1Z5SC

Crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Insights into E3 ligase activity revealed by a SUMO-RanGAP1-Ubc9-Nup358 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 1z5sC00
5D2MC 2IY0C 1Z5SC 2IO3C 1KPSB 2GROB 3UIPC 2IO2C 2GRNB 3UIOC 2GRRB 2GRPB 2GRQB 3UINC
chains in the Genus database with same CATH superfamily
4GTTA 3FTZA 3DWLG 1IQRA 3D9IA 3CKCA 3TWWA 1YYHA 1U2VG 2LO6A 3ZNGA 5G05J 1ELRA 4IN3B 3IHVA 2J49A 4Q69A 5LCWJ 1OWNA 2RKKA 5B1BE 3EUVA 3GZ1A 3SFZA 1OWMA 3RRUA 3CVPA 4GU5A 4AOFA 2WXPA 2J9QA 1UN8A 1N4RA 2WXHA 3ZPJA 4XI0A 3PUKA 3AJIA 5B1AE 3MKQA 2Q7FA 3FUDA 4JW1A 3W9FA 4E6HA 4JEHA 3UM3A 5KNGA 2CG2A 3S7DA 3L82A 3UT4A 2ETBA 3Q5MA 3HXFA 2PZIA 4ZFHA 4U0UA 4ME2A 2CG3A 4FJYA 1E90A 4GZ6A 4HI8A 5FZQA 4DX5D 4X8QA 5FQ8A 3LY8A 2H6HA 4J7WA 3AG2E 4I6GA 2VGXB 4U96D 4BERA 5LX8A 2WXMA 3V79K 4FLBA 1D8EA 4IRUA 4N2QA 2L6JA 3NBNB 3QC1A 4XIFA 2RG8A 3IXEA 2WB2A 4BX9A 2VYIA 3D9MA 4U8HA 5CEAA 3BQOA 2A5UA 3U3WA 4KMOA 3VLEA 4W9RA 5E76A 2I1KA 4J8DA 4O60A 5EDSA 5FQ6A 4MKTA 4JC8A 4EECA 2VSYA 4KVMA 4UWKA 1FVFA 5ENQD 5DBKA 2WQ7A 3PZDA 5G04C 3B7BA 1S0PA 2XZDG 1D8DA 3GZ2A 5FTPA 4HB5A 3V30A 3LYAA 4LNGA 3UT7A 3CHSA 5T8IA 2YHEA 3RO3A 4HS2A 2P9UG 3HXDA 5BUZA 1V54E 4DLOA 3UQ3A 1HH8A 4LRZA 4RSYA 5AN8A 2RD0A 2QFCA 5G2NA 3B7TA 2AW6A 5BXOA 1BI7B 3PREA 4EPZA 5ARGA 2B6CA 4JHKA 4N3AA 3T5VA 3ISMC 2LXLA 4U0SA 4A1SA 3MKQB 4GPMA 3ZIMA 2IO2C 2DZNA 3JQ1A 4I1OB 4GA1A 3ABKE 2R03A 2AWIA 4CCAA 4K5CA 4B8CB 2KXPC 4GMLA 3ZYMA 4APFA 1IYGA 4UI9K 3ZRHA 1EDUA 4I17A 2MRIA 4A55A 3UIOC 3DPDA 3T8KA 2CHWA 1NA0A 3HXCA 3MKRA 3HDXA 1H6KA 4DRXE 3CVWA 3Q15A 3FU6A 4J0UA 2P2CP 4NACA 2AXUA 2BEDA 3FUHA 1PC2A 2KBXA 3S7JA 3G2SA 4F7AA 2YINA 4R7LA 4FC8A 3PZ2A 2WM9A 5FJYA 4XX5A 2A5EA 4OAUC 3SO8A 1FT1A 3J5PA 2R5SA 3DXKG 2CHZA 1Y8MA 3D9NA 2BF0X 2XEVA 3AG3E 4KT6B 2JABA 1S63A 3APCA 3HRAA 4HORA 2FBNA 3CQGB 2KM4A 4YDYA 3CQCB 5CECB 1WG0A 3QKYA 4IYPA 4GPKA 2XS1A 4MBGA 3L17A 3RIBA 4DUIA 1NP7A 1TNZA 4BTBA 2EQXA 3CSFA 3EHQA 4PS8A 4XZ4A 2LAHA 2WMNA 3C3OA 1HFAA 3ABME 3MX3A 3SD5A 5G04J 4UWLA 1JWFA 3NQPA 3SI5A 4CDRA 2B0OE 4PH4B 3S7FA 3B95A 3RAUA 2AXZA 5BNWA 3PZ4A 3MCXA 1UJKA 1UW4B 2M63A 3ZKJA 4WWOA 2C0MA 4CDNA 1N52A 2IFUA 4WUYA 1DCQA 4GTVA 5ENNA 4F1PA 1XNFA 4AV7A 2X38A 5BXUA 1BD8A 5B3SE 4LERA 2HO1A 3LPZA 5EX3A 3LY7A 2V4HC 4ATZD 4G1TA 4KZCA 1FPPA 2YNQA 1TNOA 3L22A 4IULA 3QB2A 3TWSA 3V2XA 3JCKC 3JXIA 2FO1E 2KCVA 5AYWD 4ANUA 4CGVA 5D2MC 4QFVA 2WXKA 1RW2A 5AJDA 5AQ9A 4ANVA 4APOA 4U8YD 3CHOA 4EZLA 3APDA 1W3BA 5LP0A 2BUGA 3I4RB 2AVPA 3ONKA 3KD7A 4Z68A 2NSZA 5HRYA 4FJZA 2VJ8A 5EX0A 3R7RA 4KZ0A 5IY5E 3FUKA 2X6IA 5D66A 4EZJA 1QNFA 4BT9A 4CGWA 1TYQG 1DVPA 1KPSB 5C2YA 4GTQA 4ZHBA 3C3RA 2LUHA 1EF1C 4B93B 1HE8A 2IY0C 3HXEA 3QJZA 4G26A 1XGWA 2IO3C 1BU9A 2FF4A 4EZKA 2VSXE 3KS2A 4JHRA 2OOEA 3I5PA 4A1GA 3UINC 1HO8A 1U3DA 4DX1A 1H2UA 3R7QA 3DPYA 4RQIA 3CVUA 4GYOA 3EDTB 3D9HA 1OUVA 1UOHA 2NYJA 3PEUB 1E7VA 4BSZB 1N0RA 4HXIA 4FULA 4J6IA 3Q79A 4AY5A 3N71A 2J08A 3MA5A 2X6FA 4HOSA 5JJTA 2KZTA 2XPYA 3D9KA 3OXGA 1N11A 4TRQA 1AWCB 3QOUA 1K3ZD 3LCAA 5CBOA 3AG1E 3FH5A 2LNIA 4C9BB 1TR4A 4DPRA 4HNAD 4DX7D 3TWUA 2XENA 3IV0A 3CR3A 1JCRA 3Q9UC 5CRUA 3AAAC 2IOSA 4ATGA 3DXMG 4GTRA 4HFGA 2IOLA 3Q73A 4Y6WA 3UIPC 3MYVA 2XQ0A 3S7BA 1FVHA 4MLPA 4I1AA 3R9MA 4RLYA 2Y4UA 3FTUA 3ULEG 4RG9A 1RZ4A 4RG6A 5ANLA 2WQHA 3CLJA 3GYZA 2P9IG 3UKUG 2EIME 2XEEA 4GYYA 4NRHB 3HXBA 2R02A 5FWQA 5EN5D 4RVBA 3ZXSA 2X6JA 2WQ6A 4G24A 3CHRA 3L13A 3RU0A 4GZ5A 2YHCA 2YQ8A 2JEKA 2IU1A 5G55A 3RO2A 1H0AA 4XE0A 2LSVA 3BG1B 2XHEA 3MEKA 4HI9A 3V31A 4PUCA 2VSNA 4B0ZA 2P58C 4HOTA 5AQBA 3BUAA 4JL0A 3SNXA 3TL5A 3TWQA 2DYSE 4L2LA 2EIJE 4CT4A 5JHAA 2P9LG 4F53A 3T5XA 1P5QA 2BKKB 3AS4A 1A5EA 1X81A 4N3BA 3NOCD 3D9JA 5AAOA 4DI4A 4JVSA 3QWWA 3UXGA 1DNPA 5AARA 1JWGA 1U3CA 2ETCA 3UUXA 1MX4A 4ACKA 4FHJA 3FU5A 1UJJA 2DBAA 2PQRA 4TXQA 3PE4A 2KZTB 2ZIRA 1HG5A 4GAAA 1QBQA 2J09A 3QAQA 4ILHB 5CCMA 3CK7A 1PY1A 1B89A 3URZA 5JHBA 2F37A 2MHKA 2UWJG 3CSTA 2X3MA 4TV3A 2FULA 4TXPA 3RKVA 5KWDA 5ARFA 2XPIA 3G2TA 5C1DA 2GROB 3PEVB 1QYMA 4PS3A 4G8KA 4GTMA 2GRLA 2OV8A 3EHMA 1OCOE 3TG4A 5DIZA 2IJGX 1GW6A 3NB2A 3Q49B 1TN8A 4LCTA 5HS0A 1TNYA 4JPSA 3ZHEA 2XCCA 3FUNA 4EBAG 1N94A 3ASGA 3V2OA 1HXIA 1AP7A 1N54A 2XS8A 4WNDA 2H6IA 5CEDB 3DSTA 1X5BA 4AEZC 3CK8A 2Y0BG 3RJVA 1SVXA 2OCCE 3Q47B 3F6QA 3EJNA 5EIBE 3KEZA 2I6HA 4L7TA 3NAWA 1SQMA 2E2EA 3FU0A 3UM0A 3RSEG 2H6GA 3B7SA 4YDEA 4HRNA 3X2QE 3L16A 1N0QA 1E8XA 3FUJA 3KSLA 1JCQA 4OVVA 1Z5SC 4DK5A 3C72A 3AU4A 1MZCA 4P29A 4XEIG 1E8WA 3TG5A 3HIZA 2WXIA 4N5QA 2HYZA 2P9NG 3LJNA 4WNGA 5FINA 1YMPA 4UQYA 1OCCE 3EIJA 3ZEFA 3CKBA 5FT9A 3HVEA 4WWPA 5HI7A 1L5JA 3CHQA 4YNDA 1OCZE 2HE0A 2L0TB 3ULYA 4LG6A 5FZRA 3Q4AB 5FQ7A 3SBTB 3QARA 3ZXPA 5AJLA 4O1OA 3LKUA 3OXLA 3VTYA 2Y69E 1TJCA 2VQ2A 1O5MA 1OWLA 5EYPF 2V4LA 5JMND 2V5FA 4AP2A 5KJLA 3UT8A 4JB8P 3JUIA 3DSWA 3U66A 2IQCA 3NOGD 4U8VD 2RFMA 1H19A 1Z3YA 3SQVA 2WXLA 1MQSA 3ZHEB 1KZPA 5FIOA 3L08A 3W9GA 2FI7A 4YDWA 1K8KG 4I2ZA 1INZA 1S70B 3C5RA 3FTXA 3FUEA 5BV0A 4GA2A 2PL2A 3FUMA 3SBSA 3FTWA 3TGOA 1PAQA 4WNFA 5M72A 3EIQC 3PNTB 2X6KA 4U04A 2F8YA 3VLDA 5T3RA 5FZSA 4BX8A 5CERB 1HG2A 3QNKA 3BG0B 3T9KA 4LNUD 2R59A 1TEZA 5CHEE 2GRPB 5HKPA 2VSOE 3ZUVB 4PS7A 2IEJA 4JHJA 3OAWA 2XRZA 5CBNA 3L54A 1EYHA 4U07A 3LDZA 4C0EA 3SFYA 2L6BA 3LVQE 2H6FA 3J5QB 2J8SD 3Q7AA 1SZAA 3TWTA 2ILRA 2EIKE 2WXJA 3FULA 1JUQA 2NXPA 3ZN3A 2XCBA 3L9TA 2AXVA 4OYSA 2DWZA 5FQ4A 3CVNA 3U4TA 4CEMA 4TUUA 4KXKB 3SZ7A 4C0MA 1V55E 4U7EB 4EQFA 4N5CA 4L23A 3HVEB 3ONLA 2QC9A 4FA6A 2QZAA 4LEUA 3HG0D 2VTBA 3FTSA 4M3OA 1ELWA 3E32A 4I6JA 2LXMA 1OWOA 1MX2A 3E4BA 4HQDA 1HU3A 2J07A 3ML8A 4U95D 4QQIA 4UQXA 3SGHA 3ULQA 1BI8B 2OVBA 5A6CA 3ABLE 3NZSA 1MJ0A 4UI9C 1SW6A 3CHMA 4J8FA 3UI2A 1QZ2A 4K0RA 1WM5A 1ZBPA 2WMOA 3CVQA 2LSUA 3SFXA 2P9KG 2ZGDA 1HS6A 3Q7FA 3JUEA 3IHYA 3HHMA 2I1JA 4I6EA 4DX2A 1IHBA 2QYJA 1WDYA 1ZB1A 3JYSA 1Z3XA 4K5AB 1MYOA 3FEXA 4I1MA 4B89A 4N2SA 2MOWA 4E85A 1TNBA 4AJWA 4MRUA 4JD2G 3WG7E 3VLFA 3ENEA 3DRAA 2R2LA 4UUCA 5JJ6A 1UN9A 3U64A 3FWVA 5AQAA 3JQ0A 5HQ8A 4DJAA 3ZYQA 1SA5A 4J8YA 3AU5A 5CMYA 4BFRA 3ZU7B 3AS5A 1LF8A 2PM7A 4BSXA 4ILGA 3FUFA 4B94A 4Q94A 3CVYA 2VTBB 3MV2B 4GMJA 3FTVA 4JA7A 2MYOA 3ZW3A 2GRQB 3LY9A 3BU8A 1HF8A 1H2VC 1OY3D 4GTPA 1OXJA 1NFIE 3UM2A 3EU5A 1MHQA 5T4YA 2XGOA 4O1PA 5KJNA 5EILA 2V5QC 1WY6A 1O1SA 4TXRA 4BY6A 3CEQA 1KLXA 2IONA 1A17A 3DEPA 2PNNA 5KNHD 3DBSA 1N9AA 3ESLA 3ZYKA 2WVIA 4U0ZA 3G2VA 1Y6IA 5KJKA 1E96B 4NIKA 1TJFA 5CRVA 3TXNA 3I3NA 3CHPA 5KJMA 3MGBA 1TN6A 5KCMA 4FADA 3APFA 2EINE 2R05A 3TWVA 3QK0A 1KT1A 2I9CA 4L9PA 5AENA 4FHKA 4UI9J 3NF1A 4CYMD 5KBAA 3FTYA 3DSXA 3UTMA 4EHMA 2IF4A 3FP3A 2CHXA 3CGHA 3SHFA 4AVXA 1O1RA 3GZSA 4ACLA 4AY6A 1EPUA 2WXFA 2Y3AA 1OWPA 1S64A 4WAFA 4HRLA 3BEEA 3LS8A 2P9SG 4XI9A 3UPVA 1IQUA 2PQNA 5BW8C 4UQZA 3S2AA 3DEOA 2ZGGA 4LUNU 1H2TC 4GCNA 4N3CA 3QWVA 4ANXA 4YVOA 1KT0A 1DC2A 3FY4A 5JA4D 1HX8A 1IXVA 1SZ9A 2F0YA 1NI1A 1K1AA 3O48A 3ZGQA 2R17C 4DX6D 2OEVA 5AQ7A 1ELKA 3EU9A 3OXFA 1VDYA 5D0QD 3DSUA 1OT8A 3PE3A 3SY2A 2ETAA 3IBEA 2GW1A 3LJ3A 4CT0A 4TUMA 4JA9A 4UWGA 5H7PA 4A63B 4JZYA 1IHGA 3FH8A 3MJWA 1NA3A 2JLBA 4HRMB 3FHEA 3EHRA 2NC9A 3FFLA 2GRNB 2OVFA 2BKGA 2V8SE 4C48B 4L1BA 4BETA 3QWPA 3ZVVA 3D9OA 4UWFA 2KCKA 1E8YA 2ONDA 1FT2A 1MX6A 1JCSA 4HLEA 2A4ZA 2CFUA 5E75A 4I9CA 4BWRA 2ZU6B 3LEWA 4G2VA 3D9PA 1Q2ZA 3CVLA 4B8AA 2X6HA 1WAO1 4DLQA 5ENTD 3GW4A 4ABNA 2QYUA 4GZDA 3C3QA 2J4DA 3WXXA 4AM9A 1LD8A 4V3IA 4A3TA 3TWXA 3R9AB 2Y4TA 1YA0A 3K9IA 2XRYA 3G2UA 3PZ1A 3CIAA 2UY1A 3ASDA 1FCHA 2OEWA 3ML9A 2DVWA 5ENSD 4HOQA 4YDOA 2WXQA 3CVXA 4H7YA 4PDXA 2DCPA 4FU3A 3PUJA 4GTSA 2ZXWE 4G8LA 5ENOD 4GA0A 5EYLA 4F3VA 3Q75A 2XZTG 3PS6A 4O6FA 2HR2A 3TAXA 1Z6TA 3UX4A 4J8SA 3E30A 1E8ZA 2KATA 3RK6A 3U9WA 2DIWA 2KCLA 5A7DB 5A23A 3ASHA 3B7UX 3I4GA 3IKOB 5J90A 1QQEA 4BT8A 2DZOA 3DSVA 4F1SA 3FDHA 4A3VA 5LOZA 2GRRB 4LSZE 3KSQA 1N4SA 2DYRE 2XGSA 5ANRA 1HZ4A 1E7UA 3MV3B 1TN7A 1G3NB 4HOUA 1NZNA 3UM1A 3P1UA 2XPZA 5CCLA 1SA4A 2ZISA 5D0OD 4HVBA 3LXUX 4K5BA 1YCSB 3L6AA 2L0IA 4UWHA 3PNLB 3FUIA 1LD7A 3UKRG 2XEHA 4CDMA 2HM8A 4NQ0A 1BPOA 3PZ3A 1NL4A 4GZ3A 3EHNA 2QY7A 2LAIA 4G23A 1ZU2A 5BT1A 3UMVA 1IKND 4J8EA 4KVOA 3B13A 2BTDA 3ASOE 4I9EA 3AS8A 3FU3A 3FH7A 4URKA 1DCEA 3CK9A 2L9BA 4KBQA 3IEGA 2UY1B 2GGFA 4LNBA 3SF4A 2Y1LE 4G25A 5BV1A 4WWNA 2VGYA 4DI3A 4GCOA 3PDNA 3TWRA 1BLXB 2CFZA 4XKBA 3JXJA 1N4PA 5BPPA 5ENPD 1KZOA 2WXNA 3AG4E 5G05C 2F8XK 4FLHA 3CVVA 3NZUA 5LCWC 3ZYLA 2RFAA 2E0IA 2V0PA 3ESKA 5ITZF 3DSSA 5J08A 1H6PA 2XGMA 3QDNA 2KC7A 1N95A 3C98A 4N39A 4Y6CA 5EIDA 3PVLA 5CMWA 4OVUA 3D3MA 4HBDA 3PRZA 2WXOA 4NURA 3B7RL 3PH0C 4K03A 2AJAA 4FP7A 3LVRE 4WNEA 1N4QA 3OTNA 2FO7A 4JEUA 4I2WA 2PM6A 2WPVA 3KEAA 4GMRA 3MZLB 4D10C 3TXMA 3E34A 4BEPA 3O4ZA 3HYMB 4M7CA 4L2YA 4GTOA 4HLLA 5EKQD 1TNUA 3VTXA 3ZFWA 4H7XA 4OAVB 4I43A 3P2BA 1JPLA 4XKCA 1UG3A 2GRMA 1LTXA 4G11A 4BTAA 4F6RD 5AIJA 4EBAA 4GYWA 3D9LA 2J4BA 3ASNE 2FEZA 1K1BA 2VGXA 4BESA 3T8MA 4MS6A 4CZ2D 4Q96A 2P9PG 3CV0A 4YVQC 5LFAA 4ILIA 2WXRA 3G2WA 3Q78A 4ANWA 5ENRD 2WXGA 3E33A 4AIFA 3KAEA 4U63A 1H6OA 5JJ7A 2VGEA 3RRNB 2C0LA 2I2OA 3ASFA 4JXTA 1OCRE 1D9SA 3RRMB 4GB9A 1O1TA 4AXHA 2EILE 4KYOB 4CRWA 3Q9NC 3TJPA 4GZCA 3E37A 2C2LA 3FEYA
chains in the Genus database with same CATH topology
5D2MC 2IY0C 1Z5SC 2IO3C 1KPSB 2GROB 3UIPC 2IO2C 2GRNB 3UIOC 2GRRB 2GRPB 2GRQB 3UINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2M C;  2IY0 C;  1Z5S C;  2IO3 C;  1KPS B;  2GRO B;  3UIP C;  2IO2 C;  2GRN B;  3UIO C;  2GRR B;  2GRP B;  2GRQ B;  3UIN C; 
#chains in the Genus database with same CATH topology
 4GTT A;  3FTZ A;  3DWL G;  1IQR A;  3D9I A;  3CKC A;  3TWW A;  1YYH A;  1U2V G;  2LO6 A;  3ZNG A;  5G05 J;  1ELR A;  4IN3 B;  3IHV A;  2J49 A;  4Q69 A;  5LCW J;  1OWN A;  2RKK A;  5B1B E;  3EUV A;  3GZ1 A;  3SFZ A;  1OWM A;  3RRU A;  3CVP A;  4GU5 A;  4AOF A;  2WXP A;  2J9Q A;  1UN8 A;  1N4R A;  2WXH A;  3ZPJ A;  4XI0 A;  3PUK A;  3AJI A;  5B1A E;  3MKQ A;  2Q7F A;  3FUD A;  4JW1 A;  3W9F A;  4E6H A;  4JEH A;  3UM3 A;  5KNG A;  2CG2 A;  3S7D A;  3L82 A;  3UT4 A;  2ETB A;  3Q5M A;  3HXF A;  2PZI A;  4ZFH A;  4U0U A;  4ME2 A;  2CG3 A;  4FJY A;  1E90 A;  4GZ6 A;  4HI8 A;  5FZQ A;  4DX5 D;  4X8Q A;  5FQ8 A;  3LY8 A;  2H6H A;  4J7W A;  3AG2 E;  4I6G A;  2VGX B;  4U96 D;  4BER A;  5LX8 A;  2WXM A;  3V79 K;  4FLB A;  1D8E A;  4IRU A;  4N2Q A;  2L6J A;  3NBN B;  3QC1 A;  4XIF A;  2RG8 A;  3IXE A;  2WB2 A;  4BX9 A;  2VYI A;  3D9M A;  4U8H A;  5CEA A;  3BQO A;  2A5U A;  3U3W A;  4KMO A;  3VLE A;  4W9R A;  5E76 A;  2I1K A;  4J8D A;  4O60 A;  5EDS A;  5FQ6 A;  4MKT A;  4JC8 A;  4EEC A;  2VSY A;  4KVM A;  4UWK A;  1FVF A;  5ENQ D;  5DBK A;  2WQ7 A;  3PZD A;  5G04 C;  3B7B A;  1S0P A;  2XZD G;  1D8D A;  3GZ2 A;  5FTP A;  4HB5 A;  3V30 A;  3LYA A;  4LNG A;  3UT7 A;  3CHS A;  5T8I A;  2YHE A;  3RO3 A;  4HS2 A;  2P9U G;  3HXD A;  5BUZ A;  1V54 E;  4DLO A;  3UQ3 A;  1HH8 A;  4LRZ A;  4RSY A;  5AN8 A;  2RD0 A;  2QFC A;  5G2N A;  3B7T A;  2AW6 A;  5BXO A;  1BI7 B;  3PRE A;  4EPZ A;  5ARG A;  2B6C A;  4JHK A;  4N3A A;  3T5V A;  3ISM C;  2LXL A;  4U0S A;  4A1S A;  3MKQ B;  4GPM A;  3ZIM A;  2IO2 C;  2DZN A;  3JQ1 A;  4I1O B;  4GA1 A;  3ABK E;  2R03 A;  2AWI A;  4CCA A;  4K5C A;  4B8C B;  2KXP C;  4GML A;  3ZYM A;  4APF A;  1IYG A;  4UI9 K;  3ZRH A;  1EDU A;  4I17 A;  2MRI A;  4A55 A;  3UIO C;  3DPD A;  3T8K A;  2CHW A;  1NA0 A;  3HXC A;  3MKR A;  3HDX A;  1H6K A;  4DRX E;  3CVW A;  3Q15 A;  3FU6 A;  4J0U A;  2P2C P;  4NAC A;  2AXU A;  2BED A;  3FUH A;  1PC2 A;  2KBX A;  3S7J A;  3G2S A;  4F7A A;  2YIN A;  4R7L A;  4FC8 A;  3PZ2 A;  2WM9 A;  5FJY A;  4XX5 A;  2A5E A;  4OAU C;  3SO8 A;  1FT1 A;  3J5P A;  2R5S A;  3DXK G;  2CHZ A;  1Y8M A;  3D9N A;  2BF0 X;  2XEV A;  3AG3 E;  4KT6 B;  2JAB A;  1S63 A;  3APC A;  3HRA A;  4HOR A;  2FBN A;  3CQG B;  2KM4 A;  4YDY A;  3CQC B;  5CEC B;  1WG0 A;  3QKY A;  4IYP A;  4GPK A;  2XS1 A;  4MBG A;  3L17 A;  3RIB A;  4DUI A;  1NP7 A;  1TNZ A;  4BTB A;  2EQX A;  3CSF A;  3EHQ A;  4PS8 A;  4XZ4 A;  2LAH A;  2WMN A;  3C3O A;  1HFA A;  3ABM E;  3MX3 A;  3SD5 A;  5G04 J;  4UWL A;  1JWF A;  3NQP A;  3SI5 A;  4CDR A;  2B0O E;  4PH4 B;  3S7F A;  3B95 A;  3RAU A;  2AXZ A;  5BNW A;  3PZ4 A;  3MCX A;  1UJK A;  1UW4 B;  2M63 A;  3ZKJ A;  4WWO A;  2C0M A;  4CDN A;  1N52 A;  2IFU A;  4WUY A;  1DCQ A;  4GTV A;  5ENN A;  4F1P A;  1XNF A;  4AV7 A;  2X38 A;  5BXU A;  1BD8 A;  5B3S E;  4LER A;  2HO1 A;  3LPZ A;  5EX3 A;  3LY7 A;  2V4H C;  4ATZ D;  4G1T A;  4KZC A;  1FPP A;  2YNQ A;  1TNO A;  3L22 A;  4IUL A;  3QB2 A;  3TWS A;  3V2X A;  3JCK C;  3JXI A;  2FO1 E;  2KCV A;  5AYW D;  4ANU A;  4CGV A;  5D2M C;  4QFV A;  2WXK A;  1RW2 A;  5AJD A;  5AQ9 A;  4ANV A;  4APO A;  4U8Y D;  3CHO A;  4EZL A;  3APD A;  1W3B A;  5LP0 A;  2BUG A;  3I4R B;  2AVP A;  3ONK A;  3KD7 A;  4Z68 A;  2NSZ A;  5HRY A;  4FJZ A;  2VJ8 A;  5EX0 A;  3R7R A;  4KZ0 A;  5IY5 E;  3FUK A;  2X6I A;  5D66 A;  4EZJ A;  1QNF A;  4BT9 A;  4CGW A;  1TYQ G;  1DVP A;  1KPS B;  5C2Y A;  4GTQ A;  4ZHB A;  3C3R A;  2LUH A;  1EF1 C;  4B93 B;  1HE8 A;  2IY0 C;  3HXE A;  3QJZ A;  4G26 A;  1XGW A;  2IO3 C;  1BU9 A;  2FF4 A;  4EZK A;  2VSX E;  3KS2 A;  4JHR A;  2OOE A;  3I5P A;  4A1G A;  3UIN C;  1HO8 A;  1U3D A;  4DX1 A;  1H2U A;  3R7Q A;  3DPY A;  4RQI A;  3CVU A;  4GYO A;  3EDT B;  3D9H A;  1OUV A;  1UOH A;  2NYJ A;  3PEU B;  1E7V A;  4BSZ B;  1N0R A;  4HXI A;  4FUL A;  4J6I A;  3Q79 A;  4AY5 A;  3N71 A;  2J08 A;  3MA5 A;  2X6F A;  4HOS A;  5JJT A;  2KZT A;  2XPY A;  3D9K A;  3OXG A;  1N11 A;  4TRQ A;  1AWC B;  3QOU A;  1K3Z D;  3LCA A;  5CBO A;  3AG1 E;  3FH5 A;  2LNI A;  4C9B B;  1TR4 A;  4DPR A;  4HNA D;  4DX7 D;  3TWU A;  2XEN A;  3IV0 A;  3CR3 A;  1JCR A;  3Q9U C;  5CRU A;  3AAA C;  2IOS A;  4ATG A;  3DXM G;  4GTR A;  4HFG A;  2IOL A;  3Q73 A;  4Y6W A;  3UIP C;  3MYV A;  2XQ0 A;  3S7B A;  1FVH A;  4MLP A;  4I1A A;  3R9M A;  4RLY A;  2Y4U A;  3FTU A;  3ULE G;  4RG9 A;  1RZ4 A;  4RG6 A;  5ANL A;  2WQH A;  3CLJ A;  3GYZ A;  2P9I G;  3UKU G;  2EIM E;  2XEE A;  4GYY A;  4NRH B;  3HXB A;  2R02 A;  5FWQ A;  5EN5 D;  4RVB A;  3ZXS A;  2X6J A;  2WQ6 A;  4G24 A;  3CHR A;  3L13 A;  3RU0 A;  4GZ5 A;  2YHC A;  2YQ8 A;  2JEK A;  2IU1 A;  5G55 A;  3RO2 A;  1H0A A;  4XE0 A;  2LSV A;  3BG1 B;  2XHE A;  3MEK A;  4HI9 A;  3V31 A;  4PUC A;  2VSN A;  4B0Z A;  2P58 C;  4HOT A;  5AQB A;  3BUA A;  4JL0 A;  3SNX A;  3TL5 A;  3TWQ A;  2DYS E;  4L2L A;  2EIJ E;  4CT4 A;  5JHA A;  2P9L G;  4F53 A;  3T5X A;  1P5Q A;  2BKK B;  3AS4 A;  1A5E A;  1X81 A;  4N3B A;  3NOC D;  3D9J A;  5AAO A;  4DI4 A;  4JVS A;  3QWW A;  3UXG A;  1DNP A;  5AAR A;  1JWG A;  1U3C A;  2ETC A;  3UUX A;  1MX4 A;  4ACK A;  4FHJ A;  3FU5 A;  1UJJ A;  2DBA A;  2PQR A;  4TXQ A;  3PE4 A;  2KZT B;  2ZIR A;  1HG5 A;  4GAA A;  1QBQ A;  2J09 A;  3QAQ A;  4ILH B;  5CCM A;  3CK7 A;  1PY1 A;  1B89 A;  3URZ A;  5JHB A;  2F37 A;  2MHK A;  2UWJ G;  3CST A;  2X3M A;  4TV3 A;  2FUL A;  4TXP A;  3RKV A;  5KWD A;  5ARF A;  2XPI A;  3G2T A;  5C1D A;  2GRO B;  3PEV B;  1QYM A;  4PS3 A;  4G8K A;  4GTM A;  2GRL A;  2OV8 A;  3EHM A;  1OCO E;  3TG4 A;  5DIZ A;  2IJG X;  1GW6 A;  3NB2 A;  3Q49 B;  1TN8 A;  4LCT A;  5HS0 A;  1TNY A;  4JPS A;  3ZHE A;  2XCC A;  3FUN A;  4EBA G;  1N94 A;  3ASG A;  3V2O A;  1HXI A;  1AP7 A;  1N54 A;  2XS8 A;  4WND A;  2H6I A;  5CED B;  3DST A;  1X5B A;  4AEZ C;  3CK8 A;  2Y0B G;  3RJV A;  1SVX A;  2OCC E;  3Q47 B;  3F6Q A;  3EJN A;  5EIB E;  3KEZ A;  2I6H A;  4L7T A;  3NAW A;  1SQM A;  2E2E A;  3FU0 A;  3UM0 A;  3RSE G;  2H6G A;  3B7S A;  4YDE A;  4HRN A;  3X2Q E;  3L16 A;  1N0Q A;  1E8X A;  3FUJ A;  3KSL A;  1JCQ A;  4OVV A;  1Z5S C;  4DK5 A;  3C72 A;  3AU4 A;  1MZC A;  4P29 A;  4XEI G;  1E8W A;  3TG5 A;  3HIZ A;  2WXI A;  4N5Q A;  2HYZ A;  2P9N G;  3LJN A;  4WNG A;  5FIN A;  1YMP A;  4UQY A;  1OCC E;  3EIJ A;  3ZEF A;  3CKB A;  5FT9 A;  3HVE A;  4WWP A;  5HI7 A;  1L5J A;  3CHQ A;  4YND A;  1OCZ E;  2HE0 A;  2L0T B;  3ULY A;  4LG6 A;  5FZR A;  3Q4A B;  5FQ7 A;  3SBT B;  3QAR A;  3ZXP A;  5AJL A;  4O1O A;  3LKU A;  3OXL A;  3VTY A;  2Y69 E;  1TJC A;  2VQ2 A;  1O5M A;  1OWL A;  5EYP F;  2V4L A;  5JMN D;  2V5F A;  4AP2 A;  5KJL A;  3UT8 A;  4JB8 P;  3JUI A;  3DSW A;  3U66 A;  2IQC A;  3NOG D;  4U8V D;  2RFM A;  1H19 A;  1Z3Y A;  3SQV A;  2WXL A;  1MQS A;  3ZHE B;  1KZP A;  5FIO A;  3L08 A;  3W9G A;  2FI7 A;  4YDW A;  1K8K G;  4I2Z A;  1INZ A;  1S70 B;  3C5R A;  3FTX A;  3FUE A;  5BV0 A;  4GA2 A;  2PL2 A;  3FUM A;  3SBS A;  3FTW A;  3TGO A;  1PAQ A;  4WNF A;  5M72 A;  3EIQ C;  3PNT B;  2X6K A;  4U04 A;  2F8Y A;  3VLD A;  5T3R A;  5FZS A;  4BX8 A;  5CER B;  1HG2 A;  3QNK A;  3BG0 B;  3T9K A;  4LNU D;  2R59 A;  1TEZ A;  5CHE E;  2GRP B;  5HKP A;  2VSO E;  3ZUV B;  4PS7 A;  2IEJ A;  4JHJ A;  3OAW A;  2XRZ A;  5CBN A;  3L54 A;  1EYH A;  4U07 A;  3LDZ A;  4C0E A;  3SFY A;  2L6B A;  3LVQ E;  2H6F A;  3J5Q B;  2J8S D;  3Q7A A;  1SZA A;  3TWT A;  2ILR A;  2EIK E;  2WXJ A;  3FUL A;  1JUQ A;  2NXP A;  3ZN3 A;  2XCB A;  3L9T A;  2AXV A;  4OYS A;  2DWZ A;  5FQ4 A;  3CVN A;  3U4T A;  4CEM A;  4TUU A;  4KXK B;  3SZ7 A;  4C0M A;  1V55 E;  4U7E B;  4EQF A;  4N5C A;  4L23 A;  3HVE B;  3ONL A;  2QC9 A;  4FA6 A;  2QZA A;  4LEU A;  3HG0 D;  2VTB A;  3FTS A;  4M3O A;  1ELW A;  3E32 A;  4I6J A;  2LXM A;  1OWO A;  1MX2 A;  3E4B A;  4HQD A;  1HU3 A;  2J07 A;  3ML8 A;  4U95 D;  4QQI A;  4UQX A;  3SGH A;  3ULQ A;  1BI8 B;  2OVB A;  5A6C A;  3ABL E;  3NZS A;  1MJ0 A;  4UI9 C;  1SW6 A;  3CHM A;  4J8F A;  3UI2 A;  1QZ2 A;  4K0R A;  1WM5 A;  1ZBP A;  2WMO A;  3CVQ A;  2LSU A;  3SFX A;  2P9K G;  2ZGD A;  1HS6 A;  3Q7F A;  3JUE A;  3IHY A;  3HHM A;  2I1J A;  4I6E A;  4DX2 A;  1IHB A;  2QYJ A;  1WDY A;  1ZB1 A;  3JYS A;  1Z3X A;  4K5A B;  1MYO A;  3FEX A;  4I1M A;  4B89 A;  4N2S A;  2MOW A;  4E85 A;  1TNB A;  4AJW A;  4MRU A;  4JD2 G;  3WG7 E;  3VLF A;  3ENE A;  3DRA A;  2R2L A;  4UUC A;  5JJ6 A;  1UN9 A;  3U64 A;  3FWV A;  5AQA A;  3JQ0 A;  5HQ8 A;  4DJA A;  3ZYQ A;  1SA5 A;  4J8Y A;  3AU5 A;  5CMY A;  4BFR A;  3ZU7 B;  3AS5 A;  1LF8 A;  2PM7 A;  4BSX A;  4ILG A;  3FUF A;  4B94 A;  4Q94 A;  3CVY A;  2VTB B;  3MV2 B;  4GMJ A;  3FTV A;  4JA7 A;  2MYO A;  3ZW3 A;  2GRQ B;  3LY9 A;  3BU8 A;  1HF8 A;  1H2V C;  1OY3 D;  4GTP A;  1OXJ A;  1NFI E;  3UM2 A;  3EU5 A;  1MHQ A;  5T4Y A;  2XGO A;  4O1P A;  5KJN A;  5EIL A;  2V5Q C;  1WY6 A;  1O1S A;  4TXR A;  4BY6 A;  3CEQ A;  1KLX A;  2ION A;  1A17 A;  3DEP A;  2PNN A;  5KNH D;  3DBS A;  1N9A A;  3ESL A;  3ZYK A;  2WVI A;  4U0Z A;  3G2V A;  1Y6I A;  5KJK A;  1E96 B;  4NIK A;  1TJF A;  5CRV A;  3TXN A;  3I3N A;  3CHP A;  5KJM A;  3MGB A;  1TN6 A;  5KCM A;  4FAD A;  3APF A;  2EIN E;  2R05 A;  3TWV A;  3QK0 A;  1KT1 A;  2I9C A;  4L9P A;  5AEN A;  4FHK A;  4UI9 J;  3NF1 A;  4CYM D;  5KBA A;  3FTY A;  3DSX A;  3UTM A;  4EHM A;  2IF4 A;  3FP3 A;  2CHX A;  3CGH A;  3SHF A;  4AVX A;  1O1R A;  3GZS A;  4ACL A;  4AY6 A;  1EPU A;  2WXF A;  2Y3A A;  1OWP A;  1S64 A;  4WAF A;  4HRL A;  3BEE A;  3LS8 A;  2P9S G;  4XI9 A;  3UPV A;  1IQU A;  2PQN A;  5BW8 C;  4UQZ A;  3S2A A;  3DEO A;  2ZGG A;  4LUN U;  1H2T C;  4GCN A;  4N3C A;  3QWV A;  4ANX A;  4YVO A;  1KT0 A;  1DC2 A;  3FY4 A;  5JA4 D;  1HX8 A;  1IXV A;  1SZ9 A;  2F0Y A;  1NI1 A;  1K1A A;  3O48 A;  3ZGQ A;  2R17 C;  4DX6 D;  2OEV A;  5AQ7 A;  1ELK A;  3EU9 A;  3OXF A;  1VDY A;  5D0Q D;  3DSU A;  1OT8 A;  3PE3 A;  3SY2 A;  2ETA A;  3IBE A;  2GW1 A;  3LJ3 A;  4CT0 A;  4TUM A;  4JA9 A;  4UWG A;  5H7P A;  4A63 B;  4JZY A;  1IHG A;  3FH8 A;  3MJW A;  1NA3 A;  2JLB A;  4HRM B;  3FHE A;  3EHR A;  2NC9 A;  3FFL A;  2GRN B;  2OVF A;  2BKG A;  2V8S E;  4C48 B;  4L1B A;  4BET A;  3QWP A;  3ZVV A;  3D9O A;  4UWF A;  2KCK A;  1E8Y A;  2OND A;  1FT2 A;  1MX6 A;  1JCS A;  4HLE A;  2A4Z A;  2CFU A;  5E75 A;  4I9C A;  4BWR A;  2ZU6 B;  3LEW A;  4G2V A;  3D9P A;  1Q2Z A;  3CVL A;  4B8A A;  2X6H A;  1WAO 1;  4DLQ A;  5ENT D;  3GW4 A;  4ABN A;  2QYU A;  4GZD A;  3C3Q A;  2J4D A;  3WXX A;  4AM9 A;  1LD8 A;  4V3I A;  4A3T A;  3TWX A;  3R9A B;  2Y4T A;  1YA0 A;  3K9I A;  2XRY A;  3G2U A;  3PZ1 A;  3CIA A;  2UY1 A;  3ASD A;  1FCH A;  2OEW A;  3ML9 A;  2DVW A;  5ENS D;  4HOQ A;  4YDO A;  2WXQ A;  3CVX A;  4H7Y A;  4PDX A;  2DCP A;  4FU3 A;  3PUJ A;  4GTS A;  2ZXW E;  4G8L A;  5ENO D;  4GA0 A;  5EYL A;  4F3V A;  3Q75 A;  2XZT G;  3PS6 A;  4O6F A;  2HR2 A;  3TAX A;  1Z6T A;  3UX4 A;  4J8S A;  3E30 A;  1E8Z A;  2KAT A;  3RK6 A;  3U9W A;  2DIW A;  2KCL A;  5A7D B;  5A23 A;  3ASH A;  3B7U X;  3I4G A;  3IKO B;  5J90 A;  1QQE A;  4BT8 A;  2DZO A;  3DSV A;  4F1S A;  3FDH A;  4A3V A;  5LOZ A;  2GRR B;  4LSZ E;  3KSQ A;  1N4S A;  2DYR E;  2XGS A;  5ANR A;  1HZ4 A;  1E7U A;  3MV3 B;  1TN7 A;  1G3N B;  4HOU A;  1NZN A;  3UM1 A;  3P1U A;  2XPZ A;  5CCL A;  1SA4 A;  2ZIS A;  5D0O D;  4HVB A;  3LXU X;  4K5B A;  1YCS B;  3L6A A;  2L0I A;  4UWH A;  3PNL B;  3FUI A;  1LD7 A;  3UKR G;  2XEH A;  4CDM A;  2HM8 A;  4NQ0 A;  1BPO A;  3PZ3 A;  1NL4 A;  4GZ3 A;  3EHN A;  2QY7 A;  2LAI A;  4G23 A;  1ZU2 A;  5BT1 A;  3UMV A;  1IKN D;  4J8E A;  4KVO A;  3B13 A;  2BTD A;  3ASO E;  4I9E A;  3AS8 A;  3FU3 A;  3FH7 A;  4URK A;  1DCE A;  3CK9 A;  2L9B A;  4KBQ A;  3IEG A;  2UY1 B;  2GGF A;  4LNB A;  3SF4 A;  2Y1L E;  4G25 A;  5BV1 A;  4WWN A;  2VGY A;  4DI3 A;  4GCO A;  3PDN A;  3TWR A;  1BLX B;  2CFZ A;  4XKB A;  3JXJ A;  1N4P A;  5BPP A;  5ENP D;  1KZO A;  2WXN A;  3AG4 E;  5G05 C;  2F8X K;  4FLH A;  3CVV A;  3NZU A;  5LCW C;  3ZYL A;  2RFA A;  2E0I A;  2V0P A;  3ESK A;  5ITZ F;  3DSS A;  5J08 A;  1H6P A;  2XGM A;  3QDN A;  2KC7 A;  1N95 A;  3C98 A;  4N39 A;  4Y6C A;  5EID A;  3PVL A;  5CMW A;  4OVU A;  3D3M A;  4HBD A;  3PRZ A;  2WXO A;  4NUR A;  3B7R L;  3PH0 C;  4K03 A;  2AJA A;  4FP7 A;  3LVR E;  4WNE A;  1N4Q A;  3OTN A;  2FO7 A;  4JEU A;  4I2W A;  2PM6 A;  2WPV A;  3KEA A;  4GMR A;  3MZL B;  4D10 C;  3TXM A;  3E34 A;  4BEP A;  3O4Z A;  3HYM B;  4M7C A;  4L2Y A;  4GTO A;  4HLL A;  5EKQ D;  1TNU A;  3VTX A;  3ZFW A;  4H7X A;  4OAV B;  4I43 A;  3P2B A;  1JPL A;  4XKC A;  1UG3 A;  2GRM A;  1LTX A;  4G11 A;  4BTA A;  4F6R D;  5AIJ A;  4EBA A;  4GYW A;  3D9L A;  2J4B A;  3ASN E;  2FEZ A;  1K1B A;  2VGX A;  4BES A;  3T8M A;  4MS6 A;  4CZ2 D;  4Q96 A;  2P9P G;  3CV0 A;  4YVQ C;  5LFA A;  4ILI A;  2WXR A;  3G2W A;  3Q78 A;  4ANW A;  5ENR D;  2WXG A;  3E33 A;  4AIF A;  3KAE A;  4U63 A;  1H6O A;  5JJ7 A;  2VGE A;  3RRN B;  2C0L A;  2I2O A;  3ASF A;  4JXT A;  1OCR E;  1D9S A;  3RRM B;  4GB9 A;  1O1T A;  4AXH A;  2EIL E;  4KYO B;  4CRW A;  3Q9N C;  3TJP A;  4GZC A;  3E37 A;  2C2L A;  3FEY A; 
#chains in the Genus database with same CATH homology
 5D2M C;  2IY0 C;  1Z5S C;  2IO3 C;  1KPS B;  2GRO B;  3UIP C;  2IO2 C;  2GRN B;  3UIO C;  2GRR B;  2GRP B;  2GRQ B;  3UIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...