1Z6RA

Crystal structure of mlc from escherichia coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
395
structure length
382
Chain Sequence
QIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHEMLEAHLVQELGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Mlc, a global regulator of sugar metabolism in Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Mlc protein
total genus 106
structure length 382
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z6rA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA03
5JLHA 4FWLA 4NB5A 2P5VA 3TDUC 5BS6A 3G73A 4M6YA 1ZHFA 2KIFA 4O5VA 2I7PA 3TOAA 1Q18A 3VFZA 2NLXA 3MN9A 2W57A 5K5OA 1R5HA 4LC9B 3I59B 2YSRA 1YIOA 1C0FA 4KIGA 4H5VA 2TDXA 4L9JA 3JAMZ 4FWOA 4CZLA 4IZ9A 2D0PA 1NLVA 3FZHA 5L3BA 1HKSA 5LHHA 1IZ1A 1WQ2A 4R79A 3M1EA 5BN8A 3JAMK 2V79A 2XKPA 1LNWA 2P7CB 3DFGA 3SHFA 2P9UB 3TPQA 1YS7A 3D2EA 1OPCA 3DF8A 3W6KB 2PI0A 2CGKA 3QBWA 3R60A 2GEMA 2XVCA 1USSA 4EJOA 5AQMA 2NNYA 4OMZA 4BRGA 1BOTO 2FBHA 3HYIA 3J80K 4QS8A 3IMXA 4BRMA 1R00A 3CDHA 3RKWA 2E2NA 3KCCA 4I01A 4BC2A 1CF7B 5LEKA 4B1YB 1S7OA 1J7KA 4H0OA 2NNNA 2HQRA 1S3JA 1ZLJA 4G6DA 4JD2B 3HSEA 4BRCA 3R9PA 4GY2B 2GZWA 3R61A 1V4SA 4CZZA 3O8MA 1YUWA 5K5RA 2IVNA 3JW4A 1B6AA 4WYBA 1WUAA 4H5NA 3EKSA 1Z6TA 4CI6A 1ONVA 2RV8A 2ZBKA 1TW3A 2D45A 3GL1A 4KN4X 4U0YA 4RB2C 1GLFO 1MJAA 1XN7A 1IXSB 2BUPA 3LL3A 4RAYA 2NS0A 4KN7X 4CZEA 4QLCU 5ICFA 3D2FA 3DPTA 4FT8A 2ZNZA 1J6ZA 4QS7A 3E97A 3LFKA 3DKWA 1NMDA 5HLIA 3IKTA 1L3LA 1PUEE 3VGKA 5LRRA 5HDNA 1U6ZA 4ENJA 3I64A 5DUKA 4WQ5A 3K0LA 1IN6A 4P55A 1XGOA 2IVOA 1KQ8A 4L0ZB 4FWPA 2Q0UA 4IRHA 2PJPA 3VEOA 2ZCWA 1V4RA 3GZ6A 3VGMA 2BEOA 2OZ6A 2R7DA 2KRFA 5LHIA 4PGHA 5HVQC 1GLDG 2A6HF 5AONA 2LF7A 5ED4A 1YW7A 2HDCA 5ILUA 3U2RA 3TKYA 1GLBG 1ZGJA 4A2UA 4UUVA 1PP8F 4B8XA 1ZAOA 2Q0OA 3CUOA 2ZMEB 3R6SA 3CJBA 1E4GT 1KXPA 2Z3YA 2W41A 4BG9A 4L18B 1T38A 2E1NA 1OKJA 3BPVA 3IRQA 5E1XA 1J9IA 1SMTA 3E6MA 2WUSA 1MJBA 2FF4A 2Z5UA 4A0XA 3EYYA 4LK1F 1L0OC 2H6BA 1K8KA 4DCHA 4BRNA 3A5MC 2CW0F 4Y17A 4HX8A 3SJHA 3HUGA 1B9MA 2XGXA 5JLFA 2QWPA 4AVPA 2KJCA 2QWRA 2OQGA 4A5MA 4IHTA 2PEXA 1SD7A 3I33A 4BROA 1QGPA 3F9MA 4I6MB 4BNCA 3MAJA 4HQEA 4FHTA 1ZGAA 4B9QA 5F6FA 2IA0A 3BUZB 1TYQB 3FZFA 3BROA 5FGMA 5E17F 3HIFA 3CHWA 1NGBA 4BR5A 3E6CC 1R1TA 3QB0A 4CGZA 4WWCA 4BGBA 1ON1A 3KHYA 4K41A 4H0TB 1FOKA 3MEXA 4HX4A 1P6RA 4B1ZA 3VF6A 1XUPO 2D2WA 5D4SA 3B02A 1XD7A 2FNPA 4LG0A 3DXKA 1NBWA 4R1HA 2EFNA 3HHHA 3CJAA 4CZIA 2MH9A 2FE3A 1KYWA 1YFHA 2HYFA 4XBFA 2QWOA 1U78A 3EKUA 2R3SA 5ICCA 5EX5A 1K8KB 1R23A 2FXUA 3K2ZA 3GVAA 3WGIA 4QS9A 3UKRB 5FPNA 4LLLA 3COAC 1HKBA 1FYLA 3CJ7A 2UZKA 4BYYA 1LOTB 3O80A 4RS8A 3TU5A 2NYXA 2UWMA 1HQCA 1D8JA 1LDJA 1BG3A 4EGYA 1PDNC 2GWKA 1GVJA 2ADUA 2JSCA 2KIUA 3QMLA 1X9JA 1TBXA 4BR0A 5HLHA 1YXQA 3O3KA 3A5NC 4KMUX 5L3FA 3U4LA 2G7HA 4K25A 2FRHA 3VEWA 4YIIA 2AS5F 2STTA 2QBYB 1GLJO 5DUIA 1BA1A 4EM2A 1HW2A 4FOIA 2VN2A 4XRFA 3FWEA 1AOYA 1YW9A 1B59A 1MJ9A 3V8LA 5K1YA 4XSZF 4UV8A 1HKQA 2MBFA 2HGCA 2VODA 1FLIA 1VTNC 1DPUA 5CVRA 1R59O 5ILSA 3IWZA 4GNIA 2P9NB 2V9VA 2HKOA 5L3DA 3LWFA 3ISPA 5E8IA 4BRAA 4B1WB 3BDDA 3CUQA 2L4MA 5FPMA 3R0JA 4NQWA 5ICGA 2XROA 4N9HA 1C0GA 4OIOF 4MLEA 2O03A 1S7AA 2FSJA 3F3XA 4RB1A 4KIFA 3F8FA 1YO5C 3Q9VA 5EY4A 2FOKA 4UVAA 2M30A 4H5TA 4G6QA 3V4GA 1BOAA 2P5KA 5FFXA 2CGLA 3BY6A 3A8YA 4KICA 4ZYDA 4G94A 3CUQC 1BI3A 2XAFA 3NRVA 1W7PB 3N97A 2YU3A 1G3WA 1NGDA 5BPLA 5EEHA 3VF2A 3WTSC 3ZMDA 2YX4A 1FBQA 4H5RA 5D6EA 1IN5A 4RGRA 1SZ2A 1WKMA 3LQQA 1OYYA 2P9LA 2V7YA 2FLOA 3NEUA 1U3EM 3T5XA 2KHOA 3O08A 2L3DA 3HSFA 1LVAA 4RB0A 1ZBSA 4RCHA 1Z7UA 4PGGA 4LFUA 1FY7A 3H3ZA 5HLGA 1IXCA 4UVBA 1KA8A 3TO9A 2A40A 4RWTA 2DAOA 4M6XA 5BREA 1IUYA 4IPAA 4XH4A 1KU2A 2STWA 1GHCA 4BH9A 2E1YA 2ASPA 3LA3A 4ON0A 2A6EF 2MLGA 3H3OB 5LRSA 4KNYA 2HR3A 3FR0A 4BQAA 2XV4S 4P9FA 1MWKA 4Z2YA 3I59A 4BRQA 3BZ6A 3OOPA 1KYZA 2FU4A 5BRHA 2YHXA 2GWJA 3VEZA 5IT3A 4GYIA 4CHUA 4JBAA 4LLGF 5AFUH 4EV0A 2COMA 1ZH5A 2L02A 3DQVC 3ZX2A 4KIBA 4ZYHA 3RI4A 1I1GA 4HLXA 5KQ8A 1HW5A 3ZEUA 5AQGA 2VBZA 4I0BA 2VT3A 2QLZA 4H03B 3HBTA 1BIAA 1QZZA 4BVOA 4L5JA 2XAJA 4U88A 1OYWA 3C7NA 3GW2A 4I2OA 1P8ZA 1RNLA 4L3QA 2HEOA 2JRTA 3K1MA 2UXNA 3O1BA 1KAZA 3BWGA 2A42A 4WX9A 1J5YA 4EHTA 1U5TC 2YHWA 3A5LC 3VEVA 4GYGA 1YAGA 2EFQA 1T6CA 3BF3A 4XH5A 5DCFA 3SZTA 1SFUA 1MDMA 3VODA 4HAMA 4G7OF 3GG4A 3K1PA 1RUNA 2O0YA 2X4HA 2M45A 2DU9A 3ZMSA 3K69A 2OBPA 3GZ5A 5LJWA 5DD8A 3FMRA 3WU1B 1QZ5A 3C0BA 1DEJA 1RDWX 3DXMB 1HSTA 4HDUA 2FBIA 1BO5O 2DQLA 5BPDA 4TV7A 4IVNA 1G99A 4XSXF 1NGJA 1QHAA 1TNTA 1LDKB 2CG4A 4OMYA 3ENHA 4EJWA 3LQRA 4WQ4A 1NGIA 2A41A 2BV6A 3IC7A 4M9SA 2HFHA 2ESNA 1Z6RA 1DP7P 1U6GA 1YS6A 1FBSA 4XEIA 3M6GA 4DQ8A 5FPEA 3VOEA 4ZH4F 2J5PA 1T44A 2RVCA 5J8FA 4ISFA 2PBIA 2DK8A 4EQQA 5LJVA 3P9CA 2E2PA 4B1UB 5AZJA 2QQAA 3GYHX 3V7SA 2WTEA 4O3MA 2VBYA 3C18A 4H0YB 2F5FA 2DI3A 4CJ7A 3QOPA 4YIFA 3KEQA 1XCVA 3LDNA 1R5GA 3L6QA 3FMSA 4AIJA 5CVVA 1NGEA 4KT5C 2E1ZA 3LM9A 1FX7A 5D5XB 3FZKA 3KLNA 1ZC6A 1NGHA 2Q2RA 1CF7A 5EOYA 3ZN0A 1USTA 5D5UB 4EFHA 3CJ9A 4C23A 2X0LA 2QWLA 2A68F 1X3UA 3ZETA 3H92A 2IPQX 3O6WA 5L3CA 2EK5A 1D3YA 1BWFO 1C0WA 3ZX3A 3HRUA 2PMHA 3ULQB 3MN5A 2FQ3A 3FZLA 2E2QA 3EQLF 4BGAA 1HKCA 1O57A 4IF4A 5ERIA 4DNCA 2V1DA 2NRHA 1DGKN 1X3MA 5A2QZ 4ISEA 4HV6A 1REPC 2ESHA 1JXSA 3U1DA 3WTYC 3M3ZA 3M8EA 1BI0A 4YFXF 4FOEA 3FM5A 1EH7A 3A0IX 4G7ZF 5FB2A 3CQYA 5CVJA 3OHRA 4BR2A 4CZJA 4XLNF 3BJAA 5CJ9A 2IJLA 3CI5A 4FPAA 1BJAA 3PQKA 4P5OA 2MH2A 5JHUA 4FWRA 4EM0B 2OANA 3L7WA 4MO4A 3KFWX 3MN7A 4MLHA 4MQVA 2K27A 1W5SA 2GAUA 2VBXA 4BC4A 4CICA 1T6DA 3LDPA 1BN5A 4Q4ZF 3WODF 3KP7A 1U5TA 2QXLA 3J8AA 4KYWA 2EB7A 3RKXA 3KZBA 1UHWA 2E20A 3KZYA 3P9IA 2WWYA 3IFRA 1B9NA 2FF3B 1NGCA 1XSVA 5FLXK 4CYDA 3GLXA 1Z91A 2Q31A 3KE2A 4OOIA 2OD5A 2F2EA 2DPDA 3ELKA 4OIRF 2PFBA 1QQOA 3KP2A 2K4BA 3W6JB 2JPBA 5ADXA 3C1DA 1RUOA 1BA0A 4EHUA 1BC7C 2F5EA 4WK8F 4YG2F 4Y15A 2DQRA 1I27A 2G7UA 2P8TA 4AM7A 3QU6A 4KBOA 2CO5A 3EYIA 3F8CA 5AFUA 2DT5A 3EZWA 4CBXA 3VEPA 5IT9K 2P9IB 4FSVA 3WXLA 1F1ZA 4Q48A 3KLOA 3SXYA 3SFZA 4HDVA 4O8KA 3DJCA 4GO1A 4BRKA 2ZGYA 4RGSA 4L5IA 3O5BA 4M9XA 2FNAA 1XDUA 1MA9B 5HOOA 4UNOA 1BM9A 1YW8A 2A3SA 3LDLA 2EV6A 4GGGA 4MGRA 5E1ZB 3FZVA 1W7PA 4K42A 3CJNA 2PMUA 1R22A 3E6DA 2F5DA 4D0PA 4EM1A 3ZN1A 2GWRA 1UB9A 3M9AA 1HPMA 4IJAA 3CUQB 5AQTA 3QBXA 4CBUA 3KP5A 1LJ9A 4OIQF 4H0VB 1CGPA 3E5XA 3FF5A 4M73A 2ZWHA 3WTXC 2FMYA 1S3XA 4KDPA 5CVUA 3H3UA 2QWQA 4GCVA 4BVPA 1MZBA 3L0QA 5FLXZ 5BOXA 4ENKA 1ZN2A 1RI7A 3B73A 1I6XA 3F23A 1BI2A 5E8GA 1XC3A 4HW0A 1HKGA 1HX1A 3J80Z 2HF4A 2LNBA 4FPBA 5AZIA 1FSEA 1P4AA 2QM1A 4MHGA 4PKGA 5K5QA 2QBYA 1U2VB 3ML6A 4MQ9F 3GUDA 1ULYA 3AY9A 2ZFWA 5DDGA 3GE1A 3F8BA 3ID8A 4WF2A 2P9SB 1MDUB 4R8HA 1G4DA 2PG4A 2HYGD 2RGVA 3DAWA 4BRHA 2ZMEA 3H1VX 5BR9A 4CZKA 3T0YA 4J8FA 4U0VA 5F0XA 3REOA 2QW9A 3RKYA 2UYTA 4PCQA 1V3FA 3M7GA 4Q5SF 2H09A 1IRFA 2P6SA 5TRDA 1JCGA 1LB2A 4CZMA 3KZZA 1QO0D 3OV8A 4WQ5C 1JHFA 3S41A 4BR7A 3D0SA 2GXBA 1SFXA 3LM2A 4YFKF 3MFKA 4G9YA 4IXCA 3FMQA 3J7AO 2K4JA 3Q9SA 5D6FA 2A5XA 3IDHA 2JTVA 4AWXB 4M72A 2ISZA 1KAXA 1S8NA 1XSXA 4HYEA 3WTTC 3VF4A 4WCGA 1BDGA 3GFLA 2G9WA 2P5LC 1ZXOA 1LDDA 1QPMA 1R36A 1IRGA 2YR2A 3IRRA 2O61A 2J5OA 4ENMA 3CETA 5D5VB 3ZMVA 3CO6C 1K78B 1KU7A 3U9DA 2GA1A 5KPZA 2V7ZA 2VC1A 2ZJ2A 2HTSA 2VYPA 4S04A 1WI9A 1OMIA 2YX7A 3WXKA 1TTYA 5F1RA 4LG0B 4FWKA 3GF2A 2V1UA 5H20A 4HA8A 1UFMA 3KP3A 2QQBA 4DB3A 3ECHA 3QFPA 4I7HA 3BP8A 2RC4A 4LJZF 4LD5A 2FSWA 1B4AA 2D0OA 3FFKB 2P9UA 3ENOA 4HQMA 1P2FA 3RSEB 2YHYA 2BTFA 3MZHA 3R0AA 2L4AA 1TUUA 5AZJB 4M74A 4NHJA 4CDGA 2E8AA 3MZYA 3VEYA 2Y0MA 2P4WA 3GBTA 3M1FA 1ZLKA 1HJOA 4I6MA 1Z05A 5HS7A 3W0LA 1E2XA 4HBLA 1PP7U 2H6CA 2VOPA 2YPRA 4PKIA 3GOIA 1KGSA 3SZPA 4H0EA 3BPXA 3LAPA 4LLNA 2RDPA 1T0FA 4HWIA 3AAQA 1ZG3A 4H0PA 2IVPA 3MCZA 5HS9A 3F6OA 3WTUC 2DBBA 3RSEA 3ZPLA 3ULEA 2XUBA 1GXQA 3SQNA 1YTYA 2FBKA 4HOBA 4N9IA 5B8HA 1T6SA 2HZTA 2ETHA 2K86A 3ZMUA 5DCMB 1DKGD 3JSOA 3PFIA 4RTFD 2BBYA 4A5NA 2GUPA 2NZTA 5CLSA 3C7JA 3J81K 2FEZA 1IN4A 2KKOA 4Q47A 3MMVA 5FD6A 2EJRA 3IKVA 5AR0A 4A6DA 1NGGA 3F8NA 1OYIA 1E4FT 3WU0A 2DTRA 5JICA 2QVOA 5AQJA 5FD5A 1UCRA 1XGNA 4KMFA 3FXUA 3MDQA 3RYRA 3SMSA 1I5ZA 5JFRA 2FF6A 1H1VA 2W84A 2HS5A 2QWMA 3R4KA 4M63C 1TQMA 4A12A 4MTDA 3CO7C 3DV8A 4HF1A 3RTRA 4O5FA 4ZYEA 2EFWA 3O2PE 2CQKA 5AQZA 2O6GE 3E5QA 1HUXA 5BPMA 4FWMA 4BQZA 3HM8A 5HDGA 3TO6A 1QBJA 4JN4A 2Q2EA 3QAHA 3HRMA 4CD1A 1QQIA 2JT1A 3SMPA 2P9KB 1ON2A 1J75A 3AAPA 2AXLA 4JHDB 1ZARA 5TJJA 3CLOA 2R7FA 4HZFA 1NGAA 4JD2A 5AQIA 1IW7F 4IWVA 4BRLA 3F21A 5DYMA 2P7VB 4DHYA 3V8KA 4UVCA 4YFNF 4BR4A 4PKHA 2H27A 5FPDA 1T39A 2A5YB 4MEYF 2A61A 3GO5A 1SD4A 5AQPA 4E70A 4CXFA 4YDUC 4WXCA 1Y0UA 2ISYA 3FHZA 3WE3A 2RKHA 2E1CA 3GFIA 3DXKB 5E26A 3ABUA 3HOSA 1KQ0A 2RN7A 2F9WA 2QWNA 4BRFA 3VGLA 3IHUA 4BHPA 1R1UA 1P4XA 3WTZA 2EV5A 3F8MA 5F64A 3L9FA 1TQIA 1LEAA 1O7LA 3WE2A 4ENNA 3GDQA 3WUHA 3QRFF 1GLAG 4F7ZA 1HXDA 3ATVA 4EAHD 4P96A 3BOQA 5AQLA 5J6XA 5CYVA 2LSOA 4L9NA 1F5TA 3EUHA 1B1BA 2XRNA 5LLQA 1BU6O 2LKPA 3V7CA 1SAZA 3QU3A 4WXHA 4ZYGA 2LDUA 2OU2A 1XCBA 4L9VA 2CH5A 3EETA 3I8BA 4AM6A 3E5UA 1YG2A 3F22A 3DEUA 5BN9A 3WTVC 4L0YB 1R7JA 4Y13A 3D2EB 1H9TA 1JCEA 2PBDA 2D4WA 3WXIA 2FA5A 3UKUB 3G25A 4E1JA 3I4PA 2I7NA 5AQQA 1GXPA 4GXOA 4CBWA 2PAVA 1RZ4A 2FXAA 4I02A 4A6EA 3VB2A 3H3NO 4FWQA 2JZYA 3RPUA 4EJUA 3GWZA 5JVTA 5ELZA 2E7WA 2Q1NA 1G6NA 4RGXA 1J59A 4MNUA 1XGMA 3J81Z 1ZG5A 1OR7A 1E17A 1P92A 2W24A 2XAGA 4UXNA 1D4XA 3DXMA 4JAXA 4DQ2A 5L3EA 2BYVE 1P4WA 3LSTA 2QQ9A 2W85A 2P9KA 1ZRCA 4PZJA 4KFCA 4EIAA 4AIHA 2V52B 2MA3A 2AA4A 2IVMA 1YYVA 5H6RA 2K02A 2QZ8A 2BGCA 1EH8A 2E7XA 3RJPA 1D5VA 3HHGA 3KETA 3KP6A 3QDKA 5LGTA 4JK1X 2V51B 4I09A 2IT0A 2PN6A 1FNNA 1TW2A 3WEEA 2RQPA 3I0TA 1QQNA 3RDIA 3UKRA 1Q1HA 1ZG1A 4U7BA 4IJNA 3HOTA 5BQTA 2Z9OA 2PLYA 1IXRC 4B09A 3TO7A 4CZHA 1FYMA 3ZX0A 4XLPF 3T8TA 3SLCA 2P9SA 3GX4X 1X3NA 2GIVA 2OAZA 2XAQA 1T2KA 1YVNA 4M71A 4LGWA 1G3SA 5DV5A 3FX3A 2YJFA 4YDUA 3D5LA 3FE1A 4Y0WA 3VESA 3EL2A 1R1VA 5H6QA 5BRFA 4MEXF 3VETA 4CO8A 3FGUA 4WQ4C 1NHAA 2P6TA 2W40A 4LB5A 1KU3A 1HKTA 6PAXA 1NM1A 2DW4A 2QWWA 4UV9A 3C3WA 4FO0A 3I71A 1RFQA 1EQYA 5ILVA 2VCPA 1BUPA 5D5WB 3WGHA 3GXOA 3ULEB 1O3QA 5AQFA 1K7AA 3LDOA 4F9OA 1DPRA 4JNEA 5ADXH 1ZREA 1MKMA 2FMLA 1WOQA 2DFIA 1IAWA 4RGUA 3QPHA 1ZRDA 3MWMA 2BE5F 4A62A 2HTJA 5E18F 3CQXA 2Q8KA 3HTVA 2VXZA 3CIPA 2P9PB 5E84A 2NAZA 2DLLA 4IO8A 4A2AA 3WQUA 4M7XA 3E6BA 3JSPA 3L09A 3HSRA 4LMYA 2A07F 2AP1A 3GFMA 1JE8A 1U2WA 2QM3A 3DXJF 1WWXA 4CD3A 1FYKA 2VWBA 2KJBA 3ABTA 2LF8A 3DP7A 2HKXA 1JHHA 4ISGA 2XKOA 1BIBA 1FZPB 3P9KA 1Z9CA 4IXAA 4FX0A 4BHCA 5D8LB 1DUXC 2ITMA 4AD9A 3WG9A 4RB3C 3FM3A 5KK1A 2E2OA 3KEOA 3O4WA 3JTHA 4BREA 1MWMA 2ZGZA 4ESJA 1YLFA 4BHBA 3ZMZA 1KQ9A 5AIQA 2M87A 1IN7A 2VE9A 1QZYA 2P9IA 3VOVA 4G8XA 4BAYA 3KP4A 4EMSA 2Y48A 4A2BA 1LQ1A 1WRJA 1XGSA 3ZP5A 4N0BA 1IG8A 5ICEA 5LGUA 3MK6A 2C6YA 1ZYRF 4OINF 1GLEG 1EH6A 4HTLA 1IF1A 1ATNA 2ACJA 5KVRA 4IRIA 3D2FB 3M8FA 4PDKA 1GLCG 3E3VA 3F72A 3I54A 1WSUA 1JCFA 1BBYA 4HLYA 5DCMA 4XH1A 2YCHA 1D8KA 2OZUA 3RYPA 1ZRFA 2A3ZA 2F5CA 4U0WA 1YQAA 2HMPA 2CGJA 2ASOA 1XDSA 1ODDA 3GEZA 3K9TA 2RNJA 3ZEUB 5AQUA 5BMZA 3ERED 2EFPA 2O3FA 5JMVA 2ELHA 2HQNA 2DO7A 2CYYA 2YI1A 3QPTA 3TDZC 5L3GA 1KU9A 3ATUA 1CZAN 4EGZA 3DPLC 1IJJA 2YJEA 3H1QA 4HX7A 5AQKA 2L54A 3H6EA 4PL7A 5A2QK 5F2RA 3BJOA 1SQKA 3L4IA 3O1WA 4O6JA 2CH6A 3U9GA 3MN6A 1FBUA 3V8JA 2VC0A 3RIRA 3VPZA 3LAJA 3ROUA 1MGTA 5LY3A 1K6OA 3GFJA 1IN8A 5KPRA 4ESFA 4BR9A 3I53A 4S05A 2P9LB 5D8KB 2PQ8A 1Y64A 3LA7A 5HDKA 3H45C 3IUCA 4PL8A 3HZ6A 2GTDA 5DD4A 1NWKA 2CFXA 4I0AA 3DWLA 4AIKA 3CTAA 1TNSA 1Z1DA 4A0ZA 2XAHA 4CZGA 4ASNA 4FL9A 4B1VA 1DDNA 1ATSA 1W4MA 3JTGA 3B8AX 5CE3A 2ZF5O 2M8EA 4L9TA 2H3GX 3HTSB 3CJCA 2M5WA 4RAZA 2Q0RA 1H0MA 3BF1A 3VENA 1S29A 3EO3A 2Q36A 1K78A 2KIMA 3H46O 3L00A 1K79A 4NO7A 2CSOA 4ZZDA 1FT9A 3RPQA 3WEEB 1EV7A 5TKYA 1MD0A 4BRDA 4H0XB 3O6BB 2MLKA 2IA2A 1TUYA 3HTUA 1HW1A 1XMAA 5KPTA 4BRIA 5AQVA 5EVZA 3MQ0A 1W7PD 4WXDA 1I1SA 2MD5A 1RIOH 2A6AA 2DK5A 3FLCO 3AARA 1J0RA 2XHKA 4K43A 1QQMA 2Z99A 3R8EA 1NGFA 3EDPA 2EWNA 1QNTA 3FXQA 4M9ZA 2ZNYA 3P4IA 4A61A 2L01A 2DPNA 2ZKZA 1S22A 2GELA 3U9ZA 3NQOA 1FP1D 1F9NA 2MC3A 5E20A 2A69F 3EN9A 3CJ1A 1JGSA 1MDMB 3WXJA 3JS6A 3HRSA 3KVGA 2IA1A 1OKRA 2CGPA 4BXUA 3PQJA 3AAFA 5LEJA 3W3DA 5BPIA 1TQPA 3BJ6A 3T8RA 4ETSA 2K7LA 2VBWA 2EV0A 4G7HF 4U7DA 1RGIA 4FWNA 4K2EA 5EEGA 3D7EO 2EWSA 1U2VA 3R6MA 1S6LA 3UKUA 4HF0A 5EXWA 1TLHB 2FSNA 5KQDA 1FPQA 3ZMTA 3I58A 2F9TA 5I9EB 3IWFA 5E1WA 1GLLO 1LCUA 5AQOA 4BG8A 2VOOA 4MO5A 4ESBA 2IIRA 2XASA 5JI6A 2VONA 5AQYA 3N4MA 2DPUA 1O3TA 4I98B 2P9PA 1KAYA 3ZETB 5D4RA 4FWSA 3QP6A 4Z94A 3MCPA 2V1XA 3C7NB 4KUMA 5J8CA 1TYQA 1QZ6A 5LGNA 4BC5A 5HS8A 5JR3A 1FP2A 1ATRA 2Z33A 2EA2A 3UE5A 1V4TA 3IL2A 1SMYF 2UXXA 4KA4A 1W5TA 1U8RA 2O8XA 3I5UA 3QP5A 3G3ZA 5F1XA 3V7RA 1SFEA 1T98A 5IT9Z 2IP2A 4EJVA 1XB4A 4H5WA 1XMKA 1SAXA 1FWZA 4P9UA 1HLUA 3VERA 5AQSA 1HBXG 1SD5A 1H9GA 4LB6B 5AQWA 1UHMA 2QUFA 4HF2A 1FC3A 3P7NA 4IHSA 3JXUA 2Q97A 1A04A 4EVIA 4IRGA 4JQFA 5BRDA 3ZQ7A 5AQXA 2QYOA 2Y75A 2GA2A 4QWQA 1HSJA 2JPCA 3HI0A 5BPNA 1XQSC 3WGGA 1STZA 2ZO4A 2H94A 3LDQA 3WQTA 1SD6A 4BC3A 3VEXA 4NB4A 5LBQA 1F4KA 4OU0A 3WT0A 2VT2A 5FO5A 1R58A 4BRPA 4BQLA 2OQRA 2D1KA 1ESVA 5CVIA 2HF3A 4LK0F 4OIPF 2D1HA 1G3TA 5AQRA 3K1NA 2P9NA 3FZMA 3LA2A 4B1XB 4EJTA 3T1BA 2XIGA 4A0YA 3Q5FA 3HSCA 1AWCA 2ZXJA 1O3RA 2V6CA 3WTWC 4M7YA 2ASMA 3CERA 4FX4A 4UHTA 3SK3A 1O7FA 1LEBA 1BC8C 1J2XA 1BI1A 4JHDA 1O3SA 5AQHA 2FSKA 3BEXA 3QFUA 5DEQA 2HOEA 3ECOA 1G3YA 3HRTA 2W25A 3TOBA 3QICA 2D1VA 5AIPA 2OA4A 2EA4A 1XSDA 2GXGA 3A5OC 4MTEA 5FFZA 2NRAC 4HV5A 2EFOA 5AZIB 3U8XA 5AQNA 3TQNA 5LHGA 2IRFG 2WV0A 4CZFA 3L2CA 3UB5A 2IW5A 2HWVA 4ZZLA 2B0LA 3F6VA 2GQQA 2CWEA 3S2WA 3TGNA 1FSHA 1U5TB 2QENA 2VE8A 2WC2A 2M1BA 3FXRA 2J4RA 2E88A
chains in the Genus database with same CATH superfamily
5JLHA 3BR0A 1W0HA 4FWLA 1OCOH 3ERMA 3LMMA 3QYFA 4NB5A 4V2FA 3PSIA 3AL0C 2P5VA 2NRVA 3WG7H 2V26A 3IUOA 1TWGJ 4XKVA 4X1EA 3TDUC 5BS6A 4M6YA 4D7NA 3G73A 1OCRH 1LFUP 1ZHFA 2KIFA 4JK9A 3NAUA 4O5VA 3TOAA 1ASVA 3GTKJ 2I7PA 1Q18A 3VFZA 5K7FA 1KCFA 2NLXA 4E3SA 1Q9YA 4M41A 1ORKA 2KISA 1LE8A 2LYCA 1MNEA 5JLXA 3MN9A 2W57A 2W00A 5K5OA 1MNMC 1R5HA 1TC3C 2KL4A 3K59A 4IOXA 4XRSG 4LC9B 3I59B 1XC5A 2YSRA 3VQBA 5EG0B 1YIOA 1C0FA 4KIGA 1P7JA 4H5VA 3B6OA 2DTZA 2TDXA 4L9JA 4LIUA 3JAMZ 1DU0A 1HDDC 3I4NJ 4FWOA 4CZLA 4IZ9A 2D0PA 1NLVA 3FZHA 5I42A 2O8EA 2E4LA 1A5VA 3D6RA 2HXOA 1W7AA 5L3BA 1HKSA 5LHHA 4CK3A 1IZ1A 4BDZA 1WQ2A 4R79A 3RSNA 3M1EA 3K70D 2L7KA 5BN8A 2VJ4A 3JAMK 4N5SA 2V79A 4MO7A 2XB5A 2XKPA 1HF0A 1IV0A 1LNWA 2P7CB 2KRCA 3DFGA 3SHFA 5E3LA 1YS7A 5HNFA 2JA8J 1OPCA 3DF8A 3W6KB 2PI0A 1TKXA 1WAFA 3H5RA 5IPAA 2CGKA 2VQFK 2OZSA 3PJRA 2OPRA 3A01B 5J3LA 3QBWA 3R60A 2GEMA 2XVCA 5HBMA 4HUGA 2NVXJ 1XHXA 1USSA 4EJOA 1RDCA 5AQMA 4IEIA 2NNYA 4OMZA 2F5VA 1ITYA 4BRGA 4NCBA 1XPXA 5K14A 1X1PA 3DKYA 1BOTO 1VQ4N 2FBHA 3HYIA 3J80K 4QS8A 3IMXA 4BRMA 1U47A 2O8BB 4QIWN 1R00A 3CDHA 4BY7J 3H3VK 1SS6A 3RKWA 2E2NA 4DFPA 2E5LK 3KCCA 4I01A 1WH5A 1QHGA 2XPUA 3B6AA 1KLMA 2PYLA 3JRBA 4CIFA 4WCEL 2OJED 1S6PA 3GTPJ 2VPRA 2LD5A 2ME0A 2YNFA 1RC9A 4BC2A 1IBKK 2BXYA 1CF7B 4KO0A 4LF6K 5LEKA 1D1BA 3OYHA 3JRIA 1RNHA 4B1YB 3K4NA 4WFNL 1S7OA 4DR5K 4KHNA 1YTUA 1J7KA 4H0OA 2NNNA 3K9JA 2HQRA 1S3JA 1ZLJA 4G6DA 4XLAA 2WBNA 4JD2B 3HT3A 3K5MA 1ETXA 2ZE2A 1RPWA 2VKVA 4JKGB 3HSEA 3I8DA 4BRCA 2O4IA 3R9PA 5B3SH 3EE8A 2GZWA 3R61A 4GY2B 2E5NA 5E41A 1V4SA 4CEOA 2K40A 1VQKN 1XG1A 4CZZA 3O8MA 2HVHA 1YUWA 5FKOA 5J2NA 5K5RA 3F5TA 2HHTA 1N75A 2IVNA 3JW4A 1B6AA 4WYBA 3DBLB 1WUAA 4H5NA 2E1MC 3CZ6A 1FIPA 1NOZA 5GAGJ 2HZDA 4FW1A 1MH4A 1DTTA 3EKSA 1Z6TA 2QCOA 4CI6A 1ONVA 2RV8A 2ZBKA 2D5RA 1TW3A 1K61A 2D45A 5IWAK 3GL1A 2G8IA 2LP0A 2CQXA 4KN4X 2PX9A 4U0YA 3RZDJ 2DMUA 4RB2C 3LWMA 3KD5E 2VPLA 2BHYA 1GLFO 3PY8A 1MJAA 1XN7A 4XLHA 3NBPA 4N76A 1IXSB 2BUPA 3LL3A 3N4PA 3LSGA 4RAYA 2HB5A 4XORA 1QSSA 3ZQLA 2NS0A 1UA1A 4KN7X 4B3TK 4CZEA 4QLCU 5ICFA 3D2FA 5HRPA 3DPTA 4FT8A 3PO3J 5HRNA 1LAVA 4M3EA 4NLCA 5LMUK 2ZNZA 2IXSA 5FKKA 4F92B 3E97A 4BXXJ 1J6ZA 4QS7A 3MXMA 3LFKA 1W2BM 3DKWA 1NMDA 4DSFA 4M3UA 3VQ5A 5HLIA 2V9KA 1VQKI 3IKTA 3CMAN 1L3LA 4BGDA 1PUEE 2DT7B 3VGKA 3SCXA 4FJNA 5LRRA 5HDNA 1FTZA 1U6ZA 2JSPA 1L5UA 4ENJA 4IHYA 3SQ0A 5B1BH 4AC0A 3I64A 3J7AY 4DV7K 5DUKA 3OS0A 4WQ5A 3K0LA 1IN6A 3I55I 4P55A 1TWAJ 1XGOA 1KQ8A 2E35A 1VSEA 2IVOA 1U8BA 4KITB 4L0ZB 4FWPA 5HP1A 1C1AA 2Q0UA 3M8SA 4IRHA 2PJPA 1OVYA 2JVHA 3VEOA 3K4LA 1YTAA 4XLCA 1OR7C 2TRTA 2ZCWA 3E01A 1V4RA 3RVCA 3GZ6A 1UG0A 2F8SA 1U45A 3NVMA 3VGMA 5DM7L 4PHTX 1Q82O 1A5XA 4MDBA 2HNYA 2BEOA 1L3VA 2OZ6A 4XK4A 3DLHA 2R7DA 3ULDA 5IP9J 2KRFA 5LHIA 3OYCA 1XX5A 4PGHA 5EYRA 4DBQA 1YT3A 4EATA 1ZGWA 4CEFA 4CJLA 1MMSA 1S1VA 4PY5A 5HVQC 4BQOA 4NUBA 3BY5A 2TCTA 1MMDA 2X6OA 2VKDA 4CERA 1GLDG 2A6HF 5AONA 2LF7A 5ED4A 1YW7A 5KAIC 2HDCA 2BH1A 4B08A 1IBLK 2WBMA 5ILUA 2E88A 1EO1A 4E1NA 3CC4I 4OX9K 4J2BA 3U2RA 3TKYA 4DTNA 4W5NA 1GLBG 1ZGJA 4A2UA 2PFUA 4JKGA 4UUVA 3ASNH 3NWSA 1QVUA 1PP8F 1BL3A 2BE2A 4O44A 3CMYA 1ZAOA 2Q0OA 3CUOA 3R6SA 2ZMEB 4B8XA 2LC2A 1VSDA 3TTFA 3U3GA 4A5BA 3CJBA 3CCQN 1E4GT 3KK7A 1KXPA 3OR2C 5KRTA 2Z3YA 2W41A 3S17J 3HJEA 4BG9A 3LZIA 4L18B 4DR7K 1T38A 2R5YB 2E1NA 3VYSB 4E19A 4XN0A 3BPVA 1OKJA 1Q81O 2EIMH 1K83J 1NMNA 3IRQA 2QKKA 3VQCA 5E1XA 3ZCOA 1J9IA 1SMTA 4HSTA 1SUQA 1WI3A 1TKZA 3E6MA 4W5RA 2O8DA 2WUSA 1MJBA 2FF4A 2Z5UA 4M42A 4GKJK 4A0XA 4DLGA 2UXDK 3EYYA 3LL7A 4CF0A 4LD0A 1D9FA 4LK1F 4CEDA 1L0OC 2H6BA 1K8KA 4CGIA 2ZJPL 5LMNK 4DCHA 1OQYA 2GUIA 4BRNA 3RQIA 3A5MC 3M8RA 2DYRH 3V4IA 2CW0F 4KHPK 5CZ2A 4DR3K 4Y17A 4HX8A 5C15A 3SJHA 3HUGA 3SQ4A 4B3OA 1DT9A 1B9MA 2XGXA 5F0CA 5JLFA 2QWPA 4PJMA 3M8QA 4PJLA 2DA7A 1YVUA 4CIEA 2DT6A 2DDAA 4AVPA 3IKMA 2KJCA 4XM3A 2QWRA 4DSEA 4FZZA 1WJBA 3OYLA 4DU3A 3CFPA 3TAGA 4O0JA 2OQGA 3FXJA 4A5MA 1YJNN 5IY5H 4IHTA 2CUFA 2XPVA 2Z1JA 2PEXA 1SD7A 2HW3A 2CUZA 1RKTA 4Y7NJ 1QGPA 3I33A 4BROA 4OAYA 3F9MA 5HLTA 4D1QA 1IKYA 2R7VA 4BNCA 4I6MB 3PO2J 2Z1GA 3MAJA 3CLQA 4HQEA 1E3OC 2KKZA 1P7IA 4FHTA 2DA5A 2OC6A 1ZGAA 2IGMA 3SBTA 1VRUA 3T1HK 4B9QA 5F6FA 1QQCA 4KAZA 3FISA 2FUG2 2IA0A 2F8TA 3BUZB 1TYQB 3ZSYA 3H1CA 3FZFA 1DQUA 3BROA 3V9ZA 1ZBIA 2GXAA 2XY7A 5FGMA 5E17F 3HIFA 3CHWA 3K4JA 1NGBA 3N4QA 2LSNA 4BR5A 3E6CC 1R1TA 2EILH 4FCYA 3QB0A 3ZQQA 2LFBA 4CGZA 4KI6A 2LH9A 4WWCA 1H88C 3LP1A 4I2PA 4ZC3A 1ON1A 4BGBA 4I9LA 3KHYA 3OSFA 4K41A 1VQ9N 2MSYA 4H0TB 4PQUA 3VPRA 3MEXA 3I56I 1FOKA 3G1LA 1VQPN 4OLAA 1MNDA 4OVLA 1KQSM 3CD6N 3TABA 3IAM2 3OVNA 3GTOJ 4HX4A 1P6RA 4PSWA 3VF6A 4B1ZA 3O9SA 1XUPO 2D2WA 5J1YA 2ICWG 1WCMJ 5D4SA 2JWKA 3B02A 1HDPA 1XD7A 2FNPA 4LG0A 3DXKA 1NBWA 2ATQA 4R1HA 2EFNA 2M7BA 2P51A 1YF5L 2Y2ZA 2YX6A 1RR8C 4AIDA 1XWLA 1WFXA 3HHHA 1YOVB 3OOUA 4HHTA 3CJAA 3OWTA 1I3AA 4CZIA 2MH9A 3ZT3A 1HJRA 3FFIA 2FE3A 1RILA 5LFAA 1KYWA 1YFHA 4KH4A 1V55H 3EYZA 1OH6A 4JI6K 1LV5A 2HYFA 5CY4A 4XBFA 2QWOA 4DKWA 3EUKL 1U78A 1HNVA 3EKUA 3JSMA 1N6QA 2R3SA 3PNTA 5ICCA 4LSLA 5EX5A 1S5JA 1K8KB 1R23A 2HBLA 5TKWA 4JX4A 3K2ZA 3GVAA 3WGIA 2FXUA 1TGOA 2KQ2A 4QS9A 2D5VA 4TSXA 3UKRB 5FPNA 3MXIA 1U49A 4LLLA 2HHHK 3COAC 2NVTJ 4IL6C 3HZJA 2Q1ZB 3HPGA 4CEAA 2O8BA 3TWHA 4XLFA 1HKBA 2XRIA 2F4MB 1FYLA 3CJ7A 5C24A 2QKLB 2UZKA 4CHOA 5GIPA 1WJAA 1TK0A 2BDPA 4BYYA 4O8UA 1LOTB 3O80A 1IG9A 2X78A 1XMXA 4RS8A 4LSNA 3TU5A 2YKMA 2NYXA 4B3RK 4C3JJ 2UWMA 3L8BA 4B3MK 3C2GA 1HQCA 1D8JA 2H8WA 1WSGA 2F4OB 1LDJA 3MECA 3PFYA 4CJTA 4BY9C 1BG3A 5EU7A 3DMJA 4EGYA 1PDNC 1MMAA 4FE4A 2GWKA 5KI6A 3CF5L 1GVJA 4OKJA 1TL8A 2ADUA 3BCBA 2JSCA 3NE6A 3VA3A 5I3UA 2KIUA 3HKZA 1JJ6C 1X9JA 3QMLA 1GOAA 1VQ7N 2R7QA 1TBXA 4IO9L 3ZQGA 3CJTB 1UMQA 4BR0A 4CGJA 5HLHA 1RDUA 1YXQA 2WADA 3O3KA 4GRIA 4PUOA 3A5NC 4KMUX 5L3FA 3U4LA 3OJUA 2G7HA 4K25A 2FRHA 2E2HJ 3E1YA 3OYEA 2L9VA 4W5QA 3VEWA 3TEDA 4YIIA 1G8XA 3FXOA 2AS5F 2STTA 3HVTA 5CZ1A 2QBYB 1GLJO 5DUIA 1BA1A 1NJZA 4EM2A 4BBRJ 1HW2A 4FOIA 2P5GA 3O3GA 2VN2A 4XRFA 1NH3A 3FWEA 1AOYA 3U1KA 3AVCA 4Z4CA 3B6PA 1YW9A 3ITHA 1YI2N 4CCHA 1B59A 3MD2A 1VQ8N 1MJ9A 2LVSA 1HYZA 3V8LA 4A3IJ 3D5SC 5K1YA 4XSZF 4UV8A 3ZSXA 4YY3K 2ZQBA 1HKQA 4ILJA 3TW6A 2MBFA 2HGCA 2QF7A 2VODA 1FLIA 5C12A 4BE1A 1VTNC 4CJRA 1DPUA 5M1KA 5CVRA 1R59O 1AHDP 1LVKA 1IH7A 5ILSA 3IWZA 4GNIA 2P9NB 2M4KA 3TAFA 4KB1A 2W4SA 1LWCA 2V9VA 4LH4A 3ZOBA 2HKOA 5EZHA 5L3DA 4FLTA 3LWFA 4I99C 3ISPA 5E8IA 3CC2I 4BRAA 1ZBHA 4B1WB 3BDDA 3R3LA 3F0CA 3SZ2A 1Z3XA 2B63J 2OTLI 3CUQA 4B4CA 4XONA 4O5BA 4KJZA 3CC2N 2L4MA 3F2KA 5FPMA 2XPWA 5IP7J 2L9RA 5MLCQ 3R0JA 4NQWA 1T8EA 5ICGA 1H89C 4OPKA 2XROA 4N9HA 1C0GA 5C25A 2M4GA 1VQMI 4OIOF 4RDUA 2BANA 4MLEA 1GUUA 2O03A 1S7AA 3I0RA 2FSJA 3F3XA 4A3GJ 3OBWA 4RB1A 4KIFA 4A3BJ 1OCCH 3F8FA 4AQYK 4A57A 1NK0A 1T3VA 1YO5C 3Q9VA 4A3KJ 1R49A 2R7SA 5EY4A 3VQ7A 2FOKA 4CJWA 4UVAA 1B8IA 2M30A 4H5TA 3Q0WA 4Y4RA 4CGGA 3BC8A 3QEVA 4IEEA 1UZCA 3RMBA 1NK6A 4LIVA 4G6QA 3V4GA 1BOAA 2L2OA 4C3IJ 2P5KA 3THYB 4UB6C 1NK2P 4DQQA 2WY8Q 5FFXA 1GT0C 5M5YJ 2KLAA 4CJ3A 4DQSA 2G0EA 2BHZA 2CGLA 3AA5X 5J2PA 3BY6A 3A8YA 3RR8A 4KICA 4ZYDA 1VSKA 4G94A 3CUQC 5FJ8J 4IHVA 4GKKK 1BI3A 1BIZA 3SUNA 3P5JA 2XAFA 3NRVA 1W7PB 3N97A 2CQNA 2YU3A 2XB0X 1G3WA 3W3CA 1NGDA 1LW0A 4QCLA 4BACA 1RBVA 1X4PA 2QTDA 2HU9A 5BPLA 1I3QJ 4B1RA 2CV0A 3THYA 5EEHA 4F4KA 3VF2A 3IAS2 3WTSC 2MGQA 3QERA 4KPYA 3ZMDA 2YX4A 1FBQA 3CCVI 1VAZA 4H5RA 5D6EA 1ZYQA 1IN5A 4RGRA 3ZQHA 1WKMA 3LQQA 1SZ2A 1D0YA 5J1RA 1OYYA 2P9LA 3FKIJ 2V7YA 3LP0A 3SYTA 3HO1A 1TL3A 2FLOA 2HSTA 4AILC 2KQRA 3NEUA 4GMJB 1U3EM 4PK4A 2ELKA 3DM2A 3T5XA 4RBOA 2KHOA 2L3DA 3G1OA 3HSFA 1XS9A 2NNWA 3O08A 1LVAA 4AHCA 3RMDA 1YHQN 4RB0A 1ZBSA 4RCHA 3LAKA 4YOTA 4FASD 3SYZA 5B66C 4HNUA 1Z7UA 2A5WA 4PGGA 3WNEA 4LFUA 1FY7A 3H3ZA 5HLGA 1IXCA 1TWHJ 2VI6A 3CMMA 4UVBA 1KA8A 3TO9A 3FBIB 4NQWB 2A40A 4RWTA 2DAOA 1VHXA 4M6XA 5BREA 1RBSA 1IUYA 4IPAA 4XH4A 1ZK8A 1NJWA 4IHXA 1NNEA 3OY9A 3LPUA 2MABA 1KU2A 5EG0A 2STWA 1GHCA 4BH9A 3E1SA 2E1YA 1HNZK 1K8AO 1LWFA 5KRSA 5FKMA 2ASPA 3LA3A 4ON0A 3LSJA 2A6EF 2MLGA 2VB6A 4ANJA 3H3OB 2CMPA 5LRSA 3J7ZI 4KNYA 2HR3A 2R92J 1J5EK 2HYJA 4QPOA 1Y8QB 3AO2A 3TMOA 3BZKA 3IAYA 2HHVA 3FR0A 4FJ5A 4BQAA 2XV4S 3MVPA 4P9FA 5J47A 1MWKA 4Z2YA 5K7ZA 3I59A 4BRQA 2JK3A 5GADP 3BZ6A 1JL1A 3LP3A 3OOPA 1KYZA 2FU4A 3P83D 1LAWA 5BRHA 4E0DA 4N56A 2YHXA 2GWJA 4LOCA 3VEZA 1Z77A 1GV2A 2ZXWH 1RRJA 4DTSA 4KH6A 5IT3A 2HHQA 3NF9A 3GBGA 2QKMB 1VQ9I 4E7ZA 3KLGA 1D9DA 3OA9A 4GYIA 5KTQA 1XMQK 3TW7A 4CHUA 4JBAA 4LLGF 3LANA 4IX7A 3AVHA 5AFUH 4EV0A 2COMA 3D1NI 2L02A 3DQVC 1ZH5A 5HRSA 3ZX2A 4KIBA 3QWLA 3S9HA 4DR1K 4ZYHA 4PFPA 2CS3A 3RI4A 3HOWJ 1I1GA 2WC9A 4HLXA 3CCLI 1HW5A 2NUBA 2RN2A 5KQ8A 2GV9A 3ZEUA 4J2AA 4LG3A 5GAHJ 2VBZA 2VQLA 5AQGA 3RQ4A 1C0UA 4IFEA 4I0BA 2V6EA 2VT3A 5D3GA 2QLZA 4H03B 3M8JA 1RCHA 3HBTA 3SEQA 1BIAA 1QZZA 4BKXA 3OYFA 4XMYA 2RNGA 4E7JA 4BVOA 4L5JA 2XAJA 4U88A 1OYWA 3LALA 2X6XA 4RAGA 3C7NA 1MBKA 3ZT4A 3GW2A 3BGRA 4I2OA 1P8ZA 1RNLA 4A3EJ 3DLAA 4GDFA 1UELB 2NRTA 3MEEA 3C6HA 4DYQA 1VQ6I 1W5CC 4L3QA 3NH1A 3NHGA 2HEOA 2WAEA 4BY1J 2B6AA 2JRTA 3K1MA 2UXNA 3O1BA 1KAZA 3BWGA 4CHQA 1S5LC 2A42A 5C0YA 3MWPA 4WX9A 1J5YA 2XGCA 4EHTA 3KYDB 3QODA 3L3UA 2LY1A 1U5TC 3TSQA 1Z25A 2YHWA 3A5LC 3VEVA 4DU1A 3OIQA 4GYGA 4BJTA 1YAGA 4QSHA 1MBHA 2EFQA 1T6CA 5J2QA 3BF3A 4LF5K 4XH5A 1G59A 4X64K 3ZQIA 4BE2A 1RTHA 5DCFA 3SZTA 1SFUA 2VWKA 2WFBA 4CJUA 2OA8A 2K9QA 1GDTA 3AO1A 1MDMA 1N33K 3VODA 1NK3P 4HAMA 4S0HB 2FBTA 4G7OF 3GG4A 4E89A 2X74A 3K1PA 1RUNA 2O0YA 2X4HA 3NVKA 3CC7I 2M45A 2DU9A 2HBKA 3ZMSA 3K69A 3TAMA 2RE2A 3KWGA 3G71N 2OBPA 3GZ5A 1IV6A 3AVNA 1R6RA 3A02A 5LJWA 5DD8A 4DSJA 1E3PA 2CUJA 2X9DA 3ESWB 3FMRA 3H0GJ 4IKFA 3CYMA 3WU1B 1QZ5A 5DMRA 4CZCA 3PM1A 3C0BA 3RMCA 5FLXO 3VYTB 3MKWB 4GW6A 4C8LA 3HOYJ 1DEJA 4FTHA 3WNGA 1T08B 1RDWX 3DXMB 1HYSA 1HSTA 4HDUA 2FBIA 1BO5O 2DQLA 4FQGA 4IZZA 1IJWC 4Z4HA 5BPDA 1JTXA 2QA4I 1OH8A 3K6GA 4PJNA 4DS4A 4C2UA 4M3RA 4DTPA 2WAQA 4TV7A 4IVNA 1G99A 4XSXF 5FKNA 1NGJA 1TNTA 1LDKB 2CG4A 4OMYA 1QHAA 3ENHA 3V6DA 4EJWA 3LQRA 3S3OA 4WQ4A 2O8FB 5JHFA 3HJFA 1NGIA 3T3FA 2V7FA 4Z4GA 2A41A 2BV6A 3IC7A 4M9SA 4IG3A 2HFHA 4JKBA 2ESNA 4DWIA 1Z6RA 1DP7P 2VG5A 4IBNA 1U6GA 1YS6A 2EQRA 1HCRA 3ZT0A 4IOAF 1FBSA 4XEIA 3C6UA 2DCEA 3M6GA 4DQ8A 5FPEA 1HNXK 3VOEA 4F3QA 4ZH4F 2J5PA 1POGA 1T44A 4JYKA 4FJLA 3CCLN 2RVCA 1N77A 5J8FA 2E1MB 2D0AA 4ISFA 2PBIA 2EX3A 1M90O 2DK8A 4EQQA 3T7ZA 1XTAA 3OL4A 4C30A 3P9CA 2K9MA 2E2PA 4B1UB 5AZJA 2QQAA 1Z21A 3GYHX 4DMNA 3MAQA 3QQAA 3VWBA 3AO3A 4NDLA 3V9UA 1FOXA 4CESA 2DMPA 4XQFA 4RMNA 3SEZA 1T0FC 2WTEA 3V7SA 3A01A 5M1PA 3OYKA 2Y9YA 4F3OA 4O3MA 2K9LA 2VBYA 4CJEA 3C18A 3LAMA 4H0YB 4LH5A 2F5FA 2DI3A 4CJ7A 5IT9O 2CFOA 3QOPA 3Q7CA 4YIFA 2OCCH 3QEIA 3KEQA 1XCVA 3LDNA 1R5GA 3THXA 2M34A 3Q0UA 3FMSA 3L6QA 4AIJA 2IGOA 5CVVA 1NGEA 5C4XJ 3AVJA 4KT5C 2E1ZA 4NC8A 1ETVA 3LM9A 1VZ0A 2KZGA 2HNDA 3AA3A 1FX7A 5D5XB 3FZKA 3KLNA 3VMFB 2M3AA 3KX2A 4F52A 4OPHA 3SAFA 3TANA 1UHSA 1ZC6A 3EE9A 1NGHA 3CCMI 2Q2RA 1Y39A 2DYSH 2DN0A 3WHBA 1CF7A 4PFOA 1USTA 3OIOA 3ZN0A 5D5UB 3CJ9A 2H8RA 4JKCA 4EFHA 3KJVA 4C23A 1U48A 2X0LA 2I5JA 2QWLA 2YUSA 5C2DA 4DTOA 1LE8B 2A68F 2JUGA 4DSLA 1X3UA 3ZETA 2BZTA 3H92A 2IPQX 3O6WA 4M45A 2QGUA 4CGHA 5L3CA 4O55A 3KLFA 4JRPA 2EK5A 3THVA 1D3YA 1JUSA 1YJWI 1BWFO 2DMQA 5B1AH 2CV1A 3C65A 1C0WA 3ZX3A 3HRUA 2PMHA 1HA8A 1MSEC 1ASWA 3ULQB 2P81A 1MMNA 1RDAA 3DI6A 3MN5A 3NF7A 2FQ3A 2DXIA 3CC7N 4CECA 3FZLA 3I56N 2E2QA 3EQLF 4BGAA 1U4BA 1HKCA 1O57A 1NG7A 3LPTA 4IF4A 5ERIA 1YIJI 1WVRA 2GOMA 3SI6A 1KLNA 2OZMA 4KRFA 4DNCA 3V1OA 5CKTA 4D7MA 2V1DA 2NRHA 2L9NA 1DGKN 3O4QA 3TARA 2BW3A 4M3BA 1X3MA 4IO9F 3KYLA 1F36A 3S8PA 4YOVA 5A2QZ 1ETYA 4HV6A 4Y52J 1REPC 4ISEA 4FZYA 4M3WA 1HC8A 3K4KA 2ESHA 1JXSA 3U1DA 3WTYC 3M3ZA 3M8EA 1O1WA 1T05A 3FIWA 3HPHA 1BI0A 1R4NB 4YFXF 4FOEA 5DS9A 4CEQA 3PV8A 2VL8A 1RTDA 2KRHA 3FM5A 2KTQA 1EH7A 3EEQA 4H4OA 1LPQA 4G9ZA 2HBMA 3NGYA 3A0IX 3VQQA 2WONA 4G7ZF 1HNIA 5FB2A 1WLJA 5CVJA 4ZDOA 3CQYA 3OHRA 4BR2A 5LJVA 2QK9A 4FLZA 4CZJA 3TPQA 3HM5A 4XLNF 5EF6A 1HLVA 3BJAA 3W2AA 3CCJN 4JS4A 1NG9A 2QI2A 5CJ9A 1Z3YA 2IJLA 2WAFA 3CI5A 4FPAA 1RT1A 1BJAA 3PQKA 4P5OA 1XHZA 2DFFA 2MH2A 5JHUA 2BY2A 4FWRA 4EM0B 2OANA 4HVJA 3L7WA 4XOPA 4MO4A 4BJ6C 1RTJA 2VQHA 4E7IA 1VQLI 4KISA 3KFWX 3M07A 3MN7A 2YU9J 4MQVA 4MLHA 2EZHA 2K27A 1W5SA 2GAUA 2VBXA 1APLC 5F04A 4CICA 4BC4A 4AHSA 1NTCA 1VQMN 4FJ9A 1T6DA 2B5JA 3LDPA 3LSHA 4JP0A 1BN5A 2BVLA 4HNVA 4Q4ZF 2O9LA 3HOZJ 4B43A 1NK4A 3WODF 5KGXA 4CCNA 3BG7A 1RTIA 1P90A 3P31A 1GV5A 1JUMA 2K3PA 3KP7A 1U5TA 2QXLA 2X85A 3J8AA 1JLFA 1EA3A 4KYWA 5KHDA 2EB7A 3RKXA 4A3FJ 3TBIA 3KZBA 4F2RA 4FVUA 1UHWA 2E20A 3KZYA 3P9IA 2WWYA 2XRLA 3IFRA 3KZIC 1B9NA 2FF3B 3CM6A 3KLIA 1NGCA 4H8KA 1HNWK 1O4XA 1XSVA 5FLXK 4CYDA 4HUFA 3GLXA 1Z91A 2Q31A 3H08A 3KE2A 4OOIA 4YEJA 1YJWN 4ABZA 4E4HA 2OD5A 2F2EA 2DPDA 3HK2A 3OYJA 4BWMA 3ELKA 4OIRF 2R5ZA 1EJ9A 2PFBA 3UNGC 4AYBN 1QQOA 1J5OA 3KP2A 3G2BA 4JK7A 2K4BA 2DMNA 3W6JB 2JPBA 1ZTRA 3ABMH 1R0AA 3S32A 1RESA 2MYSA 1Z67A 3UIQA 4B9NA 5FDLA 5AJ3K 4A93J 5ADXA 3C1DA 1RUOA 4N4NB 3H36A 2XGEA 4PJ0C 2R7TA 1BA0A 1FXXA 3K9KA 1BC7C 4EHUA 4HUEA 2F5EA 5KGWA 4WK8F 4YG2F 3QYEA 2WY7Q 2LKSA 1NU0A 4XKWA 1QHHD 4CVNE 4E7LA 1W9HA 4Y15A 2DQRA 1IRXA 1I27A 2E36A 3OR1C 3AVMA 5GINA 2G7UA 2P8TA 4AM7A 1SV5A 2F48A 3W2WA 4K8XA 2HHUA 3QU6A 5FLMJ 4KBOA 1VQOI 2CO5A 3EYIA 3F8CA 5AFUA 2DT5A 1VK0A 3EZWA 3VEPA 1RETA 5IT9K 2P9IB 4CBXA 3QEXA 4HCCA 4FSVA 1BL0A 3WXLA 3HP6A 1F1ZA 3PO5A 2F6CA 4Q48A 4BUPA 1JI8A 3KLOA 2R4GA 3IH3A 1YIJN 2EH3A 3HC7A 3SXYA 3SFZA 4HDVA 4O8KA 3DJCA 4GO1A 3RR7A 1WB9A 1IKXA 3PUFA 1B72B 4BRKA 1DTQA 1K6YA 2DMTA 3G4SN 2ZGYA 4RGSA 4LF8K 4L5IA 3O5BA 2DOAA 4M9XA 3LNQA 1I39A 1BI4B 2FNAA 2MFZA 3AG4H 1KRPA 1HR0K 1TWCJ 4XRSA 3L2RA 1TL1A 1S6QA 2VQGA 3ZSOA 1BI4A 1XDUA 3S3NA 1U9OA 1MA9B 5HOOA 5KNLA 4UNOA 1EKEA 1BM9A 1HMVA 5EEAA 2OTJN 1YW8A 3NMUA 2A3SA 3LDLA 1HYVA 4CF9A 2EV6A 2DA1A 1YJ9I 4GGGA 4MGRA 5E1ZB 5EGOB 3FZVA 4CFBA 1W7PA 4K42A 5JVHL 2XY5A 3CJNA 2PMUA 1R22A 4RW6A 1U9NA 3E6DA 4X66K 5J2MA 2F5DA 4D0PA 4EM1A 3ZN1A 2K85A 2OTJI 2GWRA 1UB9A 5B5EC 3M9AA 3S1MJ 1J54A 1HPMA 3MX5A 3LZJA 4L5EA 4IJAA 3CUQB 5DM6L 5AQTA 3AV9A 4MIMA 2IDOA 3QBXA 4CBUA 1B92A 3KP5A 3HL8A 4CSWA 3AVLA 1LJ9A 4JLHA 4OIQF 3MEDA 4H0VB 3JRCA 2JWTA 1CGPA 3E5XA 3FF5A 4M73A 2QKBA 1TZLA 1B8IB 3VQ6A 4JOMA 4CYCB 2ZWHA 3J7ZO 3WTXC 4FM2A 2FMYA 3PLAA 1S3XA 4KTZA 3FHNA 4KDPA 5CVUA 1J53A 2VXDA 4EP5A 4JX5A 5T7BA 3H3UA 3ZGKA 3M3YJ 2QWQA 4Z4IA 4GCVA 4BVPA 1MZBA 3L0QA 2OF7A 5FLXZ 5BOXA 4YNQA 3CCVN 3S15J 2ID3A 2Y1IA 4LFBK 4ENKA 5J1UA 1ZN2A 1RI7A 3B73A 3DKXA 3BG6A 4B47A 1I6XA 3F23A 1BI2A 5E8GA 4YFUA 4J01A 4HW0A 1XC3A 3VQ9A 1HKGA 4ZTJA 5K7HA 1HX1A 4RM2A 3CP2A 3J80Z 2HF4A 2LNBA 4FPBA 5AZIA 1FSEA 1P4AA 2QM1A 2JLEA 2CUEA 4GVEA 5HLFA 1S72N 4MHGA 4PKGA 5K5QA 2QBYA 3ASOH 5E79C 3ML6A 4MQ9F 1QA6A 2EZLA 2IS2A 1U2VB 4UY8O 1BQMA 2HXIA 3CF2A 3GUDA 1ULYA 3AY9A 2G8HA 3KLEA 2L7FP 4PJJA 2ZFWA 3K5NA 1SKWA 2VG6A 5DDGA 1ETKA 1YI2I 3F8BA 3GE1A 3ID8A 3CDIA 2A05A 4JK8A 1H8AC 4WF2A 2P9SB 1LFPA 3KEYA 4PSXA 1FKOA 1MDUB 4DTXA 4R8HA 1G4DA 2PG4A 4AVZA 2Y30A 4GFBA 3VQDA 2HYGD 2JJ7A 2RGVA 2ZXHA 2LMDA 3S1RJ 2ZMEA 3DAWA 3H1VX 3QINA 4BRHA 5BR9A 3OJSA 2K3FA 3T0YA 4CZKA 2KZZA 4J8FA 4BXFA 2JRMA 4U0VA 5F0XA 3REOA 2FJ1A 1E3HA 2DA4A 2QW9A 5F27A 3RKYA 4W5TA 2UYTA 4H4KC 1PJRA 4C3HJ 4IFYA 4M3YA 1BJZA 4PCQA 1V3FA 4JS5A 3M7GA 4Q5SF 1S1WA 4JI0K 3DLGA 2H09A 1IRFA 3V1QA 1MBGA 2LTPA 1Y1VJ 2P6SA 5TRDA 1GOBA 2LBFA 1JCGA 1MU2A 3EZ5A 2AQEA 1LB2A 4CZMA 3KZZA 4K0KK 3M1CA 4CHYA 1QO0D 1QZEA 3O4NA 1S9HA 4CGFA 4FJMA 1SVLA 1WSEA 3Q7BA 1SANA 3FXLA 3OV8A 4WQ5C 3CCSI 2HVIA 1NK7A 3ZLJA 1JHFA 3S41A 4BR7A 1RBTA 4WFBL 3D0SA 4DR2K 2GXBA 4C8OA 2D0CA 1DGWY 3VTIA 1N32K 2M8GX 3FBNB 3HG9A 3JAMO 1SFXA 3CMAI 3PX6A 2OUMA 4B44A 1C0TA 3ZQFA 1RDBA 3L4QA 2XSDC 1J9AA 4YFKF 2JQ7A 4UUSB 4G9YA 3MFKA 2Z1HA 3LM2A 3O9QA 3ASMA 4IXCA 3FMQA 3J7AO 2K4JA 3BTJA 3Q9SA 2VG7A 3C94A 5D6FA 1C1CA 2A5XA 4KHUA 3IDHA 2JTVA 4AWXB 1ZBFA 3LWLA 4M72A 3SAGA 2ISZA 2CJJA 1S8NA 1XSXA 1KAXA 4HYEA 2R7UA 3WTTC 3VF4A 4CJVA 3BG9A 4C2TA 4WCGA 1MBJA 3S93A 1BDGA 4NCAA 3GFLA 2COBA 1VQ6N 2G9WA 4CIGA 5EDNA 1JLBA 4FJGA 1WJDA 2Y31A 4ZHRA 2P5LC 2EIKH 1ZXOA 4FISA 1LDDA 5FROA 4ELVA 1QPMA 1R36A 2ZJPF 2YR2A 1IRGA 3NFAA 1IDYA 3IRRA 4JI1K 2O61A 2J5OA 4ENMA 3CETA 3DRRA 1DP3A 1OCPA 3ZMVA 5D5VB 3CO6C 1JKPC 1K78B 1KU7A 3G10A 3U9DA 1NOYA 3NARA 1SFKA 1B9FA 4KHWA 4FK4A 2GA1A 5KPZA 1X1BA 2V7ZA 3LSIA 2VC1A 2ZJ2A 2HTSA 1SFOJ 4S04A 1VQ7I 2VYPA 4CUGA 4Z4EA 1X1AA 3NWTA 3TSUA 3WNHA 3WHCA 4CFDA 2PZSA 4KTWA 1JUPA 5HRRA 1WI9A 1OMIA 3AKZA 1A6QA 2YX7A 4OWRB 2CW8A 1TTYA 2VUMJ 3WXKA 5F1RA 3OYAA 4LG0B 4FWKA 4LFAK 4AH9A 3GF2A 3SDGA 2V1UA 3CQ8A 4DYCA 2JMWA 5H20A 3E9OA 1DU6A 4YOXA 4HA8A 1UFMA 3KP3A 3LDSA 2KFZA 2Z16A 4DFJA 4JKDA 2QQBA 3HL2A 4DSKA 2OPPA 4DB3A 4A3JJ 4IG0A 3ECHA 4AHVA 3ZRGA 4I7HA 3BP8A 3QFPA 2BY3A 2RC4A 4LJZF 1VSFA 4LD5A 4DV6K 2FSWA 4DQIA 1B4AA 2D0OA 3FFKB 5HROA 2Y0SA 1TT0A 4CJSA 3PX4A 2R7RA 4XR6A 1S9GA 2L9SA 4HQMA 2P9UA 1P2FA 1CQTA 3ENOA 3RSEB 2ITGA 4YOYA 2O8CA 4P1WA 3RWUA 3LFUA 4F8RA 3BR1A 1Q8IA 4JI5K 2HHWA 2YHYA 3CCMN 2BTFA 1V54H 3MZHA 3PSFA 2NVQJ 1UAXA 2D0BA 3R0AA 2L4AA 3H5NA 3K2AA 3GTLJ 1TUUA 1SC7A 4B48A 5AZJB 4BREA 1SL0A 3RRGA 4M74A 3KK3A 4NHJA 4CDGA 2PJRB 2E8AA 3MZYA 3K57A 4Y1CA 3VEYA 2Y0MA 3CPEA 4XN3A 3AVKA 2P4WA 2A1SA 2VLAA 3GBTA 4QPQA 3I0SA 3DLLL 3M1FA 1FIAA 1ZLKA 1HJOA 2NRZA 4IHWA 4I6MA 1Z05A 4C1NK 1HQEA 2QEXI 5HS7A 3CG7A 3W0LA 3BR2A 5M1FA 1JTYA 1X58A 1YHQI 4FLWA 1E2XA 4HBLA 1PP7U 4I76A 2DA3A 2H6CA 1FMVA 2EIJH 2YPRA 2VOPA 4PKIA 2G8FA 2G8VA 3GOIA 3A03A 1KGSA 3SZPA 3VSKA 1TWFJ 4H0EA 3BPXA 3LAPA 2EINH 3A0HC 5H1SQ 4LLNA 4JI3K 4BL0B 2RDPA 3Q3SA 1T0FA 4HWIA 4CCKA 1RT5A 5GPCA 3AAQA 3HKZN 5EGOA 1VI0A 1ZG3A 4H0PA 2IVPA 1YITI 3MCZA 5HS9A 3K58A 3F6OA 3PL8A 4ELTA 3WTUC 3ID6A 2DBBA 3E9LA 4FJJA 1BISA 3RSEA 3ZPLA 3S1QJ 1QVGM 3ULEA 5E3OA 2XUBA 3OYIA 1A6IA 1GXQA 3THXB 2CRGA 5C3EJ 3DLRA 3SQNA 1YTYA 1ACIA 2FBKA 4U67L 2K9SA 4KI4A 4HOBA 4N9IA 4CW7B 2R7XA 4AM3A 4KB0A 1TAUA 3TI0A 5B8HA 1T6SA 1T8IA 2M7AA 2DOFA 3VSLA 4YRVA 4OAZA 2HZTA 2ETHA 5JLWA 4XKBA 2LY9A 4BS9A 3HEFA 2K86A 3ZMUA 5DCMB 2YHAA 1DKGD 3JSOA 3PFIA 4RTFD 4YHHK 2BBYA 4A5NA 2GUPA 2NZTA 3ZT2A 5CLSA 2HDDA 4XLEA 3CC4N 3C7JA 4FJIA 1L3UA 3J81K 4NBQA 2FEZA 2DDBA 1WGXA 2CW7A 1IN4A 2KKOA 4JKEA 2YV0X 4Q47A 4OGEA 4CHPA 3SFIA 4DF4A 3DEEA 3MMVA 5FD6A 1TAQA 2EJRA 4GVMA 4DV1K 2VKEA 1RBUA 3V42A 5GTIC 5GAEP 4FJKA 3IKVA 4F2SA 4K8ZA 5AR0A 3BCAA 1JKOC 1V5EA 3AGKA 4A6DA 3LSKA 1ETWA 1NGGA 1Y0NA 2I10A 3F8NA 1OYIA 4CEEA 4F3TA 2UV1A 3SAHA 1E4FT 3WU0A 2DTRA 3CPWM 3AG3H 4X0GA 3RTVA 3DTEA 5JICA 2QVOA 2O8DB 4JI4K 2AO9A 3A4CA 2NRXA 5AQJA 5FD5A 1UCRA 4ELUA 1XGNA 1KVCA 4KMFA 1I94K 3FXUA 1ZBLA 3MDQA 3RYRA 1FJGK 2CU7A 2ZMEC 1I5ZA 1WPKA 5JFRA 1H1VA 2FF6A 3SMSA 2W84A 3NH0A 4FJ7A 4FK0A 2HS5A 2QWMA 1FEXA 2HNZA 2E2IJ 3R4KA 1LFBA 3JRDA 3L2VA 2FD5A 1ZBUA 2RF2A 3G1MA 3QLHA 4M63C 1TQMA 2IAIA 4Y33A 5M5WJ 3ZQCA 2VGNA 4A12A 4MTDA 4UQGA 1T03A 1KFSA 3CO7C 1P9QC 3DV8A 4HF1A 3RTRA 1T7PA 4O5FA 4ZYEA 2GBZA 2EFWA 1FK9A 3O2PE 3I9V2 2CQKA 3AA2A 3BR3A 5AQZA 4O4GA 2O6GE 3E5QA 3S16J 2XSJC 1HUXA 3ZCMA 4JEPA 4CJQA 5BPMA 2QEXN 2ECCA 4FWMA 2OYQA 4OO1J 4BQZA 3HM8A 5HDGA 3TO6A 3J7YJ 1QBJA 2HVSA 3MXJA 4JN4A 5IYCJ 4DTUA 2UXBK 2Q2EA 3QAHA 2E1OA 3HRMA 4CD1A 2ZFUA 1QQIA 2JT1A 3SMPA 1WH7A 2P9KB 3Q0VA 3C95A 2ZC2A 1X19A 1W0UA 1S9EA 1ON2A 1J75A 2BXZA 3AAPA 3H5AA 2IAJA 2E6LA 4FW2A 2AXLA 2DA6A 5E3NA 4JHDB 1ZARA 3OIPA 2HQAA 5TJJA 3CLOA 2R7FA 4HZFA 3K7AJ 1NGAA 4JD2A 4OPJA 5AQIA 2PMZA 3QNNA 4GV3A 3DWLE 3OS1A 1OCTC 4DW6A 1IW7F 2BOLA 2F4VK 4YOUA 4IWVA 4BRLA 2ETJA 3GTGJ 3F21A 5DYMA 2P7VB 1JLQA 3V8KA 1JXBA 4UVCA 2LOOA 1REVA 2Z1IA 3DYAA 4KV8A 4DHYA 1SL1A 5J40A 4YFNF 4BR4A 2X6NA 3IS9A 4PKHA 4HNTA 2H27A 3ZYYX 5FPDA 1T39A 4G1QA 2A5YB 4MEYF 2A61A 4NC7A 2Y69H 3GO5A 3K70C 2E60A 3ZR8X 4I2QA 2OPTA 3M5RA 1D1AA 3EPZA 1SD4A 2KFDA 4DYRA 1UAAA 5AQPA 4E70A 4CXFA 3S3MA 4DGWB 4BBSJ 4WXCA 1Y0UA 1Y6IA 3G6EI 4YDUC 2ISYA 3JR9A 3WE3A 3FHZA 4E1MA 2HI3A 3K10A 3OL3A 3HOXJ 1D0ZA 2RKHA 2E1CA 1R9TJ 3GFIA 5BR8K 2BGGA 3DTKA 1LUJB 3DXKB 2JN6A 3ZSZA 5E26A 2CV2A 2AJQA 2O4GA 3ABUA 1AA7A 3HOSA 1KQ0A 2RN7A 2W7NA 3GTMJ 2F9WA 2QWNA 3QIPA 4BRFA 3VGLA 3AGRA 3IHUA 3L2UA 3AVAA 1PUFB 2XY8A 3OBYA 5CHIA 2W1OA 2JGUA 2OPSA 4BHPA 3CCUN 2P5OA 1K4SA 1R1UA 1P4XA 3WTZA 2EV5A 1FMWA 1VQNI 3F8MA 5F64A 3U21A 3L9FA 4MQ3A 4X62K 4FM0A 1TQIA 1D5YA 1LEAA 1O7LA 3HB9A 3WE2A 3FXMA 1WJ5A 2LKXA 3O9TA 4ENNA 3GDQA 3FKJA 3CJRB 3DBHB 3OYNA 4RLFA 4YORA 4FXDA 4DTJA 4ILGB 3WUHA 2VQCA 4DFKA 4RA2A 3QRFF 1D8YA 2UXCK 1GLAG 4F7ZA 1VQ5I 1HXDA 3VDXA 3ATVA 2KZVA 4EAHD 4P96A 4B9VA 3BOQA 3SBGA 5AQLA 2KMUA 1T33A 5CYVA 5J6XA 4HTUA 1UWBA 2LSOA 1WSIA 3SNNA 4RG8A 4L9NA 1F5TA 1CZBA 1RT7A 4FE7A 4DV2K 2HPIA 3G71I 2OCEA 3QESA 3KD1E 3EUHA 1B1BA 2XRNA 4V19K 5CYMA 5LLQA 1VQPI 3VTHA 2W82A 1BU6O 3AO5A 2LKPA 2DFEA 4FLYA 1FTTA 3V7CA 1SAZA 3QPSA 3QU3A 4WXHA 2WB1A 4ZYGA 2LDUA 2OU2A 4AU7A 4CFAA 1XCBA 2YNIA 4L9VA 2PMZN 4NYNA 2NS8A 5EZGA 3MMYB 2CH5A 2KIQA 3EETA 3I8BA 4EZ9A 3KK1A 1MW7A 3F9KA 3K4MA 4XRMA 2RREA 3VQPA 4AM6A 3E5UA 1YG2A 4Q5VA 2V9PA 4ZDPA 3F22A 4KTQA 3DEUA 5JS1A 5BN9A 2WTUA 1PVEA 3WTVC 4L0YB 1N78A 1R7JA 4Y13A 3CCQI 2NXNB 3D2EB 1EX4A 1D1CA 1SVOA 1H9TA 3PX0A 2X48A 2YS9A 1JCEA 1QE1A 2D4WA 2PBDA 2FA5A 1C1BA 3WXIA 4FLXA 3UKUB 3THWB 1FW6A 1IG7A 1KSPA 4FYDA 1B72A 2EPFA 5GADJ 1JLEA 3IRXA 4CGDA 4DV4K 3G25A 4JX6A 4E1JA 4B9TA 3I4PA 5F1JA 3C2BA 4X65K 1ETOA 2I7NA 5AQQA 1GXPA 4XIDA 4GXOA 4CK1A 4CA0A 4CBWA 2PAVA 2G8WA 4B3SK 1IC8A 5BNGA 5GPAA 3PNVA 1RZ4A 3AVBA 3SJJA 2FXAA 4I02A 3TP0A 1KVBA 1MBFA 2FX0A 4A6EA 2B4JA 2LLKA 4EZ6A 3VB2A 5GP9A 3H3NO 2MD0A 4FWQA 2JZYA 3RPUA 2V1NA 3GWZA 3DU5A 4EJUA 5JVTA 4E7KA 2LBFB 5ELZA 2XY6A 4FETA 5GAHP 2E7WA 4FK2A 1W1WE 1VNDA 2Q1NA 1G6NA 2X6YA 1BR4A 4RGXA 3H0DA 4CEBA 1I50J 2EZKA 3AL0B 1SAUA 2IBDA 2L7MP 1J59A 1ENHA 4MNUA 1CXQA 2NRWA 3TTDA 1M1KO 2PYJA 1XGMA 2ZXIA 3OTOK 3J81Z 1ZG5A 2HBJA 1OR7A 3CQZJ 2XC7A 1E17A 1P92A 3K5LA 4DZPA 4B9MA 2W24A 2XAGA 1ETQA 4UXNA 1D4XA 3DXMA 3EUAA 4C8NA 4JAXA 4A59A 3NGZA 4DQ2A 3ZSRA 5L3EA 2BYVE 3BR6A 2IS6A 1Z0XA 1ITGA 3AFHA 1P4WA 2MC4A 3LSTA 3TL4X 2QQ9A 2W85A 3VYUB 3HDDA 1JGGA 2P9KA 5SWMA 1ZRCA 4PZJA 4KFCA 4BQNA 1X1CA 2XF6A 2EHGA 4EIAA 4DV5K 2M0MA 1EETA 1WSHA 4AIHA 4MDAA 2UUZA 2QXFA 2V52B 1VQ5N 2MA3A 2AA4A 2IVMA 4MLOA 1YYVA 2VASA 4XICA 3JYTA 3TAPA 4A3DJ 5F0FA 3HP9A 2F4IA 5H6RA 2K02A 2QZ8A 2BGCA 1ASUA 1EH8A 2E7XA 3RJPA 1D5VA 4JKFA 3HHGA 3PIOF 3KETA 2GX9A 2XDVA 4NC6A 3KP6A 4DR6K 3QDKA 2GOXB 5LGTA 1SEUA 4DTMA 1YJ9N 4JK1X 1XI1A 4LF4K 4B3XA 3AVGA 2HHXA 4RW4A 4Y3OA 1N34K 4W5OA 4DTRA 2V51B 1MBEA 1A35A 2ZM6K 4I09A 5IYDJ 3F73A 3CCEI 2IT0A 4KREA 3MZ8A 2PN6A 1O13A 1FNNA 4OPAA 2B7EA 1TW2A 2F96A 2XHBA 3WEEA 1KC8O 2RQPA 3I0TA 3A2KA 3KWIA 4I9QA 1M1EB 1QQNA 3RDIA 3UKRA 4B9LA 5GIOA 3QOEA 1Q1HA 1ZG1A 1ZR4A 4U7BA 4IJNA 3HOTA 3NF6A 3TSPA 5BQTA 2NS7A 4DQRA 2Z9OA 2IS1A 4FJ8A 4XOTA 2RPIA 3BDPA 2PLYA 1IXRC 3S1NJ 1JL2A 3OYDA 5GAGP 4NCGA 4B3AA 4B09A 3TO7A 2PY5A 4JYAK 2MW8A 1Y97A 4CZHA 4DR4K 1X9SA 3C6TA 2W6LA 1FYMA 3T69A 5IOZA 1G15A 3ISNC 4XLPF 3T8TA 1UJ8A 3SLCA 3ZX0A 2P9SA 2BW3B 3GX4X 3O3FA 1VQON 1XMOK 2LG4A 3IH2A 4CCLA 1X3NA 3MEGA 3JREA 2GIVA 2OAZA 2XAQA 1WJCA 1T2KA 4M3XA 3QPLA 4QTRA 1YVNA 4M71A 4R5PA 4LGWA 1G3SA 5DV5A 3FX3A 1IKVA 2YJFA 4M3ZA 4YDUA 3D5LA 4F55A 3C6AA 4MFEA 2M0CA 1FJLA 4A3LJ 3FE1A 4Y0WA 4V19S 2R93J 2WOMA 3FK6A 1BR1A 3OYMA 3EL2A 3VESA 1R1VA 4KT6A 1W0TA 5H6QA 3HOUJ 1IUFA 5BRFA 5J1EA 1Q1VA 3HPOA 4IQ4A 1YRNB 1LKXA 4MEXF 1V5GA 1Z7LA 5C2FA 4DUZK 3VETA 4D5CA 1TVRA 3VQAA 4CO8A 3FGUA 4WQ4C 1NHAA 4UUTA 4ZJZA 2P6TA 5FRMA 1B9DA 2QSHX 3IV5A 1KU3A 4LB5A 3CF5F 1HKTA 2W40A 1X9MA 2GM4A 6PAXA 1NM1A 1S1TA 1NJYA 2DW4A 2QWWA 1LWEA 1IBMK 4M3GA 4M3TA 4DG1A 3EUHC 2VIXA 4UV9A 3BG3A 5CQEA 1S1XA 4DQPA 1YX3A 5TISC 3MX2A 3OW2M 5H2FC 3C3WA 1SKRA 1MMGA 4AHTA 2ZSHB 3CD6I 4FO0A 1WBDA 3I71A 1RFQA 4C9YA 2RKIA 1ERDA 5CYQA 4II2A 1EQYA 5ILVA 2WB1N 1JKRC 2VCPA 3MKZA 4WE1A 4B8AB 3CCRN 5JVGL 1BUPA 5D5WB 1SKSA 3ONQA 4CJFA 3WGHA 2PJRA 1BIUA 3D5RC 3A1YA 4CF2A 3GXOA 3ULEB 1O3QA 3ZSVA 5AQFA 1K7AA 3LDOA 4QOZB 2Q3SA 1Q9XA 4F9OA 3I3LA 1DPRA 4JNEA 4XNFA 5ADXH 5DM6F 1ZREA 2XF7A 3IP4B 5M3FJ 1MKMA 1QU3A 2FMLA 4J2EA 3DLEA 4Z0UA 1VQLN 3NF8A 1WOQA 3KPHA 2BY0A 2R7WA 2G8KA 2DFIA 3HGGA 1A36A 1HQUA 1IAWA 4NLBA 3M4OJ 4IOCL 1N36K 4Z4FA 2DY4A 3QIOA 2VJIA 3QPHA 3MWMA 4RGUA 2BE5F 1ZRDA 4ICLA 4A62A 2HTJA 5E18F 4RW9A 3CQXA 3K4BA 2G8UA 2Q8KA 3HTVA 4CYCA 2VXZA 3HXMA 2ID6A 4FZXC 3CIPA 1U04A 2LR8A 2P9PB 5E84A 2NAZA 2DLLA 1YJNI 1BOBA 3RKQA 4HG2A 5CR4A 4C1NI 4WFAL 2KHMA 3HXLA 2E5ZA 4IO8A 3V1RA 3WQUA 4A2AA 1KD1O 4BU2A 4M7XA 3E6BA 4DBRA 3JSPA 2YNGA 1BCMA 3L09A 2YKNA 3HSRA 4LMYA 4D9JA 4EEFG 5M5XJ 2W6KA 2OV7A 4GV6A 3J7YP 4CCOA 3HOVJ 3S14J 3M8PA 2A07F 2AP1A 3DCFA 4I6ZA 3GFMA 1JE8A 3A2FA 5EOYA 4LF7K 3T1AA 1U2WA 2KPMA 4ILHA 4PA1A 2QM3A 3DLKA 4BWJA 4KKOA 4A5AA 3DXJF 1WWXA 3H35A 4CD3A 5M1NA 3LSMA 1FYKA 2KJBA 2VWBA 1YITN 3ABTA 2ELJA 2LF8A 3DP7A 2HKXA 1JHHA 1QVFM 5HL7L 4ISGA 4BDPA 2XKOA 3O9RA 3J7AP 3BG5A 3DRPA 1BIBA 3SV3A 1FZPB 3FDYA 3P9KA 1Z9CA 1PUFA 3CFOA 2DOEA 4FLUA 4IXAA 4FX0A 4BHCA 1X2MA 5D8LB 2HHSA 3CM5A 1KFDA 1DUXC 2ITMA 1W97L 4AD9A 2LREA 4DV3K 3WG9A 2CQQA 3DOKA 4RB3C 3FM3A 2NOJB 5KK1A 3KEOA 2JA7J 3JTHA 2E2OA 2KDZA 1MWMA 2ZGZA 1WZ2A 3O4WA 4KFBA 4DUYK 3TAQA 3QYBA 3CESA 4HCBA 4ESJA 1YLFA 4BHBA 3ZMZA 1KQ9A 5AIQA 4M6VA 4IDHA 2KZMA 3PIPL 3BZCA 3ALYA 1HPZA 2JVGA 4FJHA 2M87A 2VQEK 1IN7A 2VE9A 1QZYA 2L5QA 2P9IA 2P1JA 4G8XA 4BAYA 4RAFA 1RT4A 4QAGA 3VOVA 2BY1A 1BR2A 3KP4A 4EMSA 2Y48A 1VSLA 1ZR2A 2X6SA 1JKQC 4NYFA 3CJQB 4E6KG 3TR8A 4A2BA 1LQ1A 1WRJA 1XGSA 2HQ5A 1S1UA 2DFHA 1RR7A 3ZP5A 2DODA 2FBXA 3WNFA 2EBIA 2HPMA 4N0BA 3E7LA 1IG8A 1EWRA 4FM1A 2ZB9A 4IDKA 3CMEN 4II3A 4JI8K 1T56A 5ICEA 4IOAL 1R5ID 3EY1A 5LGUA 1CXUA 3NDKA 1OLTA 1K4TA 2VJJA 2C6YA 3MK6A 1ZYRF 4OINF 1KONA 2I8DA 1GLEG 1EH6A 4HTLA 1IF1A 1ATNA 2ACJA 1JXEA 3QEPA 5KVRA 4IRIA 2X1EA 1FOWA 3D2FB 1A31A 5FLVA 3G4SI 3M8FA 4PDKA 1GLCG 3E3VA 5DK5A 2UUCK 3T1YK 3F72A 3I54A 3N05A 3IH4A 5FKLA 1WSUA 1NK8A 1QSYA 1K9MO 1JCFA 3LP2A 4RW8A 2XO7A 1KVAA 1BBYA 3V9SA 4HLYA 5DCMA 4E7SA 3HSTB 2O7OA 4XH1A 2Q2EB 3QEWA 1YX5A 2YCHA 2YNHA 1Q86O 1Y56A 1D8KA 2OZUA 3RYPA 1ZRFA 1F43A 2WV1A 2A3ZA 1QSLA 1UG2A 2F5CA 3CDLA 3JCUC 4U0WA 1YQAA 2HMPA 2IC3A 3SV4A 1AU7A 3SDBA 2ASOA 2CGJA 1XDSA 3ZSQA 4DSIA 9ANTA 1ODDA 3GEZA 3K9TA 1ZKGA 1OH7A 2RNJA 3RPUD 3ZEUB 5AQUA 5BMZA 1TT5B 4U87A 2B9SA 3ERED 2EFPA 4CJKA 2O3FA 1F21A 3P1GA 5JMVA 4LITA 2ELHA 5DTDA 2Y9ZA 1TK5A 2HQNA 1MH3A 3CP8A 3ZT1A 4Q0BA 2RQQA 2DO7A 1WJEA 2CYYA 3HYFA 2HMIA 2YI1A 4M3FA 2E6MA 4IQJA 3QPTA 4N47A 2QA4N 1NK5A 2JUCA 3TDZC 5L3GA 1KU9A 3ATUA 3V9XA 1VRTA 1CZAN 4W97A 4EGZA 3GMEA 1NG6A 3K5OA 3DPLC 3MKLA 1IJJA 2YJEA 2XAUA 4LFCK 4NNJA 4CEZA 3H1QA 4DJAA 1OJLA 4HX7A 1TV6A 5AQKA 4CJ5A 2L54A 3FXKA 1VSIA 1WNSA 2KDOA 3H6EA 4CF1A 4Y1DA 4ZDLA 3KKSA 4PL7A 4GV9A 1KTQA 5A2QK 5F2RA 3BJOA 1SQKA 3L4IA 5EJCA 3O1WA 3UKGA 3W6VA 4O6JA 2CH6A 3U9GA 1MSFC 3MN6A 1FBUA 4CF8A 2OTLN 4B9SA 3V8JA 4PWDA 2VC0A