1Z5SC

Crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into E3 ligase activity revealed by a SUMO-RanGAP1-Ubc9-Nup358 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 1z5sC00
2GRQB 2IO2C 1Z5SC 3UINC 3UIOC 1KPSB 2GRPB 2GRNB 5D2MC 3UIPC 2GROB 2IO3C 2GRRB 2IY0C
chains in the Genus database with same CATH superfamily
5JJ6A 3FUEA 2CFZA 2XGOA 1O5MA 1E96B 2FF4A 3CK9A 1H2TC 3VLDA 3IHYA 4N5QA 1FT2A 2LXLA 1QZ2A 2R2LA 4BERA 3GZSA 5BW8C 1S63A 3E32A 3JUIA 3PH0C 5FJYA 3B95A 3CHPA 3ASFA 2V5QC 3LKUA 2FBNA 3Q7AA 3AU5A 1DC2A 4I1MA 4BX9A 1MX6A 3URZA 5KCMA 4CDNA 3Q5MA 2MHKA 5ENTD 3TWVA 3MV2B 3TWXA 2MRIA 3RK6A 3RRUA 2V8SE 5JJ7A 3TXNA 4B8CB 2VSOE 1SZ9A 5KJMA 2WMNA 3ZFWA 1JCRA 5AJLA 3AG3E 3PRZA 1TNBA 3EU9A 4DK5A 3L54A 1OCZE 3PUKA 3JQ0A 5C1DA 3L17A 5ENPD 2M63A 3G2UA 2IY0C 5C2YA 1BD8A 3EHRA 3OXLA 4KVMA 4JEUA 3UXGA 2V4LA 3T5VA 4RVBA 5KBAA 3IHVA 4FULA 4N5CA 2VGYA 4P29A 2I9CA 2PM7A 3PZ2A 2CHWA 1EF1C 1BPOA 3UPVA 4GZCA 4B94A 3AG1E 3V2OA 2RFMA 4WAFA 1H2UA 5M72A 2IEJA 1B89A 3SFZA 3EHQA 3AU4A 2OEVA 3C3QA 4UWFA 3ABME 4RQIA 4Z68A 3FTZA 3NAWA 2JABA 2AXUA 1JWGA 4F7AA 1H19A 4BESA 4ILIA 1AP7A 3D9IA 1K8KG 1HFAA 1UN8A 4ME2A 4F53A 3ZYQA 4KVOA 3RO2A 1UG3A 3IXEA 4G11A 3K9IA 4DX1A 2Y4TA 1ELWA 3FDHA 4O1PA 2VSYA 3LJ3A 3ZGQA 1E90A 3HXBA 2GRPB 5FQ8A 3TG4A 3HXEA 2F8XK 3R7RA 4XX5A 4JHJA 2QZAA 1V54E 3LDZA 5HI7A 4AIFA 4XI9A 5G55A 2OOEA 4U95D 4GZDA 2CG3A 2WM9A 3E37A 3Q7FA 5FT9A 2MYOA 4TUMA 3IBEA 2QYJA 4NQ0A 3G2TA 4Y6WA 3V30A 3T8KA 3I4GA 5FZSA 3VLFA 2WQHA 3ZW3A 1HX8A 4I1OB 2LAIA 2Y4UA 2BKGA 4OVUA 2EIKE 1P5QA 5AQ9A 5A23A 5ARGA 5EYPF 2H6HA 2AXZA 4L23A 4U0UA 1N95A 1FPPA 2KZTA 5BT1A 3UM3A 1E7UA 1KLXA 2AXVA 3C3OA 1NA0A 3PVLA 3LVRE 2PQNA 4GTPA 3PEUB 4L1BA 4J6IA 1XNFA 4LNGA 4TXPA 4YNDA 3V2XA 3TWUA 2CHZA 2H6IA 4DRXE 4CRWA 2A5EA 4ANXA 1ZU2A 3KS2A 2E0IA 1S70B 2ZIRA 1NI1A 3QB2A 5FQ6A 1MX4A 4G26A 4U8YD 3CIAA 3IEGA 3TXMA 3ZHEA 4AY6A 4UI9K 5E76A 2X6FA 3ZHEB 3ZYLA 4GCNA 1WY6A 3WXXA 4BX8A 2V0PA 2Y3AA 2VTBB 4E85A 4V3IA 1O1TA 2F37A 1A5EA 2FO1E 4JPSA 3VTYA 2BTDA 3ZUVB 2I1KA 1YMPA 3HHMA 4KZ0A 3SHFA 4XKCA 3WG7E 3Q15A 3AG2E 4JA7A 4TXRA 4U0SA 1H6KA 1OWNA 2L6BA 1OCCE 4OYSA 3TJPA 3CV0A 3MKQA 3VLEA 3NOGD 3DSTA 3R9MA 4G8KA 4JZYA 2H6FA 3DSUA 3ASHA 3FUKA 3UT8A 2VYIA 5LOZA 4ANWA 1X5BA 2DVWA 3V79K 3CVWA 4HNAD 2UY1B 3MYVA 4M3OA 3D9NA 4LCTA 3HIZA 4GYYA 3ML9A 4C0MA 5BV0A 3LY7A 3AG4E 2VSXE 1H0AA 3LEWA 3UINC 4ATGA 1LD8A 5EX0A 1HU3A 4CDMA 5FQ7A 5EYLA 1YYHA 1FVFA 4ACLA 2EIJE 2F8YA 3DSWA 4KZCA 3MCXA 1ZBPA 5DIZA 4APFA 5EN5D 2EIME 3FFLA 1D9SA 1OCOE 4MLPA 3KSQA 4J8DA 2WXJA 1D8EA 2I2OA 1PC2A 4N2SA 3I5PA 2P9PG 2GRRB 4WNDA 3ZEFA 2KBXA 4DPRA 2KATA 3UT7A 3FU0A 1JWFA 2WXRA 4GU5A 2KCKA 1MX2A 3DSSA 5AQAA 2R03A 3Q9NC 1W3BA 3S7BA 3TWQA 4GMLA 3NOCD 2XEHA 3BQOA 4AVXA 4BSXA 3U64A 3P1UA 3V31A 4B89A 3ONKA 1N9AA 3FUFA 3CVPA 1OWPA 2Y0BG 1HG5A 2J07A 3ASNE 5AYWD 3NBNB 4GB9A 1S64A 4CCAA 4DX6D 5JHBA 4HQDA 5KJKA 4YDWA 4YVOA 3FY4A 2IU1A 4G1TA 3RJVA 1TNOA 4IRUA 2ZXWE 1E8ZA 1VDYA 3D9HA 4G2VA 3B13A 4UQZA 2R59A 5LCWJ 3FTWA 1YCSB 4FJYA 2C0MA 3AAAC 3MKRA 4UWHA 3CHQA 3FTXA 3I3NA 4BETA 3JUEA 3FEXA 2VTBA 4BWRA 3R9AB 5CEAA 4ILHB 4KXKB 2IOLA 4LNBA 2X6JA 4GYWA 1K1BA 3MEKA 2ETBA 2WXQA 5CBOA 4CDRA 4EECA 2V5FA 1IXVA 1OWLA 2FEZA 4I9EA 4HRLA 2QYUA 4G8LA 4NACA 3PUJA 3PE4A 2FO7A 3UM1A 2DZNA 3FUJA 4U04A 4I1AA 3CVXA 3GZ1A 4HFGA 3TWTA 3B7TA 4J7WA 5ANLA 4JXTA 3UMVA 3CK7A 3RSEG 4XKBA 3FTYA 3B7BA 4C9BB 4UQYA 3FHEA 2YINA 4N3AA 4I6JA 3QWWA 2WQ6A 4GTMA 2OVBA 5LP0A 2P2CP 3U66A 2KC7A 4JEHA 1DNPA 1RW2A 2VGXB 3D9PA 3QDNA 3DEPA 3PREA 3CVVA 3L13A 2C2LA 2VQ2A 3L9TA 5AIJA 4J8SA 5AAOA 5HRYA 2B0OE 5ENNA 1KT0A 5KWDA 2LAHA 4X8QA 2X3MA 2R05A 4A3TA 4JW1A 5HQ8A 1U2VG 1TR4A 1QBQA 4LERA 3TL5A 3Q9UC 4XE0A 1JCSA 3ULEG 3T8MA 4U63A 1OCRE 3TAXA 1ELKA 4GCOA 5EDSA 4I43A 4JD2G 3Q75A 4WNFA 2JEKA 2NYJA 4K5BA 5AJDA 5KNGA 4QQIA 3CVUA 2PNNA 3EHNA 1Z3XA 3J5QB 4AXHA 2YQ8A 2GRNB 2LO6A 4WWOA 3EUVA 1D8DA 3DEOA 5CRUA 5LCWC 3HXFA 3FH7A 5T8IA 2J8SD 4TXQA 2LNIA 2GW1A 3SBSA 2P9UG 4KYOB 4FP7A 3CVQA 3FTSA 4EZKA 3CKCA 2XCBA 3UM2A 3KAEA 1UOHA 2XEEA 2CG2A 3X2QE 5CCMA 5ENQD 1Y8MA 4MRUA 3PEVB 4KBQA 3JXJA 3E34A 5AQBA 2DYRE 4GA1A 2EILE 2C0LA 4U7EB 4PH4B 3DRAA 2EINE 3B7UX 3RIBA 4GYOA 4DLQA 4J8YA 4AOFA 5BXUA 1DVPA 4CGWA 3W9GA 5B1AE 4IULA 3QJZA 4CT0A 4HS2A 3QOUA 3PDNA 4DX2A 5EX3A 1OY3D 3CLJA 4DI4A 3O48A 1TN6A 2PQRA 3ISMC 3P2BA 5D0OD 4XI0A 4GTOA 2Q7FA 5KJLA 3FU6A 3QAQA 3JYSA 3N71A 2FULA 3U4TA 3FUDA 3OAWA 3ML8A 4HOQA 3C3RA 3FUHA 4A1GA 4M7CA 3TG5A 4LG6A 4AEZC 2MOWA 2J09A 3FUIA 4HI8A 1FT1A 5KNHD 1DCEA 5JJTA 3ZN3A 3ASOE 2AWIA 3CSTA 3FP3A 2HYZA 4ZFHA 1MJ0A 3MKQB 4A63B 4ACKA 2WXGA 1QQEA 1N54A 3LYAA 2XS8A 1IYGA 4OAVB 4I6EA 3LVQE 3C72A 2WQ7A 4MKTA 1JPLA 1MQSA 4ANUA 2E2EA 2WXFA 1UN9A 3UIPC 3SF4A 4L9PA 3UT4A 3DXMG 4BY6A 3BEEA 5AARA 1H6PA 3APCA 2OEWA 3ZU7B 2XGSA 3GW4A 3OXFA 2DWZA 3FTVA 1OXJA 1KZOA 5FWQA 3FEYA 3L6AA 1HG2A 1KZPA 4J8EA 1INZA 1TEZA 3DSVA 3AJIA 5E75A 2BEDA 3CK8A 1HZ4A 4HXIA 4K0RA 2XPIA 2L0TB 4HLEA 3MV3B 4BT8A 5JHAA 3SNXA 4PS7A 1BU9A 4L7TA 4F6RD 2X38A 4KMOA 4IYPA 2GRQB 1TNUA 3JXIA 3SGHA 4N39A 5LX8A 3VTXA 2WVIA 4G25A 1WG0A 3I4RB 4RG9A 2WXHA 1IQRA 3FU3A 4EQFA 3KSLA 3QNKA 4HRMB 4ANVA 2X6IA 2AVPA 3DPDA 5T3RA 4N3CA 4FU3A 1EPUA 4I2WA 3LPZA 4EPZA 1YA0A 5FQ4A 5FZQA 5EIBE 4AV7A 1GW6A 2XGMA 4HRNA 2IJGX 4LNUD 4QFVA 2I1JA 5EILA 3TWWA 4I6GA 2BF0X 3RRNB 2WXIA 2R02A 3OTNA 4TV3A 4HB5A 5ANRA 2ZGGA 1N4QA 3L08A 3ZYMA 2J9QA 1N94A 2BKKB 5CHEE 3RAUA 5BXOA 3S2AA 4H7XA 4GTTA 2RD0A 5BPPA 1LF8A 2XCCA 4YDYA 3NQPA 2ILRA 1HE8A 1E8YA 4N2QA 3PZDA 2I6HA 2AW6A 2P9SG 1JUQA 2XENA 4R7LA 4ATZD 3UTMA 3Q47B 4UWLA 4FJZA 5AQ7A 2IONA 2LXMA 4U07A 3PZ3A 5AENA 3ZKJA 4W9RA 5KJNA 4E6HA 4WWNA 5A7DB 4GTVA 3KEAA 2F0YA 4FHKA 3MX3A 2LSUA 3HVEB 3UUXA 3T5XA 2JLBA 3QC1A 2PM6A 1U3CA 3D9KA 4U0ZA 1MZCA 2RKKA 4AM9A 2YHEA 3BG0B 2AJAA 4GTSA 5G05C 1Y6IA 1V55E 5H7PA 5D66A 1OWMA 5T4YA 4GAAA 1BLXB 2A5UA 3UQ3A 5J08A 1OWOA 5BV1A 2YHCA 3ZRHA 4IN3B 1ZB1A 3ASDA 4BSZB 4DJAA 2J4DA 2X6HA 3UIOC 3TGOA 5D0QD 4CEMA 3APDA 3ENEA 5ENOD 4LRZA 1Z3YA 3TWSA 3BUAA 4O1OA 4B8AA 3RRMB 3SZ7A 2V4HC 1FVHA 1HH8A 1Q2ZA 4WUYA 2A4ZA 2GRLA 4JC8A 1SA5A 3LY8A 1LTXA 4K5AB 2WXMA 4L2LA 3SFXA 1BI8B 2IFUA 3QWVA 5EKQD 5ARFA 1IQUA 3CEQA 3SFYA 4FLBA 4FLHA 2GROB 1IHBA 2P9LG 2XEVA 3ESKA 3J5PA 1H2VC 1N4SA 3DPYA 2UWJG 3CQCB 3FTUA 4LEUA 4OAUC 2ONDA 3FWVA 4UQXA 4EZLA 2WXNA 1PAQA 4JVSA 2CFUA 2EQXA 3T9KA 1TNYA 2QC9A 4HORA 3SD5A 4YDOA 3EDTB 2XRZA 5FIOA 3HVEA 4HOSA 3CVYA 3S7DA 2OV8A 2KZTB 4AP2A 1S0PA 3S7JA 4DX5D 5HS0A 2WPVA 4F1SA 2QY7A 4AJWA 4HLLA 3DXKG 4BT9A 1QNFA 2DBAA 4O6FA 1MYOA 3LCAA 3W9FA 1EDUA 2VJ8A 5EIDA 3FH5A 3SO8A 2LSVA 1WAO1 4BEPA 3HXDA 3OXGA 3CHOA 3ZIMA 2WB2A 4G24A 3CQGB 3JQ1A 1TYQG 2IOSA 3U3WA 3FUMA 3B7RL 1UW4B 3C5RA 3KD7A 2P9KG 4FADA 3PZ1A 3BG1B 1L5JA 4XEIG 2GRMA 3Q4AB 4DUIA 1WDYA 4J0UA 2XQ0A 2P9NG 4FHJA 3D9OA 4EBAG 4U8HA 1HO8A 4Q94A 3NB2A 3FUNA 3QARA 4CGVA 2XPZA 4Q96A 3SY2A 4ABNA 3ZPJA 1N4RA 3KEZA 1X81A 2H6GA 2J08A 3CHRA 1O1RA 2DIWA 2NSZA 2DCPA 3HG0D 3ASGA 3QK0A 4DLOA 4H7YA 4LSZE 4UUCA 3GYZA 3NZSA 5CECB 4C48B 4K5CA 5CCLA 3QWPA 4YDEA 3RO3A 4JB8P 3IV0A 3HDXA 1NP7A 2PZIA 1NL4A 1NFIE 2LUHA 1RZ4A 2HO1A 5FZRA 3PNTB 3ZVVA 5G04C 2ZU6B 1A17A 4EHMA 3AS5A 3G2SA 4APOA 2DZOA 4A55A 4PS8A 3U9WA 3FULA 1O1SA 3E33A 1G3NB 2J49A 4HOUA 1E7VA 4ZHBA 4L2YA 1KT1A 1UJKA 3L82A 4TRQA 4U8VD 1E8WA 4K03A 5DBKA 1AWCB 3EIJA 5ENSD 5IY5E 2KM4A 3F6QA 2WXOA 4RLYA 2ETAA 3D9LA 4I2ZA 4AY5A 3C98A 3D9JA 4UWGA 2VSNA 2BUGA 5BNWA 5JA4D 3D3MA 3SBTB 3G2WA 4WNGA 4XZ4A 3LJNA 2Y69E 2XS1A 2B6CA 5HKPA 4CT4A 5CBNA 3ONLA 3IKOB 2HE0A 3ABKE 1Z5SC 3D9MA 2IF4A 3AS4A 3S7FA 3DBSA 5G2NA 4OVVA 3L22A 1PY1A 3NF1A 4FC8A 3LS8A 4A1SA 1UJJA 1SZAA 2UY1A 1TJFA 5B3SE 4EZJA 1HF8A 3O4ZA 4RG6A 4BFRA 3CVNA 4GTQA 3ULQA 1QYMA 2GGFA 3APFA 4I9CA 4MBGA 3PNLB 3CGHA 1SW6A 4URKA 2XZDG 1HS6A 3UKUG 4WNEA 1BI7B 5CERB 1OUVA 4NIKA 3ESLA 4G23A 4GA0A 2OCCE 2XZTG 4GPMA 1N11A 2HM8A 3DWLG 3FH8A 3L16A 4GTRA 1TN7A 2PL2A 4HVBA 3HXCA 4HOTA 3PS6A 4JHRA 4RSYA 4EBAA 3Q73A 2WXLA 2DYSE 3QKYA 3MJWA 1MHQA 4PDXA 2IO3C 2RFAA 4Q69A 3CVLA 4GA2A 3NZUA 4CZ2D 1LD7A 1WM5A 3Q79A 3LY9A 4B0ZA 2IQCA 1N4PA 3UKRG 4DI3A 5FINA 4GPKA 4D10C 2WXPA 4FA6A 1IKND 4NRHB 1K1AA 5LFAA 1NA3A 4NURA 4UWKA 1ELRA 4PS3A 1FCHA 4XIFA 1EYHA 2VGEA 3BU8A 3CR3A 4GZ5A 2WXKA 5G05J 3MZLB 3EU5A 4C0EA 3B7SA 2OVFA 3ZXPA 1SA4A 4HBDA 3UX4A 3ABLE 1NZNA 3JCKC 3SQVA 2ZGDA 4ILGA 4GMJA 2L9BA 4A3VA 2QFCA 4N3BA 3Q78A 4GMRA 5D2MC 3SI5A 4UI9J 3ZNGA 2KXPC 3ULYA 5CRVA 2KCVA 5ENRD 3RU0A 4O60A 3TWRA 1U3DA 4GZ3A 1HXIA 3MA5A 2XHEA 2WMOA 4DX7D 1IHGA 4B93B 3ZXSA 1N0RA 3R7QA 2NC9A 2HR2A 1DCQA 4UI9C 2YNQA 4PUCA 1N52A 4JL0A 3PZ4A 5CMYA 5FTPA 3CHMA 5JMND 2XRYA 1TJCA 5BUZA 3E30A 3ZYKA 1N0QA 3FU5A 3CKBA 3EIQC 1H6OA 3CHSA 4JA9A 4KT6B 1E8XA 3UI2A 2ETCA 2NXPA 4BTAA 2ZISA 3RKVA 2KCLA 3E4BA 2XPYA 4TUUA 5CEDB 1OT8A 4BTBA 4MS6A 3G2VA 3MGBA 1SVXA 5CMWA 1JCQA 2R5SA 3AS8A 3CSFA 3GZ2A 1K3ZD 1Z6TA 2VGXA 4LUNU 4WWPA 4U96D 4I17A 3UM0A 2R17C 2X6KA 3Q49B 2FI7A 2P58C 4J8FA 5A6CA 2L0IA 2RG8A 2CHXA 4F3VA 4GZ6A 5ITZF 1XGWA 4F1PA 2IO2C 4JHKA 1KPSB 5J90A 4Y6CA 3HRAA 3HYMB 5AN8A 3LXUX 3DSXA 1SQMA 2J4BA 2L6JA 3PE3A 2Y1LE 5G04J 3EHMA 3EJNA 5B1BE 4YVQC 4CYMD 2P9IG 1TN8A 4HI9A 1TNZA
chains in the Genus database with same CATH topology
2GRQB 2IO2C 1Z5SC 3UINC 3UIOC 1KPSB 2GRPB 2GRNB 5D2MC 3UIPC 2GROB 2IO3C 2GRRB 2IY0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRQ B;  2IO2 C;  1Z5S C;  3UIN C;  3UIO C;  1KPS B;  2GRP B;  2GRN B;  5D2M C;  3UIP C;  2GRO B;  2IO3 C;  2GRR B;  2IY0 C; 
#chains in the Genus database with same CATH topology
 5JJ6 A;  3FUE A;  2CFZ A;  2XGO A;  1O5M A;  1E96 B;  2FF4 A;  3CK9 A;  1H2T C;  3VLD A;  3IHY A;  4N5Q A;  1FT2 A;  2LXL A;  1QZ2 A;  2R2L A;  4BER A;  3GZS A;  5BW8 C;  1S63 A;  3E32 A;  3JUI A;  3PH0 C;  5FJY A;  3B95 A;  3CHP A;  3ASF A;  2V5Q C;  3LKU A;  2FBN A;  3Q7A A;  3AU5 A;  1DC2 A;  4I1M A;  4BX9 A;  1MX6 A;  3URZ A;  5KCM A;  4CDN A;  3Q5M A;  2MHK A;  5ENT D;  3TWV A;  3MV2 B;  3TWX A;  2MRI A;  3RK6 A;  3RRU A;  2V8S E;  5JJ7 A;  3TXN A;  4B8C B;  2VSO E;  1SZ9 A;  5KJM A;  2WMN A;  3ZFW A;  1JCR A;  5AJL A;  3AG3 E;  3PRZ A;  1TNB A;  3EU9 A;  4DK5 A;  3L54 A;  1OCZ E;  3PUK A;  3JQ0 A;  5C1D A;  3L17 A;  5ENP D;  2M63 A;  3G2U A;  2IY0 C;  5C2Y A;  1BD8 A;  3EHR A;  3OXL A;  4KVM A;  4JEU A;  3UXG A;  2V4L A;  3T5V A;  4RVB A;  5KBA A;  3IHV A;  4FUL A;  4N5C A;  2VGY A;  4P29 A;  2I9C A;  2PM7 A;  3PZ2 A;  2CHW A;  1EF1 C;  1BPO A;  3UPV A;  4GZC A;  4B94 A;  3AG1 E;  3V2O A;  2RFM A;  4WAF A;  1H2U A;  5M72 A;  2IEJ A;  1B89 A;  3SFZ A;  3EHQ A;  3AU4 A;  2OEV A;  3C3Q A;  4UWF A;  3ABM E;  4RQI A;  4Z68 A;  3FTZ A;  3NAW A;  2JAB A;  2AXU A;  1JWG A;  4F7A A;  1H19 A;  4BES A;  4ILI A;  1AP7 A;  3D9I A;  1K8K G;  1HFA A;  1UN8 A;  4ME2 A;  4F53 A;  3ZYQ A;  4KVO A;  3RO2 A;  1UG3 A;  3IXE A;  4G11 A;  3K9I A;  4DX1 A;  2Y4T A;  1ELW A;  3FDH A;  4O1P A;  2VSY A;  3LJ3 A;  3ZGQ A;  1E90 A;  3HXB A;  2GRP B;  5FQ8 A;  3TG4 A;  3HXE A;  2F8X K;  3R7R A;  4XX5 A;  4JHJ A;  2QZA A;  1V54 E;  3LDZ A;  5HI7 A;  4AIF A;  4XI9 A;  5G55 A;  2OOE A;  4U95 D;  4GZD A;  2CG3 A;  2WM9 A;  3E37 A;  3Q7F A;  5FT9 A;  2MYO A;  4TUM A;  3IBE A;  2QYJ A;  4NQ0 A;  3G2T A;  4Y6W A;  3V30 A;  3T8K A;  3I4G A;  5FZS A;  3VLF A;  2WQH A;  3ZW3 A;  1HX8 A;  4I1O B;  2LAI A;  2Y4U A;  2BKG A;  4OVU A;  2EIK E;  1P5Q A;  5AQ9 A;  5A23 A;  5ARG A;  5EYP F;  2H6H A;  2AXZ A;  4L23 A;  4U0U A;  1N95 A;  1FPP A;  2KZT A;  5BT1 A;  3UM3 A;  1E7U A;  1KLX A;  2AXV A;  3C3O A;  1NA0 A;  3PVL A;  3LVR E;  2PQN A;  4GTP A;  3PEU B;  4L1B A;  4J6I A;  1XNF A;  4LNG A;  4TXP A;  4YND A;  3V2X A;  3TWU A;  2CHZ A;  2H6I A;  4DRX E;  4CRW A;  2A5E A;  4ANX A;  1ZU2 A;  3KS2 A;  2E0I A;  1S70 B;  2ZIR A;  1NI1 A;  3QB2 A;  5FQ6 A;  1MX4 A;  4G26 A;  4U8Y D;  3CIA A;  3IEG A;  3TXM A;  3ZHE A;  4AY6 A;  4UI9 K;  5E76 A;  2X6F A;  3ZHE B;  3ZYL A;  4GCN A;  1WY6 A;  3WXX A;  4BX8 A;  2V0P A;  2Y3A A;  2VTB B;  4E85 A;  4V3I A;  1O1T A;  2F37 A;  1A5E A;  2FO1 E;  4JPS A;  3VTY A;  2BTD A;  3ZUV B;  2I1K A;  1YMP A;  3HHM A;  4KZ0 A;  3SHF A;  4XKC A;  3WG7 E;  3Q15 A;  3AG2 E;  4JA7 A;  4TXR A;  4U0S A;  1H6K A;  1OWN A;  2L6B A;  1OCC E;  4OYS A;  3TJP A;  3CV0 A;  3MKQ A;  3VLE A;  3NOG D;  3DST A;  3R9M A;  4G8K A;  4JZY A;  2H6F A;  3DSU A;  3ASH A;  3FUK A;  3UT8 A;  2VYI A;  5LOZ A;  4ANW A;  1X5B A;  2DVW A;  3V79 K;  3CVW A;  4HNA D;  2UY1 B;  3MYV A;  4M3O A;  3D9N A;  4LCT A;  3HIZ A;  4GYY A;  3ML9 A;  4C0M A;  5BV0 A;  3LY7 A;  3AG4 E;  2VSX E;  1H0A A;  3LEW A;  3UIN C;  4ATG A;  1LD8 A;  5EX0 A;  1HU3 A;  4CDM A;  5FQ7 A;  5EYL A;  1YYH A;  1FVF A;  4ACL A;  2EIJ E;  2F8Y A;  3DSW A;  4KZC A;  3MCX A;  1ZBP A;  5DIZ A;  4APF A;  5EN5 D;  2EIM E;  3FFL A;  1D9S A;  1OCO E;  4MLP A;  3KSQ A;  4J8D A;  2WXJ A;  1D8E A;  2I2O A;  1PC2 A;  4N2S A;  3I5P A;  2P9P G;  2GRR B;  4WND A;  3ZEF A;  2KBX A;  4DPR A;  2KAT A;  3UT7 A;  3FU0 A;  1JWF A;  2WXR A;  4GU5 A;  2KCK A;  1MX2 A;  3DSS A;  5AQA A;  2R03 A;  3Q9N C;  1W3B A;  3S7B A;  3TWQ A;  4GML A;  3NOC D;  2XEH A;  3BQO A;  4AVX A;  4BSX A;  3U64 A;  3P1U A;  3V31 A;  4B89 A;  3ONK A;  1N9A A;  3FUF A;  3CVP A;  1OWP A;  2Y0B G;  1HG5 A;  2J07 A;  3ASN E;  5AYW D;  3NBN B;  4GB9 A;  1S64 A;  4CCA A;  4DX6 D;  5JHB A;  4HQD A;  5KJK A;  4YDW A;  4YVO A;  3FY4 A;  2IU1 A;  4G1T A;  3RJV A;  1TNO A;  4IRU A;  2ZXW E;  1E8Z A;  1VDY A;  3D9H A;  4G2V A;  3B13 A;  4UQZ A;  2R59 A;  5LCW J;  3FTW A;  1YCS B;  4FJY A;  2C0M A;  3AAA C;  3MKR A;  4UWH A;  3CHQ A;  3FTX A;  3I3N A;  4BET A;  3JUE A;  3FEX A;  2VTB A;  4BWR A;  3R9A B;  5CEA A;  4ILH B;  4KXK B;  2IOL A;  4LNB A;  2X6J A;  4GYW A;  1K1B A;  3MEK A;  2ETB A;  2WXQ A;  5CBO A;  4CDR A;  4EEC A;  2V5F A;  1IXV A;  1OWL A;  2FEZ A;  4I9E A;  4HRL A;  2QYU A;  4G8L A;  4NAC A;  3PUJ A;  3PE4 A;  2FO7 A;  3UM1 A;  2DZN A;  3FUJ A;  4U04 A;  4I1A A;  3CVX A;  3GZ1 A;  4HFG A;  3TWT A;  3B7T A;  4J7W A;  5ANL A;  4JXT A;  3UMV A;  3CK7 A;  3RSE G;  4XKB A;  3FTY A;  3B7B A;  4C9B B;  4UQY A;  3FHE A;  2YIN A;  4N3A A;  4I6J A;  3QWW A;  2WQ6 A;  4GTM A;  2OVB A;  5LP0 A;  2P2C P;  3U66 A;  2KC7 A;  4JEH A;  1DNP A;  1RW2 A;  2VGX B;  3D9P A;  3QDN A;  3DEP A;  3PRE A;  3CVV A;  3L13 A;  2C2L A;  2VQ2 A;  3L9T A;  5AIJ A;  4J8S A;  5AAO A;  5HRY A;  2B0O E;  5ENN A;  1KT0 A;  5KWD A;  2LAH A;  4X8Q A;  2X3M A;  2R05 A;  4A3T A;  4JW1 A;  5HQ8 A;  1U2V G;  1TR4 A;  1QBQ A;  4LER A;  3TL5 A;  3Q9U C;  4XE0 A;  1JCS A;  3ULE G;  3T8M A;  4U63 A;  1OCR E;  3TAX A;  1ELK A;  4GCO A;  5EDS A;  4I43 A;  4JD2 G;  3Q75 A;  4WNF A;  2JEK A;  2NYJ A;  4K5B A;  5AJD A;  5KNG A;  4QQI A;  3CVU A;  2PNN A;  3EHN A;  1Z3X A;  3J5Q B;  4AXH A;  2YQ8 A;  2GRN B;  2LO6 A;  4WWO A;  3EUV A;  1D8D A;  3DEO A;  5CRU A;  5LCW C;  3HXF A;  3FH7 A;  5T8I A;  2J8S D;  4TXQ A;  2LNI A;  2GW1 A;  3SBS A;  2P9U G;  4KYO B;  4FP7 A;  3CVQ A;  3FTS A;  4EZK A;  3CKC A;  2XCB A;  3UM2 A;  3KAE A;  1UOH A;  2XEE A;  2CG2 A;  3X2Q E;  5CCM A;  5ENQ D;  1Y8M A;  4MRU A;  3PEV B;  4KBQ A;  3JXJ A;  3E34 A;  5AQB A;  2DYR E;  4GA1 A;  2EIL E;  2C0L A;  4U7E B;  4PH4 B;  3DRA A;  2EIN E;  3B7U X;  3RIB A;  4GYO A;  4DLQ A;  4J8Y A;  4AOF A;  5BXU A;  1DVP A;  4CGW A;  3W9G A;  5B1A E;  4IUL A;  3QJZ A;  4CT0 A;  4HS2 A;  3QOU A;  3PDN A;  4DX2 A;  5EX3 A;  1OY3 D;  3CLJ A;  4DI4 A;  3O48 A;  1TN6 A;  2PQR A;  3ISM C;  3P2B A;  5D0O D;  4XI0 A;  4GTO A;  2Q7F A;  5KJL A;  3FU6 A;  3QAQ A;  3JYS A;  3N71 A;  2FUL A;  3U4T A;  3FUD A;  3OAW A;  3ML8 A;  4HOQ A;  3C3R A;  3FUH A;  4A1G A;  4M7C A;  3TG5 A;  4LG6 A;  4AEZ C;  2MOW A;  2J09 A;  3FUI A;  4HI8 A;  1FT1 A;  5KNH D;  1DCE A;  5JJT A;  3ZN3 A;  3ASO E;  2AWI A;  3CST A;  3FP3 A;  2HYZ A;  4ZFH A;  1MJ0 A;  3MKQ B;  4A63 B;  4ACK A;  2WXG A;  1QQE A;  1N54 A;  3LYA A;  2XS8 A;  1IYG A;  4OAV B;  4I6E A;  3LVQ E;  3C72 A;  2WQ7 A;  4MKT A;  1JPL A;  1MQS A;  4ANU A;  2E2E A;  2WXF A;  1UN9 A;  3UIP C;  3SF4 A;  4L9P A;  3UT4 A;  3DXM G;  4BY6 A;  3BEE A;  5AAR A;  1H6P A;  3APC A;  2OEW A;  3ZU7 B;  2XGS A;  3GW4 A;  3OXF A;  2DWZ A;  3FTV A;  1OXJ A;  1KZO A;  5FWQ A;  3FEY A;  3L6A A;  1HG2 A;  1KZP A;  4J8E A;  1INZ A;  1TEZ A;  3DSV A;  3AJI A;  5E75 A;  2BED A;  3CK8 A;  1HZ4 A;  4HXI A;  4K0R A;  2XPI A;  2L0T B;  4HLE A;  3MV3 B;  4BT8 A;  5JHA A;  3SNX A;  4PS7 A;  1BU9 A;  4L7T A;  4F6R D;  2X38 A;  4KMO A;  4IYP A;  2GRQ B;  1TNU A;  3JXI A;  3SGH A;  4N39 A;  5LX8 A;  3VTX A;  2WVI A;  4G25 A;  1WG0 A;  3I4R B;  4RG9 A;  2WXH A;  1IQR A;  3FU3 A;  4EQF A;  3KSL A;  3QNK A;  4HRM B;  4ANV A;  2X6I A;  2AVP A;  3DPD A;  5T3R A;  4N3C A;  4FU3 A;  1EPU A;  4I2W A;  3LPZ A;  4EPZ A;  1YA0 A;  5FQ4 A;  5FZQ A;  5EIB E;  4AV7 A;  1GW6 A;  2XGM A;  4HRN A;  2IJG X;  4LNU D;  4QFV A;  2I1J A;  5EIL A;  3TWW A;  4I6G A;  2BF0 X;  3RRN B;  2WXI A;  2R02 A;  3OTN A;  4TV3 A;  4HB5 A;  5ANR A;  2ZGG A;  1N4Q A;  3L08 A;  3ZYM A;  2J9Q A;  1N94 A;  2BKK B;  5CHE E;  3RAU A;  5BXO A;  3S2A A;  4H7X A;  4GTT A;  2RD0 A;  5BPP A;  1LF8 A;  2XCC A;  4YDY A;  3NQP A;  2ILR A;  1HE8 A;  1E8Y A;  4N2Q A;  3PZD A;  2I6H A;  2AW6 A;  2P9S G;  1JUQ A;  2XEN A;  4R7L A;  4ATZ D;  3UTM A;  3Q47 B;  4UWL A;  4FJZ A;  5AQ7 A;  2ION A;  2LXM A;  4U07 A;  3PZ3 A;  5AEN A;  3ZKJ A;  4W9R A;  5KJN A;  4E6H A;  4WWN A;  5A7D B;  4GTV A;  3KEA A;  2F0Y A;  4FHK A;  3MX3 A;  2LSU A;  3HVE B;  3UUX A;  3T5X A;  2JLB A;  3QC1 A;  2PM6 A;  1U3C A;  3D9K A;  4U0Z A;  1MZC A;  2RKK A;  4AM9 A;  2YHE A;  3BG0 B;  2AJA A;  4GTS A;  5G05 C;  1Y6I A;  1V55 E;  5H7P A;  5D66 A;  1OWM A;  5T4Y A;  4GAA A;  1BLX B;  2A5U A;  3UQ3 A;  5J08 A;  1OWO A;  5BV1 A;  2YHC A;  3ZRH A;  4IN3 B;  1ZB1 A;  3ASD A;  4BSZ B;  4DJA A;  2J4D A;  2X6H A;  3UIO C;  3TGO A;  5D0Q D;  4CEM A;  3APD A;  3ENE A;  5ENO D;  4LRZ A;  1Z3Y A;  3TWS A;  3BUA A;  4O1O A;  4B8A A;  3RRM B;  3SZ7 A;  2V4H C;  1FVH A;  1HH8 A;  1Q2Z A;  4WUY A;  2A4Z A;  2GRL A;  4JC8 A;  1SA5 A;  3LY8 A;  1LTX A;  4K5A B;  2WXM A;  4L2L A;  3SFX A;  1BI8 B;  2IFU A;  3QWV A;  5EKQ D;  5ARF A;  1IQU A;  3CEQ A;  3SFY A;  4FLB A;  4FLH A;  2GRO B;  1IHB A;  2P9L G;  2XEV A;  3ESK A;  3J5P A;  1H2V C;  1N4S A;  3DPY A;  2UWJ G;  3CQC B;  3FTU A;  4LEU A;  4OAU C;  2OND A;  3FWV A;  4UQX A;  4EZL A;  2WXN A;  1PAQ A;  4JVS A;  2CFU A;  2EQX A;  3T9K A;  1TNY A;  2QC9 A;  4HOR A;  3SD5 A;  4YDO A;  3EDT B;  2XRZ A;  5FIO A;  3HVE A;  4HOS A;  3CVY A;  3S7D A;  2OV8 A;  2KZT B;  4AP2 A;  1S0P A;  3S7J A;  4DX5 D;  5HS0 A;  2WPV A;  4F1S A;  2QY7 A;  4AJW A;  4HLL A;  3DXK G;  4BT9 A;  1QNF A;  2DBA A;  4O6F A;  1MYO A;  3LCA A;  3W9F A;  1EDU A;  2VJ8 A;  5EID A;  3FH5 A;  3SO8 A;  2LSV A;  1WAO 1;  4BEP A;  3HXD A;  3OXG A;  3CHO A;  3ZIM A;  2WB2 A;  4G24 A;  3CQG B;  3JQ1 A;  1TYQ G;  2IOS A;  3U3W A;  3FUM A;  3B7R L;  1UW4 B;  3C5R A;  3KD7 A;  2P9K G;  4FAD A;  3PZ1 A;  3BG1 B;  1L5J A;  4XEI G;  2GRM A;  3Q4A B;  4DUI A;  1WDY A;  4J0U A;  2XQ0 A;  2P9N G;  4FHJ A;  3D9O A;  4EBA G;  4U8H A;  1HO8 A;  4Q94 A;  3NB2 A;  3FUN A;  3QAR A;  4CGV A;  2XPZ A;  4Q96 A;  3SY2 A;  4ABN A;  3ZPJ A;  1N4R A;  3KEZ A;  1X81 A;  2H6G A;  2J08 A;  3CHR A;  1O1R A;  2DIW A;  2NSZ A;  2DCP A;  3HG0 D;  3ASG A;  3QK0 A;  4DLO A;  4H7Y A;  4LSZ E;  4UUC A;  3GYZ A;  3NZS A;  5CEC B;  4C48 B;  4K5C A;  5CCL A;  3QWP A;  4YDE A;  3RO3 A;  4JB8 P;  3IV0 A;  3HDX A;  1NP7 A;  2PZI A;  1NL4 A;  1NFI E;  2LUH A;  1RZ4 A;  2HO1 A;  5FZR A;  3PNT B;  3ZVV A;  5G04 C;  2ZU6 B;  1A17 A;  4EHM A;  3AS5 A;  3G2S A;  4APO A;  2DZO A;  4A55 A;  4PS8 A;  3U9W A;  3FUL A;  1O1S A;  3E33 A;  1G3N B;  2J49 A;  4HOU A;  1E7V A;  4ZHB A;  4L2Y A;  1KT1 A;  1UJK A;  3L82 A;  4TRQ A;  4U8V D;  1E8W A;  4K03 A;  5DBK A;  1AWC B;  3EIJ A;  5ENS D;  5IY5 E;  2KM4 A;  3F6Q A;  2WXO A;  4RLY A;  2ETA A;  3D9L A;  4I2Z A;  4AY5 A;  3C98 A;  3D9J A;  4UWG A;  2VSN A;  2BUG A;  5BNW A;  5JA4 D;  3D3M A;  3SBT B;  3G2W A;  4WNG A;  4XZ4 A;  3LJN A;  2Y69 E;  2XS1 A;  2B6C A;  5HKP A;  4CT4 A;  5CBN A;  3ONL A;  3IKO B;  2HE0 A;  3ABK E;  1Z5S C;  3D9M A;  2IF4 A;  3AS4 A;  3S7F A;  3DBS A;  5G2N A;  4OVV A;  3L22 A;  1PY1 A;  3NF1 A;  4FC8 A;  3LS8 A;  4A1S A;  1UJJ A;  1SZA A;  2UY1 A;  1TJF A;  5B3S E;  4EZJ A;  1HF8 A;  3O4Z A;  4RG6 A;  4BFR A;  3CVN A;  4GTQ A;  3ULQ A;  1QYM A;  2GGF A;  3APF A;  4I9C A;  4MBG A;  3PNL B;  3CGH A;  1SW6 A;  4URK A;  2XZD G;  1HS6 A;  3UKU G;  4WNE A;  1BI7 B;  5CER B;  1OUV A;  4NIK A;  3ESL A;  4G23 A;  4GA0 A;  2OCC E;  2XZT G;  4GPM A;  1N11 A;  2HM8 A;  3DWL G;  3FH8 A;  3L16 A;  4GTR A;  1TN7 A;  2PL2 A;  4HVB A;  3HXC A;  4HOT A;  3PS6 A;  4JHR A;  4RSY A;  4EBA A;  3Q73 A;  2WXL A;  2DYS E;  3QKY A;  3MJW A;  1MHQ A;  4PDX A;  2IO3 C;  2RFA A;  4Q69 A;  3CVL A;  4GA2 A;  3NZU A;  4CZ2 D;  1LD7 A;  1WM5 A;  3Q79 A;  3LY9 A;  4B0Z A;  2IQC A;  1N4P A;  3UKR G;  4DI3 A;  5FIN A;  4GPK A;  4D10 C;  2WXP A;  4FA6 A;  1IKN D;  4NRH B;  1K1A A;  5LFA A;  1NA3 A;  4NUR A;  4UWK A;  1ELR A;  4PS3 A;  1FCH A;  4XIF A;  1EYH A;  2VGE A;  3BU8 A;  3CR3 A;  4GZ5 A;  2WXK A;  5G05 J;  3MZL B;  3EU5 A;  4C0E A;  3B7S A;  2OVF A;  3ZXP A;  1SA4 A;  4HBD A;  3UX4 A;  3ABL E;  1NZN A;  3JCK C;  3SQV A;  2ZGD A;  4ILG A;  4GMJ A;  2L9B A;  4A3V A;  2QFC A;  4N3B A;  3Q78 A;  4GMR A;  5D2M C;  3SI5 A;  4UI9 J;  3ZNG A;  2KXP C;  3ULY A;  5CRV A;  2KCV A;  5ENR D;  3RU0 A;  4O60 A;  3TWR A;  1U3D A;  4GZ3 A;  1HXI A;  3MA5 A;  2XHE A;  2WMO A;  4DX7 D;  1IHG A;  4B93 B;  3ZXS A;  1N0R A;  3R7Q A;  2NC9 A;  2HR2 A;  1DCQ A;  4UI9 C;  2YNQ A;  4PUC A;  1N52 A;  4JL0 A;  3PZ4 A;  5CMY A;  5FTP A;  3CHM A;  5JMN D;  2XRY A;  1TJC A;  5BUZ A;  3E30 A;  3ZYK A;  1N0Q A;  3FU5 A;  3CKB A;  3EIQ C;  1H6O A;  3CHS A;  4JA9 A;  4KT6 B;  1E8X A;  3UI2 A;  2ETC A;  2NXP A;  4BTA A;  2ZIS A;  3RKV A;  2KCL A;  3E4B A;  2XPY A;  4TUU A;  5CED B;  1OT8 A;  4BTB A;  4MS6 A;  3G2V A;  3MGB A;  1SVX A;  5CMW A;  1JCQ A;  2R5S A;  3AS8 A;  3CSF A;  3GZ2 A;  1K3Z D;  1Z6T A;  2VGX A;  4LUN U;  4WWP A;  4U96 D;  4I17 A;  3UM0 A;  2R17 C;  2X6K A;  3Q49 B;  2FI7 A;  2P58 C;  4J8F A;  5A6C A;  2L0I A;  2RG8 A;  2CHX A;  4F3V A;  4GZ6 A;  5ITZ F;  1XGW A;  4F1P A;  2IO2 C;  4JHK A;  1KPS B;  5J90 A;  4Y6C A;  3HRA A;  3HYM B;  5AN8 A;  3LXU X;  3DSX A;  1SQM A;  2J4B A;  2L6J A;  3PE3 A;  2Y1L E;  5G04 J;  3EHM A;  3EJN A;  5B1B E;  4YVQ C;  4CYM D;  2P9I G;  1TN8 A;  4HI9 A;  1TNZ A; 
#chains in the Genus database with same CATH homology
 2GRQ B;  2IO2 C;  1Z5S C;  3UIN C;  3UIO C;  1KPS B;  2GRP B;  2GRN B;  5D2M C;  3UIP C;  2GRO B;  2IO3 C;  2GRR B;  2IY0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...