1Z6RA

Crystal structure of mlc from escherichia coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
395
structure length
382
Chain Sequence
QIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHEMLEAHLVQELGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of Mlc, a global regulator of sugar metabolism in Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Mlc protein
total genus 106
structure length 382
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z6rA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA03
4B9QA 3EDPA 2NNNA 4K25A 4ZYHA 1BBYA 3SHFA 3QFPA 3DKWA 3HTUA 1LOTB 1BU6O 1IG8A 4BRCA 3WTXC 2JT1A 4Y15A 5AQMA 2PAVA 2KHOA 4HX4A 2PJPA 2FBIA 1NGDA 4ZYGA 3WGIA 3GVAA 4XSXF 2CGLA 2V52B 1YVNA 1NGJA 1TQIA 2OAZA 2ESHA 2H94A 5JR3A 2QWLA 3VEXA 1HXDA 1EH8A 3COAC 1WKMA 3GO5A 1RDWX 3EN9A 3M8FA 2HR3A 4EGZA 2OZUA 1T98A 5H20A 3ATVA 4PDKA 4BG9A 2YPRA 5AQPA 2GELA 4A61A 2XRNA 5FPEA 3QOPA 1ZH5A 2V1UA 2Y0MA 4FX0A 3J80K 5KPZA 3V8JA 2HF4A 1LDKB 4RCHA 2CH5A 3WEEA 3WEEB 2YI1A 4HX8A 4BC4A 1CZAN 1XDSA 3VOVA 4KMUX 5KK1A 4HA8A 2IA2A 4C23A 3CJBA 2EB7A 1ON1A 3R9PA 3WXKA 2QVOA 4GGGA 3OHRA 3QU3A 3M7GA 3O2PE 3TO9A 2EK5A 2Z99A 2A41A 1YS6A 2YSRA 1OYYA 2HYFA 4A5NA 3FX3A 1XMAA 1K78A 2P9PB 1GLFO 3CIPA 5AQRA 2QM3A 2NNYA 2YCHA 5CLSA 5LHIA 3Q5FA 4B1XB 2ZNYA 3KEOA 3WGGA 1FLIA 1R1VA 3FWEA 2IA0A 2Z9OA 3CETA 4RWTA 5BS6A 4CZZA 2VBXA 3QRFF 3GE1A 2DW4A 4MLEA 1O3TA 5E1WA 1J2XA 1F5TA 4HBLA 5DEQA 3KVGA 2BE5F 1V4RA 3GXOA 4KMFA 3BEXA 3SMSA 5AQWA 2RC4A 3P7NA 4QWQA 1O7LA 5LLQA 2VONA 3IFRA 2DLLA 2W84A 4A0YA 1ZGJA 3I64A 1B1BA 3D2EA 2F2EA 4IVNA 4ZZLA 1NWKA 4FPBA 4KA4A 4BH9A 1G4DA 1J7KA 4BAYA 1R1TA 2MLGA 4HLXA 2DPUA 1A04A 2OANA 1ZLJA 1ATSA 3NEUA 4Y17A 2CH6A 2RNJA 2IW5A 1KU9A 3LA2A 3R8EA 2R7FA 3O5BA 1DP7P 2FRHA 1P4AA 3RSEB 5H6RA 3W6JB 4MEYF 4AIHA 3K1PA 2E88A 3O80A 4AIJA 1Z05A 4MTEA 1I5ZA 4H5TA 3IC7A 2LF8A 4G7ZF 4JBAA 4B1UB 3H3ZA 2XAJA 3KZZA 3U8XA 2K86A 5FB2A 2ESNA 3LAPA 3O6BB 1FBUA 1BC7C 3QB0A 1KA8A 1XSDA 3DXMA 4RGUA 4FWPA 3EQLF 5IT9Z 4EM1A 2QWNA 3PQJA 3HHHA 4L9TA 3WE3A 2XAQA 3WT0A 4I7HA 2IPQX 3MAJA 1TW3A 4L9NA 3EL2A 4KN7X 1E2XA 4ZYDA 2L02A 4CZGA 5DCMA 2IVPA 2P9LB 5TKYA 3SFZA 1ZG3A 3U9DA 4DCHA 2QWQA 3RPUA 4BC5A 4Y13A 4FWNA 2PFBA 2QUFA 2FBHA 4WX9A 2ZGYA 1IW7F 1Z6TA 1NGCA 3LDNA 2JTVA 4YFKF 2DT5A 4I6MB 3IRQA 4CZJA 2O6GE 4LGWA 3RKWA 1U5TA 2NLXA 2VOPA 4EVIA 2ZMEB 1G3TA 2EV6A 3WGHA 1LB2A 2KRFA 2HZTA 2O3FA 2EFWA 1IN6A 5BN9A 3W3DA 4EAHD 3VF2A 3J81Z 3LWFA 1FY7A 5HS7A 4RGRA 3JW4A 1W7PD 5E8GA 2PLYA 4H5WA 5EX5A 3GOIA 1T6CA 5F1RA 1FX7A 3EUHA 2QWWA 2FU4A 3M9AA 2RGVA 3MMVA 1UHMA 4HAMA 2HTJA 4BRIA 5LJVA 2XASA 4L3QA 3SZTA 3WXJA 5F6FA 3KZYA 1S3JA 3VEZA 1T38A 4B09A 3HZ6A 3NQOA 3EO3A 2A40A 1OKRA 4M9ZA 1ZAOA 3IHUA 4WXCA 2P9UA 2ASPA 4CO8A 4LG0B 2Q31A 2QQ9A 4JQFA 2F5CA 2JZYA 2CSOA 1VTNC 2BBYA 4M6XA 4KT5C 3A8YA 3GX4X 2XHKA 3WTSC 1K7AA 1DDNA 3U9ZA 5BQTA 4BRLA 1ODDA 2A69F 2P9SA 1C0GA 4NB4A 2A68F 2UYTA 3CHWA 1ZN2A 3TOBA 4BR7A 2IVMA 1W4MA 2VOOA 4BQZA 3HSFA 3JTGA 3MCZA 4M71A 4U7DA 3O3KA 4GXOA 3JSPA 2EFNA 4GYGA 5HDNA 4YIIA 4B1YB 5D5UB 3LQRA 3H6EA 3IL2A 2J4RA 2Q0UA 1REPC 3VFZA 3RI4A 4A2BA 2EA2A 3JXUA 5LRSA 4TV7A 3HRSA 5ED4A 5D8LB 1MKMA 1K8KB 3RJPA 1P8ZA 3CJCA 4QS8A 3BUZB 4GY2B 2PMHA 5D4SA 4LK1F 4HOBA 1SD5A 3CTAA 1YO5C 5LRRA 1P4WA 3IWZA 4IPAA 3FZLA 2V79A 4A0XA 1B6AA 3C3WA 3RPQA 1W7PB 4PGGA 3ISPA 4KYWA 2R3SA 3FMSA 2VC1A 4CDGA 2ZJ2A 3CJNA 3H1QA 3EETA 2QXLA 3QICA 4IZ9A 3ID8A 2Q2EA 4KIFA 3A5LC 2V7ZA 1KYWA 4WQ5A 4H0TB 1QZYA 4BC3A 1I1GA 5L3EA 3DQVC 1PP8F 3MWMA 3AY9A 3KP7A 4EFHA 3T0YA 2ACJA 3BJ6A 2F9WA 1WSUA 3QP5A 4KIBA 1JXSA 3O1WA 4U0WA 3F23A 2XV4S 1ON2A 2B0LA 1RIOH 5BN8A 1TUUA 2H3GX 1TUYA 5AR0A 2ZKZA 2PEXA 5AQLA 1JHHA 4KUMA 2VC0A 5BRHA 3LQQA 1X3MA 3BY6A 5E26A 3MN9A 1KAXA 4CBXA 2DFIA 2E2NA 4UVAA 2X4HA 4F9OA 3WXLA 4KIGA 2W24A 3R61A 3LM9A 4I09A 3K1MA 5A2QZ 2TDXA 4KFCA 1IJJA 2KIFA 2EFPA 4H03B 2HEOA 1IN8A 3FR0A 1S22A 2FSNA 2EFOA 1KAYA 5F64A 3DXJF 1FC3A 2YHWA 4A6DA 1I27A 1FPQA 2KIUA 4S05A 4EJOA 4NHJA 4O3MA 4H0PA 5HLIA 1T39A 5AQOA 2V6CA 3VGMA 5LJWA 2UXNA 5DD8A 3WTVC 3HM8A 1OR7A 1KQ0A 2IJLA 4CZLA 5AONA 1PUEE 4MO5A 2H6BA 1XCBA 1DPRA 2IA1A 4LMYA 4QS7A 1KQ8A 4CBUA 4G6DA 2HKXA 1MWKA 2P9LA 1HKTA 2Y75A 6PAXA 2IRFG 4FWMA 4EMSA 2OQGA 4XH1A 4AD9A 3WODF 1BA1A 1AOYA 4CZMA 4MQ9F 1XQSC 3GZ5A 2QBYB 3LA7A 5EY4A 2E2QA 4U0YA 3ML6A 1QBJA 3U2RA 2VYPA 2GWJA 2ZFWA 4RAYA 5AQXA 2W41A 5DUIA 1ZRFA 4EM2A 1X3UA 5HDGA 4UVBA 4OINF 1H0MA 3VEPA 2RQPA 5BPNA 4LD5A 1FP2A 3I58A 4Q48A 3FZMA 2XVCA 4BYYA 4FL9A 1H1VA 5JMVA 1WOQA 2JSCA 2QW9A 3OOPA 4DHYA 1FZPB 1U2WA 3OV8A 3FZKA 1YG2A 4GCVA 2FEZA 4FPAA 3BDDA 4GO1A 1LJ9A 2P6TA 4CICA 1G3SA 4CYDA 3BJOA 1YW9A 1UFMA 4IRIA 2PG4A 3BROA 5HS9A 1BOTO 4DB3A 1EQYA 4FSVA 5DCMB 5KQDA 5E17F 2FOKA 4M72A 4PGHA 4I6MA 2QQBA 1SFEA 3L00A 5AQUA 1D8KA 1TYQB 3I5UA 1BDGA 5D5WB 1QHAA 1DEJA 2GQQA 1T2KA 1BC8C 4HWIA 2XUBA 3O6WA 5AQYA 2HQRA 3T8TA 1UB9A 1XCVA 1EH7A 1TQPA 2AXLA 3DPTA 3VERA 2FQ3A 2DQRA 3DXMB 1NHAA 2ZNZA 4A6EA 1R59O 1ZARA 3AAQA 2VBWA 4ESFA 4BR5A 5D6EA 5CJ9A 4U7BA 2A5XA 2VBYA 2W40A 1W5SA 1V3FA 3D7EO 1TYQA 5BPMA 4WF2A 4FT8A 2CYYA 1IUYA 2P9IA 3E5QA 3DFGA 4XSZF 3UKRB 3UE5A 1UHWA 5J8CA 1HPMA 2J5PA 1MDMB 1L0OC 1MGTA 2K4JA 3FLCO 3SQNA 4EJVA 3FM3A 4D0PA 4FHTA 4ENMA 4O5FA 1XMKA 4KICA 5FD6A 3SMPA 4F7ZA 1YW8A 3ZEUA 3ZEUB 3F8FA 3B8AX 3E3VA 2A5YB 1QNTA 3KHYA 2FSWA 2P7CB 1SFUA 3FM5A 4N9HA 1U6ZA 4L0ZB 4P96A 1IXSB 4IHSA 1U2VB 5CVIA 4BR0A 4L5IA 1U78A 2FBKA 4YDUA 1PDNC 2P5KA 5AZJB 3MEXA 4XEIA 1E4FT 3D2FB 3U9GA 1F1ZA 1BN5A 3E6BA 1QQNA 2CFXA 2P6SA 3L09A 2GA2A 2QLZA 5H6QA 4CI6A 4RB2C 5AQQA 3RIRA 4A2UA 5K5OA 2RVCA 3SXYA 1U8RA 3DF8A 1LQ1A 5JVTA 5BREA 2YX4A 3WTUC 5F1XA 4BRMA 4Z94A 4ESBA 1YXQA 4G7OF 5AQZA 4OMZA 3VF6A 5F0XA 5CE3A 2I7NA 5L3GA 4OOIA 4BRKA 1ZBSA 4LLLA 3EKSA 3DP7A 4WQ5C 5AQFA 3TPQA 2E2PA 3E6DA 4O5VA 1RFQA 1NM1A 4ENKA 2XIGA 4Z2YA 4DQ8A 2BEOA 1D5VA 2CG4A 5AFUH 2O61A 1QZ6A 2FNAA 4IJAA 1U5TC 3I4PA 4RGXA 1X9JA 3RYRA 1KQ9A 4XH5A 3VEWA 3ZPLA 1SQKA 4BRHA 4A62A 1E17A 1XSVA 4BHCA 1P6RA 3CO7C 3KP2A 3H46O 4BR9A 4ZYEA 4CZKA 3JAMK 1YAGA 1SFXA 5LEKA 4CHUA 3RDIA 4A12A 3HUGA 3O4WA 4IWVA 5ILUA 1G3YA 1KU7A 1T6DA 1O3QA 2CWEA 5IT3A 2P9KA 4WQ4C 4QS9A 3GEZA 4JHDB 3K0LA 5BR9A 1P2FA 1FYMA 1HKBA 1OMIA 1JCFA 3C0BA 4B1ZA 2VCPA 1W5TA 2MLKA 3FFKB 4I2OA 4R1HA 4H0EA 2FF6A 3WTWC 1BIBA 2LNBA 4L9JA 3V8LA 4BG8A 3HOTA 3WTZA 5FFXA 3LAJA 1QPMA 2BTFA 3A5OC 1G99A 2BUPA 4ENNA 4H0VB 5AZIA 2XROA 3VODA 3FF5A 3KE2A 1SD6A 3CJ9A 1QZZA 3G25A 2A6EF 2ZBKA 2E20A 3K69A 5CVVA 2HOEA 1CGPA 4CZIA 3QPHA 4OMYA 5FFZA 1TTYA 3RTRA 3TO6A 4BRDA 3HSEA 5ICGA 5AIPA 1IF1A 3C18A 2GTDA 4ISEA 1CF7B 1R5HA 2FNPA 5HDKA 4MEXF 2E8AA 3KP4A 2J5OA 5JHUA 2UWMA 2DI3A 1IZ1A 2AP1A 2E7XA 1NLVA 2IVOA 2DK5A 2XAHA 3Q9VA 5EOYA 2VODA 3QU6A 2BYVE 1GVJA 3E97A 3GFJA 1BI3A 4RAZA 5A2QK 3L0QA 3QAHA 3I54A 2FMLA 3ZMSA 4OIRF 3TU5A 5KQ8A 2FSKA 1BIAA 2DO7A 4MTDA 3D5LA 1HKQA 2EWNA 2D0PA 3LDPA 3M1FA 1O3SA 5LHHA 5AQKA 3G3ZA 2P5LC 1NGIA 3WU0A 3WTYC 4RB0A 1O57A 4A5MA 4BROA 2C6YA 1FP1D 3FXQA 3A0IX 1FWZA 3NRVA 5K5RA 4Q5SF 2MC3A 2IP2A 2YR2A 3HTSB 3GWZA 1JGSA 5FGMA 1ATRA 1BJAA 1R22A 3U4LA 1ZRCA 3D2FA 5BRFA 2G7HA 1Z1DA 4BRGA 3BP8A 1DPUA 3L4IA 4HV6A 5KPTA 3I71A 2QZ8A 1S7OA 4DQ2A 4YFNF 1O7FA 2H09A 3BPVA 2NRAC 1ZLKA 1MA9B 1SD7A 1OYIA 1C0FA 4JD2A 3J81K 1XC3A 3IKTA 2EJRA 2WUSA 3FXUA 1KGSA 4M9XA 2STTA 1GLBG 1ZYRF 1MD0A 2GAUA 1HX1A 3MCPA 3RYPA 4A2AA 5FLXZ 4G94A 5HVQC 1F9NA 2P4WA 3GYHX 3AARA 4S04A 1EH6A 3QP6A 4HDVA 2GWRA 3ROUA 1GLAG 2JRTA 2YX7A 5J6XA 1SD4A 4PKGA 2F9TA 2D1VA 2BV6A 1WI9A 2D45A 2Q1NA 4UNOA 1BO5O 1NGEA 4G6QA 3S2WA 2VWBA 4CZHA 2HTSA 1LCUA 2PBIA 3DWLA 2FSJA 1J0RA 3D2EB 1B9NA 3LA3A 2GXBA 3F72A 1HKCA 1YIOA 3QFUA 5AQJA 1E4GT 4JD2B 2D0OA 4AM6A 3M1EA 1OPCA 3E5XA 4FO0A 3BOQA 3V7CA 3GBTA 2EFQA 1SZ2A 2D2WA 3V4GA 1HW1A 4AVPA 4WCGA 4K43A 1JE8A 1BM9A 1GHCA 1S6LA 2E1CA 2ZWHA 2L4AA 1HW2A 3FZFA 3L7WA 2PBDA 3WXIA 3ZX2A 3VEVA 2M87A 3WQUA 3ZX3A 4IXCA 1MJBA 3FZVA 3F8CA 4L5JA 2P9UB 3SLCA 3IKVA 3UKUA 3P9KA 5BPIA 1IN4A 3H3NO 4BHPA 1MDUB 1YW7A 3F9MA 2ISYA 3R6MA 5B8HA 3HRTA 5LGNA 3F22A 3LDLA 5JI6A 3TQNA 3AAFA 1SMYF 1U6GA 2KJBA 3BJAA 3F6VA 4L0YB 3H3UA 2OZ6A 2PN6A 5E20A 4UV8A 2L3DA 3ZMTA 2CO5A 1ZRDA 2XAGA 3WQTA 1GXQA 1ZGAA 4P55A 2ASMA 3M6GA 2KKOA 1X3NA 2IIRA 1MJ9A 4J8FA 4CD1A 1Z9CA 3QBWA 4EQQA 1S7AA 4DNCA 2D4WA 2WV0A 3KEQA 3E6MA 4H0YB 1TNSA 1B9MA 1HJOA 4XLNF 2O0YA 1Z6RA 2Q2RA 5K1YA 2HDCA 1BI0A 2DBBA 3O08A 5EVZA 3FXRA 1XGOA 1DUXC 1XSXA 3L2CA 3GLXA 1DKGD 4Y0WA 3V8KA 3PFIA 1QZ5A 4ZH4F 5JLFA 3VF4A 3Q9SA 3VEYA 3RKXA 4BQAA 1XGNA 2L4MA 3B73A 5BOXA 4JN4A 1F4KA 1RI7A 2V1XA 3ERED 4EIAA 1ZG5A 5D5XB 4KDPA 2YHYA 2LDUA 3EYIA 4HF1A 3V7RA 2GXGA 4EV0A 1ZHFA 4M74A 2E1NA 2FA5A 2ASOA 3ABUA 1D8JA 2Z33A 4BGAA 2K02A 2MD5A 3KCCA 5TRDA 3CQXA 3ECHA 2PMUA 1QGPA 4BRQA 3O1BA 3L9FA 4BRAA 2A6AA 5E84A 3MK6A 1HKGA 3JSOA 3GUDA 3GFIA 1C0WA 4CZEA 2QENA 1QQIA 1BOAA 3VEOA 5CYVA 2ISZA 3CLOA 2HGCA 2G9WA 1RNLA 2E1YA 3R4KA 1GLDG 5E1XA 2PQ8A 4U0VA 3KETA 3I53A 3FE1A 4EM0B 2WWYA 5HLGA 3ZN0A 4G9YA 4LC9B 1IN5A 5FPMA 3KP5A 3ZMUA 3UKUB 1J9IA 2XKOA 4I0AA 3E6CC 1ESVA 4I0BA 4JAXA 1WWXA 5AIQA 5DYMA 4CZFA 2CGKA 3M8EA 2L54A 5AQTA 4N9IA 1BG3A 1R5GA 4MQVA 4AIKA 1T44A 5LGTA 3H1VX 1D4XA 1LDDA 3HI0A 2D1HA 2QYOA 4BVPA 2QBYA 4EGYA 3MZHA 2ZXJA 1YFHA 2DPNA 1USTA 5FPNA 4JHDA 4K41A 4ZZDA 3I8BA 4R79A 3VPZA 1SMTA 2HYGD 4HDUA 3R0AA 5BRDA 1RZ4A 4XRFA 3GF2A 4PL7A 2VT2A 1QQOA 2EV0A 3I0TA 3DAWA 4M9SA 4YFXF 3O8MA 4IRGA 1JCEA 5BMZA 1ZG1A 4FWLA 3CUQB 5LGUA 4QLCU 5E1ZB 2A07F 1HLUA 1DGKN 4BXUA 3HRUA 4HW0A 4FX4A 4G8XA 5ADXA 2M30A 3T5XA 4M7XA 2BGCA 2HKOA 5DUKA 4GYIA 4MO4A 4I01A 2W25A 2WC2A 3DEUA 1R58A 1FT9A 3TDZC 4BHBA 4P5OA 4H0OA 5LBQA 1GLLO 5ICCA 4PCQA 3R6SA 1LEBA 4YDUC 1FYLA 4UVCA 3TOAA 2GUPA 2F5FA 1NGAA 3VESA 3EYYA 1USSA 4B1VA 4PL8A 2P5VA 3ATUA 2NYXA 3VB2A 5DCFA 3TO7A 4FWKA 3RKYA 2QWPA 4PKIA 1HUXA 2IVNA 2O8XA 1R36A 2ETHA 3FMRA 4Q4ZF 3IUCA 2HF3A 1HW5A 5EEHA 1LDJA 1J59A 1H9GA 1R7JA 3CUOA 1QO0D 1U2VA 3UKRA 4UXNA 1K6OA 1WUAA 4R8HA 4P9FA 2YU3A 2AS5F 5E8IA 1D3YA 2GIVA 4HF2A 4HX7A 4H5VA 4RGSA 4IXAA 2P9SB 4ESJA 3IWFA 4P9UA 3JTHA 3G73A 3F6OA 3GZ6A 4ON0A 4I02A 5AZJA 2QWRA 3GG4A 3VOEA 3CERA 4BGBA 3LL3A 4LJZF 1K78B 2I7PA 3D0SA 4M7YA 4BNCA 3GDQA 4YG2F 1Z91A 2P9NB 3MN5A 1I6XA 2FF3B 2KJCA 1MJAA 4KBOA 1NMDA 3N97A 3I33A 4BRPA 1AWCA 2ELHA 2MBFA 2EA4A 4RB1A 1NGGA 1BI2A 4BQLA 1TQMA 2JPBA 4MHGA 3KZBA 3DPLC 2VE9A 1S29A 4XLPF 4LG0A 3CDHA 2F5DA 5FLXK 5CVRA 3C7JA 4H0XB 5D8KB 3WUHA 1RUOA 2H6CA 3J80Z 4OIQF 1SAXA 1GXPA 3S41A 4RTFD 2M1BA 3QBXA 2ADUA 4GNIA 2E2OA 3BF3A 3IMXA 4HTLA 1YQAA 1FOKA 2P9KB 3ZP5A 4CXFA 1GLCG 4EHUA 5KVRA 3LDQA 1Y64A 3DXKA 2A42A 4IHTA 1LVAA 4LLGF 4FOEA 5JICA 4IRHA 3GL1A 1HKSA 2OQRA 2FXUA 5D6FA 3T8RA 2ZGZA 1V4TA 4AWXB 1GLJO 3C7NA 5TJJA 4HLYA 2AA4A 5JFRA 4IF4A 5E18F 1WRJA 1U5TB 2VN2A 3ZN1A 1T0FA 4BRNA 3TGNA 4HYEA 1L3LA 1ATNA 4K2EA 3DJCA 2GWKA 3WG9A 5ILVA 3R0JA 3CQYA 1MZBA 4BVOA 3JAMZ 4H5NA 4FWSA 2Q0RA 3AAPA 3ELKA 2QM1A 4KN4X 4XBFA 5DDGA 3ULEA 5L3DA 2ITMA 2E1ZA 3U1DA 3BPXA 4RB3C 1O3RA 1FSEA 5HS8A 1R23A 4Q47A 1TNTA 1IAWA 5AQNA 2DK8A 5L3CA 4WWCA 1TW2A 1J5YA 2HQNA 1IN7A 2STWA 4LFUA 4OU0A 5HOOA 1S3XA 2MA3A 2ZMEA 4AM7A 1S8NA 1IXRC 2L01A 4EJWA 4LB5A 3EKUA 5LHGA 2MH2A 3CO6C 4BC2A 1H9TA 4MNUA 2M8EA 4UHTA 1BA0A 4LB6B 5LY3A 3MZYA 2A61A 2NAZA 2P8TA 3KP6A 3ZMZA 3LDOA 2RV8A 1NGFA 4RS8A 2RN7A 3H45C 1OKJA 3SZPA 2HWVA 1HSJA 2OD5A 3FMQA 3ZETA 3LSTA 2QQAA 1MDMA 3UB5A 2A6HF 1RGIA 5FPDA 3ZQ7A 3HSRA 4WXHA 4O6JA 2EWSA 3CJ1A 2GEMA 3I59A 3I59B 5ICFA 2Q97A 1V4SA 2COMA 1FNNA 2NZTA 5ILSA 2IT0A 1STZA 2A3SA 3A5MC 2OBPA 1MWMA 3CJ7A 5F2RA 5DD4A 4K42A 4WK8F 4CD3A 3ABTA 3F3XA 2K4BA 1KAZA 4MGRA 2YHXA 1FBQA 4EJUA 1ZXOA 4NQWA 4XH4A 5ERIA 3WU1B 2DPDA 2Z3YA 3BZ6A 2ZF5O 2G7UA 4BR2A 4HQEA 3K9TA 2H27A 1NGBA 3BF1A 1IXCA 2VE8A 2EV5A 3WTTC 2CGJA 2VXZA 3ZX0A 3HYIA 3REOA 5ADXH 2O03A 4JK1X 3EZWA 2FMYA 3K2ZA 1YS7A 1Z7UA 1BUPA 3H92A 3QMLA 2RDPA 5FD5A 2RKHA 3F21A 1SAZA 3B02A 5HLHA 1W7PA 2YJEA 3IRRA 5I9EB 1Q1HA 1Y0UA 5EXWA 3ECOA 2GA1A 2WTEA 2V1DA 4B1WB 1ZC6A 1P92A 2V7YA 1LEAA 4A0ZA 2V51B 3VGKA 4H5RA 4JNEA 4HF0A 5AQGA 3F8MA 3LM2A 3QPTA 1IRFA 1R1UA 2P9PA 4ASNA 5ICEA 1K79A 2Q36A 1XN7A 3C1DA 1T6SA 3HBTA 4PZJA 4WYBA 2M5WA 1CF7A 3CI5A 2XGXA 2NS0A 3ENOA 3K1NA 3MN6A 2CQKA 3KFWX 2LF7A 1FSHA 3HHGA 2DAOA 1QQMA 4WQ4A 5CVUA 1KXPA 2OU2A 3VENA 3J8AA 1YTYA 5BPLA 3FHZA 3A5NC 5ELZA 3FGUA 3T1BA 3FZHA 4HZFA 3GW2A 3N4MA 5AQHA 1NBWA 4IJNA 4E70A 2V9VA 4L18B 2ZO4A 1KYZA 4OIPF 3GFLA 5D4RA 3BWGA 3P9CA 1J75A 2Q0OA 4UV9A 5AFUA 1ONVA 5KPRA 2LKPA 5LEJA 1G3WA 3V7SA 3VETA 4I98B 4EHTA 3M3ZA 1U3EM 1XGMA 2DU9A 3P9IA 3IDHA 2VT3A 3TKYA 1TBXA 1XUPO 4HQMA 3MDQA 1PP7U 3HRMA 2OA4A 1ULYA 2DTRA 4BREA 1Q18A 2LSOA 2QWOA 3KP3A 4ETSA 2FF4A 3ENHA 3W0LA 2HS5A 2XKPA 5K5QA 5AZIB 3GFMA 4NB5A 1KU2A 3ULQB 4KNYA 2XAFA 1YYVA 4ENJA 2FE3A 5AQSA 1G6NA 1EV7A 5CVJA 4FWRA 2W57A 3DV8A 4FWOA 4CJ7A 2CW0F 1GLEG 2FXAA 2M45A 2HFHA 4CGZA 1P4XA 4O8KA 4M73A 1YLFA 3TDUC 4M63C 1J6ZA 5L3FA 2Z5UA 1LNWA 1HSTA 1FYKA 4LK0F 1BI1A 2PI0A 5DV5A 3HSCA 3CUQA 1YUWA 3HTVA 3ULEB 2DQLA 2R7DA 3H3OB 3ZETB 1XD7A 4ISFA 3SJHA 3VGLA 3J7AO 1B59A 2UZKA 3MQ0A 3LFKA 1NGHA 3P4IA 3PQKA 2KIMA 4EJTA 3SK3A 1FBSA 3R60A 3F8NA 4G7HF 3E5UA 3HOSA 4FOIA 3WE2A 1WQ2A 2ZCWA 4L9VA 2X0LA 3JS6A 1XGSA 2W85A 4MLHA 2JPCA 2VBZA 2NRHA 2E7WA 3KLOA 5BPDA 2P9IB 1ZREA 2QWMA 2UXXA 4OIOF 5EEGA 3CUQC 1KU3A 4M6YA 2F5EA 2K27A 5FO5A 4N0BA 1OYWA 1K8KA 4E1JA 3RSEA 5L3BA 4BR4A 1IRGA 4UUVA 2HMPA 2CGPA 3DXKB 4FWQA 1TLHB 2Y48A 1HBXG 3HIFA 1UCRA 4YIFA 2FLOA 2A3ZA 1B4AA 1R00A 2P7VB 4B8XA 3C7NB 5IT9K 3F8BA 2GZWA 3MFKA 1RUNA 1XB4A 3KLNA 4HV5A 2MH9A 4ISGA 5J8FA 4WXDA 4U88A 4BRFA 3W6KB 1JCGA 4NO7A 4IO8A 5AQIA 4CBWA 5D5VB 1I1SA 1HQCA 1JHFA 4PKHA 2K7LA 4LLNA 5JLHA 3ZMDA 1XDUA 2YJFA 2D1KA 2P9NA 5AQVA 2Q8KA 3ZMVA 3QDKA 3MN7A 3CJAA 3L6QA 1BWFO
chains in the Genus database with same CATH superfamily
4B9QA 3EDPA 4XM3A 4CGJA 2NNNA 1BL0A 4ZYHA 1K83J 1BBYA 3OVNA 4K25A 3K4JA 4DTPA 1N36K 3MN2A 2F96A 3JAMO 3SHFA 3QFPA 2P81A 1IRZA 1TK8A 3DKWA 3HTUA 1LOTB 1ACIA 1BU6O 1IG8A 2HPIA 4BRCA 3WTXC 3AO1A 3LP3A 2JT1A 3SI6A 1JXBA 3AVKA 3AKZA 1WCMJ 4Y15A 5AQMA 2PAVA 1VQMI 4G12A 3KEYA 5JHFA 2KHOA 3G6EN 4HX4A 2PJPA 1XC5A 1D9DA 2FBIA 2FOWA 4ZYGA 1NGDA 3WGIA 3GVAA 1QZEA 3S1QJ 4XSXF 3J7YJ 2CGLA 4KTZA 2VIXA 4XKCA 2V52B 2Y1JA 1VSDA 1YVNA 1NGJA 1TQIA 2OAZA 2ESHA 2H94A 5JR3A 4AHRA 2QWLA 1QTMA 1T33A 3HBLA 1IO2A 3VEXA 1HXDA 1EH8A 2VG5A 3COAC 1WKMA 3GO5A 1RDWX 3EN9A 2G0EA 3NF8A 3QEPA 3CMYA 2EPFA 3M8FA 2HR3A 3QO9A 2X6WA 4EGZA 2OZUA 4GVEA 3HM9A 4DF8A 4WFBL 3AVGA 3W6VA 1VQNN 1T98A 5H20A 3ATVA 3AG3H 1N78A 4ZHRA 5DTDA 4PDKA 4BG9A 2YPRA 3O9QA 2DFFA 4XK4A 4CECA 5AQPA 4IQ4A 2GELA 4A61A 2XRNA 3BTCA 1X1PA 3QOPA 1ZH5A 5FPEA 4RMNA 2V1UA 2Y0MA 4FX0A 3J80K 5KPZA 2VASA 2OPPA 2DA4A 3V8JA 2HF4A 3SBGA 2G8FA 2HHTA 1LDKB 1RDBA 3ZR8X 4P1WA 2CH5A 1X2MA 2XPVA 4RCHA 5LL6Z 3LZJA 3WEEA 1QVGM 4ZJZA 1K4TA 1RBVA 2ZQBA 3WEEB 2YI1A 2CV2A 1UG2A 4HX8A 2IGOA 2KHMA 3U3YA 4BC4A 1CZAN 1XDSA 4CEBA 3VOVA 4K0KK 4KMUX 5KK1A 3TAQA 3ONQA 4PUSA 4ICLA 4CEOA 4HA8A 5DS9A 2VXDA 2DDAA 2IA2A 4D5FA 2CFOA 2TCTA 3E7LA 2FBTA 3VQ7A 4C23A 1YHQN 3CJBA 2BDPA 1GV2A 2EB7A 3LALA 1ON1A 2BY1A 3R9PA 2E6MA 3WXKA 3IH3A 2QVOA 2BE2A 5FLXO 2VWJA 1SFKA 1JTYA 4DS4A 4AHUA 4GGGA 3OHRA 3QU3A 1X1CA 3M7GA 3O2PE 3TO9A 4DSJA 2EK5A 2Z99A 1X1BA 4E19A 5EGOB 2A41A 1YS6A 2YSRA 1OYYA 2HYFA 4LOCA 4ZC3A 4A5NA 2VPLA 2W7NA 1JLGA 4XQFA 1ETVA 1XMAA 3FX3A 1H88C 1K78A 1APLC 2NRRA 2DOEA 1GLFO 2P9PB 3CIPA 4IOAL 4IG3A 3O4NA 5AQRA 4DTNA 2CRGA 1CZBA 2QM3A 2NNYA 2R7TA 2YCHA 5CLSA 5LHIA 4KTWA 4PJ0C 3Q5FA 4Y52J 2ZNYA 2VKVA 3KEOA 2F48A 4B1XB 3WGGA 2YHBA 3SV3A 4LF9K 4CA0A 1TT5B 1FLIA 1R1VA 2X1EA 3DU5A 2IA0A 3FWEA 2Z9OA 1YITN 5EY4A 5A2QO 5CZ1A 3DOLA 3CETA 3QESA 4RWTA 5BS6A 1WBBA 4CZZA 4FJ8A 2VBXA 3ZT1A 3QRFF 4HNTA 3GE1A 1IKXA 3BG9A 3S16J 2DW4A 4OO1J 4MLEA 2MSYA 2XF6A 4OKJA 3EY1A 2MD0A 3BR5A 1KZHA 1O3TA 1FIPA 3K7AJ 2XY6A 2K3FA 5E1WA 1J2XA 5KCMA 3RSNA 1TWAJ 2DCEA 1LE8A 1F5TA 3JR9A 4GV3A 4HBLA 2NVQJ 3LP1A 4AF1A 5DEQA 3KVGA 2X6SA 3ZQCA 2BE5F 1V4RA 3GXOA 4KMFA 1JLBA 3BEXA 3SMSA 2EIMH 2WADA 2RC4A 5AQWA 2G8WA 3P7NA 4QWQA 1O7LA 4NNJA 4OAZA 5LLQA 2VONA 1Q1VA 3IFRA 2DLLA 2W84A 1NKEA 2E19A 3SAGA 4A0YA 4KREA 1ZGJA 1ZK8A 1ZBLA 3I64A 1B1BA 2DMQA 4HCCA 3D2EA 3OIPA 4ANJA 2F2EA 3S1NJ 3K4NA 4IVNA 1W0UA 3K4CA 4ZZLA 4G6TB 1NWKA 3OJUA 5M5WJ 4FPBA 1LPQA 4KA4A 4CJLA 4BH9A 1G4DA 1J7KA 4BAYA 3QPLA 4XLCA 3VYUB 1R1TA 1H89C 1S6PA 4DQSA 2MLGA 4HLXA 2DPUA 1A04A 2OANA 1K8AO 3NE6A 1ZLJA 1ATSA 3NEUA 1KVBA 4Y17A 3VPRA 1CQTA 1WSGA 2CH6A 1XC9A 2CQQA 2IW5A 2RNJA 4IHWA 2QGUA 5HP1A 1KU9A 2Y0SA 3LA2A 3E0JB 4I9QA 3R8EA 3V9XA 2ID6A 2R7FA 1DP7P 2FRHA 1P4AA 3DRSA 3O5BA 1N77A 3RSEB 4CJVA 5H6RA 4E7HA 3TAFA 4CHNA 1N75A 3HJEA 4MEYF 3W6JB 4AIHA 2OTLI 3KD1E 1Y0NA 1TWCJ 2VKEA 3K1PA 2P5OA 2E88A 4NCBA 3NWTA 3O80A 3BR2A 4ILJA 3K2AA 1T95A 4CHOA 4F3OA 4GDFA 3A2KA 4AIJA 4ILGB 4CIGA 4B3OA 3G2BA 3J81O 1Z05A 4MTEA 2E1MB 1I5ZA 1FMWA 3ZQFA 4H5TA 1F36A 3DEEA 3IC7A 2LF8A 4HNVA 4G7ZF 4JBAA 4J2EA 1XS9A 3MWTA 3H3ZA 4B1UB 4B3SK 4OWRB 3CMAN 1PUFA 4GV6A 2XAJA 3KZZA 3U8XA 2Z1HA 1TKZA 1S1UA 4YOWA 3HGGA 2K86A 4D7MA 5FB2A 3LPUA 3ID6A 2ESNA 1JGGA 3C6HA 4E0DA 3LAPA 5HROA 4O8UA 3CCVI 3O6BB 1T8IA 2PZSA 1WLJA 1FBUA 4BY7J 4D9JA 1BC7C 4AH9A 1ZBFA 2NVUB 3QB0A 1Y97A 4GV9A 3O9TA 5CQEA 1Q7YO 3F0CA 1XMOK 4DV4K 1KA8A 4F55A 2BGGA 1XSDA 3AVFA 3DXMA 1DU0A 4CJKA 3CMMA 3OYNA 3NFAA 2L9NA 4RGUA 2RN2A 1E3HA 3EQLF 4FWPA 3KTQA 1TWFJ 1WGXA 5IT9Z 3BZCA 1RTHA 4EM1A 2QWNA 1C0MA 2HHXA 3LSRA 4FLXA 3IAYA 3PQJA 5GADJ 2MG4A 3HHHA 3LMMA 1RILA 2JWLA 3THXA 2OYQA 2O8BB 4CF9A 4L9TA 3WE3A 2XAQA 3WT0A 4I7HA 4DYQA 3G1LA 4U87A 4AHTA 2IPQX 3MAJA 1TW3A 4L9NA 4NUBA 5F0HA 1TC3C 3EL2A 3CC2I 2DMPA 4KN7X 2Z16A 2Y0SN 3EE9A 1IV6A 3JRDA 1E2XA 1S7EA 4ZYDA 5EU7A 2HNHA 2L02A 3DLBA 4CZGA 5DCMA 1WPKA 2HPMA 2K3PA 2GM4A 4E6KG 4CE9A 3DLHA 2IVPA 3TWHA 4C3IJ 4M3ZA 2P9LB 5GINA 1W0TA 3SPYA 1K61A 2ZXIA 5TKYA 3SFZA 4BDZA 1BCOA 1ZG3A 1IC8A 3U9DA 4DCHA 2QWQA 3RPUA 4LY7A 4FLYA 4BC5A 4Y13A 4FWNA 4FLZA 2PFBA 2QUFA 1FOWA 2FBHA 4OKKA 1QVFM 2KP6A 2DTZA 5IP9J 3ZT4A 4DG1A 4WX9A 5F08A 2FBYA 2ZGYA 1IW7F 5C10A 1BGXT 2E6LA 1Z6TA 1NGCA 1FIAA 1VHXA 3LDNA 4JX6A 2JTVA 4YFKF 2KZGA 2GOMA 1AHDP 2DT5A 3S1MJ 3IRQA 2QXFA 2O6GE 4I6MB 4CZJA 3H5NA 4LGWA 3K70C 2WA0A 1W97L 2VWKA 4D5CA 1Z26A 3RKWA 2ITGA 1U5TA 1BI4A 2NLXA 4B3TK 4LSNA 2VOPA 1D1CA 3K4LA 2M3AA 2NS7A 3TSUA 4CHYA 2HQAA 4EVIA 3SQ4A 1L3TA 3RRGA 4FXDA 2ZMEB 1G3TA 3BR6A 3K4KA 4C3HJ 2JA5J 1WSFA 2EV6A 3WGHA 1LB2A 1W36D 2KRFA 2HZTA 3CESA 2O3FA 1RDAA 2EFWA 1IN6A 4RW4A 4DUZK 5BN9A 5HRRA 4KHSA 3W3DA 4EAHD 3VF2A 3J81Z 3BTLA 1RR8C 3VQ9A 2ZXHA 1FY7A 3LWFA 5HS7A 4RGRA 2OPTA 3JW4A 1W7PD 5E8GA 5C2FA 4DR4K 2PLYA 4H5WA 5EX5A 3GOIA 5LMUK 2XGDA 2JA7J 1LW2A 2GX9A 1T6CA 3BY5A 5F1RA 3OIOA 1FX7A 1VSFA 2F4MB 2QKLB 2QWWA 2E5ZA 3EUHA 1N8RO 2FU4A 2DODA 4E4HA 3M9AA 2A1SA 2Y2ZA 3THYB 1KLNA 1Z0XA 2XSDC 2RGVA 3MMVA 1NMNA 1LFPA 2ZJQF 3CFPA 5TISC 1UHMA 4HAMA 4XR6A 2NUBA 2O8DB 4NCAA 2HTJA 4OGEA 4BRIA 3ZQGA 2GIZA 4GKJK 5LJVA 4BJ6C 4FJHA 2XASA 3OYGA 4L3QA 2NVXJ 3SZTA 5EF6A 1E3OC 5F6FA 1HQUA 3MEGA 3WXJA 3KZYA 1MMSA 1S3JA 3SUOA 3ZOBA 1W1WE 1T38A 3VEZA 4KI4A 3OYKA 4B09A 3HZ6A 3NQOA 3EO3A 2A40A 1OKRA 4M9ZA 3DLRA 3RMAA 4IBNA 1V54H 1KFSA 4JI2K 4BDPA 4E7IA 1ZAOA 3IHUA 4WXCA 2Y9ZA 2P9UA 3HL2A 2ASPA 1JLQA 5H1SQ 2MYSA 3Q7CA 4CO8A 4FETA 3CF5L 2RHKA 4OX9K 1X19A 4B43A 2NRVA 4LG0B 4BR5A 4FZZA 2Q31A 1LWEA 5EZHA 1LKXA 2QQ9A 4GRIA 4JQFA 3ZT3A 2Y1IA 3Q0VA 4XRSG 1VQPI 2F5CA 2JZYA 4M3DA 4GFBA 2CSOA 1VTNC 2ECCA 1S1WA 1JLEA 2BBYA 4M6XA 4KT5C 3A8YA 3GX4X 1SC7A 3CQZJ 4FJJA 1OVYA 2JK3A 2XHKA 3SYTA 3OJSA 2M34A 3S2DJ 3KJVA 4DQIA 3WTSC 1K7AA 3C6AA 1DDNA 3U9ZA 5BQTA 4MFEA 1YRNA 4BRLA 4FJ5A 1ODDA 2A69F 3L1PA 2P9SA 1GOCA 3PIPL 3G71N 3AVLA 1C0GA 1IBLK 4IEIA 2VB6A 2WFBA 4NB4A 2A68F 2UYTA 3CHWA 1ZN2A 3P1GA 3HVRA 4KHQA 2XY5A 2HXIA 3TOBA 4YY3K 4BR7A 2IVMA 2IAIA 4RBOA 1W4MA 3VMFB 2VOOA 1RT6A 4BQZA 3HSFA 3JTGA 1G15A 3MCZA 4M71A 4U7DA 3O3KA 4GXOA 1VQ6I 1R4NB 3JSPA 2EFNA 1A5XA 3NAEA 4FJNA 4GYGA 5HDNA 4YIIA 3FXLA 3M8SA 2X74A 3CYMA 4B1YB 3ZRGA 2UUBK 5D5UB 3P83D 3LQRA 4DTSA 1ETXA 1VQ5I 3H6EA 1VQLN 2DFHA 4JI8K 4IDHA 5E3NA 4I2QA 2O7OA 3IL2A 4F3QA 2J4RA 2Q0UA 2RPIA 1REPC 2G8KA 3VFZA 3RI4A 4DSKA 4A2BA 2EA2A 4V2FA 5IYCJ 3AL0C 2LSNA 1X3ZB 4FJGA 3JXUA 2BZTA 1OLTA 5LRSA 2E1OA 1NOZA 4D7NA 4IZZA 1OCTC 3F9KA 3D5SC 3FDYA 3HRSA 3I3LA 4TV7A 5D8LB 5ED4A 1MKMA 3I4NJ 1K8KB 4DV0K 3SYZA 4FK4A 3RJPA 5HODA 1P8ZA 2QSFX 1WAJA 1LWFA 4I2PA 4KH6A 2VQLA 3CJCA 4QS8A 1MU2A 3I56N 3BUZB 3LFUA 2PMHA 4JOMA 1UWBA 4GY2B 5D4SA 1E3PA 4HOBA 4LK1F 1D0XA 4F4KA 1SD5A 4JK8A 3CTAA 1T08B 4LFBK 2M4GA 1YO5C 1YJNN 5LRRA 2DYRH 2CUEA 3S8PA 4BS9A 1P4WA 3IWZA 2FBVA 4IPAA 4V2GA 2V79A 4A0XA 3FZLA 3OBYA 4AC0A 2GUIA 2LH9A 2WONA 4RAFA 2KT0A 1JJ8C 1B6AA 1LV5A 3H35A 3C3WA 3RPQA 4CK3A 1NJIO 4FJMA 1W7PB 4PGGA 4JYAK 2I5UA 1I50J 3ISPA 4KYWA 1Z25A 1SKWA 2R3SA 3BT9A 3FMSA 4KAZA 4OGCA 2VC1A 4CDGA 4DQQA 4FJ7A 2ZJ2A 4J01A 3CJNA 3G4SI 4IO9F 2HNDA 4JYKA 1W0HA 5B5EC 3A02A 5DK5A 3CCEI 4DFJA 1BQNA 4AHSA 3V81A 2O4IA 3H1QA 3EETA 1BR2A 2PX9A 3BR1A 2H1KA 2ATQA 3CMEN 4GKKK 4C2UA 4JI5K 2QXLA 3QICA 4IZ9A 3ID8A 3HP6A 2Q2EA 4KIFA 4IFVA 3FXOA 2LVSA 5F0FA 3K5NA 1UA0A 3A5LC 4AHCA 2V7ZA 4C8OA 2HDWA 1KYWA 1U4BA 4WQ5A 4H0TB 1QZYA 4BC3A 1I1GA 2HOAA 1E3MA 4C2MJ 4KISA 5C3EJ 1NK2P 2ZB9A 5L3EA 2KISA 3DQVC 4JKFA 4RW9A 5KTQA 3UIQA 4IHYA 1TK5A 1PP8F 3MWMA 3AY9A 4BQOA 3VWBA 3KP7A 4LD0A 4EFHA 5HRPA 2F4IA 3AG4H 3T0YA 3ZQIA 2ACJA 4CFBA 3NGZA 3E1YA 3BJ6A 2F9WA 1SVLA 1WSUA 4XKVA 2HVIA 3QP5A 1BIZA 4KIBA 1JXSA 1PVEA 1YOVB 3K5LA 1WJBA 3O1WA 4U0WA 4KH4A 1OCOH 1JKHA 1XX5A 3F23A 2XV4S 1ON2A 4AIDA 1A5VA 1YT3A 5B66C 3FK7A 3AA5X 2VQHA 1UMQA 2WB1A 1S1XA 2D0CA 3I55I 3B6OA 2B0LA 1RIOH 4GMJB 5BN8A 3VSLA 1TUUA 4PQUA 2H3GX 1TUYA 4DLEA 1OR7C 2OJED 5FKNA 5AR0A 4DBRA 1GDTA 2WAEA 2ZKZA 2PEXA 4CCLA 2LD5A 1HCRA 5AQLA 1JHHA 4KUMA 5GAEJ 3ZSWA 2OTLN 2VC0A 5BRHA 1RKWA 1JLFA 1MMAA 3X2QH 3L2QA 5HRSA 3LQQA 2K9MA 1X3MA 1SVMA 3BY6A 5E26A 5B1AH 3MVPA 3MN9A 1KAXA 4CBXA 1ETWA 3V1OA 2DFIA 1QA6A 2VUMJ 2E2NA 2CQXA 4LH4A 4UVAA 2E60A 2X4HA 4F9OA 3ZQLA 4N4OB 4KIGA 5M3FJ 3ENBA 3B6AA 3VERA 1BW6A 3WXLA 2W24A 4PHTX 3R61A 2K40A 3UNGC 4M3BA 3K9JA 3LM9A 4I09A 2KFDA 3K1MA 1FOYA 4FLUA 2OTJI 4DGWB 5A2QZ 2TDXA 4KFCA 1IJJA 3GBGA 1IV8A 2KIFA 2EFPA 3MKYB 4H03B 4EZ6A 1OQYA 2HEOA 1IN8A 2BXYA 2KTQA 3A03A 3VYSB 3FR0A 2Y31A 1EP4A 1S22A 3KWGA 4W1UA 2FSNA 4DFKA 2EFOA 4MFDA 5F64A 1KAYA 5TKWA 2M7BA 3SQ0A 4ELVA 3DXJF 1FC3A 2YHWA 4A6DA 1I27A 3O8HA 5TGTA 1UZCA 1FPQA 2KIUA 1MH3A 2ZM6K 4S05A 2QKMB 4EJOA 2YNHA 5GAHJ 4NHJA 4O44A 3QWLA 4M3GA 1VQ4I 1MW7A 1ZR4A 4O3MA 3KYDB 1CXUA 4H0PA 4RDUA 3VQ4A 4FLWA 2RQQA 5HLIA 3HGYA 3ZSVA 1C1BA 1MH4A 4RW6A 4E1MA 1T39A 3C95A 5AQOA 1MBKA 2V6CA 4DIQA 3UR3C 2UXNA 5DD8A 4ZYAA 3WTVC 3HM8A 1OR7A 2XRLA 1KQ0A 4H4OA 2IJLA 4CZLA 4U67L 3QETA 4CW7B 1RTDA 4I9LA 5AONA 1PUEE 4MO5A 2H6BA 3WNEA 4FE4A 4FASD 4JS4A 1YRNB 1XWLA 1XCBA 4CYCA 3VQ6A 1DPRA 1EKEA 4N5SA 3M1CA 1HJRA 2IA1A 2O8DA 3CCQN 3DKXA 4LMYA 4QPQA 2IC3A 4FJIA 2OPRA 2X1DA 4QS7A 1LE8B 1KQ8A 4HHTA 3CF2A 4CBUA 3MKWB 1Y1WJ 1HNXK 4G6DA 1YX5A 5LJWA 4B9SA 2HKXA 1MWKA 4F8RA 2XF5A 5DM6L 2P9LA 2EH3A 5GAEP 2XSJC 3T7ZA 1HKTA 5SZTA 2Y75A 4E7KA 2IRFG 6PAXA 4FWMA 1V5FA 2E4LA 4EMSA 2OQGA 4XH1A 4AD9A 3WODF 1BA1A 1G59A 1AOYA 4DS5A 1LFBA 4XLAA 4IOAF 4CZMA 4MQ9F 2LKXA 1XQSC 1SEUA 3GZ5A 5F04A 2QBYB 3LA7A 2HQ5A 1U0JA 1QRYA 2LFBA 2DMUA 1GT0C 4U0YA 3ML6A 2E2QA 4F93B 1QBJA 3G0ZA 3U2RA 1RDUA 3TARA 2VYPA 2GWJA 2ZFWA 4RAYA 5AQXA 2W41A 2HBKA 4XLHA 5DUIA 2PYJA 1ZRFA 4EM2A 5F1JA 1WI3A 4CJTA 1X3UA 3IS9A 4CFCA 5HDGA 2XO7A 4UVBA 3HPOA 1BR4A 1BI4B 4OINF 3NGIA 1H0MA 3VEPA 2GLOA 1ZBUA 2L5QA 3VSKA 2RQPA 3R1XA 5BPNA 4LD5A 1FP2A 2DOFA 3I58A 4Q48A 3CCVN 1VQ9I 3FZMA 2XVCA 4BYYA 2XDVA 4FL9A 3K57A 1VK0A 1H1VA 1A6IA 5JMVA 1WOQA 1ETOA 2JSCA 4BGDA 3HOVJ 3LAMA 2QW9A 3OOPA 3Q0WA 5B3SH 1UG0A 4DHYA 1FZPB 1U2WA 3OV8A 4PFPA 2ELKA 2EQRA 1JKRC 1YG2A 2V1NA 3FZKA 4UB6C 4XIDA 4GCVA 2FEZA 2E2IJ 4FPAA 4DTOA 4CJQA 4F2SA 3BDDA 4GO1A 1LJ9A 2MGQA 2P6TA 1G3SA 3V42A 4CICA 4CYDA 3BJOA 2YHAA 1YW9A 1UFMA 4IRIA 2PG4A 3BROA 5HS9A 5EJCA 1S9GA 4QCLA 1VQNI 3G10A 1BOTO 4M3RA 3CP2A 4DB3A 5FKLA 4HSTA 1EQYA 4FSVA 4DKWA 4FLVA 2A1RA 2PMZA 5DCMB 3DTKA 2FD5A 1DTQA 5KQDA 1MBFA 4XICA 2KQRA 3C2HA 5E17F 4X62K 3G1MA 1J5OA 4CF8A 2FOKA 4M72A 4PGHA 4I6MA 3LP0A 4CH7A 3NWSA 2QQBA 1SFEA 5KAFC 3L00A 1IG7A 3CPEA 5AQUA 2R7XA 2NRZA 1B92A 1D8KA 2L9RA 1U49A 3M3YJ 1TYQB 3I5UA 1BDGA 5D5WB 1QHAA 1DEJA 3FFIA 2GQQA 1PJRA 2R0QC 1T2KA 1BC8C 4FW2A 4YORA 4HWIA 3OR2C 3EYZA 1Q9YA 2XUBA 3O6WA 5AQYA 2HQRA 1L3SA 2UXDK 1EA3A 3KD5E 1JUSA 3T8TA 1UB9A 1XCVA 1EH7A 1KONA 1TQPA 2AXLA 3DPTA 3K70D 2FQ3A 1J53A 1S6QA 1D0ZA 2DQRA 1UAXA 3DXMB 1NHAA 2ZNZA 3RR7A 4A6EA 1R59O 1ZARA 1TL1A 2X78A 2VBWA 3AAQA 4DSEA 1VQ9N 1OJLA 4ESFA 2WY8Q 5D6EA 5CJ9A 3IH2A 4CUGA 5GAGJ 4U7BA 2VBYA 2HOTA 1W5SA 2A5XA 1HA8A 4DW6A 1V3FA 5EZGA 1TYQA 2W40A 2JRMA 3OYCA 2BVLA 3D7EO 3ZCMA 3ZSXA 5BPMA 4M3UA 4WF2A 2P51A 4FT8A 2CYYA 2KLOA 1IUYA 2P9IA 4CJPA 3WU2C 3E5QA 2E34A 4BWJA 1IBMK 3DFGA 4XSZF 2Z2SB 3UKRB 2W1OA 4FK0A 3UE5A 1QHHD 1UHWA 1IGNA 3AVNA 5J8CA 5JVHL 1NK9A 4A3CJ 5J1RA 1HPMA 2KDZA 2J5PA 1MDMB 1L0OC 2OA8A 4JX4A 1MGTA 1ERDA 3K9KA 1ENHA 2K4JA 3FLCO 3SQNA 4EJVA 3MXMA 3FM3A 4IKFA 4FW1A 2ZC2A 1RT1A 4ID1A 1IH7A 4D0PA 4FHTA 1RT7A 4M3XA 4ENMA 1J9AA 4O5FA 5J2NA 1XMKA 4KICA 5FD6A 3SMPA 3MWPA 4A5AA 1VRUA 3HT3A 4F7ZA 1YW8A 3RCOA 3ZEUA 3ZEUB 4DTJA 4J2DA 3F8FA 3B8AX 2GOXB 3E3VA 4GW6A 3PX4A 1ZBIA 1QSSA 2A5YB 1QNTA 2P1JA 4B1RA 1MSEC 2FSWA 3KHYA 2P7CB 5H2FC 3RRHA 1SFUA 3PIOL 3FM5A 1U9OA 1A36A 1ETQA 4LF7K 2G8UA 2ME6A 4N9HA 4UY8I 2DJNA 1U6ZA 5JVGL 3O9RA 4L0ZB 1VSEA 2OCEA 3LP2A 3AVHA 4PUOA 4P96A 1IXSB 4IHSA 4A3JJ 1U2VB 4F3TA 3IAS2 5CVIA 4BR0A 1TWHJ 1Y8RB 3RZOJ 4L5IA 1MMNA 4IOXA 4ZDLA 1YTAA 1U78A 2FBKA 4YDUA 1PDNC 2JVGA 3ZSZA 2P5KA 5J2QA 3GTLJ 2ZJQL 3N05A 1YIJI 5AZJB 3MEXA 4XEIA 4CEEA 1RR7A 4XN0A 4LF4K 9ANTA 3A01B 3BG6A 1E4FT 3F5TA 3C6UA 2JQ7A 5DMRA 5CR4A 4DV6K 3THXB 3D2FB 3U9GA 1F1ZA 3SBTA 3FHNA 3SQ2A 1BN5A 3E6BA 1QQNA 4KFBA 3NH1A 2CFXA 2P6SA 3DBHB 3L09A 2GA2A 3I9V2 1D9FA 2QLZA 4B44A 1YI2N 1WFXA 1MMDA 5H6QA 4IFYA 4CI6A 4RB2C 5AQQA 3RIRA 3VA0A 2XRIA 2W6KA 1P9QC 4A2UA 5K5OA 2RVCA 4WE1A 5KHDA 3SXYA 3JCUC 3LSHA 3SZ2A 1MMGA 1U8RA 1MNMC 3DF8A 1LQ1A 5JVTA 3K5OA 1L3VA 5BREA 2YX4A 3WTUC 5F1XA 3QEXA 4BRMA 2R5ZA 4KHYA 4Z94A 4FZXC 5B1BH 1Z77A 4ESBA 1YXQA 4TSXA 4ZTFA 4G7OF 4MIMA 4OMZA 4I7FA 3E9LA 5AQZA 3VF6A 5F0XA 5CE3A 2I7NA 3DMJA 3OR1C 5L3GA 4YIRX 4Z4GA 3GMEA 1NOYA 5IT9O 4OOIA 4CZCA 1ZBSA 4BRKA 4FQGA 4LLLA 5E3OA 3S3NA 3EKSA 3SDBA 2XGEA 3DP7A 3G4SN 4WQ5C 4DTXA 2LC2A 2QSGX 3CFOA 4X0GA 3WHCA 2E71A 1HYVA 2E2PA 5AQFA 3TPQA 4CFDA 4JKDA 3E6DA 4O5VA 4XONA 1X4OA 1RFQA 1NM1A 4ENKA 3KX2A 2XIGA 3E9OA 5J1EA 3A1YA 1FJLA 4Z2YA 4DQ8A 3J7YP 2BEOA 1D5VA 2CG4A 4CHQA 5GAHP 5AFUH 2O61A 2DY4A 1MBJA 4FISA 1QZ6A 4O5BA 2FNAA 4IJAA 1S1VA 3KK7A 1U5TC 3I4PA 2X48A 4RGXA 4XLEA 1X9JA 3J7AP 3RYRA 1SANA 1TGOA 4PJNA 1VRTA 1KQ9A 5FRMA 4BUPA 1LAVA 4XH5A 3VEWA 3CG7A 5LMNK 1ITYA 3ZPLA 2Z1GA 4LF6K 2COBA 5KRTA 5C0YA 3M8QA 3LANA 5C15A 3ZQHA 2JGUA 4ELUA 1SQKA 2RF2A 2YNIA 4PY5A 4BRHA 4A62A 3RQ4A 1A5JA 1E17A 1XSVA 4BHCA 1SL0A 3NVKA 4KPYA 3CC2N 1QSLA 1P6RA 3CO7C 2V26A 3KP2A 1QS4A 1WN7A 2L7FP 4ZYEA 3H46O 4BR9A 3ZYYX 4CZKA 5IPAA 3BR3A 3JAMK 3CMAI 3L2VA 1YAGA 2HNYA 1SFXA 5LEKA 4CHUA 4MDBA 2WTUA 2X9DA 2O8CB 2HHSA 3PNYA 3RDIA 4A12A 3HRGA 3VN5A 1OFCX 3HUGA 2HHHK 3KYCB 1VQ6N 3OSFA 3O4WA 1Y39A 5ILUA 1BJZA 1JL2A 4IWVA 1G3YA 4NC6A 1KU7A 1T6DA 2JJ7A 1O3QA 2CWEA 5IT3A 2P9KA 3AA2A 4FJLA 4WQ4C 4QS9A 3GEZA 4JHDB 2O8KA 5GADP 2P0WA 4II2A 2FQ4A 1HDPA 1VSLA 3K0LA 3D6RA 3JRIA 5BR9A 4J19A 1IJWC 3UKGA 1P2FA 1FYMA 1HKBA 1REVA 1OMIA 1JCFA 3C0BA 4MLOA 4K8XA 2LY1A 4B1ZA 4CEDA 3NH0A 5I42A 2VCPA 1W5TA 2MLKA 3FFKB 2DA7A 4R1HA 4I2OA 4H0EA 2FF6A 1LWCA 1SFOJ 1BIBA 2LNBA 4L9JA 3V8LA 3WTWC 1AU7A 3HOTA 4BG8A 3WTZA 5J2MA 3SDGA 2D0BA 1VQPN 1IBKK 5FFXA 3LAJA 1QPMA 2BTFA 4J2AA 2AJQA 2KL4A 3P5JA 2QEXI 4DOZA 3S14J 1G99A 3A5OC 5GIOA 2BUPA 2XY8A 1I94K 4ENNA 4H0VB 1ZR2A 5AZIA 4C1NK 2XROA 3GTOJ 3VODA 2PFUA 2IEKA 3FF5A 4J2BA 3KE2A 3DWLE 1SD6A 3QOEA 5CPRB 3CJ9A 2OF7A 1QZZA 5EGOA 3G25A 4JK9A 3VTHA 3J80O 2A6EF 2ZBKA 5J2PA 2LREA 2E20A 3H5RA 2LG4A 3K69A 5JVGF 3M5RA 4DV5K 3K4BA 5DM7F 5CVVA 2L7ZA 2HOEA 3M07A 2R5YB 1VSJA 3LWMA 5J4YA 4NLCA 5J1UA 4IX7A 3S93A 2BXZA 4AYBA 1UAAA 3P38A 4PA1A 1CGPA 4CZIA 3O3GA 3FKJA 3QPHA 3CCYA 3QODA 4OMYA 1VSIA 5FFZA 3PX0A 2R7OA 4RLFA 1TTYA 3RTRA 2DA5A 1TAQA 3TL4X 1DGWY 3TO6A 4CCOA 4CGDA 5EEAA 1OCPA 4LH5A 3HSEA 2V7FA 3HP9A 4BRDA 5ICGA 3CD6I 1QVTA 1EJ9A 4YOVA 2DTUA 5AIPA 1IF1A 3S15J 3C18A 3Q3SA 2Q1ZB 3LSGA 2GTDA 3OYIA 2WAQN 3FISA 2R7SA 4NC7A 1MNEA 1R5HA 1CF7B 4ISEA 3DLLL 2FNPA 4FM1A 2KRHA 4B08A 3B6CA 5HDKA 3CCMI 2F4OB 4MEXF 3KP4A 2E8AA 4IOCL 2J5OA 5JHUA 4HRIA 2DI3A 2UWMA 3MEDA 2UUZA 2ZSIB 4X66K 1IZ1A 1T05A 2AP1A 3V9ZA 1B8IB 2I8DA 2E7XA 1RBUA 4B4CA 1NLVA 1HDDC 2DK5A 2IVOA 3CCUN 1K73O 2F8TA 2BW3B 2BHYA 3THWB 5GAGP 3KLFA 4NC8A 5M3MJ 2XAHA 4A3MJ 1RTIA 3Q9VA 3BTIA 1Y8QB 5EOYA 3QNNA 2VODA 3QU6A 2BYVE 1GVJA 3E97A 3GFJA 3W2VA 5C4XJ 1DP3A 1BI3A 4RAZA 3DU6A 5A2QK 2MW8A 3L0QA 1K9MO 1TT0A 3QAHA 3I54A 1T7PA 2FMLA 3ZMSA 4OIRF 1K4SA 1KFDA 1RCHA 1LW0A 4PJJA 2FUG2 3TU5A 5KQ8A 2E36A 2FSKA 1BIAA 1W2BM 2DO7A 1HNWK 4MTDA 3D5LA 1W9HA 1HKQA 3KLIA 2EWNA 2D0PA 3CM6A 3LDPA 1R4MB 3ZGKA 5C25A 4A3KJ 3M1FA 2YV0X 5FRNA 3TTDA 4PJLA 1O3SA 3KK3A 4JI1K 2I10A 4BE0A 5LHHA 2AHQA 5AQKA 3G3ZA 2P5LC 1K6YA 2F5VA 1DU6A 1XG1A 3FXMA 4CK2A 4UQGA 3BCBA 1M1KO 1NGIA 3WU0A 3WTYC 4RB0A 3V1QA 4CIEA 2E5NA 2K9NA 1O57A 3NDKA 4A5MA 4BROA 2C6YA 1FP1D 1MNDA 3D1NI 2O4GA 4BXFA 3FXQA 3PLAA 3KYLA 3A0IX 1BISA 5E41A 2JUGA 1KC8O 4DR6K 1ETKA 2I5JA 3GTPJ 5GPCA 5IOYA 4DQRA 1FWZA 2FC0A 2X6XA 2JLEA 4CGIA 4B9NA 3NRVA 2CV0A 2ZXWH 5K5RA 4NQWB 4JKGB 1WB9A 3OYFA 4XKWA 2MC3A 2IP2A 2YR2A 4Q5SF 1I6HJ 3HTSB 3GWZA 1JGSA 5FGMA 5IYDJ 4N47A 4Z4CA 4H4KC 1KVAA 4CJ4A 4OPHA 4WFNL 3E01A 1ATRA 1BJAA 1R22A 1R9TJ 2ME0A 1ZRCA 3D2FA 3U4LA 1QE1A 4CGHA 4YHHK 1KSPA 2ZJPF 3ZLJA 4Y1DA 5BRFA 2G7HA 1Z1DA 4M3YA 5AJ3K 4BRGA 3BP8A 1DPUA 1HMVA 4HV6A 1S9EA 3L4IA 5KPTA 3I71A 4LFCK 2QZ8A 3SAFA 1OH7A 4Z0UA 1S7OA 4DQ2A 3MAQA 4UUTA 3DRPA 2OUMA 4YFNF 2DOAA 1O7FA 2H09A 5HLFA 3BPVA 2NRAC 4BEHA 1AKHA 2VQCA 1ZLKA 1S72I 3AG1H 1WJDA 4IQJA 1SD7A 4RM2A 3IH4A 1OYIA 3HZJA 1C0FA 1MA9B 3J81K 3S3MA 4JD2A 2W42A 3B6PA 1XC3A 3IKTA 2EJRA 2WUSA 4DBQA 2R7RA 2HZDA 3FXUA 1TL8A 1KGSA 4M9XA 4LIUA 2STTA 3LSJA 4F91B 5FLVA 1ZYRF 1GLBG 3C6TA 1MD0A 2HHUA 1EO1A 2GAUA 3JRBA 1WJCA 4CSWA 2KLAA 1HX1A 1SKRA 2ECBA 4DR1K 3MCPA 1ILYA 3RYPA 4A2AA 2R7VA 4HUFA 3S2HJ 5FLXZ 3ASMA 4G94A 5HVQC 1A31A 1T03A 4A69C 5BR8K 4PK4A 1NJZA 1F9NA 2P4WA 3GYHX 3AARA 4EEFG 1YX3A 4S04A 1EH6A 3BLYA 3QP6A 4EP4A 4WF9L 5M5XJ 4HDVA 1UOCA 2GWRA 3OWTA 3ROUA 1C0TA 4OLAA 1GLAG 2JRTA 4KT6A 2YX7A 1W7AA 5J6XA 1ORKA 1SD4A 4PKGA 2F9TA 2D1VA 5CKTA 2BV6A 3DLAA 1NK6A 1WI9A 4CCHA 2CH0A 4DWIA 2D45A 2Q1NA 3RR8A 4UNOA 1ASWA 1WBDA 2AQFA 1BO5O 3T3FA 1NGEA 4HG2A 4JI3K 4G6QA 2LP0A 3S2WA 2VWBA 4CZHA 2HTSA 2HW3A 2HXOA 1LCUA 2PBIA 1FTTA 3DWLA 2FSJA 2PYLA 1NG9A 3M8RA 3VQPA 1J0RA 3D2EB 1B9NA 3LA3A 2GXBA 4AUXA 3W2WA 2M2EA 3F72A 1HKCA 1YIOA 3QFUA 5AQJA 4JS5A 1E4GT 4JD2B 2D0OA 4AM6A 2IS2A 2E35A 1WJEA 1DGRM 3M1EA 1OPCA 4XKBA 1VSMA 3SFIA 3VQQA 4OKEA 1HR0K 2O8BA 3E5XA 3R3LA 2R7UA 4N4NB 4DFMA 4F52A 4FO0A 3BOQA 4KB0A 5M1OA 2VGMA 4JLHA 1I3QJ 3V7CA 3GBTA 4DTUA 3CCJI 3SJMA 2EFQA 2YX6A 3DKYA 1SZ2A 2D2WA 3V4GA 1HW1A 4DUYK 4AVPA 4WCGA 2DDBA 3CP8A 2RE2A 1JE8A 4K43A 4I99C 2QEXN 1BM9A 2D5RA 4KHWA 1GHCA 1S6LA 3AV9A 2E1CA 3NF7A 4I76A 2ZWHA 2L4AA 1YE9A 1HW2A 3L7WA 5EG0B 2PBDA 3FZFA 3WXIA 3ZX2A 3VEVA 1VQON 2M87A 3P31A 4A3DJ 2X6NA 3ZXSA 4IXCA 3WNFA 2X6YA 3WQUA 1MJBA 3ZX3A 3FZVA 4R5PA 4HUGA 1Z3XA 1NJYA 3F8CA 4L5JA 4RM3A 2P9UB 3IKVA 3QINA 3P9KA 4H4MA 3SLCA 3UKUA 1RC9A 1IN4A 2VKDA 5BPIA 1NKCA 4ELTA 4NCGA 4HUEA 3PO4A 3H3NO 4BHPA 4HPQA 1MDUB 1YTUA 5IWAK 1NKBA 1HYSA 2WB1N 3J7ZO 3HOUJ 3C2BA 1YW7A 5FROA 3WNGA 3F9MA 3F73A 1VQ7N 3HO1A 3VQ8A 3QNOA 3OOUA 2ISYA 2QSHX 2LTPA 2W00A 1AA7A 4RA2A 3DLKA 3R6MA 5B8HA 3HRTA 5LGNA 3F22A 3LDLA 2HVRA 5JI6A 1WSIA 3TQNA 4X64K 1D5AA 5IP7J 1JTXA 3AAFA 1VSKA 1SMYF 2JMWA 3RWUA 1U6GA 4KITB 3JRCA 1QHTA 2IGIA 3E66A 4M45A 4A59A 2KJBA 3BJAA 3F6VA 2IS4A 4L0YB 3CXCM 3ZQQA 3H3UA 1XPXA 3LAKA 2OZ6A 2PN6A 4KI6A 1CZ9A 2XGCA 1S5JA 5E20A 1XHZA 4OPKA 4UV8A 2F8SA 2L3DA 1JT0A 4Y7NJ 3ZMTA 3NHGA 2E2HJ 5M1QA 2CO5A 1NH3A 3M8JA 1YI2I 2HHVA 5FLMJ 2R5YA 3QIOA 1VQ8N 3CCLN 3KWIA 1ZRDA 2CW8A 3HOWJ 4JEPA 2XAGA 2X1CA 3WQTA 1GXQA 1ZGAA 2PJRA 4DV3K 4C8LA 4FTHA 3NVMA 5K7ZA 4P55A 4ITVA 2EHGA 2ASMA 4DSFA 1YJ9N 3RPUD 3PO2J 2KKOA 3M6GA 4W5QA 1X3NA 2B4JA 1MJ9A 1EX4A 1HYZA 3EUHC 2IIRA 4J8FA 2JA8J 4CD1A 1Q82O 1Z9CA 2QA4N 1CLQA 3QBWA 3ZCOA 3Q0UA 4BEHB 4S0HB 1AKHB 3CCMN 3BG7A 1EWQA 2O8CA 3NF9A 1S7AA 4EQQA 4DNCA 2D4WA 2WV0A 5IOZA 2KFNA 3KEQA 3E6MA 3VA3A 2M4KA 1M90O 3PO5A 1C0UA 4H0YB 5HNHA 2IS3A 3NH2A 3EUKL 5FKKA 1TNSA 3THVA 1SL2A 3CD6N 1B9MA 1HJOA 4XLNF 3LZIA 4E7ZA 2CS3A 2O0YA 1Z6RA 2Q2RA 2IGNA 3CC7N 3KIOA 1BA5A 5K1YA 2HDCA 4JI0K 2VG7A 1BI0A 4IFEA 1NNEA 3K0SA 3CJTB 4UB8C 2DBBA 1KQSM 3O08A 5CZ2A 5EVZA 3FXRA 2L2OA 1XGOA 4ABZA 1FKPA 4FLTA 4EP5A 5C44J 1RT3A 5K7FA 1D1BA 3W3CA 3O8GA 1DUXC 2V9PA 1XSXA 3HOZJ 3L2CA 5CY4A 3BDPA 3GLXA 3LDSA 3AGRA 1DKGD 3G6EI 4Y0WA 1D1AA 1P7JA 3V8KA 3PFIA 1ASUA 1QZ5A 4ZH4F 4CJUA 4E7LA 5JLFA 3VF4A 3FKIJ 1BHLA 3Q9SA 5JLXA 1EWRA 3VEYA 4M3WA 3AL0B 4JKEA 2FBXA 3GLLA 1VZ0A 3RKXA 4CF2A 5GTIC 4BQAA 1XGNA 2CUJA 2L4MA 3B73A 5BOXA 1HC8A 4JN4A 1HLVA 1RI7A 2V1XA 1F4KA 3ERED 4YOXA 3LSIA 3JREA 4CCJA 5FDLA 4DU4A 4LG3A 4EIAA 4YEJA 1RBTA 1ZG5A 5D5XB 2DJIA 2FX0A 4KDPA 2YHYA 2LDUA 3EYIA 1X2NA 4HF1A 1RBSA 3QERA 3J7ZI 3V7RA 1MSFC 2GXGA 4EV0A 3QYFA 4N56A 2O5RA 4XMYA 1LUJB 4DTMA 3CDLA 3O9SA 1ZHFA 2JWTA 2E1NA 4M74A 1NK7A 2FA5A 1T0FC 2ASOA 4KKOA 1Z67A 3PUBA 1MBHA 3IAM2 3K4MA 5J4VA 3PM1A 3L2WA 2R92J 3ABUA 1GOBA 3MXJA 1D8JA 4CJFA 2Z33A 3ULDA 1F21A 5GPAA 2K02A 1QHGA 4BGAA 3KK1A 4DSIA 2MD5A 3KCCA 5TRDA 3CQXA 3ECHA 4HNUA 4BL0B 2PMUA 1QGPA 4RG8A 4BRQA 1GVDA 3O1BA 3DYAA 3L4QA 3L9FA 4DJAA 4BRAA 2X6OA 3HPGA 3HXMA 3SUNA 2NRXA 2A6AA 5E84A 1MBEA 2OPQA 1BCMA 3MK6A 3GTMJ 4FYDA 1HKGA 3JSOA 3GUDA 3GFIA 1C0WA 4C2TA 1X1DA 2OZMA 2LRDA 2M7AA 1R0AA 2Z1DA 1TKTA 3DLLF 4CZEA 2QENA 1QQIA 2RAEA 1BOAA 2HI3A 2LBFB 1XNQK 2HBMA 4B8AB 2M8GX 3VEOA 4DV1K 5CYVA 2ISZA 2HSTA 3CLOA 5M1NA 2HGCA 4B3MK 4KRFA 2OPSA 2G9WA 1RNLA 2IBDA 2B6AA 5E3MA 4X6AJ 2E1YA 3R4KA 5LD2C 2R7ZJ 1GLDG 5E1XA 3TSPA 2PQ8A 4U0VA 5J40A 2E2JJ 3KETA 4B9LA 3I53A 2WOMA 3SCXA 2BY0A 4CEQA 2OCCH 3FE1A 3OY9A 4E1NA 4XOPA 4BY9C 1MIJA 3L3VA 4EM0B 2VI6A 1WSJA 2WWYA 5HLGA 1WNSA 3TAEA 2DA3A 3ZN0A 1X4PA 2WY7Q 3HPHA 4G9YA 4LC9B 1IN5A 3V1RA 5FPMA 1JLAA 4KTQA 3KP5A 3ZMUA 3UKUB 1O1WA 5M1PA 4E89A 3H3VK 3CCQI 2CV1A 5DM6F 1J9IA 2F6CA 2XKOA 1Z3YA 4PWDA 4I0AA 4B9VA 4ILHA 3E6CC 2CQNA 1ESVA 2EX3A 4I0BA 3OTOK 3D5RC 4JAXA 1WWXA 2EZKA 5AIQA 5DYMA 1VQLI 4CZFA 2XB5A 2CGKA 2V6EA 1PUFB 1O13A 3A0HC 1KCFA 4W5RA 3IG1A 3M8EA 1OVQA 2L54A 3FBIB 3H9JA 3PSIA 5AQTA 4JI4K 2KPMA 4N9IA 4YELA 1R5GA 1BG3A 4MQVA 4DV7K 1GLNA 3SEZA 4AIKA 4BE2A 1T44A 4ZDOA 3BC8A 5LGTA 4QAGA 4CJ3A 5C2DA 4M3TA 4C30A 3H1VX 1D4XA 4O55A 1LDDA 3HI0A 2D1HA 2QYOA 2CUZA 4BVPA 4OVLA 3VQAA 1HNIA 3OMYA 1U04A 4JKHA 2QBYA 4A3BJ 4HSRA 2XAUA 3SV4A 4EGYA 3MZHA 2JUCA 3NAUA 4D1QA 1WAFA 2ZXJA 4FJKA 3T1HK 3AFHA 1YFHA 4JRPA 2DPNA 1USTA 3ABMH 1W5CC 4UUSA 2K9QA 5FPNA 3S9HA 5M1KA 4JHDA 4K41A 2AQEA 4ZZDA 1WH5A 3I8BA 4R79A 1KD1O 4B3RK 3VPZA 1SMTA 2HYGD 2XPWA 3RQIA 3HC7A 2DFEA 2IGMA 4HDUA 3R0AA 3PV8A 5BRDA 1RZ4A 2NRTA 3DTIA 4DV2K 3KKSA 4XRFA 3JRGA 2VG6A 3HUGB 3T1YK 1U45A 3GF2A 4PL7A 4CFAA 4PSWA 4CJWA 3DPUA 1O4XA 3MX5A 1SVOA 1ZKGA 2VT2A 3OIQA 1QQOA 2YKMA 1GV5A 1UELB 1U9NA 2EV0A 3I0TA 1KTQA 2WAQA 1RBRA 1WSEA 2BH1A 3DAWA 4M9SA 4RAGA 1JKPC 4LSLA 4YFXF 3SNNA 1FW6A 3O8MA 2NS8A 4IRGA 4MO7A 3MCAB 2VQFK 4ID5A 2W6LA 2WC9A 1JCEA 4DTRA 4M3FA 5BMZA 4OPJA 4DR5K 1ZG1A 3M4OJ 4FWLA 3CUQB 1BW5A 5LGUA 3OL3A 4QLCU 5JS1A 3ABLH 3CDIA 5E1ZB 2A07F 4IHVA 1HLUA 3RVCA 3RMCA 1DGKN 4H8KA 2ICWG 4CEFA 4BXUA 3CLQA 3HRUA 4HW0A 3I56I 4G8XA 4FX4A 5ADXA 1B9DA 2M30A 2H8RA 3T5XA 4M7XA 4C8NA 3JYTA 2BGCA 2HKOA 5DUKA 4DQPA 3OYEA 1UA1A 2N8GA 2VJ4A 1EXQA 2KZZA 4B8CA 4GYIA 3MXIA 4MO4A 2EZIA 4I01A 4B9MA 2W25A 5F0CA 2WC2A 3DEUA 5JLWA 1R58A 1FT9A 3TDZC 1L3UA 3LPTA 4BHBA 4P5OA 1DLOA 5LBQA 4H0OA 1GLLO 3VQDA 5ICCA 1RKTA 4PCQA 3R6SA 3PFYA 3MD2A 4E7JA 1H8AC 1LEBA 4YDUC 1FYLA 5J3LA 4UVCA 3TOAA 2GUPA 2BVMA 2F5FA 3KLEA 2CUFA 2QF7A 3A4CA 3CCRI 3ALYA 1Q86O 2CJJA 1NGAA 3VESA 3EYYA 1USSA 3S3OA 4IHXA 3BQZA 4B3AA 2B7EA 1YVUA 4B1VA 5GP9A 4PL8A 4DU3A 2JVHA 2P5VA 2YUSA 3ATUA 1XNRK 3CMEI 3P39A 1RTJA 2NYXA 3VB2A 5DCFA 3TO7A 3PO3J 4FWKA 2EIKH 3RKYA 4QOZB 2QWPA 3CJQB 4PKIA 4CEZA 4BU2A 4AYBN 1HUXA 2IVNA 2O8XA 2R5ZB 4ISGA 2VQEK 1R36A 4X65K 2ETHA 3DTEA 3FMRA 3BG5A 2Q3SA 4XRMA 4Q4ZF 4CF0A 1SKSA 3IUCA 2HF3A 1HW5A 1XTAA 2HBLA 3TR8A 2R7YA 5EEHA 1LDJA 3DM2A 1RT2A 4EATA 3AO2A 1J59A 1H9GA 1R7JA 3CUOA 1QO0D 1U2VA 3UKRA 2EINH 4UXNA 1K6OA 1TVRA 1WUAA 3CFRA 5KGXA 2W82A 4R8HA 1ASVA 3LL7A 4P9FA 2YU3A 3MKZA 5E8IA 2AS5F 3I4MJ 4DMNA 1D3YA 2GIVA 2KDOA 1YJNI 5MLCQ 3O3FA 2HOSA 4ZTJA 5M5YJ 4HF2A 4HX7A 2A5WA 2KQ2A 1NJWA 1D5YA 4H5VA 1NTCA 4RGSA 4IXAA 2P9SB 4ESJA 3OL4A 3IWFA 4P9UA 3JTHA 1M1EB 1A35A 3BCAA 3WNHA 1HNZK 3G73A 3F6OA 3GZ6A 1I39A 1JT6A 2VQGA 4ON0A 2R93J 2NVTJ 4I02A 5AZJA 4HTUA 4AQYK 4HCBA 2QWRA 3GG4A 3VOEA 3CERA 4EZ9A 4BGBA 3LL3A 5SWMA 1NG6A 4LJZF 1K78B 4FM2A 2I7PA 3HOXJ 3H0GJ 1C1AA 2KRCA 3D0SA 4F92B 4LF5K 3OS0A 4M7YA 4PJMA 4BNCA 3WXMB 3CPWM 3OW2M 3GDQA 4E3SA 4CK1A 1CXQA 3AG2H 1OH8A 4Z4HA 3LSPA 1JKOC 4YG2F 1X9SA 1Z91A 2P9NB 4Y33A 3MN5A 1I6XA 3EEQA 3AVAA 3QLHA 3SAHA 4BKXA 2BW3A 4A93J 2FF3B 2KJCA 1MJAA 4KBOA 3EE8A 1NMDA 3N97A 3OSGA 3I33A 1N6QA 1IUFA 4BRPA 1XMXA 1AWCA 4FVMA 4KH5A 3CQ8A 1JI8A 1XHXA 2ELHA 1ITGA 1LAWA 4DF4A 2MBFA 2EA4A 4RB1A 1NGGA 4CERA 4B9UA 1BI2A 1TWGJ 3MKLA 1TQMA 2JPBA 4MHGA 3KZBA 2LKSA 4BQLA 3I8DA 2QK9A 2X85A 4NYFA 3ZT2A 2KFZA 3IDHA 3DPLC 4C8MA 4YFUA 2VE9A 2YNGA 4FJXA 1S29A 3K6GA 4XLPF 2HB5A 5T7BA 4KO0A 1SS6A 2UXCK 1DQUA 2GV9A 4W5NA 1WH7A 2KZVA 3AA4A 4LG0A 2NRWA 3CDHA 4CJSA 2F5DA 1WSHA 5FLXK 5CVRA 2E5LK 3C7JA 4H0XB 5D8KB 3WUHA 3GTJJ 1RUOA 4CHPA 3BTJA 2HU9A 3TANA 4A5BA 5DM7L 2H6CA 4C1NI 4BQQA 3J80Z 4OIQF 1SAXA 4JI6K 3K2PA 1A5WA 1TK0A 1R5ID 2EZLA 1GXPA 3S41A 3BG3A 3TABA 3SZGA 4XLFA 2JSPA 2M1BA 4RTFD 2HYJA 1VFCA 4QTRA 3WHBA 1NU0A 3QBXA 2ADUA 3VGMA 4JV5K 2O8FB 2DMNA 3KLHA 1QU3A 4GNIA 2E2OA 1JLCA 1VF9A 1TV6A 4OLBA 3BF3A 3NGYA 1YJ9I 3IMXA 4HTLA 4A3IJ 1YQAA 1FOKA 1RT5A 3QQAA 3T69A 2P9KB 1QSYA 3ZP5A 1SV5A 4CXFA 4UUSB 1GLCG 4EHUA 1ZYQA 5KVRA 3WG7H 3LDQA 3CCLI 1VQ8I 1Y64A 4FJ9A 4AHVA 3DXKA 3KK2A 2YNFA 3BR0A 3QYBA 2A42A 4IHTA 2DT6A 4DYCA 4QIWN 3PX6A 1A6QA 1U8BA 1LVAA 4KJZA 4LLGF 1VI0A 4FOEA 5JICA 1T8EA 1BQMA 4IRHA 4Q5VA 3GL1A 1W36C 3E9PA 1HKSA 2OQRA 4V19K 2FXUA 3KPHA 1FOXA 2H8WA 2QKBA 4FM0A 5D6FA 1WZ2A 1S9HA 3T8RA 2ZGZA 4LFAK 2QA4I 3E1SA 1V4TA 2XHBA 1BR1A 2UU9K 1S5LC 4AWXB 1GLJO 3C7NA 3K5MA 5TJJA 2ZE2A 1Q8IA 4HVJA 4HLYA 2AA4A 5JFRA 4IF4A 4G1QA 4CESA 5E18F 4O0IA 1WJFA 1WRJA 2IDOA 3GZNB 4CJ5A 1U5TB 3VQCA 2Z1IA 2VN2A 3ZN1A 5KRSA 4XN3A 1T0FA 4BRNA 3TGNA 1VNDA 4HYEA 3AVBA 1L3LA 4N76A 4QPOA 2HHQA 1ATNA 3L2UA 4NYNA 4K2EA 2B5JA 3DJCA 1T3VA 2GWKA 2HBJA 2AXTC 3I55N 4A3LJ 3WG9A 1OH6A 4CVNE 1X9WA 2OTJN 3NARA 5ILVA 2ZSHB 2LMDA 2D0AA 3R0JA 2LK2A 1MZBA 3CQYA 4BVOA 5C12A 4FZYA 3JAMZ 2M9HA 4Y4RA 3AO3A 3DOKA 4H5NA 2PJRB 2MC4A 2Q0RA 4FWSA 1RDCA 4DZJA 1OCRH 3HXLA 3AAPA 1F43A 2UV1A 3ELKA 4O0JA 4DFPA 2QM1A 4KN4X 4XBFA 1LVKA 3SEQA 3U1KA 5DDGA 2WBNA 4RW8A 3ULEA 2BY3A 1DT9A 5L3DA 2ITMA 2E1ZA 3H1CA 3CCSI 3KLGA 3CCJN 4DLGA 3U1DA 4M42A 1JL1A 3BPXA 4RB3C 1O3RA 1FSEA 5HS8A 3HK2A 5IY5H 4G9ZA 1R23A 1UHSA 4Q47A 1TNTA 1IAWA 3J7AY 2BY2A 2DK8A 3IUOA 5L3CA 5AQNA 4WWCA 1TW2A 5EYRA 2EIJH 1IDYA 1J5YA 2HQNA 3W2AA 1FK9A 3ZSOA 1WJAA 3TW7A 2B9SA 1IN7A 2STWA 2L0KA 3TMOA 3AO4A 4LFUA 3OYAA 4YOUA 3SJJA 3CCEN 1RDDA 2F7TA 4OU0A 5FJ8J 5HOOA 1JXEA 1S3XA 1XI1A 2MA3A 1E0EA 4CF1A 1KLMA 4CGFA 2OZSA 2ZMEA 4AM7A 4XORA 1S8NA 3V9SA 3RMBA 1IXRC 2L01A 1KVCA 4EJWA 4XIUA 2K5CA 3K59A 2IS1A 4LB5A 5HRNA 3GCMA 3EKUA 4XL9A 4AILC 4JRQA 3ASNH 5LHGA 2MH2A 3CO6C 2RKIA 4BC2A 2R7WA 3T19A 1V5EA 5FKMA 1NK5A 1H9TA 4MNUA 4DYRA 1N5YA 2M8EA 3H08A 4M41A 4UHTA 3TP0A 4LB6B 3LSKA 3CZ6A 1BA0A 5JS2A 5LY3A 3MZYA 2A61A 2NAZA 5GIPA 2P5GA 3G1OA 3VYRB 5CYMA 2P8TA 3KP6A 1BIUA 3ZMZA 2XC7A 2VPRA 2VLAA 3LDOA 4JKAA 1VQMN 2RV8A 1NGFA 2DMTA 2LLKA 2RN7A 4RS8A 4C3JJ 3H45C 1WJ5A 3AVIA 3AVCA 3OYHA 2L7MP 3S17J 1OKJA 3SZPA 2HWVA 1NK4A 3I0SA 1HSJA 4CEAA 2OD5A 2CW7A 1BL3A 3FMQA 1RNHA 1JKQC 3ZETA 3LSTA 1QVUA 2QQAA 2ZJPL 1MDMA 1N32K 3HB9A 2KZMA 3UB5A 2L9SA 2A6HF 1RGIA 3KKRA 2VJ5A 2O9LA 2NNWA 5FPDA 3VQ5A 2YS9A 3VQEA 3ZQ7A 3HSRA 4JK7A 3RKQA 4WXHA 3TSQA 4O6JA 2EWSA 4B48A 3CJ1A 1D8YA 2GEMA 3I59A 3I59B