2BJVA 3AB8A 3AVOA 4RHTA 5GVSA 2RKOA 4WA8A 2WG2A 2BKAA 1G20E 2ODBA 1HYBA 3KTFA 4X6YA 4CMIB 3W4IA 2ES4A 5HJ7A 1J2EA 3G02A 4EAQA 4X9XA 5T4HA 4F72A 3QMVA 1GPDG 4A0FA 3KHTA 4UBOA 1O2DA 1SXGA 2IEAA 5C46F 3C3PA 3FPJA 1MB9A 1XDZA 1P60A 1SG6A 2AMVA 4C22A 5KNCA 1GU1A 2QA5A 3KUCA 5HHTA 1Z5VA 3HCBA 1WCYA 3PRHA 1AB5A 4JX8A 4F7DA 4MW5A 2I6QA 5A4DA 4MP8A 1RCFA 1UBNA 4LYJA 4B9EA 4KITB 2XKJE 3PA6A 3O90A 4R2HA 5KYKA 1R0BA 3CF6R 4HWRA 1KQPA 1B14A 1QKIA 4MJ3A 3K0EA 4BNVA 2D4AA 1N5RA 1HFJA 1P39A 3A9TA 1E92A 3G5UA 3M2PA 4GP9A 4YQZA 3PVSA 2YFQA 3AT1A 3O4IA 1Z0DA 3T06B 4DCUA 1MORA 1Z4NA 3EW9A 4Y9TA 5CDHA 4RTSA 1T9BA 1F48A 4OYRA 2XAUA 2HUPA 5AI8A 1YASA 1UBMS 3MSXA 4PC1A 2GA8A 3A0UA 4YN3A 4KC0A 5I4KA 3U5ZB 1NJ8A 4QXRA 4YRNA 1A9PA 5L53A 1E5DA 4J0GA 4DCMA 2W0MA 3H75A 1JKIA 1JMKC 3NIDB 2R11A 4G81A 2OBNA 4G9GA 4M7OA 4WXMA 2GEVA 4R9SA 4OAQA 4Y0AA 3RVQA 2XUZA 1BC5A 5E6SA 1ZY2A 4GZ6A 1BA2A 1QR2A 2EJBA 2WSBA 4GVLA 3AESA 3LD9A 1NVUQ 2WVAA 1JEEA 4YAFA 1NMQA 3IAFA 2OA0A 4BVEA 4B2PA 5AI9A 1YS6A 5K3BA 1CQXA 4FIDA 3NWOA 3VU9B 4DLVA 3TZKA 4KQKA 2YWRA 1GD1O 3HABA 4XYBA 2Q5OA 3X44A 2Z08A 5C52B 1EWYA 1GYRA 1KP3A 4IGEA 3TVYA 3VQTA 1C7FA 2ARKA 2JCVA 3N5CA 2XZTA 4P4SA 4I3HA 2G82A 1SUWA 1VE6A 3L6DA 4MI3A 4DHEA 2VWQA 3DV0A 4FJ2A 3THXA 3DLBA 2GPBA 3TZHA 3PHLA 1E63A 1CY6A 1LQ2A 3H5OA 5EOVA 3UK7A 3ZOZA 1I36A 2XRFA 1YB5A 3K94A 3OZBA 1C50A 1CU1A 3SJAA 1CE8A 1GCAA 2ORVA 2WP0A 4AJNA 4EG3A 2C77A 4M0MA 1QSGA 4R1LA 4DLBA 4OK3A 3WRWA 3QVVA 2OMKA 3OT1B 2ZAIA 4D9BA 1ESDA 1FTWA 1CUWA 2FEOA 2OHJA 3HRHA 2D0IA 4M7WA 4M7PA 2ZRJA 2ZBDA 3H1PA 3X1DA 3UF0A 5JD5A 2V8BA 1RE0A 3NLLA 2BDUA 1UPXA 3AQ4A 5IMBA 1NI4B 1T9DA 5EWLB 2PUFA 4O2AA 3IAS6 1O96A 3NM4A 2BHTA 2AD5A 3K53A 4OB8A 2BYTA 4YUXA 3FYUA 2NM0A 2UYOA 4MS4A 4BU0A 2BZ0A 5JNVA 3M1LA 4S2UA 3ESQA 3TSOA 3HBJA 3LLCA 4MS1B 5ITSA 2WAYA 2JZOA 4TMTA 1S2NA 4BBJA 2ADOA 1UDRA 1RRVA 5DTMA 5EIBC 3UAXA 1SZPA 3JQBC 4GX1A 2QZ9A 4N7MA 4QLBA 2VHCA 4ZYWA 2F59A 1RFGE 2WYHA 3GAFA 1YKGA 3IDSA 2WNSA 3GDGA 5AVRA 2Z2XA 2F6RA 1MR3F 1RP1A 1QYXA 2O2JA 2WF8A 4RDXA 3KQTA 2CUTA 5A5GA 4P58A 3U37A 4LDRA 2H4HA 3JQCA 4RPGA 3ZHBA 1DBWA 1XQ1A 4NFHA 3IQHX 1ORVA 1H0KA 4UTPA 1QWOA 4LOIA 2Q4DA 3TK1A 1LSSA 2OYRA 4Q9KA 3GPIA 2QRPA 1DX6A 2WTUA 2PH3A 3IAM1 2H1FA 4IAOA 3TIGA 1VA4A 3ZVNA 4KJZA 4LSZA 1KY2A 2HBYA 4Q4HA 3VI3B 2OP0A 4YUZA 3IR7A 2DUMA 3A11A 4MKZA 2OAEA 4REMA 4PN3A 1YQQA 2W2PA 2YINC 3FZEA 1ODLA 3NAMA 4MIEA 4Q9LA 3T7IA 3BAFA 4B71A 1UBHS 5FAXA 4EVSA 3IP7A 3BF7A 3NTQA 3A1UA 2JGDA 4CM9D 4ZGGA 3FVWA 1GQQA 3THXB 1Q7RA 3ANXA 4RD1A 1QXSA 2BISA 2XYPA 3K8ZA 1G1AA 3DL0A 3PQ2A 2OXCA 1IOLA 2J6BA 5J43A 4CF3A 1ACMA 1KE1A 3D4LA 1D4ZA 3FFWA 4AAYA 5AOVA 1FBTA 3VX3A 3B6KA 1G21B 2J5RA 2WD9A 3CRMA 3VPSA 1UZAA 4OJNA 1TM2A 4EZBA 3M3PA 3AUSA 3ILVA 4D6PA 2ZI9A 3CF4A 2EWWA 1Z18A 1ZI8A 1U2PA 3QVLA 1AUQA 1IG3A 1UMDB 4MQFA 2OYCA 3HVRA 5JAQA 3CZCA 4GWGA 3QQ5A 3R3XA 1AKVA 1K7SN 4JX9A 3V2GA 1K3FA 3T0IA 2A9PA 4RDIA 4XX1A 2WHPB 4DEYA 2O59A 4A92A 3AUKA 2WG1A 1RZUA 3DUFB 4ZK2A 1JA9A 2VKQA 2IHYA 1E2QA 1HETA 1W59A 4ZAFA 1DT3A 1XCGB 1CUBA 3KZNA 1ONPA 3L6CA 4LFCB 1P61B 2X5KO 2XX3A 1KZ4A 5A7HA 3DFUA 1F2UA 1ABBA 1EBUA 1JHQA 3UJCA 1L7MA 1VJCA 1I2BA 4L3WA 1UBRS 4FLEA 4D02A 2ZYAA 4H7DA 3SCZA 5MN4A 3F7MA 1A5AB 3FW1A 2Q62A 2AUNA 2XMGA 3EBLA 5B3JC 2IU6A 4EHHA 3FKSA 4Z86A 3SLGA 1N5MA 2FX2A 3O4JA 5AK4A 4KFCA 2HLPA 3FUTA 3KYDA 3D8NA 4A5SA 4WNIA 4FZ5A 3D6HA 3SD7A 1PW7A 1DEAA 1HV8A 1Z8HA 2B3DA 2WUDA 5BOSB 5CXQA 1BXGA 3DDOA 5KQPA 1NUAA 1V5GA 3LPCA 2ATEA 2QX9A 3OHMA 2VF8A 4WLVA 1C3UA 1U9JA 4UHDA 3RT1A 5SICE 1I0AA 1LPOA 5K0TA 2QN1A 3ONNA 2XHZA 3FCCA 4RWZA 2J0EA 1TK2A 4FN4A 3W2TA 3Q9NA 1V8BA 4POAA 5A5FA 3IP6A 4YMGA 2G5GX 5KNDH 2WFLA 1I3LA 3QPWA 4YJ3A 4KR9A 2O6LA 1T25A 3RFFA 4P4LA 4URYR 2WU1A 5CIYA 3PX2A 3NTLA 2DTDA 1DKUA 4HGRA 3OA2A 1ILWA 1N8NA 1O08A 3TQCA 3CNLA 4QL3A 5IXYA 2WWRA 4MEBA 3DDWA 4R7ZA 2PZAA 4FGUA 1FOEB 4OB6A 4R2IA 4Y9RA 4MQMA 2Y3IA 2AZXA 1R3UA 2J30A 4MEJA 3FUVA 1J2YA 4WFJA 2OMEA 4LSWA 1I2DA 2OHVA 1UMKA 1QTRA 3V8EA 2O5CA 1N3BA 4RY8A 2OKCA 4PO8A 3PQFA 3O8CA 2JA1A 3GQBA 1V1MB 3PEVA 2EJVA 2WD7A 5BQPA 4C3UA 3THYB 1DG1G 1VSUA 3SGLA 1O94C 2ANCA 4RVCA 5TVGA 3IILA 1YOBA 1POWA 1F2VA 2G5PA 4HGNA 5KTTA 4RS3A 4HQKA 5FTLA 4Y0NA 3TXAA 4DNXA 4KN5A 1FFAA 2BHLA 4HYTA 1E6UA 1II9A 2C3PA 4G0XA 3KLBA 4ZQIA 2H1LA 2G09A 3VR4D 1O57A 4HS9A 3WBKA 4C4RA 1SUIA 3LBIA 1DXHA 2GVZC 3SHTA 2FPKA 3X2EA 2HZ7A 1X8KA 3BORA 1VG9B 3TSWA 2X13A 3DOUA 1YB6A 3QLVA 1YMQA 2VWPA 2PX5A 5D00A 2QTAA 1PW5A 1ZD5A 5JBNA 2UUOA 4P8RA 3S1AA 1RE5A 1SVLA 3VR5D 2B78A 3DR3A 2EKDA 2P67A 2ZWOA 2WJHA 1WU7A 2XMBA 5F91A 3K5IA 2C88A 3KQPA 4H7EA 1MNQA 4K86A 4WZAA 4GMXA 2R0QC 3K8OE 4Z7QB 3WY9A 4F3KA 1NQTA 5HSGA 5CCXA 1XKLA 1ODJA 1I3NA 3UATA 3T0FA 3TTYA 3ZWBA 1MDBA 2ODPA 2VQ3A 4CW7A 4TTJA 4TV8B 4XKJA 4QICA 1NLZA 4I5FA 1XMQB 4IDFA 2VCEA 2X8JA 1SXJE 3PUWA 2FE1A 3PUYA 4KDEA 4PIMA 1H9AA 1MB3A 1AKTA 3HU1A 5ILGA 4JN6B 3ABSB 2F8TA 1A8QA 2V5UA 1JNYA 1TRKA 2H0RA 3D3QA 1A4UA 1C4KA 2ZAYA 3NTUA 1W1UA 5HPYB 4DJDC 3MJEA 3WGMA 2J3EA 1HSZA 2ZZMA 2FOXA 3F4BA 4II2A 2FWMX 3D2BA 3IERA 5E1OA 3PTAA 2GN9A 3BX1A 2GJSA 3Q7EA 3BE4A 1ODKA 3WC4A 2RJNA 3C41J 1PF7E 3O83A 5E4JA 4F1WA 2B6HA 4U7GA 1D9ZA 1USVA 3AWDA 3E2IA 4O4JF 2Q6VA 2PWPA 3HMQA 1AOXA 5ENVA 4BQEA 1US8A 3DOEA 3TJZA 3DBHB 1NVAA 4FSXA 3NNDA 1ILEA 3PXDA 1CRZA 3IEUA 3VUFA 1Z13A 2CXHA 5DZSA 3LT0A 3AC0A 3DAFA 5CT6A 5EJ8A 2JFFA 3ZHOA 2CMKA 1BFKA 4QU0A 2JRCA 3W2IA 3H05A 1IHPA 3H2KA 1Y3BE 4UVHA 3UPDA 3WK9A 2XNCA 1PLJA 2VUIB 4QE3A 3OEED 5AP9A 1U3TA 4M36A 4MVJA 3UC5A 2HSJA 4GOND 1ZWKA 4NARA 4UFPA 2PQMA 5B2EA 3HJFA 5CLHA 4TYWA 4LBZA 3KXLA 1T5HX 4U2KA 3MM4A 4P93A 3D7NA 1QAMA 3AEXA 5KYVA 2XMZA 5JVDF 3V4SA 2DERA 3U7JA 1MJFA 2W0SA 1JJBA 3IRUA 4OJTA 4BNYA 1UFKA 3H99A 3TTUA 5AWFC 3ZBUA 1YXMA 4MVJM 4R7TA 5I9MA 2HVGA 3ADOA 3MRSA 1E79A 4IIJB 4B83A 2LWIA 3ZTTA 1P3DA 2B2NA 3KXPA 2WIFA 2H8GA 4JOCA 5IAOA 1IU9A 4NYJQ 3KSAC 4NMWA 1I9CA 1KK0A 2J3MA 4EX6A 1CEXA 4Z4FA 1UMBB 4JJAA 4NQZA 1IW7D 4ML3A 4XIYA 3TW8B 4L6AA 1CYDA 3HN2A 4ENSA 4UZEA 3E3OA 2IEIA 3K2QA 2RBGA 4NOKA 5BWNA 1FP6A 4FLMA 2XJ9A 4DV2B 4NYJR 1OCEA 3U17A 5L4SA 3NMUF 2MSWA 2JLWA 2FW1A 1E2EA 1XYVA 3E2MA 1WUIS 2V4ZA 3AUAA 1JAYA 1Z7WA 2ETXA 4GKVA 2NU9A 4RGQA 1K92A 5LZ2A 4F4HA 2F1HA 1ZW1A 3E61A 1CTQA 1MG0A 3ZDCA 1ZQ9A 3UUEA 1FTQA 1TK3A 1EMDA 2Z04A 1XTJA 3CLKA 1GKUB 3W2HA 4L22A 4BRWA 1J21A 1L4EA 1NMZA 2X3UA 3GGJA 5CXSA 5ADVA 1AUOA 2PVCA 3DWFA 3OC0A 3U7QB 4W5HA 5ALRA 1NZJA 2RHDA 4O1IA 1JA1A 3HZHA 2VYCA 2W93A 1R0XA 3HRIA 4CLOB 2IIVA 4DXAA 1QO0A 3VYSB 3UGTA 2EZ4A 2F3SA 1LDEA 2H5IA 1LI4A 1NQUA 2DMRA 4RYDA 4HB3A 2AB0A 1Y8RB 2PZLA 4JLJA 3V00A 3IL2A 3OUTA 4BFCA 1NBME 4B47A 2EU8A 5JXWA 2WMYA 1BD3A 1SCDA 3C4JA 5J2UA 1M8JA 1IULA 4GW3A 4E32A 1QX3A 1HZJA 3M9XA 3T7AA 1QGUB 1RLOA 3AF4A 4LX8A 4AJHA 2ZROA 2RK4A 4FFRA 5JNUA 2DVMA 5ERXA 3OQVA 1P9RA 4XCQA 4B1FA 5KNCH 1PFQA 4KW7A 4PQYA 5K4GA 2I1LA 4DR7B 1XPUA 1JLRA 3ZVLA 2PHZA 3S1LA 1M2WA 4RHFA 4J07A 3DMPA 2DFPA 2OZVA 2VZ0A 1KMHA 4IZ6A 2Q1XA 3S2EA 3ZW8A 5AW4A 1CY7A 4EUHA 5LP6B 3EIHA 1Y9ZA 3PC6A 2OCLA 3GIWA 3R20A 4W6QA 3RKUA 3A7DA 3D3WB 5FBRB 1N78A 2O1WA 4H2DA 1Z5GA 5CITA 2WAMA 3NBQA 2VA9A 4MIOA 5LZ5A 1J7KA 3LKBA 4BV9A 3PXGA 1Z2NX 2BMVA 1D7OA 1VIVA 1PK8A 2BSXA 1MJGA 2JGFA 3AF0A 3Q6IA 2XB2A 2AQIA 4CG1A 1ZD4A 1DAGA 3EODA 3TL3A 1Z83A 3SSAA 2X1LA 2ZRPA 3DL7A 1X7YA 3QJ5A 2YZ7A 4IWXA 4P2BA 4RLQA 4RF4A 4TZKA 4CM9A 3U7QA 1HURA 4L72A 5FLXA 2AEJA 3JWHA 4G0VA 5HKBA 1KEVA 1QDLB 3KTOA 3WWOA 1DIBA 4UVGA 1LVGA 2EG5A 3E1GA 5BXQC 1MP0A 2CD7A 2PUJA 3AGPA 3RRJA 2PTQA 4PQEA 2C2YA 3NHBA 4PPGA 3U40A 3LUHA 3MIZA 3F3KA 2BMJA 1QJ4A 2O1SA 2PA0A 4A0QA 10MHA 2FTKE 2V6MA 2DFDA 1DJOA 5J2UB 2W4IA 3OKCA 3EBPA 2FW8A 3BF8A 2JLAA 3AILA 3OQBA 3D54D 2FSVC 2NNWB 1UANA 3IUMA 4PQFA 4JMLA 4J91A 3WK6A 2M9MA 2ACKA 1A4RA 2PYIA 3NUGA 3RC3A 3HEAA 1I2MA 4M55A 4LF9B 1Z6PA 4F2HA 1TO6A 4Q39A 3CMCO 3D7RA 1VPEA 5JSYA 3WLQA 3ZX4A 4LGMA 1CP3A 4BNWA 4OBWA 4D8UA 5BSVA 3AKZA 1SM4A 3D3WA 3GAZA 3UY4A 3OZ7A 5IH3A 2MSEB 3AJEA 3QMWA 3HFSA 5BN5B 7REQA 3FNQA 3U9LA 3EVDA 2A0WA 2ZIEA 1AIPA 3WGJA 1JALA 2AK2A 1VDZA 4ZU1X 1PL6A 4A5OA 1C0KA 3UAGA 1NYRA 2RMKA 1YZFA 3GDHA 4O0LA 3S2GA 5I4BA 4ZT6A 3GJ8A 3OETA 4PCVA 1NBMD 2JDID 2YWXA 1OX4B 1UZMA 3QVGA 1V9LA 2LR0A 1KAEA 3NWBA 4HGPA 4I4NA 1Q0HA 2E3JA 3ZD8A 3K15A 1YUNA 2ZWAA 2NX2A 1E2KA 1TVMA 1TUGA 1YO6A 4EABA 1NVDA 3R5JA 1H0RA 1ZRHA 1CFJA 1I7PA 1EFDN 1R5OA 4GXTA 2ODAA 4TLBA 4OQQA 5D1HA 1U16A 3LUGA 3I09A 4DJJA 3M6XA 4LRWA 4CDGA 2WJ6A 3GGCA 3LECA 2XWBF 3AETA 1Z12A 1RT9A 3Q10A 4BP8A 1FSFA 1L5OA 1X1BA 1R8SA 4PXYA 1GNTA 1LWOA 5YASA 1GRQA 2BEWB 5ARDA 5IDXA 4IW3B 4HH0A 1E62A 1L6RA 3RTGA 2O8EB 4LECA 2OD2A 4HBGA 3MTIA 4BYGA 2JIBA 1V95A 3D0OA 2XA2A 2O2DA 3SKXA 5IUJC 3DB2A 3RYIA 1ADCA 3JZMA 3MJTA 1QBGA 4L8LA 1MGPA 2Y1CA 1GGEA 4MX2A 2QG4A 2ZTLA 3FVQA 3TLXA 1WXIA 2QYHA 1NXXA 1QIEA 2I1QA 2I6UA 5F23A 3KFLA 4GBJA 1PG5A 1EJ6A 1KETA 1XK7A 1PVDA 2A8YA 4D3ZA 2F7SA 2RGWA 5U4QA 3STWA 3AVUA 3DWEX 3HNRA 3CYFA 4QWMA 1CXZA 4IFBA 5DSZA 1U0BB 1C4OA 3C1AA 5JTUA 5DBFA 2ZR0A 2Y4NA 1IBRA 4KUHA 3CF0A 2RE8A 3UBTA 1POXA 2GWRA 2GQ0A 2EYQA 2BFCA 2J09A 4Z0TA 5KJ1A 1WB6A 2ZUFA 1QHEA 3A0RB 4GPAA 4ZI5A 3JQ7A 1YR9A 1WO8A 1MH1A 1PP4A 2GBIA 3NALA 4MQUA 2LDBA 4NBRA 4PSAA 1GUYA 2Q7OE 3FHJA 5FOQA 3VPAA 2DAPA 2VWGA 2V6FA 3BDAA 3EY4A 1YB7A 4M8IA 3OFJA 4KR6A 3EFOB 5BN4A 5CA0A 5AW8A 3PT9A 1B41A 2W9XA 3L0YA 4KI7A 2OV8A 4M0LA 2OD7A 3LFUA 3UWSA 3NHRA 1DAPA 1PO7A 1SIOA 3NBAA 3QE0A 1T8UA 4GYJA 2ODNA 1P1CA 5CUQA 1WVIA 1N2GA 4GPD1 2C82A 1JEOA 4I4IA 2H31A 3RWBA 3QKRA 2JFWA 3L5KA 3ZY2A 3OQNA 3RAPR 1DHRA 3BB4A 4ND8B 3TRDA 4D2IA 1UWVA 4YHHB 1IHUA 3AFOA 1CQWA 3NTVA 1DELA 1VHLA 2FFJA 4HLUA 1IZ8A 2HHLA 3UCFA 4INZA 1U0HC 3A32A 3ROPA 2AH5A 2P3QA 3QG1A 5K45A 2LRHA 4GLJA 4Y2GA 1BE8A 4AX8A 5A1TA 5P8WA 5FBZA 4D3XA 4WFIA 1L5RA 2ZUBA 1QIIA 2E1PA 3Q1LA 3K0BA 5BWCA 3UXEA 4J2OA 3SQXA 1IPFA 1GZ4A 2J9FA 2WE7A 4H35A 4L2IA 1H65A 1XCOA 2VP5A 1DAHA 3E9QA 3DONA 3HL0A 3QGMA 3KKNA 2ZBRA 3KQUA 1Z22A 2VHEA 1S8FA 2C03A 5K6RA 4CIDA 3BGDA 2GK4A 3O47A 4LJ6A 4R2LA 2FU5C 5DWQA 5C8VA 3R9XB 2OHHA 1QAOA 1W87A 2QX6A 2ZI5A 1MIOB 2YXPX 3LT2A 4DCNA 5SY6A 1JKMA 2R48A 2WHPA 3O8QA 4B31A 3RS4A 5I48A 1O5IA 2XTNA 2C3MA 4FEAA 4YP1A 1FNSA 3QKUA 4FMCF 1CIJA 1SA0B 2Z98A 1WSBA 4MQ5A 5FI3A 1PJRA 2Z2JA 1D4AA 3FZNA 3KQYA 4JLMA 4PLYA 3TV2A 5HRAA 3AEQA 3SDZA 3BPSA 2ZJ7A 3FMGA 1DTEA 4HDKA 5EZYA 4IMPA 2ZIFA 3I1IA 1F5SA 5DHAA 5IANA 1Y4UA 3IPXA 5TQJA 2RIRA 3I04M 1P2VA 4F6CA 2A1TS 1KU6A 1WF3A 4LWZA 1HXHA 4TVBA 2CSXA 3D8RA 3L8FA 1B6GA 1NXPA 4LJSA 3PZRA 5JPIA 3JZFA 1F38A 1NXQA 1KJ8A 4TROA 3P9QA 4BDTA 3EQ6A 4JYBA 5T64A 1DQSA 2WAXA 3Q5EA 1CY1A 1MEEA 2HBQA 1P4HA 4H60A 5DJ5A 3K2IA 5BQ3A 4EY6A 4Y9UA 5GTDA 5BRNA 1W8IA 2VJAA 1W30A 1I0ZA 1QBKC 2DWPA 3WB9A 3RSCA 2B1IA 3S81A 5DCUA 1WF6A 3CPHA 5KSYA 3ZWWA 1A71A 5CB4B 5LQJA 2ODWA 1ESCA 1L5WA 2I76A 3K1JA 1W9MA 3USES 5JRJA 2PIAA 4BLSA 1T5SA 4WKCA 5K8VA 5EKXA 3TIFA 4BQNA 4G8JA 4QHYA 1JAHA 3T6KA 3LYUA 4H1HA 2WMOB 3MJCA 2Q2WA 4LYEA 3SIXA 9LDTA 3C3MA 1JG3A 4Q7QA 2BC9A 2VJKA 3LBHA 1PVOA 2CNLA 4LWQA 3LYLA 4J49A 4N3BA 1ZZGA 3WQRA 4CG2A 3KBOA 4AQ7A 2QGAB 2B3TA 5M29A 4JBHA 2QPLA 4O0MA 5JDIC 2W98A 1XTPA 2NU7B 4LHXA 3CW9A 2Q3CA 2G9ZA 2IHBA 1E3QA 3M81A 2C9MA 2H5EA 5HMMA 4MK4A 3I45A 3IV7A 4J16A 3AMVA 4KP7A 5DBHX 2NZJA 2MSDB 3B9QA 4R9NA 3USCS 1G2PA 4BMNA 4GKKB 1XNGA 1W4LA 3K6JA 3RVOA 1JQBA 2DWOA 3QBJA 4GD3Q 1W0CA 3P4YA 4N12A 3ETJA 4BJ3A 2ZFUA 1AQUA 3MWLA 4LUCA 4X0EA 3QWFA 3M70A 2C9OA 1R9MA 5BRAA 2GPWA 4JI7B 1EQ2A 3WWYA 5CX1A 2GNAA 5H81A 1S0UA 3ICPA 3ZJYA 2PKRA 1ZIOA 3A9VA 3PT5A 1PD0A 1X39A 3BAZA 5BVHB 4OKIA 4QT4A 3EIFA 3E3MA 1E66A 2AYZA 2H54A 4DB4A 2NVOA 4KLZA 4ZEXA 5D87A 2Q46A 2I0FA 2CXTA 1E2GA 1K68A 1KIAA 1K62A 4KWCA 5HOEA 4H59A 5G40A 1FMJA 2XF2A 4OY3A 3IVCA 3VVMA 4XYGA 3LZ6A 5J9FA 1T3GA 4O8ZA 5IS2A 5HS6A 2O8DB 1A2QA 2HPZA 5D8DA 5DBIA 3ACDA 3CF4G 3MUOA 3MS4A 1O94A 1OPXA 2WWTA 3AW8A 4MYRA 3TS1A 4C7KA 2CXPA 3GJ0A 5JATA 3COSA 1QORA 1JLSA 5LA6B 2O5VA 4MYDA 2CXNA 5DN6D 3LOQA 3EQ9A 3BBPA 2XUFA 2HQRA 4J0IA 3W8FA 4C0KA 3EXFB 3FKSD 2QMEA 2QMOA 3VRHA 1YBHA 2AR0A 4REOA 1UINA 3ZHQA 3QYAA 1H3EA