1Z6RA

Crystal structure of mlc from escherichia coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
395
structure length
382
Chain Sequence
QIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHEMLEAHLVQELGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mlc protein
publication title The crystal structure of Mlc, a global regulator of sugar metabolism in Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 106
structure length 382
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z6rA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA03
3I71A 3ML6A 2BE5F 4I0BA 1GLCG 1I1SA 4ENJA 3RSEB 2XASA 2L02A 1FT9A 5E8IA 3H45C 2B0LA 1XGNA 2CH6A 3WQTA 2A6EF 2D1HA 3A5MC 3B73A 1FYMA 1XGSA 1H1VA 2DK5A 1KU3A 1BC8C 1KA8A 1KGSA 3TGNA 4EQQA 1S7AA 1ESVA 4JD2B 5KPZA 1O3QA 4LG0A 1Q18A 4XSZF 2F5CA 4HX4A 1HKTA 4MO4A 4OOIA 3HSEA 1LEAA 3VGKA 3E5QA 4HA8A 1QQNA 4A0XA 1LB2A 3A0IX 1XQSC 2XAJA 4IWVA 4BXUA 4M9XA 5BRFA 4YG2F 1JCFA 3I53A 4ENMA 1RGIA 5D5XB 2V51B 4N9IA 4I2OA 4AWXB 1TYQA 3ID8A 3WXJA 1ZGAA 2FF4A 3TPQA 2FBIA 1MZBA 4Z94A 1V4RA 1C0WA 1NGAA 1YVNA 2E2NA 5BR9A 2JT1A 3JTGA 5FD5A 2M1BA 4H0XB 3T5XA 2GWJA 4G6DA 1D8JA 3SHFA 1CZAN 4FWRA 4BR9A 3H3UA 5D8LB 3ZMVA 1JE8A 4M7YA 1O7FA 1I6XA 5EVZA 5K5RA 5D8KB 2A61A 3JSOA 1O3TA 5JICA 3N4MA 2L4AA 5AQYA 4WCGA 3KZZA 1T44A 4M9SA 1UB9A 4HF0A 1JHFA 1XD7A 3HRMA 1I1GA 5AQGA 4UV9A 4BR2A 1Z05A 4FWLA 1HQCA 1LOTB 2HTSA 3KP5A 5CVVA 2CO5A 4KIBA 4AIHA 2OA4A 1IN7A 4IRHA 4JHDB 2OQGA 2NNNA 2P9SA 2VC0A 3U9ZA 2OAZA 2ADUA 3MN5A 5CVIA 3PFIA 2P8TA 3HUGA 4PCQA 4BVPA 1LJ9A 3M9AA 2VONA 1ZBSA 3TO6A 5BPIA 4KIGA 2P9LA 3IRRA 3GZ6A 4L18B 3CHWA 1R59O 3GWZA 1O57A 1LEBA 1EH8A 3VETA 5DCFA 4BR7A 4P9FA 3PQJA 1RDWX 3T8TA 3D0SA 3F8BA 4YFXF 1SFXA 5KK1A 2H27A 2PJPA 1MA9B 2OZ6A 3J80K 2CH5A 4M72A 1NGJA 4JK1X 4MNUA 5H6QA 5ELZA 2HKOA 2Q97A 2ZFWA 4A6EA 3BEXA 1YIOA 1GLLO 4BRQA 4B9QA 5AQZA 1R1UA 2K02A 3VESA 5BPMA 3ZEUB 5HOOA 2Z33A 2VBZA 5AQLA 1TTYA 2RKHA 3MEXA 1MWMA 2CGLA 1FSHA 1K78B 5FGMA 4WWCA 1B1BA 3SK3A 1USSA 1KQ8A 5JLFA 2RN7A 3RKWA 1X3MA 4HZFA 2Q2EA 4BRAA 3DJCA 1ZREA 2P7VB 5IT3A 3EQLF 2Q31A 2YU3A 4HAMA 4BC2A 1T0FA 1GHCA 1K8KB 2QYOA 4RGSA 3HTSB 1XB4A 2ASMA 2F2EA 1P6RA 1BJAA 4BGBA 1HXDA 3P9KA 2OANA 3L6QA 1NGDA 1PDNC 4LB6B 3D2FB 1OMIA 3GYHX 3BPXA 1IN6A 5D5WB 4P96A 5K1YA 2GXBA 2P9KB 3LA3A 2H3GX 3GFIA 1EQYA 3FFKB 1J2XA 5IT9Z 4BRCA 5DV5A 3CJCA 3M1FA 4H5RA 1ZRDA 4PL8A 3K1PA 1SZ2A 1F4KA 3ZQ7A 1B59A 5LGNA 3MZYA 1XCVA 4ZYDA 4FWMA 2MA3A 3O80A 5J8CA 3EZWA 5JMVA 1XSDA 4UVBA 4ETSA 5B8HA 5CLSA 2P9NA 1UCRA 2L4MA 3MDQA 5FFZA 1HJOA 1U5TA 2DAOA 2IVOA 2STTA 3U9GA 4QS8A 3D7EO 3F72A 4HOBA 5AZJB 3SXYA 5ICCA 1HW1A 4BYYA 2CSOA 3QOPA 2Q0RA 2A07F 2O61A 2OBPA 5L3GA 4FT8A 2BEOA 2QVOA 2X4HA 3LL3A 1HKCA 4GO1A 1IZ1A 3HOSA 1IG8A 3A5NC 5LJVA 3MFKA 2PAVA 1FP2A 2Q8KA 2D2WA 1ATNA 2H09A 4MEXF 3RIRA 2QM1A 2FSNA 3BWGA 4BAYA 3C7NA 5ADXH 1V3FA 2O0YA 2VE9A 3C1DA 1GLFO 4H0TB 3EKSA 1R5GA 3ULEB 1OYWA 1B9NA 3CUQB 2DTRA 5HLIA 3QMLA 3WQUA 3GZ5A 2LSOA 5K5QA 3G3ZA 3F22A 3WU1B 1NGGA 1GXQA 4WQ5A 4FPBA 2H6CA 5LJWA 2MLGA 2QM3A 2WWYA 5CE3A 1Y0UA 3GF2A 2FMLA 1XCBA 5HLHA 2F9TA 3M8EA 3WE2A 5AQPA 1SQKA 1KXPA 2KRFA 2P6TA 4IVNA 3L0QA 3WTVC 1P4AA 1HSJA 3O4WA 2W40A 1T38A 3KZBA 1E2XA 4B1XB 4KMUX 4RWTA 3JTHA 1SAZA 3C7JA 1T98A 3GDQA 2HTJA 1JHHA 1XMAA 4IXCA 3FZLA 1ZG3A 3M7GA 4EGZA 3JXUA 1FP1D 3K69A 5TRDA 1WRJA 1T6DA 1OPCA 2KKOA 3I58A 3V7RA 5D5UB 5AQRA 3TO9A 3ZN1A 4EV0A 5EXWA 2V1DA 2XVCA 2A3SA 2DPUA 4U0YA 5EX5A 1E4FT 2UXXA 3VF2A 1RI7A 1T39A 3H3OB 4B09A 3O6BB 2FBHA 1RUOA 1FBUA 4LGWA 2VC1A 5DUIA 4LC9B 5DUKA 1LDKB 3WXKA 1A04A 3SZPA 5AQSA 2AP1A 3GFJA 3SQNA 4M6YA 1LCUA 4BRDA 4L9NA 1XGMA 3DWLA 2RV8A 2AS5F 1HSTA 4RB1A 3NEUA 2KHOA 1U78A 4H0PA 2PQ8A 4LB5A 1IUYA 4GNIA 2FA5A 1GXPA 4G8XA 1TW3A 3O1BA 2EV0A 5FPDA 4QS9A 3KE2A 1IW7F 5K5OA 3FMQA 2R7DA 2EA2A 4U0VA 2DQRA 2V1UA 2HQRA 2FF6A 1BBYA 3BJ6A 2C6YA 3F8FA 1IN4A 4FWPA 2QLZA 2QWQA 3GW2A 4CZKA 3HSFA 1FNNA 3ENOA 1SD7A 4LK0F 3DXKA 4H0OA 4BQZA 1TBXA 5LHGA 1S22A 2P9PA 3S2WA 4MO5A 3JS6A 2IT0A 4CICA 2VBXA 1FX7A 4PKGA 1J75A 2E1CA 5LBQA 1KU7A 1U8RA 3HZ6A 1EV7A 2NYXA 4RTFD 4UNOA 1D3YA 3RSEA 4UVCA 3E6BA 1FBSA 2MLKA 2E7XA 3T0YA 4ESJA 2OD5A 4MEYF 2YR2A 3WE3A 3I59B 1TNTA 2FRHA 5L3CA 4L0YB 2K4BA 3HSRA 3QU6A 3RYRA 2EA4A 3H1VX 1K6OA 4CBUA 1QNTA 4P9UA 5AQQA 2FSWA 4FSVA 4G7OF 4JD2A 2NNYA 1RZ4A 5HLGA 4BRIA 3F21A 1LQ1A 4UVAA 4CO8A 1SD6A 2MH9A 2P9IB 4IJNA 2EJRA 4E1JA 3BY6A 5TJJA 1U6ZA 2QQBA 1ZHFA 4I02A 2ZGZA 4N0BA 1P4WA 2EV5A 3L9FA 3W6JB 1R36A 1C0FA 4O8KA 2V79A 1GLDG 2DBBA 2EFNA 1IRGA 1RIOH 2E1NA 3U8XA 2E2OA 3H6EA 4A2AA 4Q4ZF 3DFGA 1QHAA 2CWEA 3H92A 3VF6A 4EHUA 2CQKA 3FWEA 3DPTA 3MN6A 5AQKA 2QBYB 1NM1A 3AARA 3VEZA 3C0BA 3C3WA 3F8MA 3D2EB 2VT3A 2NAZA 1SAXA 4CZEA 1HKQA 4IO8A 4UUVA 3DQVC 3VERA 1J6ZA 1ONVA 4U88A 2Q2RA 3FX3A 4FOIA 4WYBA 2L01A 2RC4A 1J0RA 1X3NA 2AXLA 3RKYA 1OR7A 4ZZDA 5IT9K 1ZN2A 2G7HA 2YJEA 2OQRA 2A69F 2ZCWA 1L3LA 3LAJA 3RPUA 2L3DA 2A42A 4JHDA 3U4LA 5LRSA 3GBTA 1KQ9A 2H94A 4FX4A 4BRNA 1BM9A 3Q9SA 4EJOA 4RGXA 4EM1A 3TDZC 1BN5A 1H9GA 2Q0OA 4Y15A 3FF5A 1W7PB 2D45A 1Y64A 5AFUA 2YJFA 4CHUA 4L3QA 2ZJ2A 1BC7C 4EM2A 3WGHA 2E1ZA 5ICEA 3GFMA 1H0MA 5HS9A 2D0OA 2A40A 4KYWA 2HDCA 1MJBA 1J59A 3KP6A 1Z6RA 3I4PA 5ICGA 3CQYA 4I6MA 4K42A 5AQIA 2D1VA 4EGYA 4A0ZA 2W24A 1MDMB 1Z1DA 2BUPA 1U2VA 2VOOA 3H3ZA 6PAXA 2MH2A 5ERIA 1WSUA 1O3SA 1BO5O 4AD9A 2UYTA 2HYFA 5HDKA 3SMSA 2ZKZA 4ESBA 4H0VB 2O3FA 3QPHA 3ZEUA 3MCZA 1QZ6A 4RAZA 1FYLA 5E1ZB 2Z3YA 4A61A 1OKRA 2Q0UA 2IPQX 1K78A 5BQTA 1UFMA 3B02A 2A6HF 4RB0A 2ETHA 3EL2A 3M1EA 3VGMA 3HTVA 1SD5A 1HW5A 3LM2A 4GXOA 4BC4A 1IXRC 2V9VA 1AOYA 2JZYA 2W85A 1ZAOA 2FMYA 1K8KA 5ICFA 1V4SA 2P5LC 1K7AA 1R00A 2V7ZA 4O5FA 1DKGD 5AQHA 4BHBA 4XBFA 2QWPA 2NZTA 2VBYA 3R0AA 3D2FA 3K9TA 4F9OA 2BBYA 2NS0A 4I0AA 4O6JA 4CZLA 3IDHA 3E6DA 2ELHA 4K41A 2XKOA 5CVRA 2GA1A 3DXMB 3CO7C 4PL7A 4FWOA 4KA4A 2CYYA 3VOVA 2KIFA 3IWZA 4BRMA 3E6MA 4CBXA 3QP5A 3CJBA 1G3WA 2HFHA 1HBXG 3AAPA 4Q48A 2ISZA 5I9EB 5FD6A 2IA0A 4BRFA 4BROA 2GZWA 3E5XA 1EH7A 3IL2A 1QQMA 3ZX0A 4BHCA 1QPMA 1NGFA 5ILSA 3R8EA 1BDGA 1NGHA 4H03B 4RGRA 2HF4A 1ATRA 1C0GA 3P4IA 1UHMA 3GFLA 1QGPA 5HS8A 4BRLA 4IZ9A 2QWLA 3EO3A 3OOPA 4R1HA 1HLUA 3O2PE 3V7SA 4RS8A 1ZLKA 4OMZA 1IJJA 5AZJA 3DXJF 5E18F 2ESNA 3QBXA 3ZX2A 2V52B 5AZIB 2XAHA 2ZMEB 1IAWA 5BRHA 2DU9A 3VPZA 4BR4A 3BOQA 4ZYEA 3LDLA 3ULQB 4CZJA 3ZMTA 2P9UB 5D4RA 1W4MA 1GVJA 4MTEA 2D0PA 1T6SA 2GXGA 4FWNA 4A5MA 4K2EA 3T1BA 4YDUA 4GCVA 5E26A 2COMA 4M9ZA 3SJHA 1MJAA 1ATSA 3ULEA 3ATUA 4NB4A 1ON1A 3CUQA 3HHGA 5HDNA 2VBWA 1X9JA 4G9YA 5LHHA 3TO7A 2Q1NA 4S04A 1SMTA 1T2KA 4MLHA 3RTRA 2KJCA 2UWMA 3ECHA 2HGCA 5E17F 3HSCA 1R1VA 3GUDA 2E88A 2RDPA 3V8KA 3FHZA 1H9TA 4AM7A 2GWKA 2J5PA 5FB2A 3CO6C 4I01A 4EIAA 1BI1A 4M73A 2QENA 2VT2A 5LRRA 5ILUA 5FLXZ 1F9NA 4NO7A 1NWKA 2JPBA 2O8XA 5BN9A 2NRAC 2VN2A 4CYDA 3RI4A 3FZMA 5AQOA 1BG3A 3ATVA 3VEYA 4YFNF 3HRSA 4WXHA 2FBKA 4P55A 5A2QZ 1QQOA 1S6LA 4B8XA 4CGZA 1R5HA 5F1RA 4LMYA 4ON0A 2IRFG 3CLOA 3LWFA 1F5TA 5BREA 5CYVA 2HYGD 4L0ZB 3VB2A 3OHRA 5BPNA 4A0YA 4CI6A 1MDUB 4PDKA 3WG9A 1NHAA 2V1XA 3U9DA 3DP7A 2IIRA 4DQ8A 2P4WA 3K1MA 4R8HA 4CZHA 1YG2A 3FR0A 1G3SA 1IRFA 3QU3A 4L5IA 2DQLA 2PMUA 2W41A 5F0XA 5E8GA 5CVJA 2RGVA 2RNJA 1R22A 4ISEA 1LDJA 4DCHA 2VCPA 3FM5A 3L09A 1NGCA 3P7NA 4KN7X 3ZMDA 1FYKA 3UE5A 1KYZA 3NRVA 3LA7A 3BUZB 3LDOA 3K0LA 3O08A 2W25A 4MGRA 4UHTA 4RAYA 5FO5A 1YLFA 5AQVA 1S29A 3ROUA 5LGUA 3E3VA 2XV4S 3F23A 1XSXA 3HRUA 3QAHA 1BA0A 3FXRA 2D1KA 4Y17A 3IKTA 4KIFA 5AQNA 4G7ZF 3UKUB 4H0EA 3BF1A 3ECOA 1SMYF 2YHWA 1XDUA 3WTWC 3LFKA 2I7PA 4IHTA 4EJWA 2FSJA 3WXLA 4QS7A 2FOKA 4HQEA 4YDUC 5HDGA 1BA1A 1TUYA 1FY7A 2DPDA 1S3XA 3I8BA 1KAXA 4WK8F 3VODA 3I59A 2CGPA 4M63C 3E6CC 1G3TA 3GG4A 4L5JA 4XH5A 2FSKA 4E70A 1NLVA 3SMPA 3QPTA 3ZMZA 4TV7A 4BHPA 4IRIA 1NGIA 3L4IA 3FXQA 4HV6A 3ELKA 3VF4A 1TW2A 2W57A 4FOEA 2GWRA 1ZC6A 3HTUA 5AQUA 2K86A 1IXCA 4BQLA 2EFQA 3BROA 3L2CA 3WUHA 1S3JA 3QRFF 5BOXA 1S7OA 4XH4A 3WGIA 5E20A 3BPVA 3LAPA 3SZTA 2IVMA 3I0TA 1CF7B 4BC5A 2FXAA 3REOA 2YHYA 4MQVA 2BV6A 2QZ8A 2M8EA 4L9TA 1MJ9A 5JI6A 4ZYGA 4BR5A 1DGKN 4AIKA 5DEQA 1D8KA 3HIFA 4EJTA 4DB3A 4PGHA 1BU6O 4ZYHA 2QBYA 4YIIA 3MK6A 3IFRA 1U5TC 3P9CA 2QUFA 3D2EA 1IN5A 4AIJA 5E1XA 1ULYA 1Z91A 4J8FA 3W0LA 5ADXA 1PUEE 3A5LC 4IJAA 2AA4A 3QFUA 1U3EM 4MQ9F 4ZZLA 5H6RA 4LLGF 5TKYA 3I54A 3VEVA 4BREA 3LM9A 1GLEG 3FZHA 1RNLA 2KJBA 2P6SA 3KCCA 3TQNA 4CZGA 3TKYA 2LF7A 4CD1A 3COAC 1Z9CA 3W6KB 2FXUA 2Y48A 1MD0A 3L7WA 2IW5A 3V8LA 2G7UA 2E20A 5AQWA 1SFUA 3UKRB 3VOEA 4DNCA 4FX0A 4EM0B 5AQMA 2DFIA 3ABTA 3R4KA 3UB5A 5DD4A 3FZFA 2QWWA 1F1ZA 1OKJA 4Q5SF 1YUWA 4EJVA 2E2PA 3CJ7A 2IP2A 4WQ5C 3FLCO 4OINF 1W7PA 2M45A 3QB0A 3F6VA 4BNCA 3JW4A 5KPRA 3RKXA 4KBOA 1YYVA 5KPTA 3Q9VA 2Z99A 1GLJO 3DF8A 2QWNA 1P2FA 3AAFA 1BOTO 3KLNA 2PFBA 1IN8A 4F7ZA 3FZKA 4H5NA 1ZG1A 1RUNA 2FU4A 3KETA 2LNBA 2LKPA 3E5UA 4FPAA 3G25A 3WTYC 3GLXA 5F6FA 1R58A 3SLCA 2HZTA 2FNAA 1RFQA 2DK8A 4D0PA 2TDXA 2J4RA 1QBJA 1W5SA 1FLIA 4Z2YA 5F2RA 3T8RA 2DW4A 4CZIA 5JHUA 1G4DA 3F8NA 1TNSA 5D6EA 4YIFA 2K7LA 3EN9A 1R7JA 1HX1A 3O1WA 3KEQA 2ZBKA 2VXZA 4WXCA 4U0WA 3F6OA 5E84A 1FWZA 1KU9A 1VTNC 1XN7A 4EVIA 1XDSA 3CTAA 2BTFA 5DYMA 2MD5A 4O5VA 2VE8A 2WTEA 1YXQA 2QW9A 4LLLA 4FWKA 2A6AA 3CJ9A 4FL9A 3WEEB 3J81Z 2FNPA 4PZJA 2CFXA 3WODF 2JRTA 3ZMSA 5EEGA 2OU2A 1QZZA 4G7HF 2Y0MA 2PN6A 1IF1A 1FBQA 4IRGA 4M71A 5FLXK 5AQXA 2A5YB 3KHYA 2FEZA 2PMHA 3O3KA 3VEWA 2QQ9A 1BI2A 4GYIA 5E1WA 4HTLA 2NLXA 4RB2C 2XIGA 3DXMA 3MMVA 1WKMA 5AIQA 1ZYRF 2ESHA 4B1WB 1HPMA 4FWQA 2CG4A 2HOEA 1YQAA 5A2QK 2QWOA 1ZG5A 5AONA 5ILVA 3K1NA 5J8FA 4XEIA 1TQIA 3E97A 1SFEA 1YTYA 1WWXA 2JTVA 2XAGA 1P92A 2VOPA 3BDDA 4BRGA 2EFPA 1Q1HA 3OV8A 3QP6A 5BPDA 4FO0A 3ABUA 5BN8A 1BUPA 3R61A 5LGTA 3KLOA 2P7CB 3J7AO 1G3YA 4XH1A 4DQ2A 3WTZA 1ODDA 2UZKA 3GO5A 3O8MA 3BJOA 1ZRFA 2PI0A 3GL1A 4BRHA 2F5DA 5KQ8A 2XROA 5AZIA 2ZMEA 4EMSA 3MAJA 3GE1A 2V6CA 1MKMA 4R79A 2VYPA 3FMRA 3JSPA 4C23A 1PP8F 2ZF5O 2RVCA 2VWBA 2O6GE 3ZETB 2WUSA 2GEMA 3EUHA 2P9UA 2WC2A 1DEJA 5FPMA 4H0YB 1ZGJA 1TQMA 4CBWA 1HUXA 2K4JA 4JAXA 3M3ZA 1R23A 3GEZA 2YSRA 5D5VB 4N9HA 3JAMZ 4GY2B 2BGCA 2H6BA 2ZGYA 4QLCU 5AIPA 2HWVA 3LSTA 3RYPA 5LLQA 3IMXA 1U6GA 3TU5A 1JXSA 3IWFA 1YW9A 2E8AA 1BIBA 1DPRA 2Y75A 4OMYA 4RCHA 4RGUA 1W7PD 3V4GA 4EAHD 3R0JA 4HWIA 3WTUC 5BMZA 3QICA 5DCMB 1YS7A 3ZP5A 3CQXA 5JVTA 3MN9A 4PKIA 2ZWHA 5D4SA 4O3MA 2P9KA 3CUOA 4M7XA 5CVUA 3U1DA 1JCEA 3NQOA 2F5EA 3ZN0A 1NGBA 1YAGA 4BRPA 4A2UA 1GLBG 1XMKA 4A6DA 3TOAA 5HVQC 2ZNYA 5KQDA 5EY4A 3R6SA 5FPEA 2CGJA 2QXLA 4ISFA 5BRDA 3U2RA 3RPQA 3A5OC 1WUAA 3GX4X 2STWA 2HMPA 4I09A 3HOTA 3FMSA 2WV0A 4LG0B 2E7WA 1OYYA 3L00A 5L3BA 3M6GA 1XSVA 2XUBA 2CGKA 2JSCA 3D5LA 5AQTA 2J5OA 1YFHA 2A5XA 1XC3A 4YFKF 3FGUA 3LDPA 4MTDA 4BH9A 3FZVA 4I6MB 1P8ZA 2YX7A 4KDPA 3KP2A 5DD8A 2V7YA 3WTTC 1NGEA 4AM6A 1HW2A 1U2VB 5AR0A 1TUUA 4BVOA 1TYQB 2XAFA 2QQAA 5KVRA 4WQ4A 5AQFA 2EFOA 1LNWA 4I7HA 4K43A 3WTSC 3KEOA 2EFWA 2Z5UA 2MBFA 1QZ5A 3R6MA 3CETA 2ASOA 3LDQA 4M6XA 4IHSA 3RJPA 4KMFA 2A3ZA 1BOAA 4AVPA 4GGGA 1B9MA 3BP8A 2BYVE 2O03A 2FE3A 3I64A 1P4XA 2NRHA 1BI0A 4KT5C 4NHJA 4HQMA 2FF3B 3HM8A 1I27A 1K79A 4P5OA 1HKGA 3IKVA 4HX8A 3EDPA 4HDUA 4H5WA 3QFPA 3UKUA 3CI5A 4CXFA 2UXNA 4CZMA 5FFXA 4JBAA 1DUXC 5LHIA 3GVAA 3VEXA 1Z6TA 1FC3A 2LF8A 1TLHB 4A2BA 2ZO4A 3VFZA 2P9SB 4KN4X 5JFRA 3KP4A 3O6WA 4UV8A 3WGGA 1HKBA 3KP7A 2P9LB 5F1XA 1FSEA 1STZA 3S41A 1Z7UA 1XGOA 2DLLA 4Y0WA 1ZLJA 1CGPA 3VEPA 3V7CA 2ISYA 1KU2A 1AWCA 2EWSA 1SD4A 4KFCA 1GLAG 3R9PA 4A12A 3J8AA 3HBTA 4XLNF 4OU0A 1KYWA 1USTA 5ED4A 5CJ9A 2GAUA 3ZPLA 1KAYA 3DEUA 3FXUA 2X0LA 1NBWA 1BIAA 1WQ2A 1T6CA 1CF7A 4IF4A 1UHWA 2IA2A 1J5YA 2M30A 2PEXA 3EYIA 2YCHA 3ZX3A 2Q36A 1TQPA 3KFWX 4IXAA 3CJNA 4WX9A 4HX7A 4HLXA 2YX4A 2F9WA 2L54A 1HKSA 3KP3A 4GYGA 4A62A 1S8NA 2KIUA 2PBDA 3H46O 4CZZA 1YS6A 5L3DA 2EB7A 2K27A 3WTXC 1G99A 5HS7A 4U7BA 3HHHA 2R7FA 3M8FA 3J81K 4NQWA 2M87A 4WF2A 3DPLC 2FQ3A 2Z9OA 2HF3A 1IXSB 3EYYA 4ENKA 3ENHA 5H20A 3HI0A 3VENA 3H3NO 5LY3A 3K2ZA 1L0OC 2YPRA 2P5VA 4MHGA 3G73A 4QWQA 4WXDA 2ZNZA 1EH6A 2XHKA 1YW8A 4WQ4C 3H1QA 5J6XA 5BS6A 2MC3A 2KIMA 1QO0D 2EK5A 4B1UB 4U7DA 4PKHA 1W5TA 3VEOA 3UKRA 4LK1F 5D6FA 2HEOA 1JCGA 3CUQC 2OZUA 3AY9A 1DDNA 3MCPA 3KZYA 1G6NA 1ZARA 1ZRCA 3EETA 4BG8A 1YW7A 3BJAA 2DT5A 4K25A 2R3SA 2XKPA 5AQJA 4BRKA 4FHTA 4BR0A 3RDIA 1U2WA 5DDGA 1O3RA 2M5WA 4DHYA 2VODA 3W3DA 2GTDA 3IC7A 1E17A 2P9NB 2P9IA 4HV5A 2GELA 3R60A 1U5TB 3TDUC 1J7KA 3P9IA 3V8JA 3SFZA 2GUPA 3F3XA 4OIPF 4LLNA 2P5KA 3FM3A 2QWRA 3ISPA 2GQQA 3DAWA 3J80Z 4L9VA 3WU0A 3HYIA 4CZFA 4M74A 2PG4A 5JLHA 2RQPA 3N97A 2DO7A 3ZMUA 3F8CA 2I7NA 3Q5FA 2HS5A 2HQNA 1LVAA 2A41A 2EWNA 4H5TA 2DI3A 3JAMK 4ASNA 2ZXJA 3C7NB 2E1YA 3MN7A 3CJ1A 2YHXA 2CW0F 4OIRF 2A68F 2FLOA 1LDDA 2W84A 5L3EA 2XAQA 1REPC 2PLYA 1ZH5A 1O7LA 2GIVA 4HW0A 3CJAA 3ERED 2D4WA 4A5NA 3GXOA 5LEJA 4OIOF 4G6QA 4LFUA 1DPUA 3GOIA 4HBLA 3O5BA 4CDGA 4XSXF 1PP7U 3WEEA 3MQ0A 1J9IA 3CIPA 2JPCA 5FPNA 3WT0A 4S05A 4G94A 4OIQF 2IVNA 4XRFA 3WXIA 1QZYA 3DKWA 3PQKA 5LEKA 4JN4A 2F5FA 1X3UA 3I5UA 4B1YB 3B8AX 3A8YA 5AFUH 1KQ0A 1JGSA 3IRQA 1QQIA 3EKUA 1ON2A 4KUMA 1D5VA 5F64A 3LA2A 4ENNA 2HKXA 4Q47A 1BWFO 1YO5C 3VGLA 1R1TA 2ITMA 1FPQA 2IA1A 1XUPO 4LJZF 3QDKA 4ZH4F 2GA2A 4MLEA 4Y13A 1WI9A 3IUCA 4HDVA 3LDNA 2LDUA 4HF1A 2IJLA 4JNEA 2XGXA 4XLPF 4ISGA 3LQRA 3FE1A 1MDMA 3AAQA 4IPAA 4B1VA 2HR3A 3KVGA 5JR3A 3C18A 4CJ7A 3QBWA 2XRNA 4HLYA 3I33A 4NB5A 3TOBA 1MWKA 4KICA 3BZ6A 5BPLA 3MWMA 3IHUA 1B4AA 4FWSA 4PGGA 1D4XA 2PBIA 4EHTA 4EJUA 3ZETA 1B6AA 5L3FA 1FOKA 2E2QA 4L9JA 4ESFA 4HF2A 3LQQA 5EEHA 4RB3C 1WOQA 2ASPA 2ACJA 1BI3A 3CDHA 1KAZA 1ZXOA 5EOYA 4KNYA 4B1ZA 1MGTA 4BG9A 4HYEA 2EV6A 1I5ZA 2YI1A 4BQAA 4BC3A 3MZHA 1OYIA 4CD3A 1FZPB 3BF3A 3CERA 4JQFA 1NMDA 3F9MA 3DXKB 4UXNA 5DCMA 1E4GT 2QWMA 4BGAA 3HRTA 2P9PB 2G9WA 1DP7P 4H5VA 4I98B 1V4TA 4LD5A 2IVPA 2DPNA 4EFHA 3DV8A
chains in the Genus database with same CATH superfamily
1JUPA 4CA0A 1QHGA 1I1SA 4M45A 4ENJA 3SJMA 5E8IA 1R71A 1XGNA 3V6DA 2A6EF 2D1HA 2F5VA 1KU3A 1KA8A 3MXJA 1KGSA 4J00A 2P0WA 1S7AA 4XSZF 3CYMA 4DYQA 5D3GA 5CZ1A 4HX4A 4CEBA 4OOIA 1VQ5I 4DG1A 1SANA 3VYSB 4KI4A 1QQNA 3OS1A 4BXUA 4AM3A 4ENMA 2V51B 5D5XB 3F2KA 2YNFA 3CMEI 4AWXB 1TYQA 4Z94A 1YVNA 4H0XB 3T5XA 1I3AA 2YNGA 1HMVA 1JE8A 3WNGA 3ZOBA 5K5RA 5D8KB 1QPIA 2A61A 1MBHA 4HTUA 4WCGA 1T44A 4FZZA 1YI2I 1X1DA 1I1GA 1ENHA 4KI6A 4OAYA 3TAQA 3OSGA 1HQCA 5FKLA 2WBNA 1LOTB 1S5LC 3ZT1A 1JTXA 2UV1A 1U9NA 4KIBA 2W7NA 4AIHA 2OA4A 3JRHA 1KLMA 2NNNA 2ADUA 5CVIA 3CCEI 2P8TA 3HUGA 2HVIA 2VONA 2O8BA 4KIGA 3JRFA 1VQMI 3GZ6A 4L18B 2P9LA 1O57A 5EG0B 3PQJA 3T8TA 3ASMA 1SFXA 2QSFX 2Z2SB 4M72A 4CF9A 2MW8A 1IO2A 1WCMJ 1TWCJ 1GLNA 1ASWA 1X2NA 3JRCA 4OJRA 3IH2A 2Q97A 4A6EA 2O8DB 3BEXA 4E7HA 5AQZA 2XF7A 1AA7A 1MH3A 3CC4I 3MEXA 3EUAA 5M1NA 4DR7K 2RN7A 3CQZJ 2Q2EA 3DJCA 3BGRA 2Y9YA 5IT3A 2Q31A 1DGRM 2YU3A 4BC2A 2QYOA 3OYLA 2Y30A 1Y0NA 1HXDA 4XLFA 4XRMA 1WSGA 2OANA 1PDNC 2NXNB 5MLCQ 4CERA 4XR6A 2EX3A 2WAQA 1KLNA 1YJWN 3GYHX 3BPXA 1P7IA 3S15J 1PUFA 2E1MB 4P96A 2GXBA 5JVHL 4C8KA 2H3GX 1EQYA 3SQ4A 3FKJA 4BRCA 2HHUA 4JI2K 3PNYA 4PL8A 1FIPA 3S3MA 4BU2A 2BW3A 1T03A 2KQRA 5LGNA 4GKJK 4A3CJ 1UG2A 3EZWA 3MX2A 1G8XA 5EGOA 3TTDA 4ELTA 5B8HA 2P9NA 2CQXA 5JHFA 2QXFA 3MDQA 1HJOA 3ABKH 5CKTA 2IVOA 4JS4A 4QS8A 3D7EO 3NF9A 4HOBA 1NH3A 3SXYA 5ICCA 4BYYA 3QOPA 5IOZA 2A07F 2OBPA 3HKZA 2BEOA 3J7AP 3HOSA 1JL1A 4Y1DA 1IG8A 3MFKA 2PAVA 2D2WA 1ATNA 3HJEA 3BWGA 2VE9A 3C1DA 3EKSA 4ITVA 5M1FA 5HLIA 4DFJA 4L8RB 3H9JA 3GZ5A 1ZBIA 2K5CA 1HNZK 4CHYA 5CE3A 1Y0UA 3WE2A 1MMNA 5AQPA 3D0PA 4NXNK 1W0HA 1HSJA 3VQ8A 3JRBA 4M3TA 4CJPA 2Y1IA 1VQ6N 1E2XA 4B1XB 3LALA 1SAZA 4N76A 3GDQA 2QQ8A 3AG1H 3KYLA 1WSIA 1XMAA 4IXCA 3M7GA 4EGZA 2FBXA 5EJCA 2YU9J 1ACIA 4AH9A 2KKOA 3V7RA 3MEDA 5AQRA 2HBJA 1S1XA 4DSFA 3Q3SA 2CJJA 3EZ5A 4FVUA 2A3SA 4B9MA 1ZBUA 3DBRB 2WV1A 1FJGK 3V1OA 1K83J 5KGWA 4LGWA 5DUIA 4LC9B 1A04A 2X1DA 5AQSA 1V54H 3NH0A 4L9NA 1VSEA 2RAEA 3KD1E 3OVNA 1U78A 2W48A 1V5EA 1GXPA 4G8XA 3O1BA 4QS9A 2HBKA 1MMGA 2X51A 1TL8A 2DQRA 2FF6A 1N33K 4C2TA 4YELA 1OH7A 1UAAA 4ILGB 2VQCA 1FXXA 2YHBA 1U4BA 1TBXA 5CQEA 5LHGA 1S22A 3A0BC 3LOCA 3JS6A 2E71A 2VBXA 1FX7A 3WNEA 4PKGA 1EV7A 4X65K 1EXQA 3G0ZA 1FBSA 2DJNA 4ESJA 2OD5A 2YR2A 3HSRA 1K6OA 4CBUA 3HJFA 1TWHJ 4P9UA 3AVKA 4WF9L 1F21A 3LAMA 4JD2A 1VSJA 3I56N 2PYJA 2Y31A 5KTQA 4A3JJ 4CEOA 4FLVA 4CO8A 3BY6A 3W2WA 2OPSA 1U6ZA 2QQBA 1ZHFA 4N0BA 3W6JB 1B92A 1R36A 2V9KA 4Z4IA 3LSKA 1GLDG 1H8AC 1D1BA 2R4GA 2NRRA 2E2OA 3H6EA 4A2AA 2Z1JA 3DFGA 1QHAA 3NCIA 2HZDA 2CQKA 3QPLA 5B3SH 3DPTA 3MN6A 5J4VA 3AARA 3RQ4A 3VTIA 2KHMA 3D2EB 3CCSI 2NAZA 3BCAA 4AIDA 4HNTA 4F4KA 1YX5A 3I55I 4UUVA 4YRVA 1C6VA 4DFKA 4FJ7A 2Q2RA 1SUQA 4PSWA 1X3NA 1Q9XA 4ZZDA 4KREA 5EZHA 2A69F 2O5RA 1L3LA 2A42A 2L3DA 3H3VK 2F4VK 1VQKN 4FX4A 4DTMA 3Q9SA 3ESWB 2Q0OA 3FF5A 3QQAA 1JT0A 1KTQA 2D45A 4XOPA 1Y64A 1G15A 4L3QA 2ZJ2A 1BC7C 1FKOA 4PUOA 4AILC 5JVGL 2ZD1A 5ICEA 5HS9A 2A40A 4KYWA 3KP6A 1Z6RA 5ICGA 3CF5L 2CUEA 1HNIA 4A0ZA 4CF0A 3JSMA 1MDMB 1Z67A 1GV2A 1VAZA 1OCZH 4E7IA 3GTOJ 1N32K 1LKXA 1QZ6A 1D9DA 4DV6K 3VQ7A 2Q0UA 1UFMA 3QEWA 3M1EA 3HTVA 3LM2A 4AYBA 4C8OA 1JUSA 2V9VA 1AOYA 5DK5A 3OYIA 2ZJPL 3LZJA 4KTQA 1R00A 3K5NA 3ZSVA 4BHBA 4XONA 3DKYA 3BZKA 4WFAL 4V19S 1TK0A 4F9OA 2BBYA 1T05A 1YJNN 4CZLA 2ELHA 5GAHJ 2L0KA 3TAEA 5CVRA 3DXMB 3HOXJ 4PL7A 4FWOA 4KA4A 3QEIA 1XC9A 4BRMA 1LFPA 4LSNA 3QP5A 1G3WA 5HL7L 3AAPA 1J5OA 1DT9A 4BROA 2I5JA 2BY1A 1NGHA 4H03B 3WU2C 1C0GA 4LFAK 3GFLA 1QGPA 4IZ9A 1FOWA 3HL8A 3O2PE 3V7SA 4RS8A 1JLAA 5AZJA 1OR7C 3QBXA 2V52B 3QINA 4DFPA 5BRHA 2DU9A 3BOQA 3LDLA 3FIWA 3F73A 2HNHA 2L9NA 3CC7I 3K5LA 4FE7A 3O8HA 3T1BA 4PY5A 4QCLA 4M9ZA 2LD5A 4XICA 3SJHA 4LF6K 2L7MP 3ATUA 3HHGA 2V9PA 5J1YA 5LHHA 1SMTA 1MSFC 4MLHA 4GV6A 3RTRA 2KJCA 1CZBA 4Q5VA 5FKOA 4AM7A 2J5PA 5FB2A 4NXMK 4NLBA 2JA2A 4C30A 2HW3A 1MMAA 1KSPA 2XSDC 1NG9A 2VXDA 1EKEA 2NRAC 4CYDA 3SQ2A 1BG3A 1L3SA 2DOFA 1S6LA 4CGZA 3CCJN 2PJRA 2OZMA 1LVKA 4BQNA 5CYVA 2HYGD 2FX0A 3D45A 5E3LA 4KRFA 4O0JA 1YITN 2IIRA 4R8HA 1RR7A 1HA8A 1JKHA 2DQLA 2ZB9A 2W41A 2DCEA 1R22A 4IDHA 3O3HA 1B8IA 5GP9A 1LW0A 3UE5A 4BJTA 2Y0SA 2Q2EB 3O08A 2F8TA 4RAYA 5FO5A 1YLFA 5AQVA 1S29A 3MEGA 3VYTB 2PX9A 3AVFA 1MNDA 3DRPA 3TAMA 3DLAA 4HSTA 5AQNA 5C42A 1WSHA 3BF1A 3BR3A 5HRNA 3OYCA 5M1OA 2DPDA 1KAXA 3I59A 4M63C 3E6CC 3PUFA 3FHNA 2DJIA 1YF5L 5J1EA 1JKQC 2QEXN 4BHPA 1NGIA 3AVCA 3L4IA 3ELKA 3VF4A 4FJIA 1ZC6A 5AQUA 2G8UA 1IXCA 4BQLA 1UHSA 3WUHA 1S7OA 4XH4A 4B9SA 3BPVA 3I0TA 5CY4A 2M8EA 2DN0A 2F48A 2PMZN 1IKWA 5DEQA 1S6QA 3OR1C 3HIFA 4EJTA 1FTZA 2QBYA 3A03A 3QNOA 3A01A 3H5RA 2QUFA 2IDOA 5E1XA 1Z91A 4J8FA 3W0LA 3TMOA 3BT9A 3K4KA 5IPAA 2AA4A 4MQ9F 4BXFA 4X66K 4LLGF 4XIDA 5TKYA 3I54A 4RW7A 3LM9A 4M3FA 3KCCA 2XF5A 4CD1A 2Y48A 4F3QA 2XY8A 3V9ZA 3V8LA 3ZCOA 4DNCA 4FX0A 3ABTA 5C3EJ 3UB5A 3FZFA 4JKAA 1MBGA 3V81A 2ID3A 4OINF 2M45A 3JW4A 2KQ2A 3K6GA 1RBTA 3WHBA 3RZOJ 2YKMA 1GLJO 5HLFA 4TSXA 4H5NA 1ZG1A 1RUNA 2FU4A 3OYGA 3GLXA 1JKRC 2NVUB 4X0GA 2HHXA 2DK8A 2JK3A 3ALYA 3SI6A 3CM6A 1FLIA 4E7ZA 5JHUA 1NNEA 4IEIA 1TV6A 4KTZA 5GAEJ 4B3MK 3F6OA 4YOXA 4EVIA 1JL2A 1XDSA 3CTAA 2BTFA 4C8LA 3T69A 2LK2A 2MG4A 4O5VA 3MX5A 2MYSA 2VE8A 1NK6A 2QI2A 3WEEB 4XL9A 4PZJA 3WODF 4YOTA 2JRTA 1ERDA 2JQ7A 3ZSOA 4J2AA 2NOJB 1MIJA 2GBZA 1IF1A 1BW5A 2HNYA 4YOWA 4IHWA 2FEZA 3HSTB 3H0DA 4GYIA 4HTLA 2XIGA 3MMVA 2E5ZA 5AIQA 1HPMA 1HQEA 1WLJA 1YQAA 2HBMA 1ZG5A 1JXBA 5AONA 3K1NA 4B1RA 4XEIA 1SFEA 1WWXA 2LBFB 1HC8A 1OISA 2G0EA 4F3OA 2NVXJ 4BRGA 4FYDA 5BN8A 1ZR4A 3F5TA 3J7AO 4M3XA 1ASUA 3HVRA 3WTZA 3K4BA 3GO5A 2CRGA 2CW8A 3HM9A 4CEQA 2KMUA 4BDYA 4EMSA 3G71N 3MAJA 2V6CA 1MKMA 2VYPA 3FMRA 4E89A 4C23A 2WUSA 2P9UA 1DEJA 1ITYA 3VMFB 2DA1A 3HXLA 3W6VA 2R7WA 4CIFA 5E41A 3LSTA 4FTHA 5LLQA 1YW9A 1RC9A 3SQ1A 4UB6C 2R7QA 4CK3A 1A6QA 2NRTA 4RGUA 4OLAA 2DA5A 4B08A 1JJ6C 2DXIA 1SC7A 4M3BA 2E2IJ 2IS1A 3BG7A 2ZWHA 2P9KA 1D0YA 2W42A 3IRXA 4C3IJ 3NQOA 2F5EA 2EH3A 4BJ6C 1NGBA 4XORA 4BRPA 4A2UA 1XMKA 5HVQC 1YJWI 3FK7A 3RCOA 5KQDA 5FPEA 2QXLA 5BRDA 3U2RA 1WUAA 3GX4X 3QIOA 3E01A 1MW7A 1AU7A 4A3GJ 3FMSA 2WV0A 2AO9A 3M6GA 1Q7YO 2XUBA 2CGKA 4CCOA 1V55H 4FJLA 3D5LA 3QEXA 1P8ZA 4N4NB 3WTTC 1NGEA 3OOUA 2W1OA 1T8EA 1TKZA 1HW2A 3K58A 4QOZB 2XAFA 1U48A 3GBGA 4MFEA 4KJZA 2EFOA 1R4NB 1XX5A 3QESA 3N4QA 2EFWA 2GM4A 3OIPA 1QZ5A 3CETA 2E34A 3THWB 4M6XA 4CJWA 2P1JA 3K4JA 1U04A 4EATA 3JRDA 4AVPA 2ZE2A 4CF8A 3BP8A 2COBA 3EPZA 4KT5C 4NHJA 3ZCMA 2CV1A 3DBLB 1K79A 3SAHA 5FLXO 2HXOA 1Q81O 5KRSA 4CXFA 2N8GA 5FFXA 1Z6TA 4DR3K 1KVBA 5A2QO 4NLCA 2V26A 1EWRA 4KN4X 4XM3A 4CEFA 1VQ6I 3O6WA 1OLTA 3S41A 1Z7UA 4XKCA 5JS2A 2ISYA 4FJJA 4CGHA 1W5CC 4QIWN 4A12A 4OU0A 2M2EA 3ZQLA 1NK7A 1KAYA 3FXUA 3FXKA 2KZGA 1WQ2A 3ZYYX 1TK5A 2V4JC 4E4HA 2PEXA 2X6SA 2HU9A 2L9VA 4HX7A 4HLXA 1HKSA 3KP3A 3H46O 4CZZA 2EB7A 1T3VA 1FKPA 4KV8A 1G99A 3QOEA 2R7FA 3CDIA 4JI6K 2Z9OA 1IXSB 3RMDA 2QKLB 1RNHA 3VENA 4GKKK 3OYEA 1XI1A 2ZNZA 4KT6A 3CCLN 2XHKA 4WQ4C 4OLBA 5BS6A 2O8FA 3ZXSA 2EK5A 4U7DA 4PKHA 1X1BA 2M7AA 3TTCA 3KZYA 1G6NA 1ZARA 4AHVA 1OH6A 4DBRA 3S9HA 3T7ZA 3TAGA 1D1CA 5SWMA 3W3DA 2GTDA 1WI3A 2P9IA 1VSFA 2PJRB 4FM2A 3TDUC 1J7KA 5IP9J 3AA2A 3RMAA 4OIPF 3I56I 4YOUA 1TT0A 3FM3A 2QWRA 1QVGM 3J80Z 2XPUA 2R92J 2RQPA 4J2BA 2DO7A 3ZMUA 3PIOF 1C0UA 3QODA 2A41A 2EWNA 3CF2A 2X48A 3C7NB 4Q0BA 2E1YA 3MN7A 3GLLA 3CJ1A 1RDCA 2EILH 2A68F 4MO7A 1N75A 3RR7A 2PLYA 4A59A 3L3VA 1O7LA 3ERED 2D4WA 3GXOA 1IUFA 3GOIA 1N34K 1X9WA 4IQJA 4XSXF 2DMQA 3CIPA 2JPCA 4BKXA 5FPNA 2YHAA 4YFUA 1TAUA 3HG9A 3PUBA 1DQUA 3PQKA 3BTIA 5LEKA 4B8CA 1RDBA 2F5FA 4DV1K 1X3UA 5AJ3K 4JS5A 1QQIA 3EKUA 1ZELA 3LA2A 4Q47A 1YO5C 3RKQA 2ITMA 1FPQA 4LJZF 2GA2A 2OCEA 1VQKI 4FE4A 4MLEA 3M3YJ 5F08A 4BL0B 1WI9A 3LDNA 2VL8A 2XGXA 3LQRA 3SUPA 1OCCH 4X64K 1U45A 5M3MJ 5FJ8J 3P83D 4IPAA 4B1VA 3ZQQA 2VWKA 4DSEA 2L7ZA 3FK6A 4HLYA 3I33A 3HEFA 1MWKA 4Y1CA 3SUOA 2KRHA 1JJ2M 1Y6IA 4EJUA 3BLYA 2CFOA 1IRXA 2K3PA 2VJJA 1NJWA 4RB3C 2ASPA 2ACJA 1MNEA 1VSMA 2HVQA 3B6CA 1ZXOA 5EOYA 3LPUA 4B1ZA 3KLEA 2DA6A 2YI1A 2PYLA 4B9TA 4GW6A 3CERA 4JQFA 3NBPA 2MD0A 2OV7A 4UXNA 5DCMA 2QWMA 4BGAA 4IEJA 1APLC 2P9PB 2VG7A 1DP7P 3D5RC 4LD5A 2DPNA 3I71A 2CW7A 3ML6A 4I0BA 1BJZA 3FXLA 3DLLF 2JUCA 3K57A 2XASA 1FT9A 3O3GA 1YJNI 2E2JJ 3LDSA 4PFOA 3WQTA 4JKEA 3A5MC 1FYMA 4HRIA 2XDVA 3DOKA 3TGNA 4LG0A 4QSHA 2F5CA 3U21A 3ZT2A 2WAFA 3P38A 1YE9A 1IKXA 4HA8A 4A0XA 1XQSC 4NC7A 3TR8A 3JAMO 5IY5H 1WH7A 4I2OA 3WXJA 2FF4A 4LF4K 3EY1A 2Y2ZA 1V4RA 3BR6A 1NGAA 2BZTA 2DTUA 2M1BA 3PX4A 5HP1A 2CQQA 3THYA 2FBTA 3BZCA 1BW6A 4J2DA 3ZMVA 4M7YA 4F3TA 1O7FA 2DA3A 5GADJ 1EWQA 2ID6A 5FLMJ 3OJUA 4FLYA 3N4MA 1UB9A 1JHFA 3LPTA 3BTCA 1K8AO 3C2GA 3Q0VA 3E9PA 3S14J 3GCMA 3S3OA 4FLZA 1WAJA 2HTSA 2R5ZB 1S1TA 3ABLH 2CO5A 2TCTA 4CFDA 2OQGA 5GIOA 1SL2A 3MMYB 4PCQA 2O4GA 4BVPA 1LJ9A 3M9AA 1OJLA 3HPGA 5BPIA 2CQ7A 5SZTA 3ZT3A 5M5XJ 3GWZA 1JI8A 4IOCF 3VETA 5DCFA 4BR7A 4P9FA 4DU1A 3F8BA 5EZGA 4YFXF 3N05A 3J80K 3SDGA 2FOWA 3VQ6A 3CCJI 4CJ3A 4MNUA 4HUEA 3K4MA 3HDDA 5ELZA 2HKOA 3MWTA 1R1UA 2QTDA 5BPMA 1YITI 3HC7A 3K4NA 5K7HA 2RKHA 4XN0A 1MWMA 4JI8K 2EZHA 1FSHA 5FGMA 1X4OA 4DWIA 3ZSYA 3RKWA 1WJAA 3VQBA 4DV7K 4KHSA 3E9OA 1A36A 4HAMA 3P31A 4IX7A 3QEPA 1X2MA 2KIQA 1Y39A 4IO9F 2ASMA 1DTTA 3R1XA 1BJAA 2GIZA 2UXCK 2HNZA 3WG7H 3L6QA 4IDKA 5J2QA 2G8FA 3NF6A 5IYDJ 2EPFA 5K1YA 2P9KB 4ZDPA 4CGJA 3GFIA 3FFKB 3KK7A 5M5WJ 3PIOL 3CJCA 3M1FA 4H5RA 4XNFA 1KZHA 1SZ2A 1B59A 1N8RO 2E35A 4FWMA 3O80A 1VRUA 1ITGA 4UVBA 4ETSA 5CLSA 4OKKA 3J7YP 5FFZA 2DAOA 5GTIC 2STTA 4DQQA 2QEXI 4DJAA 1Y8QB 2Q0RA 4CF1A 2I5UA 5L3GA 2QVOA 4YNQA 2X4HA 2VJ4A 1HKCA 4D9JA 1IZ1A 3A5NC 5LJVA 3SAFA 2H09A 4MEXF 3E66A 2O8EA 1T08B 3ULEB 2DTRA 4DS5A 3G3ZA 3MVPA 3L2UA 3K4CA 4XLEA 4CECA 2JMWA 1NGGA 5LJWA 4FPBA 2QM3A 3GF2A 1P90A 4KO0A 5DMRA 2F9TA 4CJVA 4NDLA 1UMQA 3HOUJ 1SQKA 1KXPA 2KRFA 2P6TA 3L0QA 4DUZK 2KZMA 2JGUA 1LFBA 1EETA 3AA4A 1VHXA 4KMUX 4RWTA 4FZXC 2MABA 1T98A 4DBQA 1ZG3A 2VG6A 3K69A 1QSYA 2NS7A 1WRJA 3A1YA 3I58A 1PVEA 5EF6A 3ZN1A 5J47A 3L2RA 2ECBA 2UXXA 3VF2A 1RI7A 2A1RA 1IJWC 3H3OB 3O6BB 3ITHA 3TSQA 1FBUA 1VZ0A 1X19A 2EZIA 4DIQA 4FJHA 2AP1A 3HZJA 1D0ZA 2DOAA 5J2MA 3OR2C 3DLLL 2AS5F 4RB1A 2PQ8A 3KD5E 3L4QA 4NC6A 2R7DA 2EA2A 1BBYA 2ME6A 3BJ6A 2C6YA 4JRQA 3GTKJ 4FWPA 2QWQA 1X1PA 4CZKA 4OGCA 3BG3A 5GADP 1SD7A 3A02A 3DXKA 3S2WA 4I9LA 4MO5A 4CICA 4B9UA 2BDPA 1J75A 1Z26A 5E3MA 1U8RA 4O44A 2NYXA 1D3YA 2O8FB 2MLKA 3T0YA 3WE3A 1TNTA 2YS9A 4L0YB 2K4BA 3C65A 4FJKA 2EA4A 1LWCA 4CFCA 3NGIA 3UNGC 2NNYA 1RZ4A 4BRIA 3TP0A 3F21A 3C6AA 1SD6A 2P9IB 4IJNA 5K7ZA 3LP2A 1T56A 3V4IA 2CMPA 1C0FA 3KYDB 2DBBA 4MIMA 2E1NA 3U8XA 2XF6A 2HNDA 3LMMA 3H92A 3G71I 3FWEA 4DZPA 2R7ZJ 4PSXA 1RT2A 3C0BA 3CLQA 2VT3A 1C0TA 4BWJA 1HKQA 4IO8A 1TZLA 3X2QH 3DTKA 1VQLN 5FRNA 3I0SA 1J0RA 1UG0A 3PFYA 2K3FA 1U49A 2IXSA 2ZCWA 2A1SA 1XPXA 5GPCA 3RPUA 2E1OA 3QYEA 3GBTA 4BRNA 4Z4GA 4RGXA 2QCOA 4EM1A 5KCMA 2WAEA 2YJFA 4O55A 4BY1J 3WNHA 4EM2A 4Y52J 2VGNA 2FUG2 4FLTA 3OTOK 2E1ZA 5EG0A 3P1GA 4CJ5A 4U87A 1I3QJ 2VQEK 1ZBHA 1J59A 3AFHA 1ETYA 1GOBA 4EGYA 4IO9L 1XWLA 2W24A 3VQAA 1RETA 5KI6A 3PL8A 4AD9A 2UYTA 2HYFA 5HDKA 1HDPA 4ESBA 4H0VB 3QPHA 3MCZA 1FYLA 1LWFA 2IEKA 1VSIA 1XNQK 2W6LA 3AL0C 2IPQX 3B02A 1QVFM 2ETHA 3PX0A 3VGMA 1SD5A 2PY5A 1HW5A 4BC4A 1IXRC 2HHQA 3ABMH 4B48A 1T95A 2FMYA 2P5LC 1K7AA 1D8YA 2IS4A 2HSTA 1X3WB 4XBFA 2QWPA 1BCOA 1ZTRA 4H4OA 4O6JA 1B9DA 1YTUA 2GA1A 2HMIA 2KIFA 2IOCA 4NYNA 1A6IA 2GXAA 5FD6A 3E5XA 1MBKA 1QQMA 2RREA 4YIRX 3ZX0A 5ILSA 3ZT0A 3K0SA 2HF4A 1ATRA 2DMPA 1T33A 1UHMA 4BRLA 4E7JA 3OOPA 3AO2A 3DXJF 5E18F 3KX2A 4IHVA 4IG0A 5AZIB 2ZMEB 1IAWA 5JS1A 2CQNA 3RR8A 3I8DA 1RT4A 4XKBA 4BR4A 4ZYEA 4FJXA 3ULQB 4CZJA 5D4RA 3IKMA 4DGWB 2D0PA 1T6SA 1NJIO 4GCVA 4OPHA 1MJAA 1ATSA 1TKDA 3RPUD 2X74A 4G9YA 2Q1NA 4XMYA 1T2KA 2UWMA 1K6YA 5E17F 2AQEA 1R1VA 2E88A 2RDPA 2GWKA 3CO6C 1WZ2A 4EIAA 1C1CA 2QENA 2VT2A 2WB1N 4NO7A 1NWKA 2JPBA 3CCLI 2DMUA 2VN2A 1SFOJ 3FZMA 4YFNF 3HRSA 2R7UA 1Z7LA 4P55A 1XMXA 4B8XA 1RKWA 2JWLA 5IOYA 3CLOA 3KLIA 4KH6A 2HHVA 5TKWA 1ZR2A 3WG9A 1NHAA 3CCYA 1YIJN 4I2QA 3DP7A 3K1MA 2UUAK 1YG2A 2HB5A 2HQAA 3FR0A 1G3SA 2IGMA 3AG2H 2ZJQL 4HCBA 3JRIA 2RGVA 2RNJA 1I6HJ 1LDJA 2D5RA 4DCHA 2H1LA 4M3GA 4XQFA 4KN7X 4DTUA 3RVCA 3CD6N 3BUZB 2LFBA 1EF4A 3ROUA 5LGUA 3F23A 1XSXA 4G7ZF 3UKUB 1S72N 3CMYA 2UU9K 1SMYF 2YHWA 4FJMA 2I7PA 4CJ4A 4JOMA 4EJWA 3WXLA 4QS7A 2FOKA 4HQEA 2GUIA 2EZKA 4XLAA 4II3A 5HDGA 1BA1A 3VODA 4HNUA 1YRNA 1RKTA 1G3TA 3J7ZI 4L5JA 4XH5A 3KK1A 4Y3OA 3PSIA 1SV5A 3FXQA 4HV6A 1RESA 1TW2A 3AO3A 2GWRA 1BL0A 5GAGP 3PO2J 2EFQA 3QRFF 3AVHA 1S9HA 5E20A 3SZTA 2IVMA 1CF7B 2YNIA 4LFBK 3M1CA 3PY8A 2F4OB 3SUNA 4F92B 4FK0A 4MQVA 2QZ8A 1MJ9A 3TANA 3H5NA 4H4KC 4AIKA 5KGXA 5GIPA 4DB3A 4PGHA 3MD2A 5M3FJ 2QGUA 4KPYA 2KRCA 1DTQA 1QS4A 3OIQA 2E19A 2O8EB 3D2EA 4HCCA 1ULYA 4K8XA 1JKPC 3O9TA 4IJAA 1U3EM 1ZKGA 4KHWA 4ZZLA 4AHTA 1OVQA 5H6RA 3G6EN 1BIUA 2LY9A 1RBRA 3VEVA 4BREA 1GLEG 2KJBA 4WFBL 3TKYA 2LF7A 4BBSJ 3COAC 1Z9CA 3TI0A 2FXUA 2EIKH 1MD0A 3SJJA 4X62K 2P81A 5GPAA 2E20A 5B5EC 3UKRB 3VOEA 4CJQA 3H9GA 2DFIA 1EJ9A 2QWWA 5F0HA 1F1ZA 4OX9K 3CJ7A 5C44J 4BNCA 1OFCX 4BE1A 5KPRA 3RKXA 5KPTA 5C15A 3Q9VA 4M42A 1C1AA 2DDBA 1EA3A 1W1WE 1IN8A 5IP7J 1UZCA 3OJSA 3NF7A 3KETA 1VSHA 1D5YA 2LKPA 1SKRA 3WTYC 5F6FA 3K59A 1R58A 2HZTA 4D0PA 4Z2YA 5F2RA 1WJCA 4CZIA 1O1WA 4OPKA 1RDAA 5D6EA 2ZBKA 2VXZA 4WXCA 2X1EA 4CZCA 3VYRB 5F04A 3VTHA 3K10A 3TABA 5DYMA 2K9MA 1N36K 1BISA 2QW9A 1FOXA 2A6AA 5M5YJ 3SPYA 2FNPA 2CFXA 3ZMSA 5EEGA 3VSLA 3DYAA 1J5EK 2A5YB 4HUFA 2PMHA 1WJFA 3HL2A 1BI2A 5E1WA 2XY6A 1J9AA 4BBRJ 5J3LA 3DXMA 1QA6A 3IAYA 2WTUA 4FWQA 2CG4A 2QWOA 5ILVA 3BC8A 5J8FA 1MNMC 1YTYA 2JTVA 5KHDA 2CUZA 2HPIA 4M3EA 3OV8A 1XHZA 5BPDA 4FO0A 3KLOA 3LSGA 3TW6A 2P7CB 2BHYA 4JRPA 2UZKA 4OPAA 4BRHA 1A5XA 1Z25A 4R79A 3JSPA 2ZJRF 1F36A 2RVCA 1JGGA 4JKGA 5FPMA 3Q0UA 4CBWA 4JAXA 3S93A 3GEZA 5DTDA 2P51A 5D5VB 5F0FA 4GY2B 2BGCA 2H6BA 2HOSA 2K9SA 5AIPA 2HWVA 3IMXA 5DS9A 1U6GA 3IWFA 1DPRA 3BDPA 4E1NA 4ELVA 4IBNA 1YS7A 3ZP5A 3BR2A 3CQXA 5JVTA 3MN9A 3HPOA 4JI3K 3JREA 4FW1A 3ZN0A 3DOLA 1YAGA 2PMZA 4LF5K 1GLBG 4A6DA 3VYUB 2Q3SA 5H2FC 3HP6A 5CHIA 4ISFA 4PJNA 3RPQA 2X9DA 3HOTA 2E7WA 1OYYA 2BY3A 5AQTA 1TWGJ 1XC3A 1HLVA 3FZVA 2WBMA 4KDPA 3ZQIA 2OCCH 4PJ0C 4AM6A 2W00A 4RDUA 2HVHA 5AR0A 2QF7A 3V1QA 5KVRA 5AQFA 4I7HA 3WTSC 4CUGA 3TWHA 2MBFA 4BGDA 4O8UA 2ASOA 1TT5B 3OBYA 3KK3A 4IHSA 2FBVA 1WJ5A 3DTIA 3IH3A 4D7MA 1ZBFA 3SFIA 2O03A 2NRHA 1OCPA 2FF3B 2XGEA 4HDUA 1Y1WJ 3DWLE 3K9KA 3OIOA 5LHIA 5IP6A 1RPWA 2NOGA 3Q7CA 1IKVA 3TSPA 4DV3K 3HYFA 2P9SB 1E3PA 3K70C 4CHNA 1MSEC 5F1XA 2DLLA 1D5AA 1CGPA 3HP9A 3VEPA 4XKVA 4ELUA 4KFCA 1GLAG 3R9PA 4CEEA 3J8AA 4HVJA 1USTA 2GAUA 2I10A 2X0LA 2O8CB 1NBWA 1ZK8A 1WVRA 2M30A 4AC0A 3KFWX 4OKJA 3AVGA 4V2FA 4FZYA 2F9WA 1W0TA 1QZEA 1YS6A 1SKSA 1S7EA 2FQ3A 2HF3A 4MFDA 1MBJA 3EYYA 3PJRA 2E36A 3WXMB 3H3NO 2VQLA 2YPRA 2P5VA 2DTZA 3RTVA 3DRSA 4LIUA 2QA4N 5C2DA 3TP3A 5J6XA 4NNJA 2KIMA 3AVAA 1W5TA 3VEOA 3AY9A 2HEOA 3MCPA 3G10A 2YUSA 4YEJA 3EETA 4BG8A 1YW7A 2IAJA 2L9RA 2XKPA 3CJTB 4IOAF 3TTFA 4BR0A 3RDIA 1U2WA 1GDTA 1O3RA 1POGA 4NUBA 3IC7A 1UA0A 4HV5A 3R60A 1U5TB 1JLBA 1BL3A 2XC7A 2BH1A 3DEWA 1S1UA 3ISPA 2NUBA 3HYIA 2PG4A 5JLHA 2BXYA 2VASA 1HYVA 3Q5FA 2HS5A 2UUBK 4ASNA 5LD2C 4C8MA 1IV6A 1HR0K 2YHXA 3BR5A 3VA3A 2FLOA 1RBVA 1REPC 1ZH5A 4HW0A 3CJAA 4OIOF 4G6QA 4LFUA 3O5BA 4CDGA 3NFAA 3NWTA 1PP7U 3WEEA 3MQ0A 2GV9A 2ECCA 3L1PA 4OIQF 5F0CA 1KRPA 4XRFA 3DKWA 3RRGA 4FK4A 1XC5A 3I5UA 4B43A 1VQLI 2M7BA 5AFUH 1HJRA 4KUMA 3S32A 1D5VA 2HKXA 4IKFA 4L5EA 2IA1A 3P39A 3CFRA 3E1SA 1YRNB 5CZ2A 2LBFA 4HDVA 2LDUA 1W9HA 4JNEA 2M0MA 2ELJA 3C95A 2BHZA 1AHDP 4OGEA 2HR3A 3KVGA 5JR3A 4CJ7A 3QBWA 4NB5A 3E7LA 4KICA 1IBLK 3IHUA 1B4AA 1PJRA 2PBIA 2HQ5A 4FM1A 4RLQA 3LWMA 1B6AA 2DDAA 4KHUA 2E2QA 4ESFA 5B1AH 3LQQA 1N5YA 1BI3A 1D9FA 2OPQA 4RAGA 2XAUA 1VQNN 2EV6A 3S2DJ 4BQAA 4BC3A 3MZHA 4DR4K 1OYIA 4CD3A 1FZPB 4ZTJA 3RMCA 2DODA 3AVIA 3F9MA 3CC2N 1E4GT 3SPZA 1DP3A 1U0JA 2G9WA 1V5GA 3OA9A 4I98B 3DV8A 4A3EJ 3OYJA 2X6YA 1GLCG 3RSEB 3DLKA 5IYCJ 1TKTA 4I76A 2B0LA 3MXIA 5BR8K 2CH6A 3CMMA 3B73A 1H1VA 4B3RK 4E19A 1ESVA 5KPZA 1O3QA 4I2PA 4A5AA 1HKTA 4MO4A 4KTWA 3KLFA 3HSEA 1X1CA 3VGKA 3RWUA 1E3HA 4XLHA 1FOYA 4PUSA 2XAJA 4IOXA 2YV0X 4IWVA 2ZXHA 3KYCB 4M9XA 5BRFA 4YG2F 1JCFA 3NARA 4D1QA 3ID8A 1ZGAA 3LSRA 2FBIA 1MZBA 1C0WA 3G1MA 2JT1A 3JTGA 1REVA 4EP4A 1VQ8N 2GWJA 4G6DA 1VRTA 3SBTA 4PJJA 3THWA 1CZAN 2D0AA 3CFOA 4BR9A 2RNGA 4AU7A 4BWMA 2E2HJ 3H3UA 1OCTC 5EVZA 1I6XA 3S2HJ 3L3UA 1O3TA 5JICA 3KZZA 4M9SA 4HF0A 3T1YK 2W6KA 3HRMA 4F93B 3DLEA 4UV9A 3RMBA 4FWLA 4OAZA 3L8BA 1NK5A 4JKFA 3KP5A 3OYMA 4IRHA 4JHDB 3U9ZA 2OAZA 4FW2A 3JCUC 3DEEA 1S5JA 3TO6A 5BNGA 4YOVA 3IRRA 1WSJA 3CHWA 1LEBA 4A3BJ 4LF8K 3RRHA 2DT6A 4NYFA 4DQPA 3D0SA 2PJPA 5KK1A 1HCRA 2OZ6A 4GRIA 1VQPN 5H6QA 4BJ5C 1GLLO 4BRQA 4B9QA 1O13A 3VESA 3ZEUB 2KFDA 2Z33A 2VBZA 5AQLA 3M8RA 2A05A 2CGLA 2R7OA 4WWCA 1K78B 1B1BA 3SK3A 4JKGB 1KQ8A 2BANA 1DGWY 4UY8I 4BRAA 2CV0A 1ZREA 4M3RA 2P7VB 3EQLF 1T0FA 1K8KB 4A3IJ 3HTSB 4ZHRA 3CD6I 2ZMEC 1E3OC 1L3VA 1YOVB 5TGTA 3DM2A 4BGBA 3DTEA 3NAUA 1TC3C 3OS2A 3G4SN 1BI4B 3D2FB 2XRLA 1OMIA 3ZT4A 2KW4A 2WADA 5D5WB 1GT0C 3LA3A 2VKVA 4B9LA 1S72I 3QYFA 5IT9Z 3K1PA 4CIEA 2K9LA 3MZYA 1XCVA 3ZQCA 2MA3A 5J8CA 4CFBA 1XSDA 2BVMA 5EEAA 2D0CA 3F72A 3VQPA 4IFVA 1HW1A 2CSOA 2O61A 1GOCA 3LSMA 3LL3A 1OH8A 4DUYK 3NE6A 1FP2A 1K61A 3RIRA 2M4KA 2L2OA 2QM1A 3C7NA 5ADXH 1SL0A 1GLFO 3TAFA 4BDZA 2X6WA 1R5GA 4A3KJ 3CUQB 5E3OA 3WU1B 3CP2A 4KHQA 1GXQA 3A4CA 2H6CA 2MLGA 2JRMA 1RBSA 5HLHA 2E60A 3HGYA 3M8EA 3K2AA 5J40A 4K8ZA 3WTVC 1P4AA 3O4WA 2W40A 3KZBA 4CFAA 3G6EI 4C3JJ 4DR1K 4LIVA 5CR4A 1IGNA 3MECA 4DSJA 2HTJA 1YX3A 1JHHA 1XMOK 1FP1D 4G6TB 1T6DA 4WE1A 1OPCA 4JKBA 3J80O 5D5UB 2NS8A 4EV0A 1HNWK 5EXWA 2V1DA 2VB6A 4JI4K 1E4FT 3EE9A 4K0KK 3PSFA 1T39A 3THXA 4B09A 2G8WA 1RUOA 2FC0A 4E7SA 2VC1A 4M3DA 3WXKA 4DQIA 1WH5A 3SZPA 1Z21A 1VQON 3HB9A 3SQNA 4M6YA 4BRDA 1XGMA 3PNTA 3UR3C 4H0PA 2KHOA 3NEUA 4B3OA 2B7EA 4LB5A 1IUYA 2FA5A 1TW3A 5FPDA 2EV0A 3KE2A 1UOCA 2DFFA 3PLAA 4U0VA 2HQRA 3DPUA 1IN4A 1NKCA 2QLZA 4PJMA 1FIAA 2OYQA 4LK0F 2Y1JA 4XRSG 4AUXA 2P9PA 2CUJA 4JI0K 1NJXA 2IT0A 3NVKA 2E1CA 5LBQA 3M07A 1KU7A 3K5OA 4UVCA 2E7XA 3CPWM 4MEYF 1TGOA 4DV0K 4FQGA 3H1VX 1QNTA 5GAHP 3VQ4A 2FSWA 4FSVA 3K5MA 4G7OF 4FK2A 3O9RA 4J01A 2QK9A 3VWBA 4DV4K 1LQ1A 3BY5A 1IC8A 2CUFA 3PO4A 5TJJA 2ZGZA 3HGGA 1P4WA 2EV5A 3L9FA 3DLGA 2V79A 4LH4A 4DV2K 2EFNA 2VIXA 5EU7A 1RIOH 2HYJA 3CP8A 2HBLA 3T19A 2CWEA 4BEHB 3VF6A 5I42A 3TBIA 1SS6A 1T8IA 2VWJA 3CJQB 5F27A 4CZEA 2F8SA 3VERA 1J6ZA 2ZC2A 4ZDLA 4N5SA 4U88A 4FOIA 3AGRA 4WYBA 1LE8A 2RC4A 1BA5A 2AXLA 4EZ9A 4P1WA 2WFBA 5IT9K 2R5ZA 2G7HA 2BGGA 2YJEA 2OQRA 1BR4A 3LAJA 1FK9A 3U3YA 5LRSA 1KQ9A 2H94A 3HVTA 3K7AJ 4EJOA 3TDZC 2IBDA 1R6RA 4Y15A 1YT3A 1W7PB 2AXTC 5AFUA 4CHUA 2L9SA 3W2VA 1XG1A 4KISA 3WGHA 1H0MA 2D0OA 2HDCA 3B6AA 3QEVA 3UKGA 3I4PA 4AHRA 5AQIA 3GMEA 2L7FP 2BUPA 3H3ZA 4IZZA 3GTLJ 6PAXA 2MH2A 5ERIA 5HRRA 1WSUA 3DLRA 3OBWA 1JXEA 4DR2K 2LMDA 2ZKZA 3SV3A 3MWPA 5E1ZB 4A61A 1OKRA 1AKHB 3EE8A 5BQTA 4FXDA 4EP5A 3SZ2A 4RB0A 3T1AA 1ORKA 1W97L 4E7KA 1X1AA 1RT6A 2DFHA 3QIPA 1ZAOA 3CCVN 4CJFA 1NK8A 2DA4A 4CIGA 2V7ZA 4W5RA 4DTRA 2EBIA 3JR9A 3JRGA 2NZTA 4CJLA 3K9TA 3NGZA 3E6DA 4H8KA 2CYYA 3E6MA 4CBXA 3DBHB 4LFCK 4CHQA 3E9LA 2RHKA 2FBYA 4BRFA 1DU0A 3HBLA 2OTJN 4BHCA 4F52A 4RM2A 4RGRA 4A3MJ 4DQSA 2QWLA 4KFBA 1HLUA 1IJJA 2ESNA 3ZX2A 3C2HA 1KONA 4A3FJ 1N77A 3VPZA 5I3UA 2X6OA 2HHHK 5JVGF 1BQMA 1GVJA 4CCHA 2GXGA 1LUJB 3NGYA 4K2EA 4YDUA 3ZLJA 2COMA 3CF5F 1JLQA 5HBMA 3ULEA 2VBWA 1X9JA 4S04A 1HQUA 3DKXA 4BS9A 4B9VA 3ECHA 2B63J 4YOYA 1KVAA 3GUDA 4IFYA 4XOTA 1BHLA 3V8KA 3FHZA 1K4TA 4NCBA 4KB0A 2Z1IA 4IL6C 2JSPA 5LMNK 3VN5A 2HHSA 5LRRA 1F9NA 4OO1J 2QA4I 2O8XA 1OVYA 3OS0A 4F2SA 4Z4HA 4YHHK 4N4OB 1QVUA 4KAZA 5BN9A 1R4MB 3RI4A 5AQOA 2ZJPF 4WXHA 4J19A 2FBKA 3BG6A 1QQOA 1VSDA 3ZRGA 1ETOA 5F1RA 4ON0A 2GOMA 1F5TA 1WBBA 4L0ZB 4LF7K 3VB2A 4A93J 5BPNA 4B44A 4A0YA 1RTIA 3QO9A 4CI6A 3MXMA 4KB1A 2Z16A 3U9DA 4S0HB 1RRJA 2OC6A 2KKZA 4C1NK 1L5UA 4DQ8A 2P4WA 4C9YA 3K70D 2E1MC 4CZHA 2UXDK 4DU4A 1VQ9N 1IRFA 3QU3A 3RQIA 3B6PA 4L5IA 2PMUA 3ZGKA 3LNQA 5CVJA 4ISEA 4C3HJ 2TRTA 4XKWA 2VCPA 2O7OA 3FM5A 3L09A 1VQ4N 1NGCA 1FYKA 1BR1A 1KYZA 3QNNA 1RDDA 5GAEP 3LA7A 4G9ZA 2E6MA 4DS4A 4GVMA 2L7KA 2O8KA 4X6AJ 3E3VA 2JVGA 2D1KA 3OW2M 1JLEA 3IKTA 4KIFA 2LY1A 2XB0X 3LFKA 5LFAA 1NOZA 3O4NA 1NK9A 1WGXA 4HUGA 1TUYA 3AVBA 3I8BA 5H1SQ 4WK8F 3QYBA 2CGPA 3CCRN 1HNXK 3C6TA 3GG4A 3CESA 4E70A 1IDZA 3QPTA 3SNNA 2OPTA 2X85A 4DYCA 4BY7J 2X6NA 2W57A 3V42A 4GFBA 1UA1A 1J54A 4FOEA 5DM7F 4CH7A 3BROA 1CLQA 5BOXA 5B66C 3LAPA 4BC5A 2FXAA 3REOA 2YHYA 2NVQJ 3DLBA 2BV6A 4L9TA 3THVA 5KRTA 1G59A 1OQYA 5JI6A 4ZYGA 1N25A 1DGKN 1P7JA 3LSPA 4CCMA 3ID6A 1D8KA 1WAFA 1BU6O 4ZYHA 3JYTA 4YIIA 2JLEA 1U5TC 3P9CA 3V9UA 2H8WA 1IN5A 2OPRA 1WSFA 3M5RA 4DZJA 5ADXA 1PUEE 2R7TA 3A5LC 2K40A 1VQNI 2VPLA 2M3AA 3IP4B 1YHQN 2HOAA 2PZSA 1ETVA 4JX6A 1RNLA 3FZHA 3TQNA 2LP0A 2IGKA 3CC2I 4ILJA 2G7UA 5AQWA 5HRSA 4BUPA 2OF7A 5AQMA 3R4KA 5DD4A 1UWBA 1OKJA 4Q5SF 2IP2A 1RBUA 2XY5A 3O4QA 1KFSA 1LW2A 4WQ5C 3QB0A 3F6VA 3OSFA 3CMAN 3CJRB 2Z99A 2QWNA 1P2FA 3PM1A 3AAFA 1BOTO 4ZYAA 2PFBA 4F7ZA 3FZKA 3E5UA 3KK2A 4DR6K 2FNAA 1RFQA 3CCQN 2TDXA 2MC4A 4JKHA 3THXB 3T8RA 2DW4A 2KPMA 3S1QJ 3I9V2 2WB1A 3NVMA 1G4DA 3F8NA 1TNSA 4CCKA 2F4MB 4YIFA 1R7JA 3KEQA 2HPMA 5K14A 1I94K 4CCJA 1KU9A 1JLCA 4F2RA 4CHOA 1RR8C 2MD5A 3M4OJ 2WC9A 2OJED 1VQ8I 5LL6Z 1YXQA 4FJ5A 4LLLA 1X9MA 5KAIC 3CJ9A 4FL9A 3J81Z 5F1JA 3C6UA 3L2WA 2KP6A 2BOLA 4N47A 1Z0XA 4G7HF 2Y0MA 4IRGA 4M71A 1S6PA 3HRGA 4LH5A 2QQ9A 3IUOA 2M8GX 2NLXA 4RB2C 1M1KO 1WKMA 2ESHA 4B1WB 3OYDA 3B6OA 2HVSA 4RW9A 1TQIA 3E97A 2XY7A 2XAGA 1P92A 2VOPA 3BDDA 3VQ5A 1Q1HA 2OTLN 3VQEA 3R61A 5LGTA 1Q8IA 2UUCK 4CJKA 1G3YA 4Z4CA 4DQ2A 1ODDA 5FDLA 3O8MA 3BJOA 1ZRFA 1S9EA 2F5DA 2BXZA 1HDDC 5AZIA 2ZMEA 3AVJA 3MN2A 1VQPI 3HOWJ 3ZETB 2MGQA 2GEMA 3EUHA 2WC2A 1Z77A 2K4JA 1W36D 1R23A 4H4MA 2ZGYA 5GTHC 1TP4A 4QLCU 2BE2A 2ZSIB 1JXSA 2E8AA 1BIBA 4QPQA 4OMYA 2FD5A 4RCHA 1HPZA 4LY7A 1TK8A 3V4GA 4DF8A 3WTUC 3QICA 3VPRA 4PKIA 5D4SA 1LE8B 2G8IA 5CVUA 2ETJA 4ZJZA 1RT3A 3G4SI 2QKBA 2XGCA 4FVMA 3R6SA 1P9QC 4C2UA 3QLHA 3A5OC 3ZSWA 2STWA 4M41A 2AJQA 2NVYJ 2HMPA 1JLFA 4I09A 2YKNA 5L3BA 3LSIA 1XSVA 5LMUK 2DA7A 3H08A 2KFZA 5B1BH 2A5XA 4YFKF 3FGUA 4BH9A 4B8AB 3PO5A 4PFPA 1NU0A 5DD8A 1QHHD 4DW6A 2R0QC 3AO4A 1NJYA 2EIJH 3N4PA 2QSGX 1TUUA 4BVOA 1TYQB 4CJRA 1U47A 4K43A 2GX9A 3KEOA 2Z5UA 3LDQA 1SVMA 1FJLA 3RJPA 3M8PA 4GGGA 1D1AA 3SQ0A 1B9MA 4J2EA 1A35A 1L3TA 1NK0A 4DTOA 2RF2A 1P4XA 3H35A 1BI0A 4CYCA 1A5VA 4HQMA 4CJUA 4P5OA 1HKGA 4HX8A 3EDPA 4H5WA 4XLCA 2NRWA 3UKUA 1BOBA 3TL4X 5DM7L 4N56A 5J1UA 3V9WA 4RW6A 4CZMA 3K4LA 4JBAA 3HT3A 3NH2A 2R7RA 1FC3A 1TLHB 4A2BA 4CF2A 1S9GA 3QPSA 3DCFA 3HUGB 3KP4A 4M6VA 2O8BB 4UV8A 3KP7A 2P9LB 1STZA 3AVMA 1ZLJA 5GINA 1AWCA 1I39A 3ZSXA 1SD4A 4HHTA 3HBTA 1KYWA 5ED4A 5CJ9A 4LOCA 1VFCA 2OUMA 4DLEA 3DEUA 2DMNA 1BIAA 1FTTA 1CF7A 3PIPF 1WB9A 1UHWA 4DTPA 3TAPA 2VKEA 1JJ8C 1J5YA 4GV3A 3EYIA 3ZX3A 2IAIA 2Q36A 1R5ID 1B72A 4IXAA 5C12A 4WX9A 3LP1A 2YX4A 2UXBK 2E6LA 4GYGA 4JI1K 2KIUA 3C2BA 1SFKA 1VQOI 1NJZA 3WTXC 1QQCA 1WFXA 3M8FA 3J81K 4NQWA 4WF2A 3DPLC 2LKXA 4NCGA 4B4CA 2KT0A 3I4MJ 5H20A 3MCAB 5LY3A 3K2ZA 1L0OC 2F7TA 2NVTJ 4MHGA 4E1MA 4WXDA 2OZSA 4GVEA 4UB8C 5M1PA 3H1QA 1PUFB 1QO0D 4B1UB 3CM5A 2DYRH 3UKRA 4LK1F 5D6FA 3CUQC 1DDNA 4JKDA 1ZRCA 2BW3B 3BJAA 1UJ8A 1ZBLA 4K25A 1WJDA 2GLOA 5AQJA 4FHTA 4DFMA 2HHTA 1Y97A 2CU7A 2VODA 5EGOB 3HPHA 4O4GA 2P9NB 4LF9K 1K4SA 2GELA 3SFZA 2GUPA 4LLNA 2P5KA 2RN2A 3WU0A 4JYAK 3OYNA 3V1RA 4CZFA 4I6ZA 4M74A 3N97A 1V5FA 2I7NA 1TL1A 5C10A 1LVAA 4H5TA 2DI3A 5CPRB 2ZXJA 4OIRF 3HM5A 4JI7K 2GIVA 2BVLA 5LEJA 4W5OA 1DPUA 1FW6A 1Z3YA 4HBLA 1T7PA 3MZ8A 3WT0A 1Z3XA 2JVHA 1VF9A 2IVNA 4EEFG 4CCLA 4FASD 4JN4A 1BCMA 3HOVJ 4PQUA 1TKXA 4QPOA 3ONQA 1KQ0A 4ILHA 1X3ZB 3IRQA 2JA5J 4A3DJ 3S1MJ 2K85A 5EYRA 3FBIB 4Y33A 3VGLA 1R1TA 2VQFK 1XUPO 3QDKA 4Y13A 3IUCA 2IJLA 4CW7B 4AHCA 4MDAA 4ISGA 3O9QA 2G8KA 1HYZA 3J7ZO 3J7AY 3I4NJ 3C18A 4IEEA 4AF1A 4DTJA 3TOBA 3EUKL 1WNSA 1IBKK 3BZ6A 3MWMA 2WAQN 2LSNA 4FWSA 1D4XA 1KQSM 4DV5K 4EHTA 4D5FA 4G1QA 3BQYA 4UQGA 2JJ7A 1FOKA 1R9TJ 5C4JJ 3G2BA 5EEHA 3L2QA 1WOQA 4JI5K 1RT5A 2P5GA 3LP0A 1MGTA 3O8GA 4HYEA 3VQCA 3BF3A 3PO3J 1KFDA 3H9QA 3TSUA 4IOCL 3CCVI 4H5VA 2IVPA 4EFHA 3HKZN 2BE5F 2BY2A 4RBOA 4Z4FA 2O9LA 4CGFA 3AV9A 2Q1ZB 4BACA 5FKKA 2L02A 1WN7A 4BXXJ 3H45C 3FBNB 3SAGA 3PV8A 3G1OA 3AL0B 3DU5A 1XGSA 2XB5A 2DK5A 4JK8A 1BC8C 3U1KA 4EQQA 4JD2B 2DOEA 3AO1A 1Q18A 1M1EB 1ASVA 1GVDA 2ICWG 4DLGA 1Y8RB 1LEAA 3E5QA 2OTJI 1OCRH 5K7FA 1LB2A 3QETA 3A0IX 3IG1A 2WY7Q 4CJSA 3I53A 1RGIA 4N9IA 4E3SA 3TPQA 2E2NA 5BR9A 4JKCA 1QVTA 2XGDA 4PWDA 3OYKA 5FD5A 1QTMA 1BIZA 1D8JA 1WJEA 3SHFA 4FWRA 5FLVA 5D8LB 1XMQK 1RDUA 5FKMA 3E0JB 4CSWA 3JSOA 4AHSA 2EQRA 4YY3K 2L4AA 3EEQA 5AQYA 2QKMB 1XD7A 3S3NA 1RILA 4XRSA 5AQGA 3AVLA 4JEPA 4BR2A 3M8QA 1Z05A 1C0MA 2D5VA 2VLAA 5CVVA 3VQDA 1IN7A 3PIPL 3T1HK 2P9SA 2VC0A 5T7BA 1SL1A 3MN5A 3D5SC 3PFIA 2NRZA 4I9QA 4IHXA 2IC3A 1ZBSA 3W3CA 4JK7A 2M4GA 1R59O 2VKDA 1EH8A 2KDOA 3NMUA 1VSKA 1RDWX 2H27A 1MA9B 4EZ6A 2CH5A 3IAM2 2R7YA 2JN6A 1QSSA 3AA3A 4KH4A 1NGJA 4JK1X 2O8CA 2ZFWA 1YIOA 2K02A 5HOOA 3PNVA 2VJIA 1TTYA 4F91B 1G2HA 4KKOA 3GTPJ 5FROA 1Y1VJ 3CCMN 3MKWB 1VQ9I 3SYTA 1USSA 5JLFA 2EHGA 2R7SA 3DI6A 3LFUA 1X3MA 4HZFA 4A5BA 1YJ9N 1JTYA 1GHCA 4RGSA 1IH7A 1QHTA 1VQ4I 1XB4A 2F2EA 1P6RA 3G1LA 4B3XA 1FEXA 3P9KA 1NGDA 2ZFUA 4LB6B 1IN6A 2HDDA 1VK0A 2VKHA 1J2XA 5DV5A 3DMJA 1SKWA 1ZRDA 2E4LA 4GMJB 4OVLA 1F4KA 3ZQ7A 4ZYDA 3SEZA 1KD1O 2XPVA 5JMVA 1TWAJ 3CCRI 2F6CA 1UCRA 2L4MA 3TEDA 4FJNA 1U5TA 1EX4A 3U9GA 1MMSA 4X1EA 2NRXA 5AZJB 3KWGA 5J1RA 2ZXIA 4FT8A 4O5BA 4GO1A 2K9QA 1JKOC 4UUTA 2Q8KA 1HOMA 2FSNA 3H36A 4BAYA 1V3FA 2O0YA 4B3SK 4H0TB 4CGDA 4W97A 1OYWA 1B9NA 3QMLA 3WQUA 3S16J 1SVOA 2LSOA 5K5QA 3F22A 4ID5A 1E3MA 4WQ5A 2WWYA 2FMLA 1XCBA 4CYCB 3AA5X 3H5AA 3L2VA 4MFBA 3AG3H 4IVNA 3C94A 1T38A 4LITA 2B6AA 5DM6F 2X78A 1YHQI 3JTHA 2XRIA 2LLKA 3C7JA 4CJEA 2JWKA 5HRPA 3FZLA 4DYRA 3JXUA 2XHBA 5TRDA 1T0FC 4RAFA 4CESA 3FXJA 3IV5A 4AYBN 4ICLA 4Y7NJ 2VG5A 3TO9A 3S8PA 3MEEA 1RTHA 2XVCA 3CMAI 3A0HC 4IQ4A 2LVSA 4U0YA 2DPUA 5EX5A 2DY4A 4B47A 4FJ8A 1KC8O 2FBHA 2VQGA 1GOAA 2ZM6K 4WCEL 3M8JA 5DUKA 1LDKB 4RW8A 3O3FA 3LP3A 3CCQI 1ILYA 3GFJA 1LCUA 3DWLA 2RV8A 1B72B 1B8IB 1VSLA 1HSTA 4KHNA 2M9HA 4GNIA 4QAGA 4FJ9A 3GTMJ 2K9NA 4ZC3A 1IW7F 5K5OA 3FMQA 4F55A 1PYVA 3CCUN 3GTGJ 3CZ6A 2V1UA 1WHUA 3F8FA 4AQYK 3QERA 2ELKA 4NQWB 3GW2A 4DSIA 4WFNL 2LRDA 2Z1DA 3HSFA 1FNNA 3ENOA 1S1VA 2LYCA 4H0OA 4BQZA 1NK2P 3CFPA 3H1CA 1FMWA 3OL3A 4CEAA 1NK4A 2WOMA 3HZ6A 4RTFD 4UNOA 3RSEA 5M1QA 3E6BA 1Q82O 4V19K 3J7YJ 3I59B 2FRHA 5L3CA 4JX4A 3QU6A 2XPWA 4RW4A 3RYRA 1YTAA 5AQQA 2JWTA 3H0GJ 2QSHX 4DQRA 5HLGA 3AGKA 3O9SA 4OKEA 3KIOA 2LREA 4UVAA 3A2KA 1EO1A 2MH9A 5CYQA 4N41A 2EJRA 2M34A 4E1JA 2DA2A 4FJGA 2MFZA 4A69C 4IHYA 4I02A 2OTLI 4O8KA 2HOTA 1IRGA 1VI0A 4CGIA 3LAKA 4Q4ZF 2IGNA 4EHUA