1Z6CA

Solution structure of an egf pair (egf34) from vitamin k-dependent protein s
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
87
structure length
87
Chain Sequence
KDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution Structure of the Ca(2+)-Binding EGF3-4 Pair from Vitamin K-Dependent Protein S: Identification of an Unusual Fold in EGF3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Vitamin K-dependent protein S
total genus 4
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2005-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07645 EGF_CA Calcium-binding EGF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1z6cA00
2UWOB 1IQHL 1ATAA 3OLTA 1KLIL 1IQGL 1FAKL 1HREA 1JL9A 2BOXA 3Q7DA 1EMOA 2XBXL 3KQCL 4MMYB 2P26A 2BO2A 4M11A 3TBDA 4NGAL 1EPJA 2AYLA 4Z0KB 4Z6AL 1FSBA 2VWLL 1CCVA 2Y82B 1G2MB 4ZXYL 2FLBL 1L5GB 2VH6B 3N8YA 4BXSA 2BOUA 1IJQA 1DX5I 3P5BL 2VJ3A 3BT1A 3BT2A 4O1ZA 2XC5L 4FM5A 2BQ6A 3LC3B 2Y38A 2WG3C 1CVWL 4ISIL 2B7DL 4ZHAB 3CENL 5FDQA 2W3IB 3MDLA 2XC4L 1CVUA 1JBUL 1U8CB 4BXWA 2WPIE 2VWMK 3N8VA 1BF9A 1NT0A 3KRKA 3QCWA 1PTHA 4X8TL 2WG4B 3LIWB 1LQDA 2RHPA 2WYJB 3GCWE 2PUQL 1EPGA 1ATDA 4JZEL 5CISA 1P9JA 1G1SA 1IVOC 1V3XB 1DVAL 1APQA 1OB1C 1WHFA 2P3TA 2J94B 4Y79B 2K2SB 2WPJE 2H9EL 2W86A 1RFNB 2WPLE 3U73A 2VH0B 1EMNA 1CX2A 2P94L 5K0HB 2VWNL 3NTGA 2RA0L 1ATEA 6COXA 5IKQA 2VWOL 2W2ME 3TK5B 4PH9A 2MHPA 1J9CL 2KL7A 2W2QE 2P3FL 1U67A 1MOXC 4A7IA 1HT5A 1IOXA 1EBVA 1YO8A 1KLJL 1XKAL 3KK6A 1HCGB 3RR3A 1JV2B 1HRFA 4X8UL 4XL1A 2YGOA 3C9AC 2W2PE 3SW2A 1ADXA 2F9BL 1WU1B 3KCGL 3EGFA 2OYEP 1EGFA 4CUFA 2RNLA 1IQFL 1Q4GA 3GISX 4JZDL 2Y5HL 1NPEB 2JKHL 1EAIC 2D1JB 2W26B 1EPHA 4Y6DB 1P0SL 2P95L 3CS7L 1UZQA 3H5CB 1NZIA 5I46L 1DIYA 4ZXXL 4RRXA 2GD4A 5JVZA 4YZUB 2J95B 2BQ7A 3N8XA 5COXA 5CKQA 2EI7B 2XC0L 4OTJA 1HT8A 1WHEA 3LTFB 3KQDL 3KQBL 1W8BL 1YGCL 2BZ6L 2UWPB 4RRWA 2J2UB 1MQ5L 3SOQA 3HS7A 1C5MF 4YT7L 4CSYA 1B9WA 1HAFA 4CUDA 1IQML 1N1IA 5IKRA 5L2ZL 3QH0A 2WFXB 1COUA 1QFKL 1KLOA 2W2OE 2J4IB 4AQTA 4RS0A 4G1MB 2Y7ZB 5E8DA 1YUKB 2WPHE 3N8ZA 2BOHA 4Y71B 5JBBE 1O5DL 1NQLB 5KN5C 4BTUA 3HS6A 4TGFA 1G2LB 2CJIB 4E1GA 5L2YL 1SZBA 4X8VL 2BQWA 3QMOA 3TZIA 3HO4A 1G1TA 5JBCE 4NG9L 3K9XA 1MQ6L 4CUEA 3HPTA 2MGPA 2Y5FL 1HJ7A 3ZYGA 2FZZL 3ENSA 3F6UL 2P93L 5JB8E 4X8SL 1K36A 1CEJA 1IQIL 2FD6A 2VVUL 3F1SB 3TGFA 4BDWA 4BTIA 4RRYA 3KL6B 4MMZB 2NPRA 1IQKL 2DDUA 4D0FA 1IOEL 1EQGA 1FE2A 2VVCK 2WPME 2Q1JB 5L30L 3V64C 3LTGD 5JW1A 1PFXL 2TGFA 1X7AL 2FLGA 1PGEA 5KIRA 2ADXA 5JB9E 4ZH8B 1IGXA 5IKVA 2P16L 1HZ8A 2XBWL 4Y76B 1LPZA 3BPSE 2P3UA 1IQNL 2K2TA 3LN1A 4NA9L 1DDXA 1GK5A 1G1QA 4RUTA 3U7UG 1LPKA 1M1XB 4ZAEB 3N8WB 3DEMA 1APOA 1PXXA 1FFMA 1CQEA 2PR3B 3KQEL 1F7MA 2FLRL 2UWLB 1NFWB 2BOKL 2Y7XB 1IQJL 3V65B 1W7XL 3FCSB 2W3KB 1HX2A 1I0UA 1PRHA 1UZJA 1UZPA 1FJSL 1URKA 2VVVL 3Q3KB 1KSNB 1L3YA 2OYUP 4XLWA 2Y80B 4Z0LA 2EI8B 3LAQA 3ZYIB 1LMJA 3HS5A 3NT1A 2I9AA 1XKBA 1IQEL 4COXA 2WFTA 4JYUL 1XDTR 4XBMA 3PGHA 3NTBA 1Z6CA 2I9BA 2G00L 2WYGB 3IJEB 1HAEA 1G1RA 4D90A 2P3FN 1EPIA 1NFXB 2Y81B 5EGMB 3HO5A 1FAXL 1AUTL 1TPGA 2PHBB 3POYA 3LN0A 2KV4A 4D0EA 5JBAE 4BTTA 4C16A 2XBYL 3FBYA 4OTYA 1TLEA 4ISHL 2WPKE 2Y5GL 4O02B 4LMFA 3TH3L 5IKTA 2W2NE 2YGPA 1IP0A 1A3PA 2J34B 3N8WA 2P28B 2EI6B 4MMXB 5F1AA 1EZQB 1K37A 3FFGL 5F19A 3OLUA 4Y7AB 1F7EA 3CA7A 3ZYJB 3M37L 1F0RB 3ASIA 1N7DA 2J38B 3ELAL 1YUGA 1XFEA 3LC5B 4JYVL 2MGRA 4LORA 2BMGA 1NFYB 3IITB 3M36L 1EQHA 3HO3A 3TK6B 4M10A 1IGZA 2XBVL 2M74A 3CFWA 1Z6EL 1FF7A 3SOVA 5CKMA 1UZKA 1IQLL 1NFUB 3GCXE 3SOBB 3MQEA 1CCFA 2KB9A 3N8YB 1YUFA 1TOZA 3NJPC 1KIGL 1F0SB 4RRZA 4Y7BB 1ZAQA 4YT6L 4JZFL 5JVYA 5CKNA 1ATBA 3R05A 4BDXA 1DQBA 1LPGA
chains in the Genus database with same CATH superfamily
2UWOB 1IQHL 1ATAA 3OLTA 1KLIL 1IQGL 1FAKL 1HREA 1JL9A 2BOXA 3Q7DA 1EMOA 2YGQA 2XBXL 3KQCL 4MMYB 2P26A 3S6XA 2BO2A 4M11A 3TBDA 4NGAL 1EPJA 2AYLA 4Z0KB 4Z6AL 1FSBA 2VWLL 1CCVA 2Y82B 1G2MB 4ZXYL 2FLBL 1L5GB 2VH6B 3N8YA 1V1IA 4BXSA 2BOUA 1IJQA 1DX5I 3P5BL 2VJ3A 3BT1A 3BT2A 4O1ZA 2XC5L 4FM5A 2BQ6A 3LC3B 2Y38A 2WG3C 1CVWL 4ISIL 2B7DL 4ZHAB 3CENL 5FDQA 2W3IB 3MDLA 2XC4L 1CVUA 1JBUL 1U8CB 4BXWA 2WPIE 2VWMK 3N8VA 1BF9A 1NT0A 3KRKA 3QCWA 1PTHA 4X8TL 2WG4B 3LIWB 1LQDA 2RHPA 2WYJB 3GCWE 2PUQL 1EPGA 1ATDA 4JZEL 5CISA 1P9JA 1G1SA 1IVOC 1V3XB 1DVAL 1APQA 1OB1C 1WHFA 2P3TA 2J94B 4Y79B 2K2SB 2WPJE 2H9EL 2W86A 2VRSA 1RFNB 2WPLE 3U73A 2VH0B 1EMNA 1CX2A 2P94L 5K0HB 2VWNL 3NTGA 2RA0L 1ATEA 6COXA 5IKQA 2VWOL 2W2ME 3TK5B 4PH9A 2MHPA 1J9CL 2KL7A 2W2QE 2P3FL 1U67A 1MOXC 4A7IA 1HT5A 1IOXA 1EBVA 1YO8A 1KLJL 1XKAL 3KK6A 1HCGB 3RR3A 1JV2B 1HRFA 4X8UL 4XL1A 2YGOA 3C9AC 2W2PE 3SW2A 1ADXA 2F9BL 1WU1B 1LK9A 3EGFA 3KCGL 2OYEP 1EGFA 4CUFA 2RNLA 1IQFL 1Q4GA 3GISX 4JZDL 2Y5HL 1NPEB 2JKHL 1EAIC 2D1JB 2W26B 1EPHA 4Y6DB 1P0SL 2P95L 3CS7L 1UZQA 3H5CB 1NZIA 5I46L 1DIYA 4ZXXL 4RRXA 2GD4A 5JVZA 4YZUB 2J95B 2BQ7A 3N8XA 5COXA 5CKQA 2EI7B 2XC0L 4OTJA 1HT8A 1WHEA 3LTFB 3KQDL 3KQBL 1W8BL 1YGCL 2BZ6L 2UWPB 4RRWA 2J2UB 1MQ5L 3SOQA 3HS7A 1C5MF 4YT7L 4CSYA 1B9WA 1HAFA 4CUDA 1IQML 1N1IA 5IKRA 5L2ZL 3QH0A 2WFXB 1COUA 1QFKL 1KLOA 2W2OE 2J4IB 2JJLA 4AQTA 4RS0A 4G1MB 2Y7ZB 5E8DA 1YUKB 2BSFA 2WPHE 3N8ZA 2BOHA 4Y71B 5JBBE 1O5DL 1NQLB 4GU4A 5KN5C 4BTUA 3HS6A 4TGFA 1G2LB 2CJIB 4E1GA 5L2YL 1SZBA 4X8VL 2BQWA 3QMOA 3TZIA 3HO4A 1G1TA 5JBCE 2BT8A 4NG9L 3K9XA 1MQ6L 4CUEA 3HPTA 2MGPA 2Y5FL 1HJ7A 3ZYGA 2FZZL 3ENSA 3F6UL 2P93L 5JB8E 4X8SL 1K36A 1CEJA 1IQIL 2FD6A 2VVUL 3F1SB 3TGFA 2KNIA 4BDWA 4BTIA 2H9EC 4RRYA 3KL6B 2HOXA 4MMZB 2NPRA 1IQKL 2DDUA 4D0FA 1IOEL 1EQGA 1FE2A 2VVCK 2WPME 1V1HA 2Q1JB 5L30L 3V64C 3LTGD 5JW1A 1PFXL 2TGFA 1X7AL 2FLGA 1PGEA 5KIRA 2ADXA 5JB9E 4ZH8B 1IGXA 5IKVA 2P16L 1HZ8A 2XBWL 4Y76B 1LPZA 3BPSE 2P3UA 1IQNL 1QIUA 2K2TA 3LN1A 2WZPP 4NA9L 1DDXA 1GK5A 1G1QA 4RUTA 3U7UG 1LPKA 1M1XB 4ZAEB 3N8WB 3DEMA 1APOA 1PXXA 1FFMA 1CQEA 2PR3B 3KQEL 1F7MA 2FLRL 2UWLB 1NFWB 2BOKL 2Y7XB 1IQJL 3V65B 1W7XL 3FCSB 2W3KB 1HX2A 1I0UA 1PRHA 1UZJA 1UZPA 1FJSL 1URKA 2VVVL 3Q3KB 2BT7A 1KSNB 1L3YA 2OYUP 4XLWA 2Y80B 4Z0LA 2EI8B 3LAQA 3ZYIB 1LMJA 3HS5A 3NT1A 2I9AA 1XKBA 2HORA 1IQEL 4COXA 2WFTA 4JYUL 1XDTR 4XBMA 3PGHA 3NTBA 1Z6CA 4GU3A 2I9BA 2G00L 2WYGB 3IJEB 1HAEA 1G1RA 4D90A 2P3FN 1EPIA 1NFXB 2Y81B 5EGMB 3HO5A 1FAXL 1AUTL 1TPGA 2PHBB 3POYA 3LN0A 2KV4A 4D0EA 5JBAE 4BTTA 4C16A 2XBYL 3FBYA 4OTYA 1TLEA 4ISHL 2WPKE 2Y5GL 1LMMA 4O02B 4LMFA 3TH3L 5IKTA 2W2NE 2YGPA 1IP0A 1A3PA 2J34B 3N8WA 2P28B 2EI6B 4MMXB 5F1AA 1EZQB 1K37A 3FFGL 5F19A 3OLUA 4Y7AB 1F7EA 3CA7A 3ZYJB 1KKEA 3M37L 1F0RB 3ASIA 1N7DA 2J38B 3ELAL 1YUGA 1XFEA 3LC5B 4JYVL 2MGRA 4LORA 2BMGA 1NFYB 3IITB 3M36L 1EQHA 3HO3A 3TK6B 4M10A 1IGZA 2XBVL 2M74A 3CFWA 1Z6EL 1FF7A 3SOVA 4A94C 5CKMA 1UZKA 1IQLL 1NFUB 3GCXE 3SOBB 3MQEA 1CCFA 2KB9A 3N8YB 1YUFA 1TOZA 3NJPC 1KIGL 1F0SB 4RRZA 4Y7BB 1ZAQA 4YT6L 4JZFL 5JVYA 5CKNA 1ATBA 3R05A 4BDXA 1DQBA 1LPGA
chains in the Genus database with same CATH topology
2UWOB 1IQHL 1ATAA 3OLTA 1KLIL 1IQGL 1FAKL 1HREA 1JL9A 2BOXA 3Q7DA 1EMOA 2YGQA 2XBXL 3KQCL 4MMYB 2P26A 3S6XA 2BO2A 4M11A 3TBDA 4NGAL 1EPJA 2AYLA 4Z0KB 4Z6AL 1FSBA 2VWLL 1CCVA 2Y82B 1G2MB 4ZXYL 2FLBL 1L5GB 2VH6B 3N8YA 4BXSA 2BOUA 1IJQA 1DX5I 3P5BL 2VJ3A 3BT1A 3BT2A 4O1ZA 2XC5L 4FM5A 2BQ6A 3LC3B 2Y38A 2WG3C 1CVWL 4ISIL 2B7DL 4ZHAB 3CENL 5FDQA 2W3IB 3MDLA 2XC4L 1CVUA 1JBUL 1U8CB 4BXWA 2WPIE 2VWMK 3N8VA 1BF9A 1NT0A 3KRKA 3QCWA 1PTHA 4X8TL 2WG4B 3LIWB 1LQDA 2RHPA 2WYJB 3GCWE 2PUQL 1EPGA 1ATDA 4JZEL 5CISA 1P9JA 1G1SA 1IVOC 1V3XB 1DVAL 1APQA 1OB1C 1WHFA 2P3TA 2J94B 4Y79B 2K2SB 2WPJE 2H9EL 2W86A 1RFNB 2WPLE 3U73A 2VH0B 1EMNA 1CX2A 2P94L 5K0HB 2VWNL 3NTGA 2RA0L 1ATEA 6COXA 5IKQA 2VWOL 2W2ME 3TK5B 4PH9A 2MHPA 1J9CL 2KL7A 2W2QE 2P3FL 1U67A 1MOXC 4A7IA 1HT5A 1IOXA 1EBVA 1YO8A 1KLJL 1XKAL 3KK6A 1HCGB 3RR3A 1JV2B 1HRFA 4X8UL 4XL1A 2YGOA 3C9AC 2W2PE 3SW2A 1ADXA 2F9BL 1WU1B 3KCGL 3EGFA 2OYEP 1EGFA 4CUFA 2RNLA 1IQFL 1Q4GA 3GISX 4JZDL 2Y5HL 1NPEB 2JKHL 1EAIC 2D1JB 2W26B 1EPHA 4Y6DB 1P0SL 2P95L 3CS7L 1UZQA 3H5CB 1NZIA 5I46L 1DIYA 4ZXXL 4RRXA 2GD4A 5JVZA 4YZUB 2J95B 2BQ7A 3N8XA 5COXA 5CKQA 2EI7B 2XC0L 4OTJA 1HT8A 1WHEA 3LTFB 3KQDL 3KQBL 1W8BL 1YGCL 2BZ6L 2UWPB 4RRWA 2J2UB 1MQ5L 3SOQA 3HS7A 1C5MF 4YT7L 4CSYA 1B9WA 1HAFA 4CUDA 1IQML 1N1IA 5IKRA 5L2ZL 3QH0A 2WFXB 1COUA 1QFKL 1KLOA 2W2OE 2J4IB 4AQTA 4RS0A 4G1MB 2Y7ZB 5E8DA 1YUKB 2WPHE 3N8ZA 2BOHA 4Y71B 5JBBE 1O5DL 1NQLB 5KN5C 4BTUA 3HS6A 4TGFA 1G2LB 2CJIB 4E1GA 5L2YL 1SZBA 4X8VL 2BQWA 3QMOA 3TZIA 3HO4A 1G1TA 5JBCE 4NG9L 3K9XA 1MQ6L 4CUEA 3HPTA 2MGPA 2Y5FL 1HJ7A 3ZYGA 2FZZL 3ENSA 3F6UL 2P93L 5JB8E 4X8SL 1K36A 1CEJA 1IQIL 2FD6A 2VVUL 3F1SB 3TGFA 2KNIA 4BDWA 4BTIA 2H9EC 4RRYA 3KL6B 4MMZB 2NPRA 1IQKL 2DDUA 4D0FA 1IOEL 1EQGA 1FE2A 2VVCK 2WPME 2Q1JB 5L30L 3V64C 3LTGD 5JW1A 1PFXL 2TGFA 1X7AL 2FLGA 1PGEA 5KIRA 2ADXA 5JB9E 4ZH8B 1IGXA 5IKVA 2P16L 1HZ8A 2XBWL 4Y76B 1LPZA 3BPSE 2P3UA 1IQNL 2K2TA 3LN1A 2WZPP 4NA9L 1DDXA 1GK5A 1G1QA 4RUTA 3U7UG 1LPKA 1M1XB 4ZAEB 3N8WB 3DEMA 1APOA 1PXXA 1FFMA 1CQEA 2PR3B 3KQEL 1F7MA 2FLRL 2UWLB 1NFWB 2BOKL 2Y7XB 1IQJL 3V65B 1W7XL 3FCSB 2W3KB 1HX2A 1I0UA 1PRHA 1UZJA 1UZPA 1FJSL 1URKA 2VVVL 3Q3KB 1KSNB 1L3YA 2OYUP 4XLWA 2Y80B 4Z0LA 2EI8B 3LAQA 3ZYIB 1LMJA 3HS5A 3NT1A 2I9AA 1XKBA 1IQEL 4COXA 2WFTA 4JYUL 1XDTR 4XBMA 3PGHA 3NTBA 1Z6CA 2I9BA 2G00L 2WYGB 3IJEB 1HAEA 1G1RA 4D90A 2P3FN 1EPIA 1NFXB 2Y81B 5EGMB 3HO5A 1FAXL 1AUTL 1TPGA 2PHBB 3POYA 3LN0A 2KV4A 4D0EA 5JBAE 4BTTA 4C16A 2XBYL 3FBYA 4OTYA 1TLEA 4ISHL 2WPKE 2Y5GL 1LMMA 4O02B 4LMFA 3TH3L 5IKTA 2W2NE 2YGPA 1IP0A 1A3PA 2J34B 3N8WA 2P28B 2EI6B 4MMXB 5F1AA 1EZQB 1K37A 3FFGL 5F19A 3OLUA 4Y7AB 1F7EA 3CA7A 3ZYJB 3M37L 1F0RB 3ASIA 1N7DA 2J38B 3ELAL 1YUGA 1XFEA 3LC5B 4JYVL 2MGRA 4LORA 2BMGA 1NFYB 3IITB 3M36L 1EQHA 3HO3A 3TK6B 4M10A 1IGZA 2XBVL 2M74A 3CFWA 1Z6EL 1FF7A 3SOVA 4A94C 5CKMA 1UZKA 1IQLL 1NFUB 3GCXE 3SOBB 3MQEA 1CCFA 2KB9A 3N8YB 1YUFA 1TOZA 3NJPC 1KIGL 1F0SB 4RRZA 4Y7BB 1ZAQA 4YT6L 4JZFL 5JVYA 5CKNA 1ATBA 3R05A 4BDXA 1DQBA 1LPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWO B;  1IQH L;  1ATA A;  3OLT A;  1KLI L;  1IQG L;  1FAK L;  1HRE A;  1JL9 A;  2BOX A;  3Q7D A;  1EMO A;  2XBX L;  3KQC L;  4MMY B;  2P26 A;  2BO2 A;  4M11 A;  3TBD A;  4NGA L;  1EPJ A;  2AYL A;  4Z0K B;  4Z6A L;  1FSB A;  2VWL L;  1CCV A;  2Y82 B;  1G2M B;  4ZXY L;  2FLB L;  1L5G B;  2VH6 B;  3N8Y A;  4BXS A;  2BOU A;  1IJQ A;  1DX5 I;  3P5B L;  2VJ3 A;  3BT1 A;  3BT2 A;  4O1Z A;  2XC5 L;  4FM5 A;  2BQ6 A;  3LC3 B;  2Y38 A;  2WG3 C;  1CVW L;  4ISI L;  2B7D L;  4ZHA B;  3CEN L;  5FDQ A;  2W3I B;  3MDL A;  2XC4 L;  1CVU A;  1JBU L;  1U8C B;  4BXW A;  2WPI E;  2VWM K;  3N8V A;  1BF9 A;  1NT0 A;  3KRK A;  3QCW A;  1PTH A;  4X8T L;  2WG4 B;  3LIW B;  1LQD A;  2RHP A;  2WYJ B;  3GCW E;  2PUQ L;  1EPG A;  1ATD A;  4JZE L;  5CIS A;  1P9J A;  1G1S A;  1IVO C;  1V3X B;  1DVA L;  1APQ A;  1OB1 C;  1WHF A;  2P3T A;  2J94 B;  4Y79 B;  2K2S B;  2WPJ E;  2H9E L;  2W86 A;  1RFN B;  2WPL E;  3U73 A;  2VH0 B;  1EMN A;  1CX2 A;  2P94 L;  5K0H B;  2VWN L;  3NTG A;  2RA0 L;  1ATE A;  6COX A;  5IKQ A;  2VWO L;  2W2M E;  3TK5 B;  4PH9 A;  2MHP A;  1J9C L;  2KL7 A;  2W2Q E;  2P3F L;  1U67 A;  1MOX C;  4A7I A;  1HT5 A;  1IOX A;  1EBV A;  1YO8 A;  1KLJ L;  1XKA L;  3KK6 A;  1HCG B;  3RR3 A;  1JV2 B;  1HRF A;  4X8U L;  4XL1 A;  2YGO A;  3C9A C;  2W2P E;  3SW2 A;  1ADX A;  2F9B L;  1WU1 B;  3KCG L;  3EGF A;  2OYE P;  1EGF A;  4CUF A;  2RNL A;  1IQF L;  1Q4G A;  3GIS X;  4JZD L;  2Y5H L;  1NPE B;  2JKH L;  1EAI C;  2D1J B;  2W26 B;  1EPH A;  4Y6D B;  1P0S L;  2P95 L;  3CS7 L;  1UZQ A;  3H5C B;  1NZI A;  5I46 L;  1DIY A;  4ZXX L;  4RRX A;  2GD4 A;  5JVZ A;  4YZU B;  2J95 B;  2BQ7 A;  3N8X A;  5COX A;  5CKQ A;  2EI7 B;  2XC0 L;  4OTJ A;  1HT8 A;  1WHE A;  3LTF B;  3KQD L;  3KQB L;  1W8B L;  1YGC L;  2BZ6 L;  2UWP B;  4RRW A;  2J2U B;  1MQ5 L;  3SOQ A;  3HS7 A;  1C5M F;  4YT7 L;  4CSY A;  1B9W A;  1HAF A;  4CUD A;  1IQM L;  1N1I A;  5IKR A;  5L2Z L;  3QH0 A;  2WFX B;  1COU A;  1QFK L;  1KLO A;  2W2O E;  2J4I B;  4AQT A;  4RS0 A;  4G1M B;  2Y7Z B;  5E8D A;  1YUK B;  2WPH E;  3N8Z A;  2BOH A;  4Y71 B;  5JBB E;  1O5D L;  1NQL B;  5KN5 C;  4BTU A;  3HS6 A;  4TGF A;  1G2L B;  2CJI B;  4E1G A;  5L2Y L;  1SZB A;  4X8V L;  2BQW A;  3QMO A;  3TZI A;  3HO4 A;  1G1T A;  5JBC E;  4NG9 L;  3K9X A;  1MQ6 L;  4CUE A;  3HPT A;  2MGP A;  2Y5F L;  1HJ7 A;  3ZYG A;  2FZZ L;  3ENS A;  3F6U L;  2P93 L;  5JB8 E;  4X8S L;  1K36 A;  1CEJ A;  1IQI L;  2FD6 A;  2VVU L;  3F1S B;  3TGF A;  4BDW A;  4BTI A;  4RRY A;  3KL6 B;  4MMZ B;  2NPR A;  1IQK L;  2DDU A;  4D0F A;  1IOE L;  1EQG A;  1FE2 A;  2VVC K;  2WPM E;  2Q1J B;  5L30 L;  3V64 C;  3LTG D;  5JW1 A;  1PFX L;  2TGF A;  1X7A L;  2FLG A;  1PGE A;  5KIR A;  2ADX A;  5JB9 E;  4ZH8 B;  1IGX A;  5IKV A;  2P16 L;  1HZ8 A;  2XBW L;  4Y76 B;  1LPZ A;  3BPS E;  2P3U A;  1IQN L;  2K2T A;  3LN1 A;  4NA9 L;  1DDX A;  1GK5 A;  1G1Q A;  4RUT A;  3U7U G;  1LPK A;  1M1X B;  4ZAE B;  3N8W B;  3DEM A;  1APO A;  1PXX A;  1FFM A;  1CQE A;  2PR3 B;  3KQE L;  1F7M A;  2FLR L;  2UWL B;  1NFW B;  2BOK L;  2Y7X B;  1IQJ L;  3V65 B;  1W7X L;  3FCS B;  2W3K B;  1HX2 A;  1I0U A;  1PRH A;  1UZJ A;  1UZP A;  1FJS L;  1URK A;  2VVV L;  3Q3K B;  1KSN B;  1L3Y A;  2OYU P;  4XLW A;  2Y80 B;  4Z0L A;  2EI8 B;  3LAQ A;  3ZYI B;  1LMJ A;  3HS5 A;  3NT1 A;  2I9A A;  1XKB A;  1IQE L;  4COX A;  2WFT A;  4JYU L;  1XDT R;  4XBM A;  3PGH A;  3NTB A;  1Z6C A;  2I9B A;  2G00 L;  2WYG B;  3IJE B;  1HAE A;  1G1R A;  4D90 A;  2P3F N;  1EPI A;  1NFX B;  2Y81 B;  5EGM B;  3HO5 A;  1FAX L;  1AUT L;  1TPG A;  2PHB B;  3POY A;  3LN0 A;  2KV4 A;  4D0E A;  5JBA E;  4BTT A;  4C16 A;  2XBY L;  3FBY A;  4OTY A;  1TLE A;  4ISH L;  2WPK E;  2Y5G L;  4O02 B;  4LMF A;  3TH3 L;  5IKT A;  2W2N E;  2YGP A;  1IP0 A;  1A3P A;  2J34 B;  3N8W A;  2P28 B;  2EI6 B;  4MMX B;  5F1A A;  1EZQ B;  1K37 A;  3FFG L;  5F19 A;  3OLU A;  4Y7A B;  1F7E A;  3CA7 A;  3ZYJ B;  3M37 L;  1F0R B;  3ASI A;  1N7D A;  2J38 B;  3ELA L;  1YUG A;  1XFE A;  3LC5 B;  4JYV L;  2MGR A;  4LOR A;  2BMG A;  1NFY B;  3IIT B;  3M36 L;  1EQH A;  3HO3 A;  3TK6 B;  4M10 A;  1IGZ A;  2XBV L;  2M74 A;  3CFW A;  1Z6E L;  1FF7 A;  3SOV A;  5CKM A;  1UZK A;  1IQL L;  1NFU B;  3GCX E;  3SOB B;  3MQE A;  1CCF A;  2KB9 A;  3N8Y B;  1YUF A;  1TOZ A;  3NJP C;  1KIG L;  1F0S B;  4RRZ A;  4Y7B B;  1ZAQ A;  4YT6 L;  4JZF L;  5JVY A;  5CKN A;  1ATB A;  3R05 A;  4BDX A;  1DQB A;  1LPG A; 
#chains in the Genus database with same CATH topology
 2UWO B;  1IQH L;  1ATA A;  3OLT A;  1KLI L;  1IQG L;  1FAK L;  1HRE A;  1JL9 A;  2BOX A;  3Q7D A;  1EMO A;  2YGQ A;  2XBX L;  3KQC L;  4MMY B;  2P26 A;  3S6X A;  2BO2 A;  4M11 A;  3TBD A;  4NGA L;  1EPJ A;  2AYL A;  4Z0K B;  4Z6A L;  1FSB A;  2VWL L;  1CCV A;  2Y82 B;  1G2M B;  4ZXY L;  2FLB L;  1L5G B;  2VH6 B;  3N8Y A;  1V1I A;  4BXS A;  2BOU A;  1IJQ A;  1DX5 I;  3P5B L;  2VJ3 A;  3BT1 A;  3BT2 A;  4O1Z A;  2XC5 L;  4FM5 A;  2BQ6 A;  3LC3 B;  2Y38 A;  2WG3 C;  1CVW L;  4ISI L;  2B7D L;  4ZHA B;  3CEN L;  5FDQ A;  2W3I B;  3MDL A;  2XC4 L;  1CVU A;  1JBU L;  1U8C B;  4BXW A;  2WPI E;  2VWM K;  3N8V A;  1BF9 A;  1NT0 A;  3KRK A;  3QCW A;  1PTH A;  4X8T L;  2WG4 B;  3LIW B;  1LQD A;  2RHP A;  2WYJ B;  3GCW E;  2PUQ L;  1EPG A;  1ATD A;  4JZE L;  5CIS A;  1P9J A;  1G1S A;  1IVO C;  1V3X B;  1DVA L;  1APQ A;  1OB1 C;  1WHF A;  2P3T A;  2J94 B;  4Y79 B;  2K2S B;  2WPJ E;  2H9E L;  2W86 A;  2VRS A;  1RFN B;  2WPL E;  3U73 A;  2VH0 B;  1EMN A;  1CX2 A;  2P94 L;  5K0H B;  2VWN L;  3NTG A;  2RA0 L;  1ATE A;  6COX A;  5IKQ A;  2VWO L;  2W2M E;  3TK5 B;  4PH9 A;  2MHP A;  1J9C L;  2KL7 A;  2W2Q E;  2P3F L;  1U67 A;  1MOX C;  4A7I A;  1HT5 A;  1IOX A;  1EBV A;  1YO8 A;  1KLJ L;  1XKA L;  3KK6 A;  1HCG B;  3RR3 A;  1JV2 B;  1HRF A;  4X8U L;  4XL1 A;  2YGO A;  3C9A C;  2W2P E;  3SW2 A;  1ADX A;  2F9B L;  1WU1 B;  1LK9 A;  3EGF A;  3KCG L;  2OYE P;  1EGF A;  4CUF A;  2RNL A;  1IQF L;  1Q4G A;  3GIS X;  4JZD L;  2Y5H L;  1NPE B;  2JKH L;  1EAI C;  2D1J B;  2W26 B;  1EPH A;  4Y6D B;  1P0S L;  2P95 L;  3CS7 L;  1UZQ A;  3H5C B;  1NZI A;  5I46 L;  1DIY A;  4ZXX L;  4RRX A;  2GD4 A;  5JVZ A;  4YZU B;  2J95 B;  2BQ7 A;  3N8X A;  5COX A;  5CKQ A;  2EI7 B;  2XC0 L;  4OTJ A;  1HT8 A;  1WHE A;  3LTF B;  3KQD L;  3KQB L;  1W8B L;  1YGC L;  2BZ6 L;  2UWP B;  4RRW A;  2J2U B;  1MQ5 L;  3SOQ A;  3HS7 A;  1C5M F;  4YT7 L;  4CSY A;  1B9W A;  1HAF A;  4CUD A;  1IQM L;  1N1I A;  5IKR A;  5L2Z L;  3QH0 A;  2WFX B;  1COU A;  1QFK L;  1KLO A;  2W2O E;  2J4I B;  2JJL A;  4AQT A;  4RS0 A;  4G1M B;  2Y7Z B;  5E8D A;  1YUK B;  2BSF A;  2WPH E;  3N8Z A;  2BOH A;  4Y71 B;  5JBB E;  1O5D L;  1NQL B;  4GU4 A;  5KN5 C;  4BTU A;  3HS6 A;  4TGF A;  1G2L B;  2CJI B;  4E1G A;  5L2Y L;  1SZB A;  4X8V L;  2BQW A;  3QMO A;  3TZI A;  3HO4 A;  1G1T A;  5JBC E;  2BT8 A;  4NG9 L;  3K9X A;  1MQ6 L;  4CUE A;  3HPT A;  2MGP A;  2Y5F L;  1HJ7 A;  3ZYG A;  2FZZ L;  3ENS A;  3F6U L;  2P93 L;  5JB8 E;  4X8S L;  1K36 A;  1CEJ A;  1IQI L;  2FD6 A;  2VVU L;  3F1S B;  3TGF A;  2KNI A;  4BDW A;  4BTI A;  2H9E C;  4RRY A;  3KL6 B;  2HOX A;  4MMZ B;  2NPR A;  1IQK L;  2DDU A;  4D0F A;  1IOE L;  1EQG A;  1FE2 A;  2VVC K;  2WPM E;  1V1H A;  2Q1J B;  5L30 L;  3V64 C;  3LTG D;  5JW1 A;  1PFX L;  2TGF A;  1X7A L;  2FLG A;  1PGE A;  5KIR A;  2ADX A;  5JB9 E;  4ZH8 B;  1IGX A;  5IKV A;  2P16 L;  1HZ8 A;  2XBW L;  4Y76 B;  1LPZ A;  3BPS E;  2P3U A;  1IQN L;  1QIU A;  2K2T A;  3LN1 A;  2WZP P;  4NA9 L;  1DDX A;  1GK5 A;  1G1Q A;  4RUT A;  3U7U G;  1LPK A;  1M1X B;  4ZAE B;  3N8W B;  3DEM A;  1APO A;  1PXX A;  1FFM A;  1CQE A;  2PR3 B;  3KQE L;  1F7M A;  2FLR L;  2UWL B;  1NFW B;  2BOK L;  2Y7X B;  1IQJ L;  3V65 B;  1W7X L;  3FCS B;  2W3K B;  1HX2 A;  1I0U A;  1PRH A;  1UZJ A;  1UZP A;  1FJS L;  1URK A;  2VVV L;  3Q3K B;  2BT7 A;  1KSN B;  1L3Y A;  2OYU P;  4XLW A;  2Y80 B;  4Z0L A;  2EI8 B;  3LAQ A;  3ZYI B;  1LMJ A;  3HS5 A;  3NT1 A;  2I9A A;  1XKB A;  2HOR A;  1IQE L;  4COX A;  2WFT A;  4JYU L;  1XDT R;  4XBM A;  3PGH A;  3NTB A;  1Z6C A;  4GU3 A;  2I9B A;  2G00 L;  2WYG B;  3IJE B;  1HAE A;  1G1R A;  4D90 A;  2P3F N;  1EPI A;  1NFX B;  2Y81 B;  5EGM B;  3HO5 A;  1FAX L;  1AUT L;  1TPG A;  2PHB B;  3POY A;  3LN0 A;  2KV4 A;  4D0E A;  5JBA E;  4BTT A;  4C16 A;  2XBY L;  3FBY A;  4OTY A;  1TLE A;  4ISH L;  2WPK E;  2Y5G L;  1LMM A;  4O02 B;  4LMF A;  3TH3 L;  5IKT A;  2W2N E;  2YGP A;  1IP0 A;  1A3P A;  2J34 B;  3N8W A;  2P28 B;  2EI6 B;  4MMX B;  5F1A A;  1EZQ B;  1K37 A;  3FFG L;  5F19 A;  3OLU A;  4Y7A B;  1F7E A;  3CA7 A;  3ZYJ B;  1KKE A;  3M37 L;  1F0R B;  3ASI A;  1N7D A;  2J38 B;  3ELA L;  1YUG A;  1XFE A;  3LC5 B;  4JYV L;  2MGR A;  4LOR A;  2BMG A;  1NFY B;  3IIT B;  3M36 L;  1EQH A;  3HO3 A;  3TK6 B;  4M10 A;  1IGZ A;  2XBV L;  2M74 A;  3CFW A;  1Z6E L;  1FF7 A;  3SOV A;  4A94 C;  5CKM A;  1UZK A;  1IQL L;  1NFU B;  3GCX E;  3SOB B;  3MQE A;  1CCF A;  2KB9 A;  3N8Y B;  1YUF A;  1TOZ A;  3NJP C;  1KIG L;  1F0S B;  4RRZ A;  4Y7B B;  1ZAQ A;  4YT6 L;  4JZF L;  5JVY A;  5CKN A;  1ATB A;  3R05 A;  4BDX A;  1DQB A;  1LPG A; 
#chains in the Genus database with same CATH homology
 2UWO B;  1IQH L;  1ATA A;  3OLT A;  1KLI L;  1IQG L;  1FAK L;  1HRE A;  1JL9 A;  2BOX A;  3Q7D A;  1EMO A;  2YGQ A;  2XBX L;  3KQC L;  4MMY B;  2P26 A;  3S6X A;  2BO2 A;  4M11 A;  3TBD A;  4NGA L;  1EPJ A;  2AYL A;  4Z0K B;  4Z6A L;  1FSB A;  2VWL L;  1CCV A;  2Y82 B;  1G2M B;  4ZXY L;  2FLB L;  1L5G B;  2VH6 B;  3N8Y A;  4BXS A;  2BOU A;  1IJQ A;  1DX5 I;  3P5B L;  2VJ3 A;  3BT1 A;  3BT2 A;  4O1Z A;  2XC5 L;  4FM5 A;  2BQ6 A;  3LC3 B;  2Y38 A;  2WG3 C;  1CVW L;  4ISI L;  2B7D L;  4ZHA B;  3CEN L;  5FDQ A;  2W3I B;  3MDL A;  2XC4 L;  1CVU A;  1JBU L;  1U8C B;  4BXW A;  2WPI E;  2VWM K;  3N8V A;  1BF9 A;  1NT0 A;  3KRK A;  3QCW A;  1PTH A;  4X8T L;  2WG4 B;  3LIW B;  1LQD A;  2RHP A;  2WYJ B;  3GCW E;  2PUQ L;  1EPG A;  1ATD A;  4JZE L;  5CIS A;  1P9J A;  1G1S A;  1IVO C;  1V3X B;  1DVA L;  1APQ A;  1OB1 C;  1WHF A;  2P3T A;  2J94 B;  4Y79 B;  2K2S B;  2WPJ E;  2H9E L;  2W86 A;  1RFN B;  2WPL E;  3U73 A;  2VH0 B;  1EMN A;  1CX2 A;  2P94 L;  5K0H B;  2VWN L;  3NTG A;  2RA0 L;  1ATE A;  6COX A;  5IKQ A;  2VWO L;  2W2M E;  3TK5 B;  4PH9 A;  2MHP A;  1J9C L;  2KL7 A;  2W2Q E;  2P3F L;  1U67 A;  1MOX C;  4A7I A;  1HT5 A;  1IOX A;  1EBV A;  1YO8 A;  1KLJ L;  1XKA L;  3KK6 A;  1HCG B;  3RR3 A;  1JV2 B;  1HRF A;  4X8U L;  4XL1 A;  2YGO A;  3C9A C;  2W2P E;  3SW2 A;  1ADX A;  2F9B L;  1WU1 B;  3KCG L;  3EGF A;  2OYE P;  1EGF A;  4CUF A;  2RNL A;  1IQF L;  1Q4G A;  3GIS X;  4JZD L;  2Y5H L;  1NPE B;  2JKH L;  1EAI C;  2D1J B;  2W26 B;  1EPH A;  4Y6D B;  1P0S L;  2P95 L;  3CS7 L;  1UZQ A;  3H5C B;  1NZI A;  5I46 L;  1DIY A;  4ZXX L;  4RRX A;  2GD4 A;  5JVZ A;  4YZU B;  2J95 B;  2BQ7 A;  3N8X A;  5COX A;  5CKQ A;  2EI7 B;  2XC0 L;  4OTJ A;  1HT8 A;  1WHE A;  3LTF B;  3KQD L;  3KQB L;  1W8B L;  1YGC L;  2BZ6 L;  2UWP B;  4RRW A;  2J2U B;  1MQ5 L;  3SOQ A;  3HS7 A;  1C5M F;  4YT7 L;  4CSY A;  1B9W A;  1HAF A;  4CUD A;  1IQM L;  1N1I A;  5IKR A;  5L2Z L;  3QH0 A;  2WFX B;  1COU A;  1QFK L;  1KLO A;  2W2O E;  2J4I B;  4AQT A;  4RS0 A;  4G1M B;  2Y7Z B;  5E8D A;  1YUK B;  2WPH E;  3N8Z A;  2BOH A;  4Y71 B;  5JBB E;  1O5D L;  1NQL B;  5KN5 C;  4BTU A;  3HS6 A;  4TGF A;  1G2L B;  2CJI B;  4E1G A;  5L2Y L;  1SZB A;  4X8V L;  2BQW A;  3QMO A;  3TZI A;  3HO4 A;  1G1T A;  5JBC E;  4NG9 L;  3K9X A;  1MQ6 L;  4CUE A;  3HPT A;  2MGP A;  2Y5F L;  1HJ7 A;  3ZYG A;  2FZZ L;  3ENS A;  3F6U L;  2P93 L;  5JB8 E;  4X8S L;  1K36 A;  1CEJ A;  1IQI L;  2FD6 A;  2VVU L;  3F1S B;  3TGF A;  2KNI A;  4BDW A;  4BTI A;  2H9E C;  4RRY A;  3KL6 B;  4MMZ B;  2NPR A;  1IQK L;  2DDU A;  4D0F A;  1IOE L;  1EQG A;  1FE2 A;  2VVC K;  2WPM E;  2Q1J B;  5L30 L;  3V64 C;  3LTG D;  5JW1 A;  1PFX L;  2TGF A;  1X7A L;  2FLG A;  1PGE A;  5KIR A;  2ADX A;  5JB9 E;  4ZH8 B;  1IGX A;  5IKV A;  2P16 L;  1HZ8 A;  2XBW L;  4Y76 B;  1LPZ A;  3BPS E;  2P3U A;  1IQN L;  2K2T A;  3LN1 A;  2WZP P;  4NA9 L;  1DDX A;  1GK5 A;  1G1Q A;  4RUT A;  3U7U G;  1LPK A;  1M1X B;  4ZAE B;  3N8W B;  3DEM A;  1APO A;  1PXX A;  1FFM A;  1CQE A;  2PR3 B;  3KQE L;  1F7M A;  2FLR L;  2UWL B;  1NFW B;  2BOK L;  2Y7X B;  1IQJ L;  3V65 B;  1W7X L;  3FCS B;  2W3K B;  1HX2 A;  1I0U A;  1PRH A;  1UZJ A;  1UZP A;  1FJS L;  1URK A;  2VVV L;  3Q3K B;  1KSN B;  1L3Y A;  2OYU P;  4XLW A;  2Y80 B;  4Z0L A;  2EI8 B;  3LAQ A;  3ZYI B;  1LMJ A;  3HS5 A;  3NT1 A;  2I9A A;  1XKB A;  1IQE L;  4COX A;  2WFT A;  4JYU L;  1XDT R;  4XBM A;  3PGH A;  3NTB A;  1Z6C A;  2I9B A;  2G00 L;  2WYG B;  3IJE B;  1HAE A;  1G1R A;  4D90 A;  2P3F N;  1EPI A;  1NFX B;  2Y81 B;  5EGM B;  3HO5 A;  1FAX L;  1AUT L;  1TPG A;  2PHB B;  3POY A;  3LN0 A;  2KV4 A;  4D0E A;  5JBA E;  4BTT A;  4C16 A;  2XBY L;  3FBY A;  4OTY A;  1TLE A;  4ISH L;  2WPK E;  2Y5G L;  1LMM A;  4O02 B;  4LMF A;  3TH3 L;  5IKT A;  2W2N E;  2YGP A;  1IP0 A;  1A3P A;  2J34 B;  3N8W A;  2P28 B;  2EI6 B;  4MMX B;  5F1A A;  1EZQ B;  1K37 A;  3FFG L;  5F19 A;  3OLU A;  4Y7A B;  1F7E A;  3CA7 A;  3ZYJ B;  3M37 L;  1F0R B;  3ASI A;  1N7D A;  2J38 B;  3ELA L;  1YUG A;  1XFE A;  3LC5 B;  4JYV L;  2MGR A;  4LOR A;  2BMG A;  1NFY B;  3IIT B;  3M36 L;  1EQH A;  3HO3 A;  3TK6 B;  4M10 A;  1IGZ A;  2XBV L;  2M74 A;  3CFW A;  1Z6E L;  1FF7 A;  3SOV A;  4A94 C;  5CKM A;  1UZK A;  1IQL L;  1NFU B;  3GCX E;  3SOB B;  3MQE A;  1CCF A;  2KB9 A;  3N8Y B;  1YUF A;  1TOZ A;  3NJP C;  1KIG L;  1F0S B;  4RRZ A;  4Y7B B;  1ZAQ A;  4YT6 L;  4JZF L;  5JVY A;  5CKN A;  1ATB A;  3R05 A;  4BDX A;  1DQB A;  1LPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...