1Z52A

Proaerolysin mutant w373l
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
467
structure length
451
Chain Sequence
b'PVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDLNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPVPLAGLRLEIPLDAQELSGLGFNNVSLSVTPAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aerolysin
publication title Crystal Structure of Proaerolysin at 2.3 A Resolution and Structural Analyses of Single-site Mutants as a Basis for Understanding Membrane Insertion of the Toxin
rcsb
source organism Aeromonas hydrophila
molecule tags Toxin
total genus 108
structure length 451
sequence length 467
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01117 Aerolysin Aerolysin toxin
A PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 1z52A03
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1z52A01
3.30.412.10 Alpha Beta 2-Layer Sandwich Proaerolysin; Chain A, domain 2 Proaerolysin, chain A, domain 2 1z52A02
1PTOH 1PRTC 1W3AA 1PTOB 1BCPC 3G4OA 3C0MA 1PRTB 3C0NA 3C0OA 2D42A 1PREA 3G4NA 1UYJA 1PTOC 1BCPB 1W3FA 3ZJXA 1Z52A 1W3GA
chains in the Genus database with same CATH superfamily
1PTOH 1PRTC 1W3AA 1PTOB 1BCPC 3G4OA 3C0MA 1PRTB 3C0NA 3C0OA 2D42A 1PREA 3G4NA 1UYJA 1PTOC 1BCPB 1W3FA 3ZJXA 1Z52A 1W3GA
chains in the Genus database with same CATH topology
1PTOH 1PRTC 1W3AA 1PTOB 1BCPC 3G4OA 3C0MA 1PRTB 3C0NA 3C0OA 2D42A 1PREA 3G4NA 1UYJA 1PTOC 1BCPB 1W3FA 3ZJXA 1Z52A 1W3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTO H;  1PRT C;  1W3A A;  1PTO B;  1BCP C;  3G4O A;  3C0M A;  1PRT B;  3C0N A;  3C0O A;  2D42 A;  1PRE A;  3G4N A;  1UYJ A;  1PTO C;  1BCP B;  1W3F A;  3ZJX A;  1Z52 A;  1W3G A; 
#chains in the Genus database with same CATH topology
 1PTO H;  1PRT C;  1W3A A;  1PTO B;  1BCP C;  3G4O A;  3C0M A;  1PRT B;  3C0N A;  3C0O A;  2D42 A;  1PRE A;  3G4N A;  1UYJ A;  1PTO C;  1BCP B;  1W3F A;  3ZJX A;  1Z52 A;  1W3G A; 
#chains in the Genus database with same CATH homology
 1PTO H;  1PRT C;  1W3A A;  1PTO B;  1BCP C;  3G4O A;  3C0M A;  1PRT B;  3C0N A;  3C0O A;  2D42 A;  1PRE A;  3G4N A;  1UYJ A;  1PTO C;  1BCP B;  1W3F A;  3ZJX A;  1Z52 A;  1W3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...