1Z5SC

Crystal structure of a complex between ubc9, sumo-1, rangap1 and nup358/ranbp2
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
ADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into E3 ligase activity revealed by a SUMO-RanGAP1-Ubc9-Nup358 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2005-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 1z5sC00
3UIOC 2GRQB 1KPSB 2GRNB 2IO2C 3UIPC 2GRPB 2IY0C 3UINC 2GROB 2IO3C 5D2MC 2GRRB 1Z5SC
chains in the Genus database with same CATH superfamily
2C0MA 3C3RA 3CVXA 1E96B 2VGXB 1EYHA 1QYMA 3CK7A 3SY2A 4Q96A 2QY7A 1N0RA 3CHQA 3PZ3A 5CRVA 1XGWA 3UINC 3ZU7B 4KYOB 1TN7A 4DI3A 3SFXA 3MV2B 4GTPA 2ZGDA 4FHJA 4ILHB 2B6CA 3BUAA 2KM4A 3CQCB 4AY5A 1SZ9A 2DYRE 5JHAA 1FVHA 5LCWC 2CFZA 4K5AB 1TNUA 3HXEA 3UTMA 2NYJA 1WDYA 4FLBA 1SA5A 2KCVA 4RSYA 5AYWD 1N0QA 2XGOA 3MJWA 3MKQB 2LAHA 2BKGA 2GRPB 3CHMA 4QQIA 3Q73A 3SBTB 3KEAA 3IEGA 4BX9A 4I1MA 2R5SA 1N4QA 4CT4A 4ACKA 3TXMA 3CK8A 4GTRA 1U3DA 5CECB 2OVBA 2WMOA 3ENEA 4EZKA 2OOEA 2J08A 4GZDA 1WAO1 2BTDA 3EUVA 4DK5A 3I4RB 4I9EA 4JHRA 3ZXPA 4G24A 1OCOE 3GZ1A 3NZUA 4RG9A 1O1SA 2DWZA 2Y4UA 3UXGA 4D10C 2C0LA 2DCPA 4EZLA 2F0YA 2FULA 3G2UA 2LSUA 5FWQA 4Z68A 3EU5A 3F6QA 4LEUA 4K5CA 3HYMB 5CMWA 2EIME 3Q7AA 4P29A 2XEHA 3IKOB 1SVXA 5CMYA 3L08A 2IJGX 4LNBA 3C72A 3EIQC 3FU3A 2X6FA 4RG6A 5CERB 2IO2C 5AN8A 2X3MA 2PQNA 1KPSB 3KSLA 1PAQA 4F1SA 2ZIRA 4CEMA 3QJZA 4NIKA 2UY1B 2XPYA 4JL0A 4TRQA 2VGYA 4JC8A 2WXIA 5G55A 4HI9A 5BT1A 4GA1A 3G2SA 2J09A 1V54E 2XPIA 3Q75A 1OWOA 1OWPA 2NXPA 1NA0A 2X38A 3SFZA 4BEPA 3ESLA 4I2WA 4YDYA 3RO2A 4C48B 2X6HA 5J08A 2H6IA 4GU5A 3CHPA 3ZW3A 4BESA 1MX4A 3HRAA 1UOHA 3AJIA 3QDNA 1WM5A 1PY1A 4ANXA 4YDEA 4EBAA 4C0EA 3D9LA 4EHMA 2VYIA 3E37A 4HI8A 3LEWA 3ZEFA 3TWRA 4URKA 4FJZA 4YDOA 4NACA 3NBNB 3KAEA 4XI0A 2FF4A 3E34A 4J8FA 1QBQA 2ZU6B 4UQZA 1H0AA 1MQSA 4KMOA 4L2LA 1HF8A 3QC1A 5CBNA 1E8XA 5BNWA 1SW6A 3G2WA 5CBOA 4BX8A 4K5BA 2EINE 5FQ4A 1SQMA 3QKYA 4HB5A 4BT9A 3PUJA 2J07A 5AJLA 4UI9J 4Y6WA 3HVEB 4N39A 1OCRE 4F3VA 3SZ7A 2Y69E 4PS8A 4OYSA 3VLEA 3NF1A 5HI7A 1QZ2A 3W9FA 4CT0A 5KBAA 4O60A 3PS6A 1RZ4A 2R2LA 3V2OA 2R02A 4I1OB 3DSWA 3UT4A 3AS5A 3RRMB 5BUZA 3B7TA 1QQEA 3E4BA 1EPUA 4I17A 4B94A 1GW6A 3HXFA 4L1BA 3MX3A 3D3MA 1FT2A 3B7UX 1N4PA 2UWJG 4IYPA 3C3QA 2ETCA 2MRIA 4PS7A 1TN6A 3S7JA 4JZYA 3TG5A 3L54A 3AG2E 4GMLA 2AXVA 2F8XK 3D9NA 5LCWJ 3QWPA 4FADA 2Y1LE 4HOTA 2HM8A 1UN8A 4F1PA 2WXGA 1E7VA 2WM9A 4UUCA 3ZNGA 5FZRA 4GPMA 2WQ6A 3LJ3A 2VSOE 1MZCA 3SO8A 4RQIA 3KD7A 1DC2A 3O4ZA 2J4DA 1O1RA 4W9RA 3HXDA 1DCQA 3FTUA 4MS6A 2CG2A 4F53A 3I3NA 1N95A 4R7LA 1S0PA 3FFLA 2V0PA 2H6HA 1Z6TA 4O1OA 3LCAA 1E90A 1DCEA 5JMND 4K03A 1H6KA 3VTXA 2V8SE 4F6RD 1H2UA 1TNYA 5FTPA 3UI2A 4LG6A 4XE0A 2P9UG 3CLJA 5FINA 1HX8A 2YHCA 5ENRD 4N5CA 3BG1B 2RG8A 3AS8A 1D9SA 4Y6CA 2OVFA 4DX7D 4XKCA 3DPDA 3FEXA 2KZTA 5LOZA 4J6IA 4J8YA 4I9CA 2UY1A 4FULA 3LS8A 2QYJA 5AAOA 3FU5A 2ZGGA 4MLPA 2WXLA 4F7AA 3C5RA 3FH5A 3ASDA 3HDXA 3FULA 3HXCA 4BSXA 4O1PA 3MEKA 3PNLB 1OWMA 2XEVA 4G2VA 1N9AA 2A5UA 3QNKA 4KBQA 2ONDA 3RIBA 4JD2G 5T8IA 4HVBA 3UKUG 5H7PA 1ELKA 3TGOA 4FP7A 3UPVA 2FO7A 3CIAA 4UWFA 1TJFA 4DX2A 5KJNA 2XQ0A 4KZ0A 5EKQD 2XS1A 3URZA 3G2VA 1B89A 3B7RL 3NZSA 1EDUA 5HS0A 2I2OA 4ILIA 4CRWA 2LXLA 3UT7A 1EF1C 3PH0C 2IQCA 3MV3B 3MKQA 3OXFA 3FUJA 2GRNB 4JEUA 2CHWA 2JEKA 1G3NB 2L6JA 4J7WA 4ACLA 3CVWA 4BTAA 3SFYA 4ANVA 3DWLG 5BPPA 5ENQD 3DSTA 1IXVA 3JXJA 4L9PA 4DLOA 2EQXA 4XIFA 4WNDA 4BT8A 5A7DB 5KJKA 5KJLA 3RKVA 3LKUA 1LD8A 4IN3B 4TV3A 1YMPA 1MX2A 2BKKB 2WXKA 4AY6A 3BQOA 3RRUA 4WUYA 1AWCB 1HZ4A 4J8SA 2IF4A 3IXEA 4CGVA 4NURA 3DEOA 5KNHD 1WY6A 3JYSA 3MGBA 1E8WA 4Q69A 2A5EA 1YCSB 3TWVA 1IHGA 5A23A 4MKTA 5G2NA 4XX5A 5ANLA 4A3VA 1TJCA 1JWFA 1N94A 3TWUA 5C2YA 1A17A 3DSVA 5D66A 3DSSA 2L6BA 4WAFA 5ENOD 2RKKA 1SZAA 4APOA 4A3TA 4ANUA 1KZPA 4HLEA 3U64A 2V5FA 1DNPA 4X8QA 5E75A 4U04A 1TNOA 3TAXA 3CK9A 3QARA 2XZTG 3HHMA 2EIKE 1NP7A 4OVVA 1NA3A 1S63A 4JEHA 3AU4A 2P9LG 5JHBA 4G25A 3IBEA 3TWSA 4FA6A 4YNDA 2L0TB 5AQ9A 2HR2A 3TWWA 5KCMA 3LY7A 1ZB1A 3LVQE 5DIZA 2HYZA 3ZUVB 2WB2A 4GYWA 5T4YA 4U7EB 4K0RA 2QFCA 3R9MA 1U2VG 3T5VA 5JJTA 3TL5A 4U0UA 4E6HA 4GB9A 5G04J 2YQ8A 1N54A 5KNGA 5BXUA 3OAWA 2P58C 4V3IA 5JJ6A 4CGWA 1KLXA 3L9TA 1N4SA 1ZBPA 3FU0A 1IQRA 3FY4A 1TYQG 1LTXA 3D9HA 4EPZA 2WMNA 3FTZA 4U07A 2AWIA 3B7BA 4LCTA 3ASFA 1D8DA 1BPOA 1OWNA 1ELRA 2X6KA 4U8YD 2XRYA 2XRZA 2KZTB 4TXPA 2LSVA 5G04C 4N3CA 2WXRA 4N3BA 3UX4A 2P9PG 3U3WA 4GTTA 4FJYA 3CHOA 4HORA 3NB2A 4RLYA 4BTBA 3ONKA 5CHEE 2P9KG 3CVNA 4AEZC 2VGXA 3T5XA 5G05J 3V31A 3ULQA 3NOCD 1UN9A 2GGFA 3JXIA 2VTBA 1OXJA 4C0MA 2XPZA 1MHQA 2XZDG 3B95A 4KXKB 1E7UA 2XGMA 4GTQA 1A5EA 2P9SG 4YVQC 2NC9A 1K8KG 3J5QB 3Q9UC 5EIBE 1OT8A 3B7SA 2E0IA 3BEEA 3Q47B 3EU9A 3MCXA 2LO6A 3Q78A 3ZYKA 3UM1A 3T9KA 2R59A 3CVQA 2IY0C 4A63B 2XCCA 4PUCA 3TWTA 4HRMB 4DX5D 4J8DA 4TXQA 4EZJA 2L9BA 5LFAA 3R7QA 2WXHA 4G8LA 4JB8P 3D9PA 2EIJE 2IFUA 3Q4AB 2QC9A 4I6GA 2YNQA 3FP3A 4UQYA 1JWGA 2KCKA 2YHEA 4H7YA 4ILGA 3FTVA 4DUIA 4A1GA 2XCBA 2JABA 4PH4B 1RW2A 3ZIMA 4N2QA 1N4RA 3PZ4A 1KZOA 3N71A 4GZ6A 4AM9A 3PE3A 5D0QD 1S70B 2DVWA 3ZYQA 2IONA 1FT1A 3AS4A 4GTVA 2DZOA 1NI1A 3JQ1A 3L13A 2IEJA 2GRQB 1HH8A 4HS2A 3OXGA 2L0IA 3PZ2A 4I6JA 4AP2A 5C1DA 3L22A 2XGSA 2P9IG 3OTNA 4H7XA 3UKRG 4Q94A 1OCZE 4I43A 5FQ7A 3TWQA 2WXOA 4GCOA 4GAAA 3ABME 3FUHA 1H19A 5D0OD 4U8VD 1FPPA 4GZ5A 3RSEG 4JA7A 3I4GA 5ENTD 5J90A 5EILA 4AVXA 2MOWA 3DSUA 3EHNA 3PREA 3SF4A 4FLHA 4N2SA 3VTYA 3WXXA 4UI9C 3AG3E 3ULYA 5ITZF 5EYLA 3FUIA 3SD5A 1OWLA 2FBNA 1Y6IA 3L6AA 2CFUA 4CYMD 5CRUA 3VLFA 4BWRA 1BU9A 3LXUX 2P9NG 4UQXA 4AV7A 3FDHA 2DZNA 3EHMA 4N5QA 4OAVB 3FUNA 2MYOA 4ME2A 2IOLA 4BY6A 3CVUA 4TXRA 3X2QE 3CVLA 4ATGA 3SQVA 3QWVA 3O48A 2PNNA 5BW8C 3EDTB 2WVIA 2Y4TA 2VSYA 2VQ2A 3D9JA 3ZHEB 5ANRA 3FUMA 3HIZA 1TR4A 3FUDA 2YINA 1BI8B 4EBAG 2WXNA 4CDNA 3W9GA 3E33A 4UWKA 4U0SA 3ZGQA 1H2VC 3IHYA 1ELWA 2KC7A 1UJKA 2MHKA 1K1AA 3CGHA 4HOQA 1HU3A 5B1BE 5HRYA 5A6CA 4CDRA 4I2ZA 2J9QA 3CR3A 1WG0A 3S7FA 4GTOA 3UIOC 3FTSA 2WQHA 4WWOA 4BETA 2EILE 4MBGA 3NQPA 2X6IA 2R03A 4ZFHA 2J4BA 1UJJA 3QOUA 2ETAA 4A1SA 2A4ZA 3DEPA 3CVYA 4G26A 4LNGA 4LUNU 5BXOA 3CVVA 4UWHA 4B0ZA 4RVBA 2CHZA 3GW4A 2OCCE 2RFAA 2F8YA 3APFA 5EN5D 3BG0B 3J5PA 2FEZA 1KT1A 3MA5A 4HXIA 3APDA 3CSFA 4LERA 3MZLB 3C3OA 4PS3A 3ZRHA 2PM7A 3ML8A 5IY5E 5KWDA 4GYYA 2I1JA 4XKBA 1UW4B 4HBDA 3S2AA 5M72A 3Q7FA 2ZISA 4GZ3A 3ZHEA 4GTSA 1JUQA 3WG7E 3TG4A 3B13A 4U0ZA 3UT8A 3FUKA 4QFVA 4JW1A 1JCRA 3ISMC 3ML9A 2VJ8A 3FHEA 2F37A 4TUUA 2VSXE 3FTWA 2JLBA 2V5QC 4GA2A 4APFA 2Q7FA 4U95D 2GROB 5G05C 1YA0A 3AG1E 3S7DA 3BU8A 3TWXA 5CCMA 4GMJA 4C9BB 3JQ0A 3GZ2A 4HRLA 1O1TA 2V4HC 5CEDB 2P2CP 3AAAC 3VLDA 4LRZA 3L17A 1E8YA 3SBSA 2H6GA 4GTMA 1IQUA 3AG4E 4DX1A 3QAQA 2OV8A 1HS6A 3C98A 3D9IA 3FUFA 4NQ0A 4JHJA 3KEZA 4N3AA 4XEIG 5B3SE 1QNFA 3JUIA 1Z3XA 3JCKC 5HKPA 1DVPA 2CHXA 4XI9A 3RU0A 3UMVA 3U9WA 2I6HA 4JVSA 4AIFA 3PEVB 1OCCE 1HFAA 5AQAA 4B89A 1JCSA 2XENA 3D9OA 1L5JA 1V55E 2WXFA 2AVPA 4DLQA 5EX0A 2OEWA 3LY9A 4IRUA 1E8ZA 3UM3A 3V30A 2PZIA 2J49A 2LXMA 3FU6A 3LYAA 1D8EA 1TEZA 3Q5MA 4JA9A 1JPLA 3JUEA 2BF0X 5CEAA 1TN8A 1UG3A 3HXBA 2ILRA 3V2XA 3PZDA 5T3RA 1IHBA 4DPRA 3IHVA 4KZCA 1ZU2A 2WXJA 1BD8A 5ENPD 5BV1A 5EDSA 2WQ7A 4JPSA 2XS8A 4LSZE 1K3ZD 3PVLA 4G23A 4NRHB 3T8KA 1MJ0A 4G11A 3R9AB 2BUGA 1PC2A 1FVFA 2KATA 5FJYA 5EYPF 3CHRA 3DBSA 4U8HA 2XHEA 2ZXWE 4HOSA 4BSZB 1O5MA 1OUVA 2LUHA 3U66A 3DXKG 3QB2A 3OXLA 3P2BA 5FZSA 2GRRB 5CCLA 4XZ4A 4DX6D 3PZ1A 3I5PA 4G8KA 4HOUA 3PE4A 2NSZA 4UWGA 3E30A 1LF8A 5DBKA 1NL4A 2WXPA 1NZNA 1TNBA 2IOSA 2RD0A 4DJAA 1KT0A 4FHKA 1HE8A 4WWPA 1IYGA 3RAUA 3ZPJA 3PDNA 2GRMA 3UM2A 4I1AA 2AW6A 3CKBA 2WPVA 4E85A 4WNGA 3P1UA 5FT9A 2PL2A 3HVEA 3LPZA 2DYSE 1U3CA 2GW1A 1BLXB 1H2TC 3UQ3A 4U63A 5ARFA 2VSNA 3U4TA 4GMRA 3LDZA 3APCA 3ZYLA 3UIPC 3L82A 3ABKE 1H6PA 2AXZA 1Y8MA 1INZA 2M63A 3ESKA 3NOGD 2I9CA 3FH8A 1W3BA 5FZQA 4M3OA 1P5QA 2IU1A 3Q9NC 2KBXA 5EX3A 2PQRA 3ASNE 5JA4D 4WWNA 2H6FA 4L2YA 3ULEG 3QK0A 3ZFWA 1FCHA 3FEYA 5HQ8A 3HG0D 5AARA 5EIDA 3CHSA 3SI5A 2BEDA 2WXQA 3LVRE 3DSXA 1XNFA 4WNEA 1AP7A 4WNFA 4CCAA 2PM6A 4J0UA 4BFRA 2B0OE 5B1AE 4B93B 5AJDA 3FTXA 1SA4A 5ARGA 3IV0A 2KXPC 5ENSD 4GA0A 3LJNA 4B8AA 4G1TA 4ATZD 5AENA 4EECA 3ASOE 2RFMA 2HO1A 1H6OA 3CKCA 3DXMG 1HXIA 4KVOA 2ETBA 4LNUD 4GPKA 3ASHA 3GZSA 4J8EA 4BERA 3ZN3A 2QYUA 3D9KA 4JXTA 1LD7A 5AQ7A 4KT6B 2J8SD 1HO8A 2Y3AA 2AJAA 3UM0A 3ONLA 3EHQA 2HE0A 3DRAA 1OY3D 4DRXE 2C2LA 4UI9K 2OEVA 1VDYA 4HLLA 5KJMA 1MYOA 3FTYA 4GCNA 4A55A 1K1BA 2DBAA 5AIJA 4MRUA 3NAWA 3ABLE 1N11A 3ZVVA 4HRNA 4L23A 1TNZA 2CG3A 4GZCA 3FUEA 1Z5SC 3AU5A 3MKRA 2VTBB 4FC8A 2V4LA 3PRZA 3FH7A 5FQ6A 5AQBA 3ZYMA 4TUMA 3SHFA 2XEEA 3V79K 4ABNA 3PNTB 1NFIE 3R7RA 1Z3YA 5FQ8A 4EQFA 4HNAD 3KS2A 3CV0A 3D9MA 5LX8A 3KSQA 3QWWA 5ENNA 1X5BA 4AOFA 3K9IA 3L16A 3TJPA 3Q49B 3Q15A 3SNXA 3EHRA 4AJWA 4IULA 5E76A 4I6EA 4AXHA 1S64A 2LAIA 4YVOA 3CSTA 5JJ7A 2LNIA 3ZKJA 4M7CA 2FO1E 3SGHA 1HG2A 1BI7B 5D2MC 2Y0BG 4U96D 4CZ2D 2GRLA 4GYOA 1X81A 4B8CB 3FWVA 1N52A 4JHKA 1JCQA 3UUXA 1Q2ZA 2WXMA 3EJNA 4DI4A 3T8MA 4ZHBA 4O6FA 1YYHA 4HQDA 3ASGA 4YDWA 3CVPA 3DPYA 2R05A 3G2TA 3ZXSA 1MX6A 5BV0A 3S7BA 5LP0A 1HG5A 2X6JA 4OAUC 2IO3C 4OVUA 3E32A 3PEUB 3RO3A 4PDXA 3RK6A 2I1KA 5FIOA 3MYVA 3CEQA 3TXNA 3EIJA 3Q79A 2AXUA 3GYZA 4CDMA 3LY8A 2FI7A 2KCLA 3RRNB 4L7TA 4FU3A 3CQGB 1IKND 3RJVA 2E2EA 4ANWA 4UWLA 4KVMA 2VGEA 3PUKA 2DIWA 4HFGA 2QZAA 2R17C
chains in the Genus database with same CATH topology
3UIOC 2GRQB 1KPSB 2GRNB 2IO2C 3UIPC 2GRPB 2IY0C 3UINC 2GROB 2IO3C 5D2MC 2GRRB 1Z5SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIO C;  2GRQ B;  1KPS B;  2GRN B;  2IO2 C;  3UIP C;  2GRP B;  2IY0 C;  3UIN C;  2GRO B;  2IO3 C;  5D2M C;  2GRR B;  1Z5S C; 
#chains in the Genus database with same CATH topology
 2C0M A;  3C3R A;  3CVX A;  1E96 B;  2VGX B;  1EYH A;  1QYM A;  3CK7 A;  3SY2 A;  4Q96 A;  2QY7 A;  1N0R A;  3CHQ A;  3PZ3 A;  5CRV A;  1XGW A;  3UIN C;  3ZU7 B;  4KYO B;  1TN7 A;  4DI3 A;  3SFX A;  3MV2 B;  4GTP A;  2ZGD A;  4FHJ A;  4ILH B;  2B6C A;  3BUA A;  2KM4 A;  3CQC B;  4AY5 A;  1SZ9 A;  2DYR E;  5JHA A;  1FVH A;  5LCW C;  2CFZ A;  4K5A B;  1TNU A;  3HXE A;  3UTM A;  2NYJ A;  1WDY A;  4FLB A;  1SA5 A;  2KCV A;  4RSY A;  5AYW D;  1N0Q A;  2XGO A;  3MJW A;  3MKQ B;  2LAH A;  2BKG A;  2GRP B;  3CHM A;  4QQI A;  3Q73 A;  3SBT B;  3KEA A;  3IEG A;  4BX9 A;  4I1M A;  2R5S A;  1N4Q A;  4CT4 A;  4ACK A;  3TXM A;  3CK8 A;  4GTR A;  1U3D A;  5CEC B;  2OVB A;  2WMO A;  3ENE A;  4EZK A;  2OOE A;  2J08 A;  4GZD A;  1WAO 1;  2BTD A;  3EUV A;  4DK5 A;  3I4R B;  4I9E A;  4JHR A;  3ZXP A;  4G24 A;  1OCO E;  3GZ1 A;  3NZU A;  4RG9 A;  1O1S A;  2DWZ A;  2Y4U A;  3UXG A;  4D10 C;  2C0L A;  2DCP A;  4EZL A;  2F0Y A;  2FUL A;  3G2U A;  2LSU A;  5FWQ A;  4Z68 A;  3EU5 A;  3F6Q A;  4LEU A;  4K5C A;  3HYM B;  5CMW A;  2EIM E;  3Q7A A;  4P29 A;  2XEH A;  3IKO B;  1SVX A;  5CMY A;  3L08 A;  2IJG X;  4LNB A;  3C72 A;  3EIQ C;  3FU3 A;  2X6F A;  4RG6 A;  5CER B;  2IO2 C;  5AN8 A;  2X3M A;  2PQN A;  1KPS B;  3KSL A;  1PAQ A;  4F1S A;  2ZIR A;  4CEM A;  3QJZ A;  4NIK A;  2UY1 B;  2XPY A;  4JL0 A;  4TRQ A;  2VGY A;  4JC8 A;  2WXI A;  5G55 A;  4HI9 A;  5BT1 A;  4GA1 A;  3G2S A;  2J09 A;  1V54 E;  2XPI A;  3Q75 A;  1OWO A;  1OWP A;  2NXP A;  1NA0 A;  2X38 A;  3SFZ A;  4BEP A;  3ESL A;  4I2W A;  4YDY A;  3RO2 A;  4C48 B;  2X6H A;  5J08 A;  2H6I A;  4GU5 A;  3CHP A;  3ZW3 A;  4BES A;  1MX4 A;  3HRA A;  1UOH A;  3AJI A;  3QDN A;  1WM5 A;  1PY1 A;  4ANX A;  4YDE A;  4EBA A;  4C0E A;  3D9L A;  4EHM A;  2VYI A;  3E37 A;  4HI8 A;  3LEW A;  3ZEF A;  3TWR A;  4URK A;  4FJZ A;  4YDO A;  4NAC A;  3NBN B;  3KAE A;  4XI0 A;  2FF4 A;  3E34 A;  4J8F A;  1QBQ A;  2ZU6 B;  4UQZ A;  1H0A A;  1MQS A;  4KMO A;  4L2L A;  1HF8 A;  3QC1 A;  5CBN A;  1E8X A;  5BNW A;  1SW6 A;  3G2W A;  5CBO A;  4BX8 A;  4K5B A;  2EIN E;  5FQ4 A;  1SQM A;  3QKY A;  4HB5 A;  4BT9 A;  3PUJ A;  2J07 A;  5AJL A;  4UI9 J;  4Y6W A;  3HVE B;  4N39 A;  1OCR E;  4F3V A;  3SZ7 A;  2Y69 E;  4PS8 A;  4OYS A;  3VLE A;  3NF1 A;  5HI7 A;  1QZ2 A;  3W9F A;  4CT0 A;  5KBA A;  4O60 A;  3PS6 A;  1RZ4 A;  2R2L A;  3V2O A;  2R02 A;  4I1O B;  3DSW A;  3UT4 A;  3AS5 A;  3RRM B;  5BUZ A;  3B7T A;  1QQE A;  3E4B A;  1EPU A;  4I17 A;  4B94 A;  1GW6 A;  3HXF A;  4L1B A;  3MX3 A;  3D3M A;  1FT2 A;  3B7U X;  1N4P A;  2UWJ G;  4IYP A;  3C3Q A;  2ETC A;  2MRI A;  4PS7 A;  1TN6 A;  3S7J A;  4JZY A;  3TG5 A;  3L54 A;  3AG2 E;  4GML A;  2AXV A;  2F8X K;  3D9N A;  5LCW J;  3QWP A;  4FAD A;  2Y1L E;  4HOT A;  2HM8 A;  1UN8 A;  4F1P A;  2WXG A;  1E7V A;  2WM9 A;  4UUC A;  3ZNG A;  5FZR A;  4GPM A;  2WQ6 A;  3LJ3 A;  2VSO E;  1MZC A;  3SO8 A;  4RQI A;  3KD7 A;  1DC2 A;  3O4Z A;  2J4D A;  1O1R A;  4W9R A;  3HXD A;  1DCQ A;  3FTU A;  4MS6 A;  2CG2 A;  4F53 A;  3I3N A;  1N95 A;  4R7L A;  1S0P A;  3FFL A;  2V0P A;  2H6H A;  1Z6T A;  4O1O A;  3LCA A;  1E90 A;  1DCE A;  5JMN D;  4K03 A;  1H6K A;  3VTX A;  2V8S E;  4F6R D;  1H2U A;  1TNY A;  5FTP A;  3UI2 A;  4LG6 A;  4XE0 A;  2P9U G;  3CLJ A;  5FIN A;  1HX8 A;  2YHC A;  5ENR D;  4N5C A;  3BG1 B;  2RG8 A;  3AS8 A;  1D9S A;  4Y6C A;  2OVF A;  4DX7 D;  4XKC A;  3DPD A;  3FEX A;  2KZT A;  5LOZ A;  4J6I A;  4J8Y A;  4I9C A;  2UY1 A;  4FUL A;  3LS8 A;  2QYJ A;  5AAO A;  3FU5 A;  2ZGG A;  4MLP A;  2WXL A;  4F7A A;  3C5R A;  3FH5 A;  3ASD A;  3HDX A;  3FUL A;  3HXC A;  4BSX A;  4O1P A;  3MEK A;  3PNL B;  1OWM A;  2XEV A;  4G2V A;  1N9A A;  2A5U A;  3QNK A;  4KBQ A;  2OND A;  3RIB A;  4JD2 G;  5T8I A;  4HVB A;  3UKU G;  5H7P A;  1ELK A;  3TGO A;  4FP7 A;  3UPV A;  2FO7 A;  3CIA A;  4UWF A;  1TJF A;  4DX2 A;  5KJN A;  2XQ0 A;  4KZ0 A;  5EKQ D;  2XS1 A;  3URZ A;  3G2V A;  1B89 A;  3B7R L;  3NZS A;  1EDU A;  5HS0 A;  2I2O A;  4ILI A;  4CRW A;  2LXL A;  3UT7 A;  1EF1 C;  3PH0 C;  2IQC A;  3MV3 B;  3MKQ A;  3OXF A;  3FUJ A;  2GRN B;  4JEU A;  2CHW A;  2JEK A;  1G3N B;  2L6J A;  4J7W A;  4ACL A;  3CVW A;  4BTA A;  3SFY A;  4ANV A;  3DWL G;  5BPP A;  5ENQ D;  3DST A;  1IXV A;  3JXJ A;  4L9P A;  4DLO A;  2EQX A;  4XIF A;  4WND A;  4BT8 A;  5A7D B;  5KJK A;  5KJL A;  3RKV A;  3LKU A;  1LD8 A;  4IN3 B;  4TV3 A;  1YMP A;  1MX2 A;  2BKK B;  2WXK A;  4AY6 A;  3BQO A;  3RRU A;  4WUY A;  1AWC B;  1HZ4 A;  4J8S A;  2IF4 A;  3IXE A;  4CGV A;  4NUR A;  3DEO A;  5KNH D;  1WY6 A;  3JYS A;  3MGB A;  1E8W A;  4Q69 A;  2A5E A;  1YCS B;  3TWV A;  1IHG A;  5A23 A;  4MKT A;  5G2N A;  4XX5 A;  5ANL A;  4A3V A;  1TJC A;  1JWF A;  1N94 A;  3TWU A;  5C2Y A;  1A17 A;  3DSV A;  5D66 A;  3DSS A;  2L6B A;  4WAF A;  5ENO D;  2RKK A;  1SZA A;  4APO A;  4A3T A;  4ANU A;  1KZP A;  4HLE A;  3U64 A;  2V5F A;  1DNP A;  4X8Q A;  5E75 A;  4U04 A;  1TNO A;  3TAX A;  3CK9 A;  3QAR A;  2XZT G;  3HHM A;  2EIK E;  1NP7 A;  4OVV A;  1NA3 A;  1S63 A;  4JEH A;  3AU4 A;  2P9L G;  5JHB A;  4G25 A;  3IBE A;  3TWS A;  4FA6 A;  4YND A;  2L0T B;  5AQ9 A;  2HR2 A;  3TWW A;  5KCM A;  3LY7 A;  1ZB1 A;  3LVQ E;  5DIZ A;  2HYZ A;  3ZUV B;  2WB2 A;  4GYW A;  5T4Y A;  4U7E B;  4K0R A;  2QFC A;  3R9M A;  1U2V G;  3T5V A;  5JJT A;  3TL5 A;  4U0U A;  4E6H A;  4GB9 A;  5G04 J;  2YQ8 A;  1N54 A;  5KNG A;  5BXU A;  3OAW A;  2P58 C;  4V3I A;  5JJ6 A;  4CGW A;  1KLX A;  3L9T A;  1N4S A;  1ZBP A;  3FU0 A;  1IQR A;  3FY4 A;  1TYQ G;  1LTX A;  3D9H A;  4EPZ A;  2WMN A;  3FTZ A;  4U07 A;  2AWI A;  3B7B A;  4LCT A;  3ASF A;  1D8D A;  1BPO A;  1OWN A;  1ELR A;  2X6K A;  4U8Y D;  2XRY A;  2XRZ A;  2KZT B;  4TXP A;  2LSV A;  5G04 C;  4N3C A;  2WXR A;  4N3B A;  3UX4 A;  2P9P G;  3U3W A;  4GTT A;  4FJY A;  3CHO A;  4HOR A;  3NB2 A;  4RLY A;  4BTB A;  3ONK A;  5CHE E;  2P9K G;  3CVN A;  4AEZ C;  2VGX A;  3T5X A;  5G05 J;  3V31 A;  3ULQ A;  3NOC D;  1UN9 A;  2GGF A;  3JXI A;  2VTB A;  1OXJ A;  4C0M A;  2XPZ A;  1MHQ A;  2XZD G;  3B95 A;  4KXK B;  1E7U A;  2XGM A;  4GTQ A;  1A5E A;  2P9S G;  4YVQ C;  2NC9 A;  1K8K G;  3J5Q B;  3Q9U C;  5EIB E;  1OT8 A;  3B7S A;  2E0I A;  3BEE A;  3Q47 B;  3EU9 A;  3MCX A;  2LO6 A;  3Q78 A;  3ZYK A;  3UM1 A;  3T9K A;  2R59 A;  3CVQ A;  2IY0 C;  4A63 B;  2XCC A;  4PUC A;  3TWT A;  4HRM B;  4DX5 D;  4J8D A;  4TXQ A;  4EZJ A;  2L9B A;  5LFA A;  3R7Q A;  2WXH A;  4G8L A;  4JB8 P;  3D9P A;  2EIJ E;  2IFU A;  3Q4A B;  2QC9 A;  4I6G A;  2YNQ A;  3FP3 A;  4UQY A;  1JWG A;  2KCK A;  2YHE A;  4H7Y A;  4ILG A;  3FTV A;  4DUI A;  4A1G A;  2XCB A;  2JAB A;  4PH4 B;  1RW2 A;  3ZIM A;  4N2Q A;  1N4R A;  3PZ4 A;  1KZO A;  3N71 A;  4GZ6 A;  4AM9 A;  3PE3 A;  5D0Q D;  1S70 B;  2DVW A;  3ZYQ A;  2ION A;  1FT1 A;  3AS4 A;  4GTV A;  2DZO A;  1NI1 A;  3JQ1 A;  3L13 A;  2IEJ A;  2GRQ B;  1HH8 A;  4HS2 A;  3OXG A;  2L0I A;  3PZ2 A;  4I6J A;  4AP2 A;  5C1D A;  3L22 A;  2XGS A;  2P9I G;  3OTN A;  4H7X A;  3UKR G;  4Q94 A;  1OCZ E;  4I43 A;  5FQ7 A;  3TWQ A;  2WXO A;  4GCO A;  4GAA A;  3ABM E;  3FUH A;  1H19 A;  5D0O D;  4U8V D;  1FPP A;  4GZ5 A;  3RSE G;  4JA7 A;  3I4G A;  5ENT D;  5J90 A;  5EIL A;  4AVX A;  2MOW A;  3DSU A;  3EHN A;  3PRE A;  3SF4 A;  4FLH A;  4N2S A;  3VTY A;  3WXX A;  4UI9 C;  3AG3 E;  3ULY A;  5ITZ F;  5EYL A;  3FUI A;  3SD5 A;  1OWL A;  2FBN A;  1Y6I A;  3L6A A;  2CFU A;  4CYM D;  5CRU A;  3VLF A;  4BWR A;  1BU9 A;  3LXU X;  2P9N G;  4UQX A;  4AV7 A;  3FDH A;  2DZN A;  3EHM A;  4N5Q A;  4OAV B;  3FUN A;  2MYO A;  4ME2 A;  2IOL A;  4BY6 A;  3CVU A;  4TXR A;  3X2Q E;  3CVL A;  4ATG A;  3SQV A;  3QWV A;  3O48 A;  2PNN A;  5BW8 C;  3EDT B;  2WVI A;  2Y4T A;  2VSY A;  2VQ2 A;  3D9J A;  3ZHE B;  5ANR A;  3FUM A;  3HIZ A;  1TR4 A;  3FUD A;  2YIN A;  1BI8 B;  4EBA G;  2WXN A;  4CDN A;  3W9G A;  3E33 A;  4UWK A;  4U0S A;  3ZGQ A;  1H2V C;  3IHY A;  1ELW A;  2KC7 A;  1UJK A;  2MHK A;  1K1A A;  3CGH A;  4HOQ A;  1HU3 A;  5B1B E;  5HRY A;  5A6C A;  4CDR A;  4I2Z A;  2J9Q A;  3CR3 A;  1WG0 A;  3S7F A;  4GTO A;  3UIO C;  3FTS A;  2WQH A;  4WWO A;  4BET A;  2EIL E;  4MBG A;  3NQP A;  2X6I A;  2R03 A;  4ZFH A;  2J4B A;  1UJJ A;  3QOU A;  2ETA A;  4A1S A;  2A4Z A;  3DEP A;  3CVY A;  4G26 A;  4LNG A;  4LUN U;  5BXO A;  3CVV A;  4UWH A;  4B0Z A;  4RVB A;  2CHZ A;  3GW4 A;  2OCC E;  2RFA A;  2F8Y A;  3APF A;  5EN5 D;  3BG0 B;  3J5P A;  2FEZ A;  1KT1 A;  3MA5 A;  4HXI A;  3APD A;  3CSF A;  4LER A;  3MZL B;  3C3O A;  4PS3 A;  3ZRH A;  2PM7 A;  3ML8 A;  5IY5 E;  5KWD A;  4GYY A;  2I1J A;  4XKB A;  1UW4 B;  4HBD A;  3S2A A;  5M72 A;  3Q7F A;  2ZIS A;  4GZ3 A;  3ZHE A;  4GTS A;  1JUQ A;  3WG7 E;  3TG4 A;  3B13 A;  4U0Z A;  3UT8 A;  3FUK A;  4QFV A;  4JW1 A;  1JCR A;  3ISM C;  3ML9 A;  2VJ8 A;  3FHE A;  2F37 A;  4TUU A;  2VSX E;  3FTW A;  2JLB A;  2V5Q C;  4GA2 A;  4APF A;  2Q7F A;  4U95 D;  2GRO B;  5G05 C;  1YA0 A;  3AG1 E;  3S7D A;  3BU8 A;  3TWX A;  5CCM A;  4GMJ A;  4C9B B;  3JQ0 A;  3GZ2 A;  4HRL A;  1O1T A;  2V4H C;  5CED B;  2P2C P;  3AAA C;  3VLD A;  4LRZ A;  3L17 A;  1E8Y A;  3SBS A;  2H6G A;  4GTM A;  1IQU A;  3AG4 E;  4DX1 A;  3QAQ A;  2OV8 A;  1HS6 A;  3C98 A;  3D9I A;  3FUF A;  4NQ0 A;  4JHJ A;  3KEZ A;  4N3A A;  4XEI G;  5B3S E;  1QNF A;  3JUI A;  1Z3X A;  3JCK C;  5HKP A;  1DVP A;  2CHX A;  4XI9 A;  3RU0 A;  3UMV A;  3U9W A;  2I6H A;  4JVS A;  4AIF A;  3PEV B;  1OCC E;  1HFA A;  5AQA A;  4B89 A;  1JCS A;  2XEN A;  3D9O A;  1L5J A;  1V55 E;  2WXF A;  2AVP A;  4DLQ A;  5EX0 A;  2OEW A;  3LY9 A;  4IRU A;  1E8Z A;  3UM3 A;  3V30 A;  2PZI A;  2J49 A;  2LXM A;  3FU6 A;  3LYA A;  1D8E A;  1TEZ A;  3Q5M A;  4JA9 A;  1JPL A;  3JUE A;  2BF0 X;  5CEA A;  1TN8 A;  1UG3 A;  3HXB A;  2ILR A;  3V2X A;  3PZD A;  5T3R A;  1IHB A;  4DPR A;  3IHV A;  4KZC A;  1ZU2 A;  2WXJ A;  1BD8 A;  5ENP D;  5BV1 A;  5EDS A;  2WQ7 A;  4JPS A;  2XS8 A;  4LSZ E;  1K3Z D;  3PVL A;  4G23 A;  4NRH B;  3T8K A;  1MJ0 A;  4G11 A;  3R9A B;  2BUG A;  1PC2 A;  1FVF A;  2KAT A;  5FJY A;  5EYP F;  3CHR A;  3DBS A;  4U8H A;  2XHE A;  2ZXW E;  4HOS A;  4BSZ B;  1O5M A;  1OUV A;  2LUH A;  3U66 A;  3DXK G;  3QB2 A;  3OXL A;  3P2B A;  5FZS A;  2GRR B;  5CCL A;  4XZ4 A;  4DX6 D;  3PZ1 A;  3I5P A;  4G8K A;  4HOU A;  3PE4 A;  2NSZ A;  4UWG A;  3E30 A;  1LF8 A;  5DBK A;  1NL4 A;  2WXP A;  1NZN A;  1TNB A;  2IOS A;  2RD0 A;  4DJA A;  1KT0 A;  4FHK A;  1HE8 A;  4WWP A;  1IYG A;  3RAU A;  3ZPJ A;  3PDN A;  2GRM A;  3UM2 A;  4I1A A;  2AW6 A;  3CKB A;  2WPV A;  4E85 A;  4WNG A;  3P1U A;  5FT9 A;  2PL2 A;  3HVE A;  3LPZ A;  2DYS E;  1U3C A;  2GW1 A;  1BLX B;  1H2T C;  3UQ3 A;  4U63 A;  5ARF A;  2VSN A;  3U4T A;  4GMR A;  3LDZ A;  3APC A;  3ZYL A;  3UIP C;  3L82 A;  3ABK E;  1H6P A;  2AXZ A;  1Y8M A;  1INZ A;  2M63 A;  3ESK A;  3NOG D;  2I9C A;  3FH8 A;  1W3B A;  5FZQ A;  4M3O A;  1P5Q A;  2IU1 A;  3Q9N C;  2KBX A;  5EX3 A;  2PQR A;  3ASN E;  5JA4 D;  4WWN A;  2H6F A;  4L2Y A;  3ULE G;  3QK0 A;  3ZFW A;  1FCH A;  3FEY A;  5HQ8 A;  3HG0 D;  5AAR A;  5EID A;  3CHS A;  3SI5 A;  2BED A;  2WXQ A;  3LVR E;  3DSX A;  1XNF A;  4WNE A;  1AP7 A;  4WNF A;  4CCA A;  2PM6 A;  4J0U A;  4BFR A;  2B0O E;  5B1A E;  4B93 B;  5AJD A;  3FTX A;  1SA4 A;  5ARG A;  3IV0 A;  2KXP C;  5ENS D;  4GA0 A;  3LJN A;  4B8A A;  4G1T A;  4ATZ D;  5AEN A;  4EEC A;  3ASO E;  2RFM A;  2HO1 A;  1H6O A;  3CKC A;  3DXM G;  1HXI A;  4KVO A;  2ETB A;  4LNU D;  4GPK A;  3ASH A;  3GZS A;  4J8E A;  4BER A;  3ZN3 A;  2QYU A;  3D9K A;  4JXT A;  1LD7 A;  5AQ7 A;  4KT6 B;  2J8S D;  1HO8 A;  2Y3A A;  2AJA A;  3UM0 A;  3ONL A;  3EHQ A;  2HE0 A;  3DRA A;  1OY3 D;  4DRX E;  2C2L A;  4UI9 K;  2OEV A;  1VDY A;  4HLL A;  5KJM A;  1MYO A;  3FTY A;  4GCN A;  4A55 A;  1K1B A;  2DBA A;  5AIJ A;  4MRU A;  3NAW A;  3ABL E;  1N11 A;  3ZVV A;  4HRN A;  4L23 A;  1TNZ A;  2CG3 A;  4GZC A;  3FUE A;  1Z5S C;  3AU5 A;  3MKR A;  2VTB B;  4FC8 A;  2V4L A;  3PRZ A;  3FH7 A;  5FQ6 A;  5AQB A;  3ZYM A;  4TUM A;  3SHF A;  2XEE A;  3V79 K;  4ABN A;  3PNT B;  1NFI E;  3R7R A;  1Z3Y A;  5FQ8 A;  4EQF A;  4HNA D;  3KS2 A;  3CV0 A;  3D9M A;  5LX8 A;  3KSQ A;  3QWW A;  5ENN A;  1X5B A;  4AOF A;  3K9I A;  3L16 A;  3TJP A;  3Q49 B;  3Q15 A;  3SNX A;  3EHR A;  4AJW A;  4IUL A;  5E76 A;  4I6E A;  4AXH A;  1S64 A;  2LAI A;  4YVO A;  3CST A;  5JJ7 A;  2LNI A;  3ZKJ A;  4M7C A;  2FO1 E;  3SGH A;  1HG2 A;  1BI7 B;  5D2M C;  2Y0B G;  4U96 D;  4CZ2 D;  2GRL A;  4GYO A;  1X81 A;  4B8C B;  3FWV A;  1N52 A;  4JHK A;  1JCQ A;  3UUX A;  1Q2Z A;  2WXM A;  3EJN A;  4DI4 A;  3T8M A;  4ZHB A;  4O6F A;  1YYH A;  4HQD A;  3ASG A;  4YDW A;  3CVP A;  3DPY A;  2R05 A;  3G2T A;  3ZXS A;  1MX6 A;  5BV0 A;  3S7B A;  5LP0 A;  1HG5 A;  2X6J A;  4OAU C;  2IO3 C;  4OVU A;  3E32 A;  3PEU B;  3RO3 A;  4PDX A;  3RK6 A;  2I1K A;  5FIO A;  3MYV A;  3CEQ A;  3TXN A;  3EIJ A;  3Q79 A;  2AXU A;  3GYZ A;  4CDM A;  3LY8 A;  2FI7 A;  2KCL A;  3RRN B;  4L7T A;  4FU3 A;  3CQG B;  1IKN D;  3RJV A;  2E2E A;  4ANW A;  4UWL A;  4KVM A;  2VGE A;  3PUK A;  2DIW A;  4HFG A;  2QZA A;  2R17 C; 
#chains in the Genus database with same CATH homology
 3UIO C;  2GRQ B;  1KPS B;  2GRN B;  2IO2 C;  3UIP C;  2GRP B;  2IY0 C;  3UIN C;  2GRO B;  2IO3 C;  5D2M C;  2GRR B;  1Z5S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...