1Z6RA

Crystal structure of mlc from escherichia coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
395
structure length
382
Chain Sequence
QIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHEMLEAHLVQELGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mlc protein
publication title The crystal structure of Mlc, a global regulator of sugar metabolism in Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 106
structure length 382
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z6rA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA03
4XBFA 2K4JA 1U5TB 4ZYEA 2PQ8A 5DUKA 3ELKA 2GUPA 5TKYA 3ATUA 4I0BA 4GYGA 4D0PA 5LGTA 1S6LA 3ZP5A 2HQNA 3L2CA 3VFZA 4YFNF 2YX4A 4A0XA 1RFQA 3W3DA 2MH9A 4OIRF 3BJ6A 3OHRA 5EX5A 4HF1A 2JT1A 3EZWA 2KRFA 1BOAA 2QQ9A 3N4MA 1YW7A 5BRHA 5L3GA 4ASNA 2B0LA 1LOTB 2FQ3A 1XGMA 2RKHA 3CETA 2H27A 2AA4A 3CUQB 2IVPA 4EM2A 5HLHA 3BF1A 5CVVA 5EXWA 3RTRA 2QW9A 5FPMA 4FWMA 1HKTA 4U7BA 3FLCO 3JTHA 2P9LA 3MZYA 3VOEA 2LF7A 4BRKA 5CLSA 1HJOA 1QPMA 2V79A 5J6XA 1AWCA 1T6DA 3H45C 3QBWA 4JHDB 2ZKZA 1HKBA 3FE1A 2OAZA 4BHBA 1KGSA 2COMA 2CO5A 4LB6B 3CLOA 4AVPA 3D2EB 1FLIA 4ISGA 5LHGA 2F5DA 3TDUC 5AQMA 1D3YA 4KIBA 4BRIA 2STWA 2XKOA 2NNYA 5AQYA 2Y48A 3P9KA 2VN2A 1K6OA 2DQRA 1JCEA 4RGUA 3FXQA 3WTXC 3V4GA 1RUOA 1JXSA 1OKJA 2OQRA 3CJ7A 1ON2A 3HHHA 5D4RA 4PKHA 3ZQ7A 2EWSA 4L9TA 4HYEA 4A61A 2PI0A 1KAYA 3MCZA 4JN4A 2HS5A 2EFPA 4ENNA 4CI6A 4OU0A 4YIFA 4UVCA 1PUEE 3A5LC 1P4XA 3H3NO 1KYWA 2EV5A 1IN6A 3BEXA 2V1UA 4RCHA 3QPTA 1USTA 4ESJA 1QZ6A 1IXRC 2GQQA 4CYDA 3E6BA 2IRFG 4I6MA 4M7YA 3IRQA 1FBSA 2ZGZA 3B02A 4BC4A 4MGRA 3F8CA 3C18A 3WTZA 5E1ZB 3ZEUA 1QGPA 4JNEA 2D45A 2Q8KA 2X0LA 1T39A 3A5OC 4GCVA 4FWNA 4FWLA 1I5ZA 2PFBA 3FWEA 2J5OA 4H0TB 3O1BA 1QZ5A 1HLUA 4OIOF 1NLVA 3DF8A 2D1KA 5BR9A 4LMYA 1XUPO 2EK5A 4K41A 3RKYA 3BUZB 4H5WA 5AQQA 3T8TA 1GLLO 3KCCA 2FRHA 3CQXA 2MBFA 1CF7B 1YFHA 1FBQA 2JPCA 1FWZA 3C7NB 4BRPA 4KN4X 5AQSA 4JK1X 3PFIA 2YX7A 3G73A 5AFUH 4J8FA 2YCHA 1FPQA 4G6QA 1DPRA 1R23A 5BN9A 1KU3A 2CGJA 3BDDA 2PEXA 1KU9A 4MEXF 1R1UA 1F5TA 1GVJA 4U0VA 1LJ9A 1FX7A 4CZFA 3GW2A 1TYQB 4BRHA 3C3WA 3UKRA 1KQ0A 3ZETB 4P55A 4GO1A 4FL9A 2CGKA 3M8EA 5D5WB 2FBIA 3FHZA 4L3QA 2XAHA 6PAXA 3KZBA 2XROA 1V4RA 4K25A 4EFHA 1K8KB 4LJZF 2GTDA 2Q0UA 4CD1A 3KEQA 4QS8A 3WXIA 1D8KA 1WWXA 4B1UB 4HF0A 2CG4A 4EVIA 4CZGA 2BTFA 3VEOA 3IWFA 3SMSA 4BRAA 1BA0A 4KMUX 1LCUA 3I58A 2ADUA 4F9OA 3F21A 1SZ2A 2HGCA 3MWMA 3R60A 2F9WA 4BG8A 3DXKA 4CZMA 3V8JA 1XSVA 5FLXK 4N9HA 1YO5C 5AQJA 3CQYA 3DEUA 3GX4X 3RYPA 3T5XA 2WTEA 4H0VB 1C0FA 2OZUA 1IRGA 1XSDA 4XEIA 1T0FA 2HDCA 2D2WA 3KP3A 4JBAA 1OPCA 1HKSA 5DCMA 1RIOH 1ZGJA 2KJCA 5AZIA 5FB2A 2ZNZA 4HX4A 2P9LB 4CZJA 2DLLA 3QU3A 5H6QA 3FMQA 3EO3A 1MDMA 2LNBA 4IJNA 4H0YB 3ZX2A 2FOKA 3MK6A 2HOEA 5BPDA 2EJRA 4HA8A 3UB5A 3EL2A 1AOYA 1XC3A 2IJLA 3DQVC 3DFGA 5E8GA 3E97A 4LLLA 2DQLA 4GYIA 1U2WA 3SXYA 4MNUA 3KE2A 1R59O 2O8XA 3E3VA 1SAZA 1TBXA 3KZZA 2Q97A 1YLFA 1BWFO 5AQRA 5EOYA 3EETA 1JCFA 4M72A 1XB4A 3H3ZA 2P9NB 2LDUA 2OZ6A 5K5RA 5IT3A 1Q18A 2Y0MA 1F9NA 3WUHA 2VC0A 4L0ZB 2CGLA 1OYWA 4Y0WA 2RNJA 1G3TA 1FYMA 2F5FA 3A8YA 4CGZA 1UFMA 5EVZA 4FO0A 3UKUA 3QRFF 1SD6A 3GL1A 3RPQA 1HKGA 1YQAA 4MHGA 3KP4A 1O57A 3JAMK 3WGGA 3WG9A 5KQ8A 2E2NA 4FWKA 4M63C 3OOPA 2R7FA 1R00A 5AQFA 2W40A 3I33A 2MA3A 5FPNA 1QZZA 4JD2B 3ZEUB 3D5LA 4Y13A 3VEWA 3WTYC 2ESHA 3WXKA 2VOPA 4AWXB 4BRDA 5LJWA 1EH6A 2CYYA 4BC5A 3CUOA 4BR0A 1E17A 5AIQA 5EEHA 2ZFWA 2E1CA 1O7FA 4CZEA 3IUCA 2XUBA 2P9IA 1C0WA 1WRJA 1ZRFA 2AXLA 4PCQA 3LAPA 4YFKF 3IFRA 1KA8A 3O8MA 3HTSB 1BA1A 4L0YB 2L54A 3GOIA 3DKWA 2E1NA 4B1VA 1GLDG 1XSXA 3VGKA 2EFQA 1P4AA 3GFIA 3KEOA 5D8KB 4RAZA 5AQPA 1ZGAA 4BRQA 3A5NC 4LK0F 4FOIA 1G6NA 3TU5A 4WF2A 5HS8A 4A2AA 4OIQF 3E5UA 2NNNA 3H46O 4RTFD 1BOTO 3QDKA 4U7DA 3LM9A 1O3QA 2IVMA 2DI3A 3UKRB 3EUHA 3ZMTA 2VOOA 3HSFA 2V6CA 3FZKA 4H5NA 3AAQA 3O5BA 2MLGA 3VEVA 4M9XA 3HHGA 1S29A 3I71A 3K9TA 3REOA 1W4MA 3B8AX 1RDWX 4MLHA 1NGDA 4WXCA 1O3SA 3F8MA 1U2VB 3ISPA 3HRUA 3BPVA 2CWEA 4P5OA 3GDQA 2W85A 3F72A 3QP6A 2ZMEA 5F6FA 2FEZA 4LB5A 1IN5A 4H0XB 2VYPA 2G9WA 4A6EA 2HTJA 1JCGA 3RSEA 3SMPA 4F7ZA 1GLBG 1NGAA 1MJ9A 4QS9A 2L01A 2D1VA 4H5VA 2QWMA 3FM3A 5AQHA 3MAJA 3LSTA 3VOVA 3Q5FA 3T0YA 4M73A 1Y0UA 2M30A 1DKGD 4FHTA 3IC7A 1UHWA 3K2ZA 3QAHA 2OQGA 3C7JA 3VF6A 2FNAA 2A40A 2YJEA 5BPNA 1P8ZA 4FPAA 1KAXA 2QWPA 5AZIB 4Z2YA 2K7LA 5FPEA 5FFXA 3R0JA 5LBQA 3SFZA 3EN9A 4WQ4C 5AQWA 4G7ZF 5E8IA 4BRLA 1ESVA 4HLXA 1FBUA 1YVNA 2FMYA 2VT2A 3S2WA 4BREA 4A0ZA 2A3SA 2FBKA 1T38A 4BYYA 2CGPA 1MWMA 3KETA 1XN7A 3CIPA 1WUAA 4BR4A 3SZTA 3JSOA 3QFUA 3VEZA 5JR3A 3F9MA 3ID8A 2QWWA 2QM1A 1HW5A 5HOOA 2Q2RA 1XDUA 1R5GA 3ECHA 3W6KB 1S8NA 2D1HA 3GUDA 3F6VA 1BUPA 5AQNA 1TQIA 4ESFA 1K79A 4CZHA 1X3NA 5LRSA 1O7LA 3CTAA 4XH1A 3KP6A 4WXHA 4I01A 3R9PA 2VODA 2V52B 3CJAA 3F8FA 2XRNA 1H0MA 4UV8A 4B9QA 3JW4A 1TLHB 3UKUB 3WTUC 5BREA 3EKSA 3ULQB 4I2OA 4LC9B 2FA5A 2QYOA 2XVCA 2QWLA 1BI0A 4DCHA 2HZTA 4EJVA 3L4IA 2O6GE 3KP2A 4DB3A 4PZJA 1R22A 2H94A 2HF4A 2HEOA 1IUYA 3MEXA 1V4TA 3R6MA 3IMXA 2P5VA 3LA2A 1RUNA 3MDQA 2K02A 3COAC 1BG3A 2WC2A 3ERED 3WGIA 3GFJA 4XSZF 1HSJA 2KIMA 4E1JA 5KPRA 1MDUB 5BMZA 4XLPF 3HM8A 1W7PB 1GHCA 4G9YA 1GLAG 2FSKA 4A2UA 2RDPA 4P96A 3ZMSA 2VE9A 2E2QA 5E20A 4IF4A 3BZ6A 5LJVA 5JICA 4G7OF 2PN6A 4XH4A 4UHTA 2MLKA 1IAWA 1BIAA 3SZPA 2V7YA 3WE3A 4MQ9F 2A69F 2YR2A 3P7NA 2XGXA 4IWVA 4WX9A 5FLXZ 2ASPA 2D4WA 2YJFA 4KNYA 3FZMA 1DUXC 2QM3A 3FXUA 5B8HA 3O1WA 2Q0RA 2YHYA 3AARA 2H6CA 3HSRA 1XGNA 2UYTA 5CYVA 5JVTA 4M74A 3ZX0A 5F1XA 1IZ1A 3VERA 2A3ZA 2P9SB 2BEOA 3J81Z 1NHAA 4O5VA 1MA9B 3WEEA 3VGLA 3RYRA 3CJ1A 3ABTA 3WGHA 3HOSA 4OMZA 3O2PE 3LAJA 3U9ZA 3NRVA 1S7AA 3BY6A 1IN7A 2R3SA 1MGTA 1NMDA 1Y64A 2QXLA 1ZBSA 4HV6A 4IRHA 2FBHA 2F5EA 4A0YA 2NS0A 5BPIA 4ISFA 4DHYA 3LQQA 4XRFA 3FR0A 2F5CA 4Y17A 3DXJF 5D8LB 1G3YA 2STTA 1YAGA 3LFKA 2YU3A 2A41A 5LGNA 4YIIA 4YDUC 2A07F 3CO6C 2A6HF 5LY3A 5J8CA 1X9JA 4IJAA 3IL2A 1R5HA 5ADXH 3FGUA 2QVOA 3K0LA 1TUYA 3BOQA 2DK8A 1ZARA 4BGAA 1MJBA 2M87A 1NGGA 1ZG1A 2HYGD 1HXDA 5D6FA 2Z5UA 4BNCA 1WI9A 2PBIA 4R79A 2P9KB 3HSEA 2V51B 1BC7C 1WKMA 3HBTA 2M5WA 4H5RA 2UWMA 5BQTA 3CHWA 1MZBA 3JAMZ 4BR2A 3O08A 3VGMA 4UXNA 3SHFA 3V8KA 3KP5A 2QBYB 2DK5A 5HVQC 3VEYA 4U0YA 4FPBA 4QS7A 2PAVA 2JSCA 3ML6A 2P9UA 3GWZA 3WQUA 4WQ5A 4CZZA 4HTLA 2CW0F 1BC8C 1H9GA 2Z3YA 4A2BA 1MD0A 4R1HA 4LLGF 1NBWA 1YYVA 3MN7A 5AQZA 3W0LA 3K1PA 1ZLJA 3HTUA 1ONVA 3FZFA 3TO9A 3D0SA 3F23A 4DNCA 5AQGA 4CO8A 2OANA 1XQSC 2VXZA 3RKXA 1K78A 3BROA 4GY2B 2BUPA 4U0WA 2FLOA 2EWNA 2RV8A 4EHTA 3WU1B 4UUVA 5CVIA 4BQZA 1R58A 5ICGA 4MTDA 1BU6O 1JGSA 2ASOA 2XHKA 4Q48A 5AQLA 3Q9VA 5ILVA 1O3RA 5ADXA 1LDDA 4EIAA 2OBPA 4QLCU 1ZYRF 4WYBA 1NGIA 4I0AA 1Z6RA 3H1VX 3BJOA 3FF5A 3GLXA 2P7VB 3DPTA 3I4PA 1BDGA 2W57A 1BI1A 2DO7A 3U2RA 4IHTA 3KP7A 2QQBA 2W41A 2HQRA 1BIBA 4EGYA 2E2PA 4BHCA 1T98A 1V3FA 5BRFA 3M1EA 2FXAA 2ESNA 1T6SA 1LEAA 4FT8A 4I98B 1D8JA 3J81K 1IF1A 4TV7A 4CD3A 3CI5A 2IVNA 5JI6A 3O6BB 1QHAA 3SK3A 1XMAA 1S3JA 4I09A 5F0XA 2NRHA 4IPAA 5ED4A 2FNPA 3WODF 1SMYF 4ZYDA 1UHMA 5KK1A 4B1ZA 2C6YA 4H0EA 3KLOA 4O3MA 2H3GX 1NGEA 1R36A 2QZ8A 3CJBA 1J75A 1YTYA 3HTVA 3I0TA 4B8XA 4XSXF 3RIRA 2P9PA 4O5FA 5AQUA 3LQRA 3KVGA 4HDVA 5CJ9A 5IT9K 2ZCWA 4PGGA 1F4KA 4IZ9A 4WQ5C 5JLFA 3TO6A 1KU2A 3CO7C 2CH6A 2Q1NA 3ZN0A 1E4FT 2XAQA 5L3BA 4EJTA 1DPUA 4B1XB 3C0BA 4H0OA 3DXMA 4B1WB 4HV5A 1WSUA 3U9GA 3TGNA 1XD7A 1W7PD 1YXQA 2IT0A 1T6CA 3JSPA 2H6BA 2Q36A 3U9DA 2P5LC 1S7OA 4S05A 1DGKN 5KQDA 5D4SA 3HYIA 1G99A 1B6AA 5JLHA 5ILUA 2F9TA 5HS7A 3ZMVA 2PJPA 1B59A 1I27A 2NLXA 3DAWA 3K69A 4Z94A 4FOEA 3DWLA 4IRIA 4OMYA 4I6MB 3R8EA 3A0IX 4PGHA 1FY7A 1Z05A 5DV5A 3WQTA 2P8TA 2G7UA 2PBDA 2VONA 4K43A 4MO5A 1SD4A 2E20A 4KUMA 2L02A 2FSWA 3O3KA 4BC3A 2V1XA 4BRCA 5F1RA 4DQ2A 5AZJA 2ZF5O 4KIFA 4WXDA 3DV8A 4RB3C 1X3MA 4WQ4A 4AM6A 4I02A 3P9CA 2PMUA 4FWRA 1R1TA 1ODDA 1QZYA 3O6WA 3T8RA 1PP7U 2O0YA 3QFPA 4NHJA 3SJHA 4EQQA 2GA2A 1KYZA 3U4LA 3WXLA 1FP1D 2HMPA 2XAJA 4GNIA 5FFZA 2EV6A 5ELZA 1BM9A 3Q9SA 1LB2A 2HTSA 5L3FA 3GF2A 3I8BA 5BRDA 5DYMA 1B4AA 1D4XA 2W84A 2LSOA 1FYLA 4M6XA 2FE3A 5DDGA 1ULYA 2RQPA 4EGZA 1FSEA 4JHDA 3E6DA 3D7EO 3WTSC 2KIUA 2QWOA 2K27A 3JS6A 2EV0A 4HQMA 3VETA 2DT5A 2OU2A 3D2EA 4JQFA 2UXXA 2VBYA 3MN9A 2L3DA 1R1VA 2FF4A 3WTTC 2ACJA 3QBXA 3M3ZA 2NAZA 1RGIA 3EYIA 3N97A 2QQAA 5AQXA 1K78B 4A6DA 3D2FA 1LVAA 3TDZC 4K42A 1SMTA 1ON1A 4CBWA 1K7AA 3MN5A 3V8LA 2QUFA 4P9UA 2XAGA 3IKTA 5H20A 4EM0B 1SAXA 4BR5A 2EA4A 3PQJA 4LK1F 2IVOA 3VEXA 4XLNF 1E4GT 3T1BA 1ZREA 4KFCA 2ZO4A 3DXKB 4OOIA 5KVRA 3LA7A 4BXUA 4AM7A 2XKPA 1LDKB 4EHUA 2P4WA 3FMSA 5H6RA 3QICA 1XGSA 3R4KA 1HBXG 1U5TC 5AR0A 4RB2C 3HOTA 2A42A 5DUIA 3M6GA 2UZKA 3H3UA 4RB1A 3F22A 2DPNA 1SD7A 5KPTA 1OKRA 5DCMB 5HS9A 3SLCA 2A5XA 5TJJA 4G94A 3RKWA 4HQEA 3W6JB 2NZTA 5DD8A 5HDGA 1MDMB 4UNOA 4BQLA 2LKPA 2I7NA 5I9EB 1B1BA 4K2EA 4EJUA 4CBXA 3CUQC 4G7HF 2GWJA 2P6TA 2JTVA 2XAFA 2VBWA 4AIKA 4BHPA 4WK8F 5CE3A 5D5UB 2CSOA 1EH8A 5E26A 1CF7A 4ZZLA 3C7NA 4BR9A 2FXUA 3OV8A 2L4AA 1ZN2A 2WV0A 1JHFA 3F8BA 3P9IA 2HR3A 1GXPA 1ZHFA 2VBXA 3A5MC 4LD5A 3M7GA 1J6ZA 3H6EA 5AIPA 1YS6A 2JPBA 4BC2A 3QMLA 3H1QA 2J4RA 2AS5F 1ZG3A 4PKGA 3ULEA 4BH9A 4BGBA 5AQTA 1ZAOA 1HPMA 4CHUA 4L9NA 4FX4A 2JZYA 1I1SA 2FF6A 2DFIA 4MQVA 3IRRA 1Z91A 5ILSA 3EYYA 1J2XA 5A2QK 1YG2A 1U78A 4LLNA 2BGCA 4CJ7A 1YUWA 1GLCG 4MLEA 4EV0A 2E1YA 3R0AA 3FZHA 2H09A 4YDUA 4I7HA 4OIPF 1EV7A 2DTRA 2QLZA 4WWCA 1CZAN 2PLYA 1K8KA 2FSJA 5BN8A 5L3CA 5K1YA 2GXGA 2EA2A 3V7RA 5L3DA 3FX3A 2DAOA 4OINF 1KAZA 1T2KA 4BRFA 4L5JA 1S22A 3QOPA 2E88A 1P6RA 1LDJA 3L0QA 1HKQA 3F8NA 5AZJB 1QO0D 2O61A 3M8FA 1STZA 3CERA 2I7PA 1FT9A 4M7XA 4M9ZA 2CH5A 2M45A 2P9IB 4FWPA 2EB7A 1IRFA 4IVNA 2IA0A 4UVBA 4MTEA 5L3EA 3LM2A 2FU4A 3IWZA 3DPLC 5D6EA 2O3FA 1IW7F 3CJCA 5FGMA 2V7ZA 1QQNA 4ZYHA 4E70A 1Z7UA 4L9VA 1KQ9A 1W5TA 3R6SA 1TQMA 2Z9OA 1SQKA 3DJCA 3K1NA 5TRDA 4HLYA 2P5KA 3GEZA 1HW2A 2KIFA 1BI2A 3GFLA 4KBOA 3FMRA 4GXOA 3GO5A 5K5QA 2NRAC 2QWNA 3HZ6A 3V7CA 1ATNA 4ZH4F 1GLJO 4HWIA 2Z33A 4ESBA 2ZXJA 4ISEA 1I6XA 2TDXA 5ERIA 1J7KA 2KHOA 3VPZA 5HDKA 3MCPA 3R61A 1I1GA 3U8XA 1BO5O 2EFWA 3D2FB 2ISZA 2YPRA 3G25A 4H5TA 4G8XA 4CZLA 5D5VB 5D5XB 5ICEA 2CFXA 2GZWA 3ZMDA 2GA1A 4IXCA 3GZ6A 1BN5A 2R7DA 4QWQA 1FC3A 5DD4A 2P9NA 3NEUA 2E7XA 5HLGA 1HSTA 3BWGA 3I54A 1DDNA 4HBLA 4ZZDA 2X4HA 1OYIA 3GG4A 2ELHA 4RAYA 2ZMEB 4AIHA 1V4SA 5IT9Z 1Z6TA 1TNSA 2IW5A 1ZXOA 1WQ2A 3EQLF 2WWYA 3RSEB 4EAHD 3QB0A 2NYXA 4LGWA 4A62A 3L09A 3HRMA 4PDKA 1OR7A 3E6CC 3J80Z 3WXJA 3B73A 2DW4A 3FXRA 1D5VA 4O8KA 4BAYA 4Y15A 3CJ9A 2L4MA 3TKYA 4JD2A 2E8AA 2FSNA 2D0PA 2VWBA 5F64A 3MN6A 3MQ0A 3H92A 5JHUA 4EJWA 1XMKA 2V1DA 2GXBA 2IA2A 2W25A 4ETSA 1UB9A 3PQKA 4H03B 4HZFA 4LFUA 2P7CB 2QENA 1FSHA 1W5SA 2VBZA 1C0GA 3WU0A 4HOBA 3WTVC 2EFNA 2IA1A 5BOXA 3VF4A 5DCFA 3VEPA 1EQYA 3I53A 3ECOA 1YIOA 1IXSB 1U3EM 4FWQA 2GIVA 1LQ1A 5AQIA 2DPUA 4CZKA 4DQ8A 1A04A 2DU9A 4RGSA 2ISYA 1KQ8A 5BPLA 1USSA 4BR7A 2W24A 2A5YB 2Q2EA 3FFKB 3LDOA 1J0RA 1PDNC 2RGVA 5LRRA 3GZ5A 5LHHA 3GFMA 1NM1A 2JRTA 1HKCA 3KFWX 3BF3A 4L18B 5FD5A 3ULEB 2ZGYA 1JHHA 3GXOA 1F1ZA 2MC3A 5ICFA 1NGJA 3U1DA 1XCVA 2GWRA 2VE8A 2LF8A 1QBJA 1G4DA 3ABUA 1YS7A 1DP7P 4GGGA 3ZMZA 3ZX3A 3HRTA 1H9TA 1FZPB 2HKOA 4UVAA 4ENJA 4M6YA 3E5QA 5JFRA 2PG4A 2ZWHA 4KA4A 2VT3A 2A61A 2OA4A 1SFXA 2HWVA 3JTGA 4BRMA 4MO4A 3J8AA 3FZLA 1IXCA 1U2VA 3TQNA 5AQKA 4MEYF 1X3UA 3KHYA 2A6AA 1SFEA 1YW8A 4RWTA 3F6OA 2ZBKA 2VC1A 4IRGA 2BV6A 1ZLKA 2HKXA 2HF3A 2E7WA 3I59A 1BI3A 1QQIA 4N9IA 1E2XA 4FSVA 2O03A 4EMSA 2GAUA 5K5OA 4XH5A 2A6EF 2Z99A 5LGUA 3P4IA 1NWKA 4HW0A 5AQVA 1HW1A 1OYYA 1QNTA 5LLQA 1PP8F 3L00A 1ZG5A 1ATRA 2ZNYA 4ENKA 1NGFA 2EFOA 2YSRA 1FP2A 1RZ4A 4AIJA 2Q31A 1IG8A 1B9NA 5AFUA 3ZPLA 4NO7A 1ZC6A 5BPMA 4BROA 3UE5A 4H0PA 1QQMA 4A5NA 4BVPA 3BJAA 4A12A 4N0BA 1G3WA 1DEJA 2A68F 2BBYA 3MZHA 4BVOA 3CJNA 3AAPA 3L6QA 3GE1A 3HSCA 4M71A 3SQNA 5LEJA 4HAMA 2FMLA 4U88A 3J80K 3IDHA 3CDHA 4LG0A 5KPZA 5CVJA 3WEEB 1TQPA 1NGCA 5FD6A 5JMVA 3LDQA 2YHWA 1Z1DA 1BJAA 4ENMA 2RN7A 2QWQA 2KJBA 1MWKA 1REPC 5FO5A 4G6DA 4KIGA 2HFHA 4KMFA 3RPUA 4BQAA 4BG9A 1SD5A 3WT0A 3H3OB 4KN7X 3I5UA 4RS8A 5EEGA 3E6MA 1O3TA 2UXNA 4HDUA 4O6JA 1CGPA 3M1FA 4CBUA 4S04A 1NGBA 2FF3B 1P92A 1U5TA 4ON0A 2HYFA 2K4BA 4KT5C 3VF2A 2BE5F 2XV4S 1P4WA 4CDGA 2OD5A 1IN4A 3AAFA 2PMHA 5LEKA 1TW2A 4KYWA 1Z9CA 1ZH5A 4FX0A 1HX1A 3HUGA 1RI7A 3VENA 1G3SA 1H1VA 3LWFA 5A2QZ 3KZYA 3HI0A 1QQOA 3CUQA 1TW3A 3VB2A 1HQCA 3L9FA 3TO7A 3G3ZA 5F2RA 3O80A 1L3LA 3S41A 4KDPA 1ZRDA 4L9JA 3LDLA 1MJAA 2P9UB 3EDPA 4YFXF 3MFKA 1W7PA 1B9MA 1R7JA 3BPXA 2MD5A 4B09A 4HF2A 3GYHX 3TPQA 4RGXA 3EKUA 4YG2F 1KXPA 3WTWC 2XIGA 1U6ZA 1J5YA 1IN8A 1TTYA 2K86A 2RVCA 4M9SA 1GLFO 4AD9A 2DPDA 1TUUA 4IHSA 4WCGA 5CVRA 2F2EA 3LDNA 4KICA 1J59A 1GXQA 5BS6A 5LHIA 5EY4A 4CICA 4FWSA 3QP5A 4HX7A 2ASMA 4Q4ZF 4IO8A 4HX8A 3JXUA 4IXAA 2P9SA 3FZVA 1BBYA 5DEQA 2G7HA 3ZN1A 2ETHA 4Q5SF 1GLEG 3LDPA 3VESA 3MMVA 2CQKA 1OMIA 5CVUA 3AY9A 3IKVA 5AONA 4EM1A 1TNTA 1SFUA 3GVAA 4JAXA 5FPDA 1XGOA 5HLIA 4A5MA 2V9VA 3NQOA 2M8EA 2D0OA 1YW9A 5J8FA 2IIRA 5E84A 2GEMA 2P6SA 2MH2A 4UV9A 4L5IA 2DBBA 5E18F 1P2FA 4R8HA 3LL3A 4EJOA 1XDSA 3C1DA 2E1ZA 1UCRA 5ICCA 2M1BA 3TOBA 1LNWA 1S3XA 4P9FA 3I59B 3M9AA 3FM5A 4PL8A 1U8RA 3O4WA 4PL7A 3L7WA 3HRSA 3I64A 1FYKA 2RC4A 1T44A 4RGRA 2GWKA 1JE8A 3RJPA 3GBTA 4FWOA 2BYVE 2Y75A 3TOAA 3ENHA 1FNNA 1XCBA 1ATSA 3K1MA 4RB0A 2YI1A 2E2OA 2IPQX 3ATVA 4BRNA 3J7AO 3RDIA 1KU7A 2Q0OA 5E1WA 2P9KA 2P9PB 1RNLA 3QU6A 3F3XA 2QWRA 3DP7A 2AP1A 5E17F 4B1YB 2GELA 2ITMA 1EH7A 2QBYA 3VODA 1NGHA 3BP8A 2ZJ2A 4C23A 4CZIA 2J5PA 2WUSA 1VTNC 3DXMB 1IJJA 1U6GA 3HIFA 1J9IA 5E1XA 2IP2A 4LG0B 2YHXA 4ZYGA 3QPHA 3WE2A 1HUXA 3IHUA 3V7SA 4CXFA 1L0OC 3LA3A 4NQWA 1Q1HA 5AQOA 3KLNA 4PKIA 3E5XA 3RI4A 1TYQA 4Q47A 2XASA 3ZMUA 4BRGA 1FOKA 3ZETA 1WOQA 1ZRCA 4NB4A 1MKMA 1LEBA 3ENOA 5HDNA 2VCPA 3ROUA 2KKOA 4NB5A
chains in the Genus database with same CATH superfamily
4GRIA 2UXCK 1NJYA 1JLFA 5FRNA 1JLAA 3ELKA 3ZSQA 3OYDA 1S6LA 2Y9YA 3ZSZA 4YFNF 1S1VA 4NCGA 3HKZA 3QLHA 5JVHL 2LH9A 2DTZA 1BOAA 2B4JA 1XGMA 2RKHA 1YVUA 2AA4A 4NCBA 3BF1A 4MLOA 5CVVA 1W0TA 2CUJA 2DYRH 3J7YJ 4DV1K 1YIJN 4PWDA 1HKTA 3FLCO 1RBUA 2P9LA 3MZYA 3QYFA 1T33A 1QPMA 2W7NA 4HPQA 1AWCA 3U21A 1T6DA 2ZKZA 1RTIA 1VSFA 4FW2A 1LUJB 4ZYAA 2LREA 3F9KA 4O8UA 2F5DA 5AQMA 1D3YA 3NHGA 4BRIA 2STWA 5AQYA 4CIFA 1K6OA 1JCEA 4RGUA 3HXLA 1ITGA 1FJLA 2KDOA 4B3SK 1C1CA 1RR8C 2EWSA 1VSIA 1YT3A 1ZBFA 3DOLA 4OU0A 4YIFA 4UVCA 3H3NO 5CKTA 2Z1DA 3CFPA 3BEXA 4RCHA 3E66A 1MMAA 2LD5A 2XF5A 1ILYA 1JTXA 4M7YA 4CYDA 2X6WA 4MDBA 3IRQA 2JMWA 4FLUA 4MGRA 3F8CA 3C18A 3GCMA 2R7YA 3CCLI 4HSRA 2Q8KA 3A5OC 4BQNA 4FWLA 1I5ZA 4BXFA 3FWEA 3LSGA 1Z3XA 1QZ5A 4F92B 1NLVA 2D1KA 1LE8A 3BDPA 3P5JA 1MBJA 4H5WA 5AQQA 2N8GA 2QSFX 1CF7B 1FBQA 2JPCA 3ASMA 4BRPA 1QHTA 4QPQA 2VGMA 4A3EJ 1FPQA 4GV9A 3L4QA 3CCJN 3BDDA 1UG0A 1KU9A 1F5TA 2CW7A 3VYRB 1LJ9A 3CFRA 4Y1CA 1JT6A 1XMQK 3VQ8A 3ZETB 3HPHA 4FL9A 5D5WB 1JL2A 2DA5A 2IS1A 4FE7A 4K25A 2GTDA 3KEQA 2VXDA 1V54H 4B1UB 4KT6A 4HF0A 3OL3A 3LZJA 3KPHA 1BA0A 1LCUA 3I58A 4F9OA 4IL6C 3Q0UA 3R60A 2VQCA 1GLNA 3L2WA 1XSVA 4I9QA 3G1OA 2VJIA 3RYPA 3T5XA 2UU9K 4H0VB 4LIVA 1ZBLA 3WNHA 1JLBA 4U87A 1IRGA 1LWEA 5HL7L 2YKNA 5DCMA 1RIOH 5AZIA 5FB2A 2ZNZA 3BZCA 3SPZA 3C94A 3AA5X 2W6LA 1MDMA 4IJNA 4H0YB 2E4LA 5LFAA 2HOEA 5BPDA 3GTGJ 4HA8A 3EL2A 1AOYA 1WAJA 1XC3A 5KGXA 3SXYA 4CEEA 4M45A 1R49A 4DQSA 1RT2A 1V5GA 5EG0A 3FHNA 3O9TA 1SAZA 3KZZA 3CMAI 1YLFA 1JCFA 4F52A 2RE2A 1UELB 2VC0A 4B9VA 3BT9A 2CV0A 2RNJA 4CGZA 1UFMA 4YOWA 4CF9A 3QRFF 1SD6A 1UMQA 3RPQA 3VQCA 3KP4A 1U49A 3MXJA 2NOJB 3JAMK 1SS6A 4LIUA 1GT0C 2YKMA 4M63C 1EX4A 2R7FA 4JD2B 3D5LA 1X3WB 2M2EA 3VEWA 3WTYC 1RNHA 2ESHA 3WXKA 4XIUA 2VOPA 1JLQA 1TAUA 4RDUA 3OIOA 4ANJA 5EEHA 5J2NA 4CZEA 2O8DA 2XUBA 1AA7A 4PCQA 2D0CA 5J2PA 3OS0A 5GAEP 4PJJA 3TSQA 2L54A 4CF1A 1NK7A 1WGXA 5C24A 2Q2EB 1QSLA 1GLDG 3VA3A 3GFIA 2A5WA 3KEOA 4DSKA 3B6OA 5D8KB 3PV8A 4LK0F 4FOIA 4A2AA 2LC2A 3H46O 4RTFD 1BOTO 3QDKA 3K9KA 4BEHB 1BR4A 4CJ4A 2DI3A 3UKRB 3EUHA 3HSFA 2V6CA 4I2QA 3FZKA 4M9XA 5FKNA 3I71A 1GOCA 1O3SA 2CWEA 2HDDA 3FBNB 4CJUA 1HMVA 1ZR2A 2G8KA 3DBLB 3F72A 3QP6A 3C2HA 4LB5A 2G9WA 2Y30A 4A6EA 4F7ZA 3TTFA 3K4KA 2L01A 4H5VA 2DN0A 4CECA 5AQHA 4NCAA 3VOVA 3KIOA 2XPVA 2ZJPL 4CVNE 3QAHA 4FTHA 3VF6A 2FNAA 4NC7A 4CEOA 3EUKL 4B43A 1WCMJ 1VF9A 2VG7A 4BUPA 2Y31A 1S72N 1W5CC 3S2WA 4BREA 2A3SA 4NC8A 2RF2A 2VJJA 3JYTA 4DFMA 4CYCB 3PO2J 4W5RA 1XN7A 1FXXA 2E71A 4MFEA 3VEZA 3ID8A 2QWWA 1BI4A 4F4KA 1YITN 3HC7A 1TKDA 1XDUA 2KTQA 4FK4A 1RKWA 3GUDA 1NU0A 3OMYA 3VTIA 1O7LA 2K9NA 1IG9A 3R9PA 2F96A 4UV8A 3WTUC 5FKKA 4RW9A 2QWLA 2HZTA 3KP2A 4LF9K 2CQQA 1IUYA 4FLZA 4DR6K 4CEFA 1EP4A 3THYA 2DOAA 4P1WA 4HVJA 4MIMA 3A0BC 3K6GA 5C44J 2K02A 3COAC 1BG3A 2WC2A 3WGIA 2CMPA 4XSZF 1BR2A 2YUSA 1TWAJ 1BL3A 1XMXA 2L7FP 1K61A 4G9YA 1GLAG 4CHQA 3ZMSA 4IF4A 4PK4A 5LJVA 2XY5A 3KX2A 1UHSA 4E7KA 2Z1GA 4MQ9F 1VQ5I 1VQPN 4MDAA 2XGXA 4WFNL 2E60A 2YJFA 5HROA 4PFOA 3FZMA 1MNEA 4XLEA 3FXUA 2M34A 3ZSVA 1FKOA 1RT1A 5JVTA 5F0FA 1OH6A 1NHAA 2V26A 2DOEA 1MA9B 1MBKA 3O2PE 1X1AA 4NUBA 2R3SA 4CGGA 2YU9J 2DFHA 3LP1A 4A0YA 2EIJH 5IP9J 4XRFA 3IV5A 2WB1A 1G3YA 2A41A 2YU3A 5LGNA 1O13A 4YDUC 1J53A 4I6ZA 2A6HF 1BHLA 2F8SA 3QNNA 2QVOA 1TUYA 4RMNA 4C1NI 2K9QA 2DK8A 1MJBA 2NVXJ 1HXDA 4BNCA 3AL0B 2PBIA 4D1QA 2M0CA 4HNTA 3Q0WA 2V51B 4A3IJ 1WNSA 5BQTA 3D0PA 4J2DA 3CHWA 1GDTA 3TTCA 4Z4IA 3VGMA 3V8KA 4DSLA 2QBYB 3ZQFA 4U0YA 5M1PA 2JSCA 1E3MA 5C4JJ 1RETA 1HNVA 5LMNK 4LLGF 1Q1VA 1NBWA 1YYVA 3MN7A 4Q0BA 2KLAA 2DODA 4IHXA 1I3QJ 3HTUA 3TO9A 2KZMA 2X48A 1KC8O 5M5XJ 4V19K 4Q5VA 2FLOA 2RV8A 1ERDA 5CVIA 4MTDA 2ASOA 1L3UA 2XHKA 4Q48A 5AQLA 3UIQA 4YHHK 5DM7L 1VQ8N 2OBPA 4WYBA 1NGIA 1KVAA 1EO1A 1BDGA 3KP7A 2QQBA 3RPUD 4AVZA 2HQRA 1T98A 1V3FA 2FXAA 4BL0B 1LEAA 1D8JA 3LSIA 1IF1A 3CI5A 4B44A 3LSKA 4DR1K 2NRHA 3DLEA 2FNPA 3EUAA 2C6YA 4DTMA 1KCFA 2B63J 4JKBA 4KHYA 4FYDA 3CCMI 1J75A 2IAIA 2DMNA 1YTYA 2A1RA 3HTVA 3I0TA 4W5OA 1VQLI 3NAUA 4FM0A 4I99C 1RR7A 2RNGA 5FKOA 1VQ9N 1F4KA 2Z16A 4M3DA 2OZSA 1EWQA 5C10A 2KP6A 2Q1NA 3AA2A 1VAZA 4EJTA 1DPUA 1BCMA 4B1XB 4MFDA 4JI8K 3TGNA 2VQHA 2IT0A 3JSPA 3PIPL 4F2SA 2UUBK 4S05A 1DGKN 1NK8A 5JLHA 2PJPA 2NLXA 4ID5A 3TW6A 1XS9A 5SZTA 3WNFA 2PJRA 4F3QA 1IRXA 4XRSG 4K43A 2VONA 3CCRN 4MO5A 3DBRB 3SQ2A 2BY2A 3D5SC 4IQJA 2FSWA 1IC8A 1WSEA 2M9HA 4BRCA 5GAHP 2IS3A 3OS1A 4WXDA 2DY4A 2ZXHA 3DV8A 4RB3C 1X3MA 4WQ4A 4I02A 3P9CA 4FWRA 2GXAA 1ODDA 1PP7U 2E6MA 4J19A 3VMFB 3DCFA 2HMPA 2I5UA 3Q9SA 2ZE2A 3NF6A 2GX9A 4M6VA 1JL1A 5DDGA 1ULYA 2RQPA 1SFOJ 4EGZA 4JHDA 4FJGA 2CV1A 4FVMA 3D7EO 5FRMA 3JS6A 3VETA 2DT5A 3ASOH 3RZDJ 2VBYA 2L3DA 3CC2N 3MECA 3OBWA 3M3ZA 4RM3A 3AO1A 1TGOA 1ON1A 2P5OA 4F3OA 1F43A 3V8LA 4DZPA 5H20A 3LFUA 3W2WA 1BJZA 3G4SN 2BOLA 1S9EA 4AH9A 2HOTA 4XLNF 3SUNA 3HYFA 3EE9A 1ZREA 1IKWA 2TCTA 5KVRA 1WBBA 3SI6A 4LF7K 2P4WA 2RN2A 3D5RC 3M8PA 3QICA 5TGTA 1MNDA 5F1JA 3F22A 5DCMB 2A5XA 3BQZA 4F8RA 2HNYA 5I42A 4HQEA 3KKRA 1MDMB 4UNOA 2WAQA 2BXZA 4YRVA 3NF8A 1IV0A 4K2EA 4EJUA 1BA5A 4G7HF 4HEA2 2HBMA 1MH4A 5JLXA 4JK9A 1EH8A 5E26A 3W6VA 1MBHA 3HO1A 2FXUA 3WXMB 4KHPK 3P9IA 1ZHFA 4LD5A 3H6EA 4M3YA 2HPIA 3QYEA 4PKGA 2LOOA 1V5EA 3ULEA 5AQTA 2ZJPF 1ZGWA 4BXXJ 3MD2A 2JZYA 3DKYA 4MQVA 3IRRA 3J7AP 1J2XA 1YG2A 4BY1J 2BGCA 1GLCG 4EV0A 3OYGA 2HVIA 3HPGA 3S2DJ 1APLC 2DTRA 3L2VA 1HNIA 4WWCA 1K8KA 1FJGK 3T1AA 2ECBA 2GXGA 5CR4A 5L3DA 4OINF 1T2KA 4L5JA 1S22A 2O61A 3M8FA 2DA3A 3VTHA 2I7PA 2FBTA 1SC7A 2O8DB 4M9ZA 3JRAA 2W00A 4KTQA 2O3FA 5C12A 2XC7A 1IW7F 3SCXA 1QQNA 4DR5K 5C0YA 2CQXA 4L9VA 5JVGL 1KVCA 3H9QA 3K1NA 4HLYA 2P5KA 3JR9A 2KIFA 1BI2A 3AL0C 4XNFA 3V7CA 3TBIA 4AIDA 1X58A 2ZXJA 3MKWB 3W3CA 4ISEA 3JSMA 4KJZA 1JKPC 3VPZA 1HR0K 2EIKH 3B6CA 1DP3A 2HSTA 1RBRA 2ISZA 2YPRA 2DFEA 2EHGA 4RW7A 3WNGA 2E1MB 4CZLA 5D5XB 4HUGA 3GZ6A 2R7DA 1UJ8A 1FC3A 5HLGA 4CH7A 3C6HA 3M8RA 3V1RA 1ORKA 4RAYA 2OC6A 2LK2A 3EY1A 1Z6TA 1TNSA 2ZJRL 2IW5A 1ZXOA 1WQ2A 3EQLF 2XB5A 2IC3A 3QB0A 2NYXA 3L09A 1OR7A 3CMEN 3FXRA 2QA4I 4O8KA 3OYCA 3TKYA 3ZRGA 2VWBA 5F64A 3MN6A 3MQ0A 5JHUA 5HRNA 4D9JA 2V1DA 3CCYA 2VQGA 4A3CJ 2P7CB 2QENA 1S6QA 1W5SA 2VBZA 3T1YK 2EFNA 2IA1A 3VF4A 4JI6K 4II3A 3IG1A 1EQYA 3ECOA 5FJ8J 1C0MA 1U3EM 4RGSA 1KQSM 1KQ8A 1CQTA 2W24A 1BI4B 1TT0A 4CE9A 3PX4A 3NF9A 4JOMA 5LHHA 1VQOI 3O9UA 1VSHA 1NM1A 2JRTA 4CEDA 1HKCA 2DA7A 3CD6I 3QO9A 1WFXA 1JHHA 3LDSA 4DLGA 1F1ZA 2MC3A 1NGJA 1UZCA 1QBJA 3TTDA 1DP7P 3ZMZA 1KFSA 3SJMA 3OSFA 1YI2I 3HRGA 4M6YA 2QKLB 2PG4A 2ZWHA 2EH3A 4JI0K 1SFXA 4BRMA 4MO4A 3J8AA 3FZLA 4J01A 2G8VA 2VL8A 2MYSA 4PHTX 4ZC3A 2R7UA 2VC1A 1ZLKA 3AGKA 3L2RA 1TWGJ 2V9PA 2HHQA 4XL9A 3QYBA 1BI3A 4N9IA 3S1NJ 1N5YA 2R7ZJ 4C1NK 4FSVA 2GAUA 4HTUA 5LLQA 3L00A 1ZG5A 2E2HJ 2EFOA 2YSRA 1IG8A 3TARA 3ZPLA 4BROA 1KVBA 4H8KA 3GTJJ 1QQMA 2BBYA 2K9SA 3MZHA 4BVOA 4M71A 3TSUA 3MX5A 2PYLA 5LEJA 3IDHA 2JVGA 3CDHA 1S1WA 2KHMA 3J7ZO 3LDQA 1RBSA 2YHWA 1Z1DA 1R5ID 4JK8A 4ENMA 2RN7A 2BHYA 2KJBA 4QTRA 1MWKA 4KMFA 3RPUA 3WT0A 5HRRA 5EEGA 4A59A 2M3AA 2UXNA 4HDUA 1HDPA 3TEDA 4CBUA 4S04A 1NGBA 4DOZA 1P92A 4OKJA 3VF2A 4IO9L 3BQYA 1MMDA 1JUPA 4BKXA 3EEQA 2DFFA 1HQEA 2X6YA 4DFKA 1T7PA 4GV3A 3OBYA 4XN0A 5GPAA 2YNFA 1XMOK 2MGQA 3LWFA 2JA8J 1YJWN 3PIPF 5K14A 3TO7A 5F2RA 1VQ7N 4O0IA 3O80A 1SVOA 3LDLA 4ILGB 5JLWA 1B9MA 1R7JA 3TAFA 1KXPA 3VYSB 3ASNH 1J5YA 1TTYA 4M9SA 2O8EA 4CCOA 5CQGA 3SBGA 3HM5A 3LDNA 4KICA 1WLJA 3U3YA 1J59A 1GXQA 4AYBN 5BS6A 3AO2A 1G59A 4B3AA 5EY4A 1HRHA 3QP5A 2COBA 5C2FA 3JXUA 3OOUA 2P9SA 3FZVA 1BBYA 3ZN1A 2ETHA 4B08A 3CCEN 3VESA 3NAEA 1OVQA 4IZZA 3DLRA 3AY9A 2H1KA 3KD1E 4M3EA 4EM1A 2HOAA 4JAXA 2BVMA 5FPDA 1XGOA 2HPMA 2X1DA 3CC7N 5HRSA 3ZT4A 2P51A 5E84A 3DTEA 2IS2A 4UV9A 1OCTC 4R8HA 3LL3A 2CH0A 3T69A 4EJOA 1XDSA 2R5YA 2KFZA 3I59B 4PL8A 1U8RA 4PL7A 1X1CA 4A3KJ 4RGRA 1D0ZA 1X1BA 1JE8A 2Y75A 3TOAA 2XPUA 1XCBA 3K1MA 4RB0A 4XLAA 1A36A 2Q0OA 5E1WA 1RDDA 3SPYA 2QWRA 3H3VK 5GIOA 3DP7A 5E17F 1C0TA 2JUGA 3D1NI 4ZDOA 3AVNA 4Y3OA 1VTNC 4DSFA 1U6GA 5E1XA 4CHYA 4DQQA 4LH5A 3IHUA 3V7SA 3JRFA 1OFCX 2P0WA 3DU5A 3PFYA 1IV6A 3KTQA 1WOQA 4NB4A 1MKMA 2CUFA 2D0AA 2M4GA 4XBFA 1U5TB 1SUQA 4ZYEA 2GUPA 3ATUA 4DS4A 3K4NA 2KDZA 3L2CA 3VFZA 2VUMJ 1RFQA 2MH9A 1EJ9A 1TK5A 4XQFA 5EX5A 2JT1A 1DGWY 5F27A 4CSWA 3EZWA 4FCYA 2QQ9A 4FJ7A 1YW7A 5BRHA 3HUGB 1LKXA 2VB6A 3CP8A 1LOTB 2FQ3A 5I3UA 3GZNB 1R4MB 4A3JJ 3CUQB 2PZSA 4JRPA 2HBJA 1NG9A 4DV5K 2JQ7A 3VOEA 5CLSA 2HVRA 1HJOA 2V79A 5J6XA 2UXDK 5J1UA 3QBWA 4JHDB 5AJ3K 4E6KG 1FEXA 1HKBA 3AVJA 3FE1A 4BHBA 1KGSA 3HBLA 2CO5A 3O4NA 4AVPA 1Q9YA 1FLIA 4ISGA 3OYBA 1AKHA 2DJIA 1HJRA 4DTUA 1Y56A 2XKOA 2L2OA 1VNDA 2R7XA 1W97L 3V4GA 5J1EA 2OQRA 3CJ7A 3HHHA 5D4RA 1DQUA 3ZQ7A 4B3RK 3HVRA 1CLQA 5GADJ 4A61A 1X4PA 2PI0A 5FKMA 2L9NA 2HS5A 4ENNA 5JVGF 2EV5A 2YNIA 2V1UA 4IG0A 2ZSHB 3ONQA 2VLAA 4ESJA 1QZ6A 3E6BA 4I6MA 1K9MO 4IDKA 3ZQLA 2CW8A 4RLQA 4AF1A 4ELUA 2X0LA 1T39A 4CZCA 4GCVA 4FWNA 3VQAA 4BE0A 2PFBA 2WAEA 3O9QA 4OIOF 3TABA 3DF8A 3QODA 3CPEA 4BU2A 4LMYA 1XUPO 2EK5A 3BUZB 2OTJN 3ITHA 3SBTA 1TKTA 4B3TK 3RR7A 2FJ1A 3H9GA 3CQXA 2VG5A 2ZJRF 4DTSA 1A35A 2G8UA 2YX7A 4IFYA 4J8FA 4G6QA 1DPRA 1R23A 2F6CA 3BG3A 2CGJA 5IYCJ 1R1UA 4C8LA 2VG6A 2A1SA 2NVQJ 1FX7A 3GW2A 1TYQB 1Y97A 1U0JA 1XTAA 4BRHA 4JI5K 4GO1A 2CGKA 2WA0A 1VSDA 2XAUA 2XAHA 6PAXA 1K8KB 3K2AA 4ZJZA 4QS8A 4JI3K 2CG4A 2LBFA 3LP3A 4RW6A 2CJJA 1RRJA 4BRAA 3CPWM 1WJAA 3MWMA 5FLXK 4N9HA 1YO5C 4E7LA 1MU2A 4OGEA 4D5FA 1Z26A 4A5AA 5AQJA 2WFBA 3CQYA 1IDYA 3GX4X 3VQPA 1X2MA 2HHVA 5LL6Z 1XSDA 4XEIA 3K4BA 1T0FA 4E7JA 2E5NA 4JBAA 3K4JA 1OPCA 4OO1J 1ZGJA 2KJCA 1H88C 3RZOJ 2DLLA 5H6QA 3EO3A 3LSPA 3ZX2A 4E7ZA 2FOKA 3MK6A 3G0ZA 4CFCA 3BR1A 4CW7B 2IJLA 3DQVC 2QSGX 4LLLA 4YELA 2DQLA 4DBRA 4FZZA 3GLLA 4AHTA 3KE2A 3MKYB 1U4BA 4CHZA 3PUFA 1TBXA 2Q97A 5C3EJ 5EOYA 2YS9A 3ZQHA 4M72A 3H3ZA 2OZ6A 1Q18A 2GBZA 1JJ2M 2O8BA 1S9HA 3WUHA 2KZVA 1OYWA 2PFUA 1EKEA 1A5WA 3A8YA 3SV4A 3PNTA 2VKEA 5EVZA 4C8KA 1YITI 3QETA 1MBGA 3WGGA 3WG9A 4E7IA 3V1OA 2E2NA 1C6VA 3AO3A 1HQUA 2BXYA 2A6TA 1RILA 5AQFA 2W40A 4HUFA 2JLEA 4C8MA 2MA3A 1QZZA 1REVA 3AVMA 3ZEUB 2DMTA 4RA2A 5J3LA 1Y39A 5LJWA 1QSSA 1GV2A 4BC5A 3CUOA 1QVTA 3PSFA 1DT9A 1WHUA 1O7FA 2UV1A 1WRJA 4MQ3A 3RCOA 3LAPA 1KA8A 3O8MA 4JKDA 4FJJA 1SFKA 4L0YB 3GOIA 3PX0A 3DKWA 4IO9F 2E1NA 2EFQA 1P4AA 2NRZA 4FJ8A 4RAZA 1ZGAA 1Z7LA 3F2KA 5HS8A 4OIQF 4AM3A 4F3TA 2L0KA 4JKFA 4EP5A 3CZ6A 4FJLA 1O3QA 3ZMTA 2VOOA 3OIQA 2EZIA 3VEVA 5HRPA 3CCQN 1S29A 3K9TA 3L2QA 1RDWX 1IRZA 3F8MA 4OPKA 3SYZA 2AXTC 3HOZJ 2AJQA 4CJ3A 3DEEA 2BZTA 3OL4A 4KV8A 5DTDA 1JCGA 2NRXA 5KNLA 2W4SA 1FTZA 1NGAA 1MJ9A 5EEAA 2LSNA 2D1VA 3FM3A 1LAVA 1PJRA 3LSTA 3Q5FA 1DKGD 2QK9A 4FHTA 4OPJA 4FM1A 1WH5A 2A40A 3GBGA 4XN3A 3OW2M 2MSYA 5FFXA 3ZT2A 3EN9A 4WQ4C 4G7ZF 1SVLA 1WJFA 4BRLA 5HLTA 4IHYA 2M7AA 4A0ZA 2FBKA 4Z4FA 1T38A 5GAGP 1MWMA 1C0UA 4CJVA 3L3UA 3CIPA 1WUAA 4BR4A 3SZTA 3F9MA 1VI0A 2QM1A 5HOOA 5FROA 1V55H 4W5NA 3CMYA 1Y1VJ 4CCHA 2D1HA 2XHBA 1BUPA 3THWB 4ESFA 2DDBA 5LRSA 3GMEA 3F8FA 2R5ZA 3NVMA 3JW4A 1TLHB 3UKUB 5BREA 1Z25A 5HLFA 1R0AA 1WVRA 4AQYK 4I2OA 2Z1HA 2FA5A 5CQEA 1MBEA 3WHBA 4EJVA 2E19A 3L4IA 2WY8Q 2HF4A 2HEOA 3MEXA 1S5LC 3CCSN 1PUFA 1UAXA 3BLYA 2P5VA 3LA2A 3MDQA 3OR2C 4CK1A 1NG7A 5KTQA 4C3IJ 3LAMA 4JS4A 2O8FA 1K4TA 1QA6A 2F7TA 4IOAL 4O0JA 2KIMA 1MDUB 3DTIA 4XLPF 4BDPA 1IBMK 4NXNK 2JA6J 1WSJA 3NGIA 1Q8IA 2O4GA 4P96A 3CCUN 1XI1A 3VQ5A 2DYSH 1Y8RB 5JICA 4ZTJA 4UHTA 2MLKA 2FC0A 1IAWA 1BIAA 3CXCM 4PJMA 2O8EB 3WE3A 2VJ4A 2A69F 3ZOBA 4IWVA 4WX9A 1B9FA 1TZLA 2CS3A 3AARA 3HSRA 4FJNA 1XGNA 5CYVA 4M74A 3ZX0A 3VERA 2P9SB 3J81Z 3F73A 2CQ7A 5J4YA 3VGLA 1VQ9I 2BW3A 3HOSA 3LAJA 4RW8A 1MGTA 1Y64A 4IRHA 2FBHA 1BIZA 4BJ6C 4E1NA 2KT0A 3PLAA 4DHYA 3DXJF 3ZQIA 4KH4A 4EP4A 1YAGA 4E4HA 2R5YB 3KWGA 2A07F 3O9SA 1MSEC 3CO6C 4JX6A 2XRLA 1X9JA 3IL2A 5ADXH 3V1QA 4HHTA 4XLFA 3C6TA 3O3GA 4BGAA 2M87A 1NGGA 2HYGD 2Z5UA 4JKGA 3HSEA 1OQYA 1NMNA 2IS6A 3VQ7A 1VQNN 4BR2A 3VYTB 4CJQA 2DK5A 3VEYA 4FPBA 4QS7A 2PAVA 3ML6A 2FQ4A 4DSEA 4A3FJ 4CZZA 2LG4A 4JX4A 4HTLA 4IOCL 3NBPA 1BC8C 2Z3YA 3NGYA 4LY7A 2X9DA 3S14J 1LFUP 4N47A 1BQNA 1QHGA 4DNCA 3A4CA 1B72A 5AQGA 4UQGA 4CO8A 5DS9A 3KLGA 1K78A 4LFCK 2BUPA 4J00A 3DEWA 3WU1B 3QPLA 3DMJA 1N8RO 4GFBA 5IYDJ 1JGSA 3LMMA 5IWAK 2LTPA 3NWTA 3FK7A 4FLYA 4G6TB 5ADXA 4EIAA 3KZIC 4I0AA 1Z6RA 3BJOA 3DU6A 3DPTA 3I4PA 2FX0A 4KHNA 2W57A 1H89C 1D1AA 2LLKA 5MLCQ 4LITA 3J81K 3L2UA 4TV7A 2KFNA 2IVNA 1ENHA 4XK4A 4ITVA 1WJDA 3SK3A 1S3JA 4I09A 2X6NA 4ZYDA 4B1ZA 2NVTJ 3A2KA 2H3GX 2QZ8A 4FE4A 3CJBA 3ID6A 3AGRA 1NK3P 4B8XA 4DS5A 2HHHK 2P9PA 3KVGA 1AKHB 4HDVA 3ZT3A 5IT9K 4PGGA 4CHNA 1S1UA 2AQEA 4IZ9A 5JLFA 4DFJA 1L5UA 1K73O 2K3PA 1KU2A 3ZN0A 3OA9A 4B1WB 4HV5A 3U9GA 4CEQA 1W7PD 4Y4RA 1YXQA 1T6CA 2Q36A 2H6BA 5GADP 4AU7A 5D4SA 2YHAA 1G99A 1B6AA 3I9V2 2F9TA 5HS7A 3DRPA 2LVSA 1DTQA 3DAWA 3K69A 4Y1DA 4I6MB 3A0IX 2Y69H 2OZMA 3RMAA 2E20A 4XRMA 3VQ4A 2L02A 2DDAA 4IFEA 3AVHA 1UA1A 3O3KA 2OF7A 1B92A 2V1XA 4DQ2A 3O4QA 5AZJA 4KIFA 4XOPA 1R1TA 1QZYA 4IFVA 1MBFA 1JLEA 3O6WA 5D3GA 3QFPA 1RDBA 5KAIC 4NHJA 4EQQA 2LKSA 4CERA 3QNOA 1CZBA 3WXLA 1FP1D 4GNIA 2MC4A 4QOZB 1U8BA 3I8BA 5B1BH 2W84A 2LSOA 4M6XA 3DRRA 2VIXA 4B47A 2MFZA 2KIUA 2QWOA 2K27A 2EV0A 1OISA 4HQMA 3D2EA 2JVHA 3HJFA 4A3MJ 5AQXA 4A6DA 5C15A 4K42A 3MN5A 4P9UA 3IKTA 4EM0B 4IOXA 4BE1A 1SAXA 4WFBL 1ETOA 4KB0A 1X1DA 4B9UA 4LK1F 1N32K 3JCUC 4DBQA 1V5FA 3LSMA 3LSHA 2HNZA 2ZO4A 3LA7A 4AM7A 2XKPA 3PY8A 2DT7B 3FMSA 1CXQA 5AR0A 2PMZN 4RB2C 3HKZN 3HOTA 1ITYA 3M6GA 2AO9A 1D1CA 2ATQA 2P5GA 1TVRA 2RKIA 2MG4A 1SD7A 1OKRA 2OPRA 3SLCA 4G94A 2AQFA 3RKWA 3SAGA 3W6JB 2NZTA 2BHZA 4B9LA 4BQLA 3I0RA 5DK5A 2LKPA 3CMAN 3CMMA 4ZDLA 2JTVA 2YX6A 5H1SQ 4BHPA 1UA0A 2V9KA 2WV0A 4FM2A 3F8BA 2HR3A 2VBXA 3SZ2A 4M3ZA 3M7GA 2VJ5A 2I10A 1YS6A 2JPBA 4ELVA 3QMLA 3ZCOA 2AS5F 4KRFA 4E1MA 4DZJA 3R1XA 2Y1JA 2DFIA 3BG6A 5A2QK 1SEUA 3TW7A 4CJ7A 1YUWA 4FVUA 2E1YA 4ICLA 3R0AA 2RHKA 2DMUA 4I7HA 1EV7A 2QLZA 2F4VK 5BN8A 5K1YA 1YJ9N 2IOCA 3FX3A 2I8DA 3DBHB 2PMZA 2E88A 1LDJA 2JGUA 3QQAA 1STZA 3CERA 1XHZA 3ABKH 4FW1A 5EYRA 2M45A 3B6AA 2EB7A 4IVNA 5CYMA 4OWRB 2W6KA 2EZHA 3DPLC 5D6EA 3AFHA 5FGMA 4GVEA 1J54A 1KQ9A 1QRYA 1A5VA 3P38A 3DJCA 1HW2A 4GKKK 4GXOA 3WU2C 2NRAC 3LNQA 1GLJO 1FMWA 2HXIA 2WADA 2Z33A 4ESBA 4QAGA 1I6XA 1L3SA 2TDXA 1IKYA 5ERIA 4FJ5A 2TRTA 2QGUA 3R61A 2QEXN 1RKTA 2EFWA 4IOAF 3D2FB 2HVHA 4W1UA 5D5VB 2CFXA 5ICEA 1E3OC 2GA1A 3TI0A 4LF5K 5JHFA 3DLGA 3I54A 1DDNA 4ZZDA 1OYIA 3SDBA 4M42A 4CCNA 2WOMA 2G8FA 4IG3A 4KKOA 4II2A 1KSPA 3HDDA 3HK2A 2QF7A 1RTJA 3M07A 3GTPJ 1LW2A 3HGYA 3AVBA 3K59A 2FSNA 2D0PA 4NLCA 5GPCA 3H92A 4X6AJ 3TP0A 5GAHJ 3PQKA 1FSHA 3THXB 4KFBA 5EJCA 3WTVC 1GVDA 2YNGA 4RAGA 4JKCA 1J09A 4XICA 2OPTA 4FWQA 2GIVA 2DPUA 3RSNA 2DU9A 2HHXA 2ISYA 1USSA 2V4JC 3ISNC 3G6EN 1T95A 1PDNC 3LAKA 1WZ2A 3O8HA 4PJ0C 3GFMA 4KAZA 3KFWX 4XM3A 4KH5A 1Y8QB 1D9FA 3RVCA 2R5ZB 4DV3K 2VE8A 4N56A 1N77A 1H9TA 1FZPB 4ENJA 3E5QA 3OS2A 4YEJA 2VT3A 5DMRA 3MX2A 2NRVA 3U3GA 3JTGA 1BGXT 1IJWC 1IXCA 1U2VA 3HG9A 3AVCA 4IOCF 1PUFB 4UUSB 4DMNA 1MW7A 2A6AA 1SFEA 1YW8A 3F6OA 3JRBA 2O8FB 2Y9ZA 4FLTA 3MWPA 3BCBA 3CC7I 4EMSA 5K5OA 2Z99A 5LGUA 3P4IA 4HW0A 3JAMO 2HXOA 1N33K 1PP8F 2ZNYA 3ZXSA 4ENKA 1NGFA 2Y0SA 1FP2A 1RZ4A 4AIJA 1ZR4A 2I5JA 4NO7A 5GP9A 3ZCMA 5H2FC 3LPUA 4BVPA 4CF0A 4N0BA 5BR8K 4DIQA 4U88A 2ECCA 4IEEA 5KPZA 3K58A 1TQPA 1BQMA 2BW3B 3OYNA 3ABLH 3NARA 2QWQA 5J4VA 2D0BA 2IXSA 5EGOA 5FO5A 4Y33A 4KIGA 2HFHA 4BBSJ 4BQAA 3GTQJ 1ETYA 4KN7X 3I5UA 5KI6A 1FTTA 1O3TA 3K4LA 4DJAA 1CGPA 3M1FA 4M41A 4ON0A 1RT6A 2XV4S 4CDGA 2G8IA 4DR3K 4K8XA 2OD5A 1RDCA 1IN4A 3P83D 1NK4A 2PMHA 5JS1A 1TW2A 4KYWA 1ZH5A 2Z2SB 4JKGB 2E5ZA 3VENA 3ZQGA 3VB2A 3L9FA 3MEEA 3M8SA 3NF7A 3N4PA 3S41A 1K8AO 3H1CA 4AHVA 1SKWA 3EDPA 1T0FC 3MFKA 1W7PA 5F0HA 3BPXA 4B09A 4RGXA 4FETA 3I55I 2R7QA 1ZBIA 4HRIA 4PJNA 1U6ZA 1IN8A 2RVCA 4AD9A 2DPDA 1TUUA 1G8XA 2CFOA 2CV2A 4CIEA 4JI2K 5SWMA 2GM4A 2DA1A 3A1YA 1GOBA 4HX7A 4Q4ZF 4JI4K 4HX8A 1L3TA 4QCLA 3MCAB 1EWRA 2G7HA 4Q5SF 1GLEG 4H4KC 3PSIA 3NQOA 2M8EA 3KJVA 4CIGA 1Z77A 2NXNB 4BY9C 5EZHA 2P6SA 2MH2A 4IKFA 4B3XA 1P2FA 3E1SA 4OAYA 3CCMN 2NVUB 3C1DA 5ICCA 4OLAA 2M1BA 3TOBA 5IYBJ 2X51A 1S3XA 1VQLN 4P9FA 4E7SA 3CM6A 3O4WA 3L7WA 3O9RA 3HRSA 1OCPA 2KPMA 1JJ8C 3TAPA 1AHDP 1G2HA 3RJPA 2KL4A 5KCMA 2BYVE 1FNNA 1ATSA 3ATVA 4BRNA 4XMYA 4QIWN 3J7AO 5EZGA 2P9KA 2HQ5A 2P9PB 5IPAA 3ZQCA 2O4IA 1VQMI 2IDOA 2AP1A 3CP2A 3P39A 3V9UA 4RBOA 2ZFUA 3VODA 3UKGA 5B3SH 3MWTA 3JRCA 3BP8A 4H4OA 3KWIA 1RDUA 2OTJI 4DV7K 3HIFA 1J9IA 2IP2A 4LG0B 4DV2K 1HUXA 4B9NA 4CXFA 3LA3A 4NQWA 5AQOA 3KLNA 3K10A 3OYMA 3RI4A 3QEWA 4Q47A 3H35A 3I4MJ 3OYAA 3ZETA 4BDYA 1LEBA 2R7WA 2KKOA 4NB5A 4PY5A 4C3HJ 2K4JA 4CA0A 4B9SA 5DUKA 5TKYA 4RG8A 3AVGA 4D0PA 5LGTA 3IAYA 1H8AC 2EIMH 2YX4A 4A0XA 1ETVA 1W7AA 2GV9A 1FOYA 4B8AB 2WB1N 2ETJA 4HF1A 2HVQA 2KRFA 3FK6A 3PJRA 1JXBA 3ZSRA 3CDIA 3CETA 3I56I 2H27A 3LL7A 3CF2A 2IVPA 5HLHA 5EXWA 5FPMA 4FWMA 4U7BA 1ETQA 5CHIA 2DMPA 4BRKA 2OCEA 3WHCA 4N41A 2COMA 1WI3A 4XRSA 3SAHA 4LB6B 2HB5A 3D2EB 3TR8A 2CUEA 5KRTA 3TDUC 3KK3A 1MIJA 2NNYA 3K9JA 4A3LJ 2Y48A 5M3FJ 2VN2A 1X19A 3BTCA 3BZKA 3FXQA 4E3SA 2ZB9A 4IEJA 3WTXC 4AUXA 5J40A 4MO7A 1ON2A 1CZ9A 4OPAA 2OUMA 4HYEA 3AA4A 2D5RA 1KAYA 2EFPA 4CI6A 1SKRA 1KYWA 1IN6A 3BTIA 1USTA 4M3BA 1QZEA 4EZ9A 1IXRC 2GQQA 5E41A 2O5RA 1FBSA 1T8IA 2ZGZA 4BC4A 2K5CA 1QGPA 4JNEA 4IQ4A 4EZ6A 4W5TA 3KYDB 2CUZA 2J5OA 1VQ4I 3O1BA 5BR9A 2M7BA 2NRTA 3RKYA 3W2AA 2RQQA 2NRWA 3T8TA 1GLLO 3KCCA 2FRHA 1YHQI 1FWZA 3HVTA 3PFIA 5AFUH 2CQNA 4U67L 1IUFA 2LMDA 4MEXF 4N76A 1GVJA 4U0VA 4DV6K 4CZFA 3EPZA 3UKRA 3TAMA 3EZ5A 4LFAK 2EINH 2FBIA 1YTUA 3E1YA 2XROA 2HHTA 4EFHA 4LJZF 4CD1A 3WXIA 4B48A 4K8ZA 4Y52J 1WWXA 3VPRA 2X6OA 1IBLK 1F36A 4CZGA 4BJ5C 3VEOA 3S8PA 4C2MJ 3THVA 2ADUA 1SZ2A 3J80O 4KPYA 5HODA 2F9WA 2F5VA 3SV3A 2KZGA 5E79C 2LP0A 3DXKA 2IGKA 3V8JA 2OTLN 3DRSA 4CEZA 3QEIA 2W48A 4L8RB 4JV5K 2O9LA 4DUZK 1D9DA 5LMUK 1C0FA 2OZUA 3LZIA 2K3FA 2HDCA 2D2WA 4JEPA 4M3XA 3LPTA 3M1CA 2P1JA 2P9LB 1TAQA 4DQPA 1VQ6N 1FIAA 5EF6A 2EJRA 3BR5A 4CYCA 3DFGA 3E97A 2JRMA 4GYIA 1U2WA 3CJTB 3M3YJ 4DUYK 1R59O 1IG7A 4X66K 1SV5A 3TP3A 2LDUA 3TAEA 5K5RA 3K4MA 2Y0MA 2WAFA 3QIOA 1N75A 4FZYA 2QA4N 4Y0WA 1G3TA 2F5FA 2UXBK 1ETKA 4LD0A 1YQAA 3RWUA 4MHGA 1O57A 1YX3A 5KQ8A 4FWKA 2LY1A 3OOPA 3AKZA 4HUEA 3OVNA 4Y13A 4KTWA 3KLIA 3L8BA 2D5VA 1OCRH 4BR0A 1E17A 2ZFWA 3RKQA 3IUCA 1LE8B 4BQQA 2BH1A 2W42A 2P9IA 2PY5A 2UUZA 4J2EA 4YFKF 4X64K 1O1WA 1BA1A 3QEXA 2WAQN 3O3HA 1LWFA 3MKZA 3H08A 2Z1JA 1ZTRA 3O8GA 5B66C 3DLLL 5AQPA 4CHOA 1FIPA 3AG4H 2QKBA 4BRQA 3OYLA 4E0DA 1G6NA 4B9MA 3TU5A 4JS5A 1NNEA 3E5UA 2NNNA 1TL3A 3LM9A 1HPZA 2P81A 2Y2ZA 4H5NA 3AAQA 3O5BA 2ICWG 3RR8A 4J2AA 3E9OA 3HHGA 3E01A 1JUSA 3B8AX 4KITB 1NGDA 4WXCA 1U2VB 3ISPA 1TK0A 3BPVA 4DTPA 1IKVA 4D5CA 3GDQA 2W85A 1Q9XA 4NDLA 2ZMEA 5F6FA 1LAWA 2FEZA 4YOXA 5M1QA 1XWLA 2QWMA 2H8WA 1HNXK 3T0YA 4M73A 2M30A 3IC7A 1UHWA 3K2ZA 3HT3A 3C7JA 1IGNA 2YJEA 3I3LA 5BPNA 1P8ZA 4F91B 1FOXA 1KAXA 5AZIB 4Z2YA 5FPEA 3R0JA 1WBDA 3SFZA 3IH4A 1WSGA 4HLXA 1YVNA 2VT2A 4JK7A 2QTDA 4FLVA 4W97A 4Z4EA 3K2PA 4QSHA 4BYYA 2CGPA 1WAFA 4KTZA 3TWHA 5EG0B 4GV6A 1HW5A 1DGRM 2Q2RA 2LRDA 5EGOB 2IBDA 3OYKA 3ECHA 1EA3A 3W6KB 3F6VA 3HSTB 4XH1A 4WXHA 4DF8A 3PO4A 2V52B 3CJAA 3LP0A 1BOBA 1H0MA 4CCJA 2B9SA 4B9QA 4IEIA 3SJJA 4BY7J 3CCVN 3A01A 3EKSA 1ZBHA 3IKMA 2JWLA 4LC9B 2QYOA 1TK8A 1BI0A 2QI2A 4RW4A 1TWHJ 4DB3A 1R22A 3HOXJ 2ITGA 3V6DA 1KRPA 3R6MA 3IMXA 1QU3A 3DLBA 1HLVA 3GFJA 3LOCA 4C2UA 5IOYA 5KPRA 4OAZA 2F4IA 3IAM2 4JI7K 2NS8A 1W7PB 2RDPA 1OCCH 2E2QA 5E20A 4G7OF 2PN6A 3NWSA 4XH4A 1XPXA 1J5OA 3SEZA 2YR2A 1E3HA 4NC6A 4KNYA 3CDLA 2XGCA 2Q0RA 3DTKA 2UYTA 5C4XJ 2EILH 2X74A 1IZ1A 3K4CA 2ZJQL 2A3ZA 2BEOA 4W5QA 2X1CA 2JWTA 3OIPA 3PNYA 2F48A 1BR1A 3RYRA 3V9ZA 1U47A 3CJ1A 4C3JJ 3WGHA 4N5SA 3ZSXA 3NRVA 1BISA 2HBKA 3FXMA 1S7AA 1ZBSA 4HV6A 4A57A 2QKKA 3VDXA 4KREA 3CYMA 3HEFA 5FDLA 5E3LA 4ISFA 3FR0A 4LF4K 2ELJA 5D8LB 2K9MA 4CCLA 3LFKA 4YIIA 2X6XA 3QOEA 3QERA 5J2MA 4FQGA 4IJAA 2BANA 1R5HA 1ZARA 1WI9A 1WSHA 2BGGA 1JUMA 2P9KB 1M1EB 1BC7C 3HBTA 1XHXA 4H5RA 2UWMA 3JAMZ 2YHBA 4UXNA 4X0GA 4XORA 1U48A 1MNMC 3GWZA 3WQUA 2CW0F 1X3ZB 4CFAA 3HPOA 4A2BA 4NQWB 2R92J 1KONA 3W0LA 4AHUA 1POGA 1W1WE 3D0SA 1XQSC 1EXQA 2VXZA 1F21A 3RKXA 3BROA 4GY2B 3LWMA 3DOKA 4EHTA 4UUVA 4BQZA 5ICGA 1BU6O 4KISA 2DA6A 1O3RA 2EBIA 2Q3SA 1LDDA 1ZYRF 3LSRA 5FKLA 3FF5A 2P7VB 3THYB 1BI1A 3U2RA 2KQRA 4EGYA 4BHCA 2WBNA 3NH0A 1UG2A 5JI6A 3O6BB 1QHAA 1TP4A 4IPAA 5TKWA 1SMYF 1UHMA 1B8IA 3CC4I 5KK1A 4H0EA 3KLOA 1OVYA 3VYUB 1NGEA 3I0SA 3I8DA 3RMCA 4M3TA 4XSXF 4O5FA 5AQUA 3LQRA 1M90O 1OH7A 2FBXA 2L9RA 1T03A 1Q86O 4WQ5C 5GIPA 5GAGJ 2XAQA 5L3BA 1YTAA 1AU7A 1JLCA 3C0BA 4H0OA 2W82A 1Z21A 5GTIC 4CJSA 4YNQA 4DU1A 1S7OA 1W36D 3SQ0A 5KQDA 4O55A 5IP7J 5ILUA 3ZMVA 1I27A 2IGMA 4Z94A 4FOEA 4IRIA 1GUUA 4A69C 5DV5A 3WQTA 2P8TA 2PBDA 1SD4A 4KUMA 1YJNI 1WN7A 3FDYA 5F1RA 1OH8A 1NH3A 3PO3J 4AM6A 3OSGA 2FBYA 2HHUA 2ZXWH 2XSJC 3T8RA 3AVFA 3KLEA 2O8CA 2GA2A 1YJ9I 1KYZA 3U4LA 1TT5B 4CGIA 2MABA 4XIDA 5EDNA 1BM9A 1LB2A 4JYAK 3GF2A 5BRDA 4FLXA 3MMYB 3FFIA 1FYLA 5M5YJ 4H4MA 3ZGKA 2Z1IA 2XB0X 3WTSC 1DTTA 4DTRA 1YE9A 1YIJI 4JQFA 2VQEK 3WTTC 4N4OB 3S1MJ 2NAZA 2M8GX 5IY5H 4YOYA 3N97A 2QQAA 5E3MA 4X1EA 1DU0A 3HOUJ 4XR6A 1LVAA 1NKEA 3E9PA 1SMTA 4CBWA 3S17J 2QUFA 3ZSOA 2XAGA 4C8OA 3P1GA 3Q7CA 1CXUA 2F8TA 5K7ZA 2EA4A 2VKHA 4OKKA 1ZBUA 2QEXI 3OJSA 3DXKB 4ILHA 1WH7A 1LDKB 3DLLF 3C2BA 4EHUA 5H6RA 3CLQA 3R4KA 3G2BA 1HBXG 4XONA 2XY8A 1VSJA 5J2QA 4DSJA 2UZKA 3K5OA 3H3UA 4RB1A 2DPNA 5KPTA 1P9QC 3ERMA 1D8YA 1BW5A 3SQ1A 2AHQA 4BS9A 4Y7NJ 4B4CA 2XGDA 4FASD 4CJRA 2BY3A 2P6TA 4DYRA 3KLHA 4BACA 3RTVA 2B5JA 4AIKA 4OVLA 1RC9A 5CE3A 5D5UB 1Y6IA 4ZZLA 3C7NA 4BR9A 1HCRA 2KIQA 1JHFA 3RRHA 1GXPA 3CFOA 3MVPA 1J6ZA 5AIPA 4CHPA 4FZXC 3S1QJ 3SNNA 1HNWK 3EYZA 2GOXB 2J4RA 2IGOA 3G1LA 4BH9A 1HPMA 4CHUA 3C6AA 5GINA 4FK0A 1I1SA 3PUBA 5DM6L 1Z91A 3EYYA 2GBYA 3G6EI 1U78A 4M3RA 4IHWA 2H09A 1A31A 1TL8A 3SUOA 1FMVA 3CCJI 2PJRB 1ASVA 4YORA 4OIPF 1CZAN 1K4SA 2PLYA 3ABMH 5L3CA 2HI3A 1TL1A 1OCZH 3V7RA 2JA2A 2DAOA 4BRFA 3Q3SA 1X4OA 3QOPA 4QPOA 4J2BA 3ZYYX 3L0QA 3F8NA 2L7MP 3D6RA 1J9AA 1FT9A 4C2TA 4PUSA 2P9IB 4FWPA 1WPKA 4MTEA 5L3EA 3OYJA 2FU4A 5GTHC 1NK6A 4BE2A 1I3AA 2V7ZA 5TISC 2HBLA 4E70A 1QVGM 3LWLA 3R6SA 2Z9OA 1SQKA 3GFLA 4KBOA 2GLOA 3GO5A 4CFDA 4DFPA 4NYFA 1ATNA 4CJFA 4XKCA 1HF0A 4BWMA 1I50J 3I4NJ 1J7KA 3VQ9A 5HDKA 3MCPA 1I1GA 4FXDA 1VSEA 3GTOJ 3U8XA 1BO5O 3C95A 3KK1A 2HOSA 4F93B 4H5TA 3G25A 2GZWA 3ZMDA 4IXCA 4QWQA 5DD4A 2P9NA 2E7XA 3PIOL 3NH1A 1HSTA 3S16J 4HBLA 2X4HA 2ELHA 2ZMEB 4AIHA 2KISA 4CJLA 2E1OA 3S32A 4G9ZA 3MZ8A 1D1BA 1Q81O 4CUGA 4LGWA 4A62A 4PDKA 1JI8A 4CGFA 3CESA 3J80Z 3NVKA 4BAYA 2ZJQF 2KMUA 2L4MA 2E8AA 4EJWA 2VKDA 1TWFJ 2W25A 4ETSA 2ZD1A 1UB9A 4H03B 3PO5A 4B9TA 4HZFA 4CJ5A 4JRQA 1QTMA 1KFDA 4ZHRA 4HOBA 3KYLA 3SAFA 3KK7A 5BOXA 3C6UA 1IXSB 4KO0A 5FLXO 3F5TA 1KLMA 1LQ1A 4CZKA 4DQ8A 4RAFA 2RREA 3SDGA 3FFKB 1J0RA 2RGVA 4CJEA 1W9HA 2GIZA 5FD5A 3ULEB 2ZGYA 4YFUA 5ICFA 2LKXA 1XCVA 2LF8A 3A01B 3ABUA 1YS7A 3F0CA 4CGJA 3WNEA 3K70D 3ZX3A 3HRTA 2ZQBA 4UVAA 3L1PA 4KA4A 2HU9A 2A61A 2OA4A 1R71A 5AQKA 4MEYF 1XX5A 3C2GA 3S93A 4DV4K 3NH2A 3KHYA 1VQKN 1E0EA 1LW0A 4RWTA 3JRGA 3HB9A 2BV6A 3NFAA 4WCEL 3AVKA 4CJPA 3HOVJ 2E7WA 3I59A 1WB9A 3J7YP 1QQIA 1ACIA 5BNGA 2O03A 3J7ZI 2RPIA 2DJNA 2A6EF 5CY4A 5AQVA 1QNTA 1JJ6C 3ZT1A 2LY9A 1B9NA 1EF4A 1ZC6A 2OYQA 2R7VA 3UE5A 4H0PA 4ILJA 4A12A 4E89A 1G3WA 1X9SA 2WONA 3HSCA 3SQNA 4HAMA 3KEYA 4NYNA 1OLTA 2FMLA 3J80K 3HOWJ 5JMVA 1TKXA 2JJ7A 3IS9A 4GKJK 1REPC 1S72I 2ID6A 3SYTA 3JRIA 2EPFA 1VFCA 1SD5A 1VRUA 3BG9A 9ANTA 2FBVA 4O6JA 4PSXA 4CJTA 2FF3B 4CEAA 1U5TA 1PYVA 1VK0A 4IDHA 3V81A 5LEKA 3AO4A 1Z9CA 3ZQQA 4FX0A 3AVAA 3QINA 1HX1A 4NNJA 2B7EA 3HUGA 1RI7A 5M1OA 4LH4A 1G3SA 1H1VA 3KZYA 3HI0A 2XF6A 3CUQA 2BY1A 4D7NA 3QEVA 2PX9A 2L7KA 4KDPA 4L9JA 1MJAA 4YFXF 4HF2A 1FKPA 3GYHX 2A05A 1NKBA 3K5LA 3WTWC 1MSFC 1GLFO 4WCGA 5CVRA 3M8QA 1S1XA 5LHIA 1X1PA 3UNGC 4IO8A 3RMDA 4IXAA 1IKXA 3LDPA 1VQPI 3DLKA 2OV7A 1VSKA 5CVUA 5AONA 3ZLJA 5HLIA 1JKQC 2D0OA 5J8FA 2QKMB 3FKJA 4N4NB 2DBBA 1JLGA 3SQ4A 2LYCA 3FM5A 3ZT0A 4TSXA 2ELKA 3I64A 3N05A 2RC4A 1B8IB 1T44A 3ZSYA 4Z4CA 1QS4A 1K83J 2F4MB 5C42A 2VASA 5CPRB 2OJED 2FD5A 3F3XA 4LF8K 1T56A 3OYEA 1WJBA 4AILC 2GELA 2BDPA 1D5YA 1EH7A 1FK9A 3VWBA 1NGHA 4HCBA 2ZJ2A 4C23A 4CZIA 2J5PA 2WUSA 1HYZA 5KHDA 3QIPA 1Q7YO 5B5EC 2UUCK 3MN2A 3QPHA 4DQIA 2NS7A 4CJWA 1L0OC 4CGHA 2G0EA 1I94K 2NNWA 4PKIA 1HYVA 3E5XA 1TYQA 2OPSA 2XASA 1FOKA 4BWJA 4S0HB 1SAUA 2VCPA 3ENBA 3ROUA 3QESA 1RT7A 2V7FA 3K0SA 2PQ8A 2BVLA 4BQOA 4I0BA 4GYGA 4CK3A 3ZP5A 2HQNA 3V9XA 5CZ1A 3BG5A 3W3DA 3PX6A 4OIRF 3BJ6A 3OHRA 3ALYA 2ZMEC 4DU4A 3N4MA 4DGWB 5L3GA 5HBMA 4ASNA 2O8CB 2B0LA 4WE1A 4FLWA 2ID3A 4JKAA 4EM2A 3RTRA 5DM6F 1VQ8I 2QW9A 4BGDA 4A3BJ 2QQ8A 1K6YA 2OTLI 4CJKA 3JTHA 4KHQA 4FJXA 2LF7A 2G8HA 2R0QC 3H45C 2E34A 2OAZA 4NBQA 1VRTA 2HW3A 1R6RA 3CLOA 3M4OJ 3DYAA 1LPQA 4B8CA 4FK2A 5LHGA 4KIBA 1JKOC 3P9KA 1VQ6I 2DQRA 1VHXA 1RUOA 3BTLA 1JXSA 1OKJA 2XSDC 3T3FA 2VI6A 2LY2A 4PKHA 4L9TA 3V42A 3CM5A 1RPWA 3MCZA 4JN4A 3A5LC 1PUEE 3BR0A 1P4XA 1ASWA 4WFAL 5KGWA 2E2IJ 1GV5A 3QPTA 1VZ0A 2IRFG 2JWKA 1Y0NA 3B02A 3WTZA 5E1ZB 3ZEUA 2D45A 4CESA 1D5AA 2HVSA 2E6LA 1QE1A 4H0TB 1HLUA 2HHSA 2EX3A 1ETWA 3PIOF 4V2FA 2GOMA 4K41A 3QPSA 3RQIA 3CCRI 2HDWA 3Q0VA 1FW6A 1N36K 3AA3A 3BR6A 4XLCA 3BY5A 2KKZA 2MBFA 1YFHA 3C7NB 4KN4X 5AQSA 4JK1X 3G73A 2HZDA 2YCHA 3OTOK 3BCAA 3DLAA 4FJ9A 3J81O 5BN9A 1KU3A 3G71N 2PEXA 4XOTA 1DLOA 2R7TA 2K85A 5HNFA 1ZYQA 3GTLJ 3C3WA 1KQ0A 2VWKA 4P55A 1SL0A 3M8EA 1SVMA 4LOCA 5J1YA 3FHZA 2XY6A 4L3QA 3TAGA 3KZBA 1V4RA 3DI6A 2Q0UA 5IT9O 2KQ2A 5C2DA 1D8KA 4FJMA 1J5EK 1HDDC 4EVIA 1LFPA 2BTFA 3IWFA 3A02A 3CC2I 3SMSA 4KMUX 3F21A 3HOYJ 3FBIB 4CK2A 2HGCA 3MXMA 4BG8A 1BW6A 4CZMA 2ZM6K 2MW8A 1XC9A 1IH7A 4JLHA 3DEUA 2R93J 2Y1IA 2WTEA 3G4SI 2K40A 2G8WA 3GTMJ 3VA0A 3KP3A 5J1RA 1HKSA 4PA1A 4HX4A 1P90A 4CZJA 3QU3A 3FMQA 5DM7F 3SFIA 2LNBA 4DG1A 1HA8A 1QHHD 2QCOA 2QSHX 3UB5A 3CQZJ 1MMNA 5E8GA 3O3FA 4V19S 3B6PA 3H5AA 4MNUA 4WF9L 5FLMJ 1QQCA 1U04A 2O8XA 3E3VA 4L5EA 4A5BA 1S6PA 3RMBA 1BWFO 5AQRA 3EETA 1XB4A 3CQ8A 1S5JA 2P9NB 3KD5E 5FLVA 2BY0A 5IT3A 2HQAA 1NKCA 3T1HK 2CRGA 2OPQA 3THWA 1F9NA 1A6QA 4L0ZB 2CGLA 1YRNA 1FYMA 3PNVA 1QPIA 4FO0A 3CCLN 3UKUA 3GL1A 1NOZA 1HKGA 4BBRJ 3JREA 1R00A 1RT5A 5E3OA 3I33A 5FPNA 3SEQA 1SANA 3CCVI 1T3VA 3ZSWA 4AWXB 4BRDA 2HHWA 1EH6A 2CYYA 1X9WA 5AIQA 2H1LA 3VSLA 1A5XA 2E1CA 3VQEA 4OGCA 1QSYA 1C0WA 1ZRFA 2AXLA 3CJRB 3IFRA 3PL8A 4M3UA 3HTSB 3VQQA 4GW6A 4B1VA 1XSXA 3VGKA 2VQFK 3L3VA 4ZDPA 5F08A 2OCCH 2F4OB 4PSWA 1BCOA 3A5NC 3S3OA 4WF2A 1JKHA 4U7DA 1JT0A 4DR4K 2IVMA 3VQDA 1M1KO 1VSLA 1KTQA 3MEDA 4Z4GA 2MLGA 4KHWA 3FIWA 1YOVB 3V9SA 3H9JA 4KHUA 3REOA 1W4MA 2O8KA 4MLHA 4O44A 3HRUA 2LBFB 1VSMA 4ELTA 4P5OA 1P7JA 4FJKA 2M4KA 1NK0A 1IN5A 4H0XB 4AHRA 2E5LK 2VYPA 3BGRA 2HTJA 3RSEA 3SMPA 1GLBG 5CZ2A 4QS9A 5A2QO 3MAJA 4EATA 4PFPA 5K7HA 1Y0UA 3OWTA 2K9LA 2OQGA 2VGNA 4FPAA 2QWPA 1RBVA 2K7LA 1YX5A 2X6SA 5LBQA 3E7LA 4CCMA 5AQWA 4JP0A