1Z6RA

Crystal structure of mlc from escherichia coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
395
structure length
382
Chain Sequence
b'QIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHEMLEAHLVQELGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDLPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mlc protein
publication title The crystal structure of Mlc, a global regulator of sugar metabolism in Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 106
structure length 382
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1z6rA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1z6rA03
4CDGA 1ZREA 1T98A 5IT3A 4HLYA 4K25A 5LJVA 4OIRF 1IN4A 3SZPA 2J5PA 3RPUA 3KVGA 2EK5A 4HBLA 1G6NA 1ZHFA 3J7AO 1GLAG 1TYQB 3A0IX 2BUPA 3ELKA 4KDPA 2CWEA 2F5CA 2V7YA 3SHFA 3CJAA 2OZUA 3F6VA 2LDUA 2BGCA 1TLHB 4BNCA 4H5WA 4BC5A 1H1VA 2E1YA 2DW4A 4AM6A 2M1BA 2BE5F 2DK5A 4BR5A 1J6ZA 4H0YB 2QUFA 1KA8A 2HR3A 4C23A 1RIOH 1XMKA 1YS6A 4HYEA 3LM2A 3QU6A 4EMSA 3UKUA 3AAPA 1ZGAA 2FE3A 5CE3A 1ATNA 1ZC6A 2A41A 2CQKA 5E1ZB 2YR2A 2IVOA 4BRHA 2PEXA 1HSJA 1BG3A 3U9DA 3GLXA 4HDUA 4PCQA 1NMDA 1QZ6A 5FD5A 3QPHA 2VONA 4UV9A 4OOIA 1P4AA 1R59O 2DAOA 4IHTA 1NM1A 3DKWA 3F8MA 4MEYF 2A69F 3KP6A 1UCRA 4BHCA 2P5LC 3U4LA 4NB4A 2D45A 2HF3A 1P4XA 1W7PD 3K1PA 5FD6A 1BUPA 2GUPA 3I58A 3DFGA 3DJCA 1TQMA 5LHHA 2QBYA 3CUOA 4KUMA 5AQKA 2ETHA 4XSZF 1I1GA 1HLUA 2ZGYA 2OA4A 4G94A 3ABUA 3DXJF 5BOXA 4JK1X 1G4DA 1G3YA 2RN7A 3ZETA 3VGMA 5D6EA 1ZGJA 1BI2A 4KIBA 5LHGA 3EZWA 1Z91A 1ON2A 3O80A 2W84A 2RC4A 2EFWA 2FXAA 1FX7A 4N9HA 4FOEA 3DPLC 4K43A 2PFBA 2G7UA 5TRDA 3WQTA 4CZJA 3W6KB 4BC4A 4A0XA 1Z6RA 3FXQA 3ERED 2VBWA 1FYMA 1Z1DA 4QLCU 1K8KA 1IN8A 4QWQA 4EHUA 5AQQA 1GLFO 4H5RA 2Q36A 1S6LA 1TQIA 2A6HF 4WWCA 4CI6A 3VEOA 4ENNA 1OPCA 2D0PA 1YS7A 2IVNA 2FF6A 3UKUB 3E5QA 3LA3A 4IJNA 4H0OA 3GFLA 4RTFD 1MDMA 2FEZA 2RVCA 4M9XA 2O3FA 1KYWA 4YG2F 3I5UA 4WYBA 4BXUA 5ADXH 1NGJA 1ZG5A 3WTYC 3ZMUA 3E3VA 4BRAA 3DP7A 2GQQA 4AM7A 1QBJA 4BR2A 1GXQA 2IJLA 5CYVA 3ATVA 3MN5A 2FNAA 2NZTA 2F9WA 1RNLA 1XN7A 1K7AA 3RKXA 4IRGA 4ZYEA 2RQPA 4XH4A 3ENHA 1GXPA 1XUPO 2YHXA 4RCHA 3P9CA 4YIFA 3FZMA 4LFUA 2EA2A 1HKSA 2YJEA 4DB3A 1MD0A 1IN6A 2OANA 3SLCA 4JD2A 3EYIA 2QBYB 2A5XA 1Q1HA 2DI3A 1MJ9A 3FXUA 3VF4A 2L3DA 4TV7A 1DKGD 4E1JA 4BRNA 4ON0A 4ETSA 4AIJA 5DD8A 5D5WB 4BRIA 2QQ9A 4FSVA 1XGNA 2XKPA 1TBXA 3KP7A 4KIFA 5D6FA 1O57A 2GXGA 4XH5A 2VODA 4B8XA 4EQQA 3ZETB 5ICCA 4EGZA 3HI0A 4EJOA 2ASMA 4FWOA 3HTSB 1BOTO 1GLLO 2QZ8A 2VBZA 3F8BA 4BYYA 5AQRA 3WTZA 2P9PA 4ISEA 3M1FA 1YIOA 1XQSC 3ISPA 4CZIA 4Q47A 3S2WA 3JAMK 1H9TA 1K8KB 4K42A 1XD7A 3TPQA 1WRJA 5IT9K 2H94A 3IKVA 3CJ7A 5AR0A 1EH8A 5H6RA 4FL9A 1ONVA 2DFIA 2QENA 2NLXA 5AQWA 4L0YB 4KYWA 3FXRA 4RAZA 5BN9A 1IXRC 4M6XA 1R5GA 3GX4X 2E7XA 3F8CA 1HX1A 4FHTA 4OIOF 3HYIA 3HTVA 3BOQA 3FLCO 1I27A 4AIKA 1MDMB 1IUYA 3E5XA 3KEOA 2CGLA 1PP7U 4U7DA 4Y0WA 3ID8A 4BQZA 3AAQA 1BM9A 5HDKA 2P9NA 1E4GT 3DF8A 2V52B 1BI3A 1BC8C 1EH6A 4DQ8A 4HX7A 3SFZA 2VC1A 3L6QA 1SMTA 1XSVA 1XDUA 3IL2A 3M3ZA 1ZRCA 1LDJA 2P5KA 3QFPA 4Y17A 1T6DA 2MC3A 1AWCA 2QWNA 1CZAN 4JD2B 2O0YA 2K86A 3ZP5A 3MFKA 3LDPA 3C7JA 3ZX2A 1P6RA 5AQZA 4L9VA 4RB1A 2O03A 3ZMSA 1QZZA 3QPTA 1U3EM 5DD4A 1HJOA 3CI5A 1B6AA 1K79A 3LM9A 3M8FA 3D2EA 4L0ZB 2P6TA 3D7EO 5HS9A 4NHJA 3FMQA 4MNUA 1RDWX 2IVMA 3QRFF 1DGKN 3DQVC 2AA4A 1FY7A 3FHZA 1NBWA 1IRFA 3O08A 1P92A 2IP2A 1XCVA 3JTGA 3UE5A 2DBBA 1BIAA 4O8KA 2P9PB 1XC3A 3J81K 1R58A 5F0XA 3FM3A 3QFUA 1MKMA 1LDKB 1SD7A 3V8LA 3RKWA 1JHHA 4U0VA 4CHUA 1GLEG 3LWFA 1J2XA 2QQBA 4LG0B 3HRUA 1T44A 2V1UA 3R61A 5K1YA 2PI0A 3HSFA 3IFRA 3LDLA 3G3ZA 1NGFA 4J8FA 5LJWA 3WG9A 4CZGA 3H45C 2JSCA 2V7ZA 4BRMA 4M9SA 3VESA 3MAJA 5ED4A 3J80Z 5JLFA 3GBTA 2ACJA 3FMRA 4PKIA 1ZRFA 1UFMA 4ASNA 1C0WA 1OMIA 3JW4A 4IWVA 2D2WA 5EOYA 5LHIA 3CDHA 1U5TB 3QBWA 3IWFA 4WXCA 4WXDA 5LGUA 4YIIA 3N97A 3HBTA 1D8JA 2KHOA 1T6CA 5LBQA 5ILVA 2NS0A 4MLHA 1ON1A 2H6BA 2H27A 3O2PE 3OHRA 5E20A 1U8RA 2NAZA 2QWRA 3RKYA 4B1XB 1ATRA 4FWSA 3JSPA 2DT5A 3L09A 1SFXA 3D2EB 4L3QA 5FB2A 2FA5A 2Q2RA 4LMYA 1BO5O 1FT9A 4HW0A 5DCMA 4MHGA 3M9AA 4CGZA 2VBYA 3IKTA 4KN7X 1XSXA 3VEPA 2X0LA 2COMA 1XGMA 4MLEA 2A5YB 4L5IA 4R1HA 5FO5A 4P55A 2HWVA 2PAVA 3ZX3A 3DV8A 1ODDA 3MZYA 3QU3A 2W24A 5DUKA 3HSCA 5LRRA 2DQRA 2K27A 5HLHA 1OKJA 4A0YA 2QXLA 1SFUA 3GFIA 4BRLA 4XRFA 1F5TA 3P9IA 2Z3YA 3LL3A 2ZXJA 2HGCA 4I01A 2EFQA 2H3GX 3FZKA 1ESVA 3F9MA 4ZYDA 3C1DA 3ENOA 3H3UA 2FSJA 1R22A 5AQJA 4A5MA 4YFXF 4G8XA 2W25A 1RI7A 2XAHA 4EM0B 4IRIA 1BA0A 3EETA 2BTFA 1T39A 3TOAA 1DDNA 3FWEA 4LD5A 1TNSA 4OU0A 4BR9A 2NYXA 4YFKF 1X3MA 2AP1A 2I7NA 3DPTA 1LOTB 2WWYA 5ICGA 5AQFA 5HS8A 5BPNA 1OR7A 5EEHA 4AIHA 4WX9A 4I6MA 4R8HA 1LNWA 2DPDA 3MCZA 3LDOA 2E88A 3VGLA 3QMLA 1MGTA 4OINF 5KPZA 1TTYA 3LQRA 3I33A 5BPLA 3ULEA 2L01A 3WEEB 1O7FA 2DK8A 5KQ8A 4HLXA 4D0PA 3WGHA 3PFIA 1HW5A 3LAPA 2PBIA 4FWNA 2FF4A 5JHUA 5DCMB 2Y75A 1U6GA 4ZH4F 4PDKA 4ISGA 1J5YA 2K7LA 1EH7A 2EB7A 4HDVA 3UKRA 3ECHA 2QQAA 5A2QZ 2P9IA 5K5RA 2MLKA 1UHMA 3MWMA 3SMSA 3WXIA 4AWXB 1LEBA 1FBQA 1BN5A 3R8EA 4RGSA 4CZEA 4FWRA 2ISYA 3I64A 1JCEA 4EAHD 2HMPA 3O1WA 4ENKA 3BWGA 4L9JA 3ZQ7A 5H20A 1WSUA 1NHAA 1KQ0A 1F4KA 4IJAA 4GO1A 3VF6A 2XAQA 4Y15A 3CJ9A 1GVJA 5D5XB 3ECOA 3CQYA 2D4WA 1DPUA 3I59A 1YLFA 3ZN1A 4AVPA 2GWRA 4ZZDA 1RUOA 2FSWA 1R23A 4GGGA 2HF4A 3EN9A 3O6WA 3I4PA 3G73A 2XAJA 2Q1NA 3HOSA 2ZO4A 5TKYA 3SQNA 4RGRA 2CGPA 1HUXA 1NWKA 5AQMA 5L3FA 3MZHA 2QYOA 2M87A 3AY9A 1V3FA 1STZA 3U1DA 1D5VA 5BREA 4ENMA 3R6SA 1ATSA 3ABTA 1BU6O 4CZFA 3E97A 1WWXA 2P6SA 1XDSA 4L9TA 4N9IA 4I6MB 4O3MA 4U0WA 1Q18A 5EEGA 3ZMDA 4ESJA 5AQSA 3ULEB 1LB2A 3KETA 1FP2A 4P96A 3R6MA 3IMXA 3KLOA 1G3TA 2Q0OA 1SD5A 1R00A 4EJWA 5B8HA 4OMZA 1HPMA 2XHKA 3K9TA 1U78A 1SAZA 2LSOA 3ZN0A 4B1ZA 4BH9A 3UKRB 1USSA 4AD9A 4RB3C 4G7OF 5AQXA 2VE9A 2P9IB 4MGRA 1IAWA 1DP7P 2P5VA 2G9WA 4H0PA 2QW9A 2ZF5O 4LB6B 2A68F 2HQRA 1IN5A 1R36A 2UWMA 3HOTA 4A6DA 3CQXA 3SJHA 4BG9A 2ADUA 2L02A 3EO3A 1ZARA 3R60A 2ASOA 4HZFA 3FF5A 3I59B 3GZ6A 5LLQA 3V4GA 2W40A 5AIQA 4HF1A 2KIUA 5E26A 4U88A 2GELA 2GTDA 3ZMTA 2QWOA 5EY4A 1Y64A 3NEUA 3A5NC 2K02A 3FZFA 4UHTA 3EQLF 3CIPA 1Z05A 2ESHA 2KJCA 3V7CA 3FGUA 1BWFO 2CSOA 3E6DA 2CH6A 3IHUA 4CZHA 3I0TA 3VERA 3BJ6A 3V7RA 4L18B 1IN7A 2XAFA 2IIRA 3L9FA 2L4MA 3JXUA 2MH9A 2E2QA 2FRHA 3K0LA 3WODF 1V4SA 5BPDA 1G3SA 4OMYA 4S04A 1SD4A 4FWPA 4U7BA 2KRFA 2V1DA 2FXUA 4A62A 3T5XA 2DLLA 5ICFA 3KZBA 4A2BA 3P9KA 5E8GA 3BF1A 5JR3A 4BRPA 2P7CB 1B59A 3GG4A 3BEXA 4M72A 5LEKA 3FZLA 1KAYA 3VENA 1FP1D 5JLHA 3ZMZA 1WUAA 3GFJA 2IW5A 2HKOA 2MLGA 3IDHA 3TO7A 2P9LA 2P8TA 3CLOA 1YTYA 2IRFG 3GFMA 4FOIA 4KNYA 3VEWA 1S3JA 2FQ3A 1TUYA 3ZEUA 3CJCA 2ELHA 1XGSA 2XKOA 2XASA 1IG8A 3J8AA 4KBOA 4L5JA 4B1WB 1SZ2A 1QGPA 4U0YA 3IRRA 1SAXA 1ZAOA 4O5VA 5EVZA 3A5MC 4HOBA 5E8IA 4WF2A 4GYIA 3G25A 2E2NA 1QQOA 5HDNA 2YX4A 2GWKA 1E2XA 2NNNA 1AOYA 3SZTA 3HRMA 3LSTA 3RDIA 4DCHA 4MQVA 5AQGA 4HAMA 4E70A 1JCFA 3F8FA 1MWMA 5HOOA 2MA3A 4ENJA 3WTUC 1KYZA 2QM1A 2JT1A 4WQ5A 5D8KB 2M30A 3VODA 2O8XA 3VEXA 4EVIA 3KP3A 3O8MA 3EL2A 4JNEA 4LG0A 5CLSA 3WXKA 2NNYA 2P9KA 4PGGA 2F5DA 2XGXA 1CF7B 3RIRA 2EV6A 3R4KA 2A3ZA 1FBUA 2OQRA 3UB5A 5D4RA 1NGGA 2DTRA 1IXSB 4IF4A 2YX7A 2L54A 3T0YA 4BVPA 3BZ6A 3PQJA 4P9UA 5D4SA 4PL7A 3HM8A 3GZ5A 4YFNF 2A61A 1WQ2A 5FGMA 4G7ZF 2VT3A 1MDUB 1U5TA 1KGSA 3EYYA 2P9LB 3EKSA 1JHFA 5LEJA 2R7DA 2VCPA 2W57A 4G6DA 3ZEUB 5F2RA 5ADXA 4HV5A 4GXOA 1LJ9A 4QS9A 3BP8A 3IRQA 5FFZA 1TUUA 2Z5UA 3HHGA 4FWKA 4BRKA 2Z99A 4I09A 3CERA 2V79A 1DPRA 3KP4A 1KAZA 3W0LA 1MJBA 4H5TA 5H6QA 3RYRA 2CYYA 2ZWHA 1ZG1A 1FPQA 3I53A 4DQ2A 5BN8A 1YQAA 5J8CA 5I9EB 2PBDA 1H0MA 1B9NA 5L3DA 3P4IA 1IRGA 2VN2A 3LFKA 3QDKA 2VOOA 1KAXA 4IRHA 4F7ZA 4RS8A 3AAFA 3GXOA 3O5BA 3CJ1A 2WV0A 3ULQB 3JAMZ 3LAJA 2V9VA 4QS7A 2H09A 4CZKA 5IT9Z 2Q97A 2FMLA 4JHDB 2MD5A 4CXFA 4XLNF 1IZ1A 3DAWA 5CVJA 4CBXA 3F22A 3MN9A 4BR4A 1Y0UA 3FE1A 4ZZLA 4LK0F 3R0AA 1OKRA 5F1XA 5JFRA 4HQMA 1KU9A 2OAZA 2P9KB 4XBFA 3F21A 2YCHA 3W3DA 2DQLA 2O6GE 3C3WA 2Q0RA 5LRSA 5DV5A 4BROA 1CGPA 1FZPB 1HW1A 1IW7F 2QWWA 3TO6A 3BY6A 1QZ5A 2YI1A 2EWNA 1ULYA 4O5FA 1UB9A 1IJJA 4HWIA 4HQEA 1YG2A 3CTAA 2UZKA 4WQ5C 3TGNA 2HTSA 3M1EA 1S7AA 1KU3A 3V8KA 1LCUA 1YW7A 2RDPA 3WTWC 4RB2C 1XCBA 1SQKA 2QLZA 4MTEA 1YAGA 3M7GA 5ILSA 1BJAA 4H03B 1G3WA 2W41A 3O3KA 1NGHA 2NRHA 1TNTA 4L9NA 4FO0A 5FFXA 1NGDA 3E6MA 4MO5A 1USTA 4A5NA 1KU7A 2TDXA 4B1VA 4LC9B 3MDQA 4BQAA 3C18A 3A5LC 4ISFA 2B0LA 1TQPA 3U9ZA 2FSNA 2DPNA 2XUBA 3WEEA 1RGIA 5L3BA 1W7PB 4BVOA 1L0OC 2VC0A 4WK8F 4A0ZA 1C0FA 4CO8A 2Q8KA 1RFQA 1PP8F 4G9YA 1J9IA 2JRTA 3HRSA 3KHYA 2IT0A 1MZBA 1UHWA 1PUEE 3MN7A 1U5TC 4M7XA 2CW0F 4CJ7A 2Z9OA 3J81Z 5HLGA 2P9SA 3GUDA 4FWLA 2ZCWA 1KXPA 4UV8A 1BC7C 2PN6A 1C0GA 3WUHA 3EDPA 2FBHA 4MQ9F 2VWBA 3DXMA 5CVIA 1D8KA 1FYKA 4IVNA 4EIAA 4LLLA 4Z94A 5TJJA 3I54A 5J8FA 5AONA 3K1NA 3WU1B 2JPBA 4BC3A 5BRHA 2EFOA 1F1ZA 1F9NA 4BGBA 4H0TB 4GNIA 3VEYA 3WT0A 5E18F 2CGJA 4EHTA 1HQCA 5FPNA 2LNBA 2YU3A 3VFZA 5LGNA 1FNNA 3QICA 4RAYA 3MN6A 4LJZF 4Q4ZF 5L3GA 3EUHA 3SK3A 4K2EA 2YPRA 5EXWA 2ESNA 1A04A 3JTHA 3O6BB 4KT5C 5BPIA 1K78A 1B9MA 3KCCA 4JAXA 2VBXA 2J5OA 3CUQA 1FC3A 4ZYGA 5BRFA 2QM3A 1ZH5A 1HKCA 4B09A 4EGYA 4CYDA 2ZGZA 4EJTA 3LA2A 4NQWA 4BR7A 3CHWA 1TW3A 1W5TA 1DUXC 4BREA 4I98B 1G99A 3QB0A 3Q9SA 1P4WA 4A2AA 2YHYA 5EX5A 2E2PA 4I2OA 4PGHA 3C7NA 5DDGA 4N0BA 1OYIA 4UUVA 2RV8A 5JICA 4NB5A 1FSHA 3U2RA 3CJNA 4ZYHA 3A8YA 1R1TA 1MJAA 5FPMA 3VF2A 2BV6A 4A2UA 2ZMEA 4P5OA 2BBYA 5AQVA 2P9SB 1QPMA 3D5LA 1GLJO 3TKYA 4FX4A 1REPC 1Z7UA 5CJ9A 3KE2A 2P9UA 5ICEA 2HS5A 3DXMB 5J6XA 2EV0A 4FPAA 1LDDA 2W85A 3WTXC 1X9JA 3TOBA 1S22A 1R1VA 5AIPA 3VOVA 5F64A 1Z9CA 4G6QA 1YYVA 3RTRA 3CETA 3FR0A 4K41A 3U8XA 5KPTA 2Z33A 1VTNC 3A5OC 5F6FA 3WTSC 5BR9A 1U2WA 1ZYRF 3PQKA 4XEIA 1ZBSA 1Z6TA 3JSOA 3ZMVA 4R79A 1K78B 3BJAA 4B1UB 2XRNA 4M7YA 3CUQB 2KJBA 2BEOA 1XGOA 2CG4A 1D3YA 3VPZA 5E1XA 2FOKA 4GY2B 3GDQA 2OU2A 2A42A 2VE8A 1LEAA 2KIFA 3ATUA 2K4BA 2P7VB 5HLIA 1X3NA 1OYWA 4YDUA 2STTA 1JGSA 4M71A 4IO8A 3HUGA 1FOKA 1W5SA 2GWJA 2G7HA 1BA1A 2UXXA 3QP5A 3VEVA 2UYTA 1T38A 4A6EA 3BDDA 3IWZA 2BYVE 3QBXA 1FBSA 5ILUA 1U2VA 2MH2A 3RPQA 3WTVC 3C7NB 3VETA 3HIFA 4LGWA 1E17A 2DU9A 5HS7A 4RWTA 3H1VX 2FMYA 1I6XA 4Q48A 2PQ8A 1KU2A 1DEJA 3CUQC 1XB4A 1BIBA 3AARA 2OZ6A 4I0AA 2ZMEB 4BHPA 3H3OB 4OIQF 3GYHX 4I02A 3HRTA 3VB2A 2X4HA 3WE2A 3REOA 1J7KA 2EA4A 1RUNA 4BRQA 5E17F 2A07F 3QP6A 2E7WA 2KIMA 3W6JB 1S3XA 3HTUA 3BF3A 2ITMA 2XROA 4WCGA 4EJVA 4IHSA 3E5UA 2P9UB 5ERIA 4FWMA 1GLBG 2M8EA 5AZIA 3K69A 1K6OA 4CZMA 3MCPA 1QQNA 1T6SA 4ESFA 4OIPF 2XV4S 4HF0A 5K5QA 2OD5A 2FBIA 3CO7C 4NO7A 4EFHA 4A61A 2GIVA 4BGAA 3KZZA 3K2ZA 4Z2YA 2EFPA 2VOPA 3VGKA 5KQDA 3GW2A 1NGEA 4BG8A 1H9GA 2VT2A 1WKMA 2GA2A 3KEQA 1CF7A 4CZLA 2LF8A 2FU4A 4XH1A 5DYMA 1L3LA 4B9QA 5D5VB 1ZLJA 1O3QA 3ZPLA 1T0FA 2E2OA 2PMHA 1MWKA 5DEQA 3VEZA 1P2FA 3LA7A 3L2CA 4BAYA 2A40A 1U2VB 1SD6A 2PMUA 2HOEA 3IUCA 3RYPA 2Q31A 4BQLA 1BOAA 1ZXOA 2PLYA 4H5NA 4BRDA 3DWLA 2ZNYA 1ZN2A 3BPXA 1IXCA 1HSTA 2ZKZA 2ZNZA 4EJUA 3E6BA 4MO4A 4CD1A 1SFEA 1YW8A 1YXQA 3HZ6A 2E1CA 5AQOA 3BJOA 4YDUC 2JPCA 4UVBA 1NLVA 4HX4A 3S41A 5AQLA 1P8ZA 2RNJA 4HF2A 3OOPA 2A6EF 1ZG3A 3TU5A 1J59A 3IC7A 4IXAA 1O3RA 1T2KA 1RZ4A 1IF1A 1TW2A 3MMVA 1KQ9A 5L3CA 5E84A 3WU0A 3COAC 3D2FA 2YSRA 2XVCA 2H6CA 1GLCG 5AZIB 2QWPA 1I1SA 5D5UB 4JN4A 3K1MA 2HFHA 1FSEA 4JHDA 2HYGD 1BDGA 4I7HA 4KFCA 4S05A 4M9ZA 1X3UA 1HKGA 2D1HA 5BRDA 2QVOA 3T8RA 3FX3A 4WQ4A 1O7LA 5FLXK 3ZX0A 3P7NA 2FBKA 5AQHA 4KN4X 5JVTA 2HQNA 4BC2A 5E1WA 2D1VA 5KVRA 3Q5FA 3H3NO 4BRGA 3L00A 1ZLKA 4M63C 2F2EA 1QZYA 3MK6A 4BRFA 4Y13A 3H92A 1YW9A 2GA1A 4KIGA 1BI0A 1MA9B 3WE3A 3FZVA 4PKGA 3KZYA 4UVAA 5F1RA 1HXDA 3TDUC 3DEUA 4UNOA 3F72A 3H3ZA 3FM5A 3GEZA 1S8NA 2QWQA 3I8BA 3CJBA 3WTTC 1S29A 2CO5A 2OBPA 4IXCA 1V4TA 2Y48A 3QOPA 2EFNA 4KMFA 2ZJ2A 1XSDA 3LQQA 3T8TA 2KKOA 3GE1A 1NGBA 3KLNA 2AXLA 4QS8A 1NGIA 3GL1A 2WTEA 4JQFA 2F9TA 5K5OA 3J80K 5AQUA 3B02A 2GAUA 3VOEA 4FPBA 4RGUA 2STWA 3SXYA 5DUIA 2WUSA 5AQTA 4KMUX 4Q5SF 2RKHA 5AQYA 3QAHA 1LQ1A 3JS6A 2NRAC 5BPMA 2E1NA 4UXNA 1LVAA 1JE8A 4FWQA 3N4MA 2GEMA 1FWZA 1EV7A 2DPUA 2J4RA 1W7PA 3B73A 5CVRA 2FNPA 1YVNA 2A6AA 5DCFA 2PJPA 3MQ0A 3U9GA 3D2FB 2FF3B 3TO9A 3RI4A 3H6EA 1R1UA 4RB0A 5JI6A 3KP5A 3FMSA 2D1KA 5AFUH 1WI9A 3BROA 1U6ZA 3I71A 3F23A 4FT8A 3NQOA 4M74A 4H0VB 2YJFA 3L0QA 4MTDA 2IVPA 2HEOA 5FLXZ 4CD3A 3L7WA 4H5VA 5CVUA 1I5ZA 3LDNA 1ZRDA 2EWSA 4ESBA 3BUZB 3V7SA 2PG4A 2IA1A 2R3SA 2RGVA 2R7FA 4BRCA 5AQIA 1E4FT 2UXNA 4PZJA 4WXHA 2VYPA 2QWMA 2FSKA 2EV5A 4HTLA 1HW2A 1EQYA 4CZZA 5CVVA 5KPRA 4IPAA 1QHAA 2M5WA 2ISZA 5AQPA 3GWZA 5FPDA 3EKUA 1NGAA 2F5FA 5LY3A 4MEXF 4WQ4C 3RJPA 2XIGA 3R9PA 1NGCA 3GOIA 4FX0A 3F3XA 1O3SA 4F9OA 2Q2EA 3HSRA 2M45A 3MEXA 2YHWA 2P9NB 3FFKB 3WXLA 1HKQA 4M73A 3RSEA 2HTJA 2AS5F 2CGKA 5BMZA 4LB5A 3DXKA 3C0BA 3WXJA 2L4AA 2GXBA 4EM1A 3KFWX 1SMYF 1XMAA 2ZBKA 3M8EA 4XLPF 2JTVA 3H1QA 5BS6A 1HKTA 1D4XA 2D0OA 5AQNA 6PAXA 1QNTA 4HX8A 1GHCA 3HHHA 1GLDG 4IZ9A 1V4RA 4BR0A 2GZWA 4EM2A 1JXSA 2CH5A 2EJRA 3GO5A 1KQ8A 3GVAA 4G7HF 4UVCA 5JMVA 3TQNA 3F8NA 1WOQA 1OYYA 4GCVA 3HSEA 4PKHA 2MBFA 1O3TA 1QQIA 5AZJA 2WC2A 1YFHA 5HVQC 2I7PA 3H46O 3T1BA 1FYLA 5A2QK 1BI1A 1B4AA 4A12A 4EV0A 5AFUA 2Y0MA 3O4WA 4I0BA 4JBAA 3ML6A 2C6YA 4H0EA 2V51B 3LDQA 1QO0D 4KICA 4GYGA 2LF7A 1JCGA 2Q0UA 2V6CA 2HDCA 1YUWA 1FLIA 2E20A 2E8AA 3GF2A 2ASPA 1TYQA 4O6JA 3SMPA 4H0XB 1BBYA 4PL8A 5FPEA 2P4WA 3WGGA 1B1BA 3D0SA 5HDGA 4LK1F 5D8LB 2OQGA 2A3SA 4LLGF 1S7OA 2K4JA 3Q9VA 2XAGA 5LGTA 4XSXF 2ZFWA 3NRVA 5ELZA 4DHYA 1W4MA 5BQTA 1HKBA 2O61A 3L4IA 4DNCA 2HZTA 3RSEB 3DXKB 3FZHA 1PDNC 2E1ZA 3KP2A 3E6CC 5KK1A 1R7JA 2V1XA 2JZYA 3BPVA 3B8AX 1QQMA 4HV6A 2HKXA 1YO5C 4B1YB 2IPQX 3CO6C 4CBWA 2IA2A 3V8JA 5L3EA 3R0JA 2IA0A 3O1BA 3ROUA 3OV8A 2FLOA 4CICA 2CFXA 1R5HA 4M6YA 4RGXA 1J0RA 2QWLA 5AZJB 2HYFA 2VXZA 3WQUA 2LKPA 3M6GA 1HBXG 2DO7A 4P9FA 1J75A 4KA4A 3WGIA 2F5EA 4CBUA 3TDZC 4LLNA 4BHBA 4HA8A 3F6OA
chains in the Genus database with same CATH superfamily
5IT3A 3ZCOA 2QEXN 3LSRA 1IN4A 4JV5K 3SZPA 3FXJA 4CFDA 2EK5A 4HBLA 2CFOA 4A59A 2IOCA 1UJ8A 4W5NA 4B9VA 2CWEA 2F5CA 2V9KA 3CJAA 2JGUA 3F6VA 2BGCA 5JHFA 2E1YA 2BE5F 1VQ7I 4H0YB 1XMKA 3SAFA 4Q5VA 4BWMA 4KB1A 4HYEA 3LM2A 4EMSA 3AAPA 3OR2C 3VSLA 4GFBA 4TSXA 4DJAA 3OYJA 2CQKA 4JX4A 2YR2A 3AVMA 2CQNA 4HDUA 3AGKA 3THWB 1YHQI 5FD5A 3QPHA 2VONA 1ZTRA 3V9WA 3CMAI 4N4OB 5IOZA 2DAOA 4IHTA 3EUAA 2D45A 4M45A 5CHIA 3NMUA 1BUPA 5F04A 3DFGA 4KHUA 3LP2A 2QBYA 4KUMA 1MMSA 2BHZA 5J1RA 5J47A 3QESA 1LVKA 4DUYK 4NDLA 3SYTA 4G94A 4F8RA 2DA5A 3DXJF 1G3YA 3G10A 4KIBA 5LHGA 2RC4A 2EFWA 4H4OA 4QPQA 4C2MJ 3DPLC 3DLKA 1VQPN 4BU2A 3WQTA 3W6KB 4BC4A 2BOLA 3FXQA 2VBWA 1Z1DA 2OPRA 2P0WA 4H5RA 1TQIA 2A6HF 4HCBA 2D0PA 3HC7A 1EXQA 2FF6A 4CYCA 3TAGA 1NG9A 4G6TB 4RAFA 1WI3A 4H0OA 2EINH 3CC2N 3VA0A 4DTUA 3DP7A 2GQQA 1QBJA 1J09A 3Q0VA 1C0TA 5F0FA 4BY9C 4X65K 3IAS2 4IRGA 4DQRA 4LFAK 4XH4A 1XUPO 3A2KA 4YIFA 3FZMA 4LFUA 2EA2A 4DB3A 1IN6A 4JD2A 2QBYB 2A5XA 1Q1HA 2DT7B 5F27A 3HO1A 3FXUA 1FTZA 5HLTA 4ETSA 3K4BA 5DD8A 5D5WB 5GAGP 1H89C 2XSJC 5D6FA 1SEUA 4XH5A 2VODA 3RMCA 1ACIA 2PYJA 4EGZA 2X6XA 3HI0A 2LY2A 4EJOA 3WNFA 2ASMA 4FWOA 3I55I 1GLLO 2VBZA 4BYYA 3WTZA 2P9PA 3MKZA 3WG7H 3AV9A 1Q8IA 1NNEA 4CZIA 3JAMK 1BIZA 1XD7A 5IT9K 4DV4K 1O1WA 4YOTA 1EH8A 2NLXA 5AQWA 2DJIA 2OPTA 3FXRA 5BN9A 1IXRC 4M6XA 4CYCB 1Z77A 1QHHD 1JKPC 2O8CA 2DCEA 3F8CA 4FHTA 2W42A 2GUIA 1YX5A 1IUYA 4FE4A 3E5XA 3M4OJ 1PP7U 4JI5K 3ID8A 1BM9A 4IFYA 5GAHJ 5FRMA 1EH6A 3AA3A 1RT2A 3SEQA 4LFBK 2VC1A 1LFBA 4A3MJ 3L6QA 5M1OA 1S6QA 2R92J 1ENHA 3ZSXA 2QWNA 4JD2B 3DKYA 3MFKA 5AQZA 3C95A 4YEJA 3ZMSA 5TKWA 1G59A 2X1EA 1HJOA 3CI5A 4OAYA 4LOCA 3D7EO 1D5YA 1HNVA 3DU6A 1VRTA 4DU3A 2QCOA 2AA4A 4MIMA 3K5LA 3SQ4A 3FHZA 1IRFA 1XCVA 3AVLA 2P9PB 2LTPA 4NC6A 2HXOA 1MMDA 5GAEJ 3KZIC 1MKMA 1LDKB 3V8LA 1JKHA 2E2JJ 3I56I 4U0VA 2IS1A 3HRUA 2V1UA 5M5XJ 1LPQA 5K1YA 3PM1A 3IFRA 2O8CB 2UU9K 3G3ZA 2CW7A 3H45C 4E7LA 2V7ZA 5ED4A 1N32K 5JLFA 2M34A 4Z0UA 2Z1IA 1LFUP 1NOYA 1UFMA 2KDOA 4KHQA 2D2WA 3VYRB 5EOYA 1Z26A 3CFOA 1ETWA 2LKSA 2P5OA 1R9TJ 3WHBA 4O8UA 2QTDA 4MLHA 1ON1A 4M3BA 3O2PE 2R7UA 2QWRA 2NAZA 1HYZA 5D3GA 3S9HA 4FWSA 3L1PA 4L3QA 2FA5A 2Q2RA 1SV5A 2DMUA 4HW0A 5DCMA 4MHGA 4B08A 1OJLA 3P39A 1NK7A 2VBYA 3IKTA 4L5IA 3SBGA 2PAVA 1UA0A 2VUMJ 3SPZA 2YHBA 3QU3A 2I5UA 1R6RA 3F2KA 2QXLA 4NC7A 2BY3A 2VKEA 4BRLA 1RNHA 1F5TA 3P9IA 2HGCA 5C44J 3SV4A 4IQJA 4ZYDA 1TL8A 3C1DA 1RT3A 5AQJA 2F4MB 1XWLA 4A5MA 4OWRB 4EM0B 2BTFA 1BA0A 1T39A 3F0CA 2X6OA 3FWEA 4FE7A 4F93B 3NAUA 5KGWA 2NYXA 2YNFA 3OJUA 1RDUA 4L5EA 3IS9A 4BE0A 5AQFA 4IL6C 4OO1J 3QWLA 5EEHA 4WX9A 2DPDA 1BL0A 2E88A 3H3VK 4OINF 4OKEA 5FDLA 4NNJA 3I33A 1BISA 3HKZN 2K3FA 3JRHA 3RQIA 4M3XA 4D0PA 3LAPA 5DCMB 2Y75A 1JLFA 2VI6A 1VQ7N 5T7BA 2CJJA 2K7LA 1W97L 3UKRA 3ECHA 2QQAA 2P9IA 1HJRA 2FC0A 5K5RA 4BDZA 3C6AA 4K8ZA 1BN5A 4UY8I 2B63J 4CZEA 1KVBA 1YHQN 1LFPA 4LH5A 2K3PA 3CMAN 5D5XB 3CQYA 1YLFA 2GWRA 2NVYJ 3EN9A 4E7KA 4CFCA 3HOXJ 4BXFA 3ZT0A 5TKYA 3SQNA 4RGRA 3EE9A 3NAEA 3MZHA 5HRPA 2QYOA 4DYRA 2F96A 1XC9A 3S32A 1STZA 1RILA 3C6UA 2P1JA 5BREA 3OS2A 4UB6C 3R6SA 4EZ6A 1X2NA 1BU6O 3TTCA 4L9TA 2YUSA 4BQNA 4N41A 4N9IA 4X1EA 4RMNA 5EEGA 1KQSM 2E1MB 2Z1GA 4ZC3A 3AVJA 5AQSA 2HHQA 1XG1A 2YNHA 3BLYA 2K9NA 5K7FA 5FLVA 1ZQ3P 4FISA 4XIUA 2XHKA 3K9TA 2IS4A 2LSOA 4PQUA 3UKRB 3M8JA 4RB3C 4G7OF 2P9IB 4XK4A 1IAWA 4YOXA 4A6DA 1KLNA 3SJHA 4QSHA 4BG9A 3BG9A 4FZZA 5FKMA 4HSRA 4CK1A 1CXQA 3FF5A 2R7OA 4U88A 4PUOA 2QWOA 4NUBA 1Y64A 3MCAB 4DV6K 2DTZA 4H8KA 4C2TA 4OX9K 3CCSI 4L18B 1WVRA 2KL4A 2FRHA 3WODF 1V4SA 1OVQA 5C4JJ 4OMYA 4U7BA 2VLAA 1YTAA 2V1DA 2FXUA 3HYFA 2X1CA 1P90A 3I55N 5ICFA 1V55H 2KFDA 3DRSA 2WB1A 4D9JA 5JR3A 2P7CB 2P5GA 3GG4A 3BEXA 1OH7A 5LEKA 3FZLA 2R7SA 2K85A 4CJ4A 1WUAA 3IDHA 4A69C 2XB5A 2VGMA 3SQ0A 2P8TA 3CLOA 1YTYA 3GFMA 4KNYA 2IGOA 1TUYA 3BR2A 1N34K 2XASA 1IG8A 2DA2A 4CEZA 1QGPA 4U0YA 4CGHA 1I3QJ 4HOBA 4GYIA 1I6HJ 3IG1A 3G25A 4MFDA 1FIPA 2NNNA 1AOYA 3CCLI 3S2DJ 4PJLA 2JA5J 4ENJA 5EGOA 4C2UA 1HDPA 4LF9K 5MLCQ 3VODA 1N77A 2O8XA 2XF5A 1ETVA 4LG0A 2NNYA 4PGGA 1CF7B 3GTOJ 2M8GX 3KWGA 2WONA 2BANA 3MAQA 4IF4A 4LF7K 2L54A 2MABA 3NVKA 3G2BA 5D4SA 4KB0A 1EX4A 1NKBA 2KISA 3I56N 4GDFA 2R7DA 2PZSA 4JP0A 3RQ4A 2DOAA 1U48A 3NGZA 2HDWA 2K9SA 2Z5UA 2JWTA 3BR6A 4DV7K 5CQEA 1JJ2M 5H6QA 3RYRA 1SFOJ 2ICWG 5BN8A 1JUPA 5I9EB 2PBDA 3Q0WA 5L3DA 3L3UA 2X78A 2KDZA 4FLXA 5CZ1A 3CJ1A 4I2QA 3ULQB 3JAMZ 3ZSRA 4QS7A 4B3AA 3LPUA 4CZKA 5IT9Z 4Y1DA 2G8HA 4CXFA 3DAWA 5CVJA 1K8AO 3F22A 1Y0UA 4LD0A 3BCAA 3JSMA 4KI6A 3CLQA 3MZ8A 3TARA 3S1NJ 1OCRH 3HVTA 3IH4A 1EWQA 2O6GE 2Q0RA 5DM6L 5HL7L 3DLLF 1U47A 3H5NA 3I4MJ 2V26A 4ZJZA 2YI1A 3UIQA 1RETA 4LY7A 5F1JA 2HVIA 2UZKA 2RDPA 4MTEA 1NH3A 2VG5A 4M6VA 3CP8A 1G3WA 4M41A 4LITA 1NGDA 4MO5A 2R7VA 3OL3A 1USTA 4A5NA 4B1VA 1JLGA 1E3HA 3LSJA 4M42A 3MDQA 2ZXWH 4BQAA 2B0LA 4CIGA 3AA4A 3WEEA 1RGIA 3AL0C 1V5EA 1W7PB 2VC0A 4CF1A 4A0ZA 3S1RJ 2Q8KA 4FCYA 3HRSA 2HW3A 1MZBA 2NOGA 2CW0F 5J40A 2D0AA 5GIOA 2WOMA 2Z9OA 5HLGA 3JAMO 5IT9O 2RE2A 4UV8A 4JI7K 2PN6A 3A0BC 3PY8A 2YHAA 4FLVA 4MQ9F 1A5WA 3DXMA 3M5RA 1FYKA 2RNGA 4LLLA 4Z94A 5AONA 3K1NA 5DS9A 1MBJA 5E18F 1HQCA 3QICA 3JR9A 2R5YB 4LJZF 5L3GA 5EXWA 4EATA 4IDKA 3JTHA 4KT5C 3KCCA 4JAXA 2J5OA 4I9LA 4ZYGA 4K8XA 4RLQA 2QM3A 1RRJA 1HKCA 4B09A 5HLFA 4EGYA 3LA2A 4NQWA 3SDBA 3D6RA 4XLHA 3C2HA 1J53A 2UUZA 1TW3A 4BREA 1VSDA 4JX5A 3O4QA 2E2PA 4I2OA 4BJ6C 4CIEA 1VQ4I 4NB5A 1FSHA 3DYAA 1CLQA 2CUJA 2X6YA 1R1TA 4Y33A 4AHVA 3CM6A 2BV6A 2O8DA 2WC9A 4P5OA 3OWTA 4PK4A 1QPMA 5C2FA 5LFAA 4Z4GA 3SDGA 4WFNL 1ZBFA 4Y1CA 4DS5A 3K5MA 5ICEA 2CQQA 3DXMB 1A36A 4XIDA 3WTXC 3TOBA 3TANA 4F3TA 3KTQA 3ZQHA 3RTRA 2L9SA 4DMNA 4K41A 3OYGA 2IAJA 4O0IA 3A5OC 2DMTA 5F6FA 1MBKA 5BR9A 5CPRB 1ZYRF 1T03A 3KK7A 1CQTA 3ZMVA 4C8LA 4RM3A 3BJAA 2XRNA 2W00A 1D3YA 2MG4A 1VAZA 2OU2A 5JLWA 4DSKA 1OCPA 3S3OA 1LEAA 4FK4A 2STTA 4M71A 4E19A 4NQWB 3HUGA 1IG7A 1FOKA 2G7HA 2UXXA 1T38A 4JYKA 2YKNA 1RBRA 3NH2A 3EUHC 3VQ8A 3VETA 2F5VA 4LGWA 1E17A 4WFBL 1I6XA 5E79C 1KU2A 3W6VA 3U3YA 4JK8A 3V9UA 2O8DB 3CCSN 1S1UA 3PNVA 4I02A 4JS4A 1NK4A 3NF9A 1DT9A 3HRTA 3NGYA 1OVYA 2X4HA 3WE2A 3QNNA 3LMMA 4OPKA 2A07F 3QP6A 2KIMA 4CJUA 2XROA 4WCGA 1FKOA 5ERIA 5LMUK 1VQLI 3OYBA 4UY8O 1NK8A 3C6TA 4FJGA 3MCPA 1ETKA 3M8PA 1IV0A 2XV4S 5E3LA 4B47A 2EFPA 2L7ZA 2VOPA 3GW2A 1IJWC 3O3HA 2GA2A 3KEQA 1Q9YA 5H1SQ 2CW8A 3HJEA 5IPAA 3AG2H 1L3LA 4B9QA 3VMFB 3KLGA 3FXLA 4IX7A 3QQAA 3V9ZA 3CCLN 2UV1A 3L2CA 4U67L 3K6GA 2PMUA 3IUCA 1BOAA 3QIPA 2PLYA 2M4GA 4NXNK 4DQQA 4BRDA 1CZBA 4IFVA 3DWLA 2ZNYA 4I9QA 2MW8A 2ZKZA 2ZNZA 4CD1A 1YW8A 2ETJA 4RAGA 4C3JJ 2HHTA 4DV0K 1D9DA 1NLVA 3S41A 2RNJA 2JLEA 2A6EF 1ZG3A 2EZKA 3AVKA 4BGDA 1TW2A 2X1DA 1U04A 1RT1A 4B9UA 4Q0BA 3WNHA 3CD6I 4IOCL 4PSXA 1BR2A 1QVTA 2HYGD 1BDGA 4GKKK 1OCZH 1X3UA 2NRVA 5BRDA 4WQ4A 4CEOA 3OYCA 3P7NA 2FBKA 3CMMA 4KN4X 5GTIC 5JVTA 2D1VA 2R7TA 3H3NO 4M63C 1QZYA 2F4OB 4Y13A 3H92A 1TWGJ 4KIGA 3BR3A 4V2GA 2L9VA 1HXDA 3DEUA 3VDXA 1JLCA 3CJBA 3M07A 2BY0A 3IP4B 2OBPA 3QOPA 1XSDA 3RSNA 1NGBA 1NGIA 2QKKA 2F9TA 4W1UA 3J80K 4G9ZA 2GAUA 3VOEA 2H1LA 4Q5SF 4FWQA 1T0FC 3OJSA 1EV7A 4IHWA 5DCFA 1IRXA 3MQ0A 2AO9A 4OLBA 2HNHA 1YI2N 5JI6A 3DTKA 3KP5A 2HB5A 3BROA 3GTGJ 2VB6A 3KKSA 5EEAA 4FT8A 1R71A 2CV1A 3H0DA 3LZIA 1VQ6I 2IVPA 4XRSA 2HEOA 2DOEA 3LDNA 1ZRDA 2EWSA 3K59A 2N8GA 3GTPJ 4QCLA 3BUZB 3GBGA 3CCRI 2RGVA 2RF2A 4PZJA 3C2BA 4JKDA 2Z1JA 4QAGA 4ZDPA 2QWMA 4AC0A 3TW7A 3O9SA 1QHAA 5FPDA 3EKUA 1NGAA 2GM4A 5LY3A 4MEXF 4DGWB 2XIGA 3GOIA 3F3XA 3SYZA 2M45A 2P9NB 2V7FA 1VSJA 1FKPA 3WXLA 4HG2A 2FBTA 3RSEA 3WXJA 4LB5A 4EM1A 2E5ZA 1WJCA 3KFWX 1SMYF 3JRGA 1QTMA 3H1QA 4CHNA 3NH1A 6PAXA 3HHHA 1GLDG 4EM2A 2O7OA 1W36D 1T05A 3GO5A 2YNIA 1X1PA 3GVAA 3W3CA 4UVCA 5JMVA 2DN0A 1OCCH 3F8NA 3OL4A 4CGJA 4KI4A 4GCVA 3HSEA 4PKHA 2Y31A 1HCRA 3SI6A 5HVQC 3H46O 1BI1A 2EIMH 2Z16A 4EV0A 1VQ4N 1WBBA 3RRGA 3ML6A 5IWAK 5LMNK 4H0EA 2V6CA 2LBFA 1RBVA 2E20A 3ZT1A 2LLKA 2ASPA 1HNZK 4O6JA 3SMPA 4H0XB 3ZRGA 2V6EA 3HJFA 1Z7LA 1TT5B 4CHPA 3A01A 1DQUA 2XAGA 5LGTA 2CU7A 3B6AA 4XSXF 3DLGA 2DDBA 4X66K 3BDPA 3TTFA 3ISNC 3LP0A 2QSFX 3RSEB 1U45A 1PDNC 2BY2A 2E1ZA 3LANA 1HPZA 4DYQA 3E6CC 4PSWA 4MFBA 2JJ7A 3DWLE 5J4VA 3CDIA 2XDVA 3KYLA 2FX0A 3CO6C 4CBWA 4JKGB 3CESA 2ZXIA 4M6YA 4BACA 2HYFA 3HP9A 3WQUA 4P9FA 2HVQA 4LF8K 5EYRA 4FJMA 4HA8A 3ZQQA 1ZREA 4ELUA 5FKKA 1D0YA 3S14J 3VQCA 3BR1A 1K83J 2QXFA 2X74A 1ZHFA 4DSJA 5C15A 3V6DA 3TI0A 4FJ5A 2BUPA 2LDUA 1TLHB 4H5WA 4CHQA 4UUSA 4FETA 4CCJA 2O4IA 4AM6A 3A01B 2M1BA 1UG0A 4CJFA 4OPJA 1VQLN 3QEIA 1KA8A 1RBUA 1VQMI 1YS6A 4YOUA 3QU6A 1ZGAA 1MH4A 2W6LA 1ATNA 5E1ZB 4A3DJ 2PEXA 1HSJA 3GLXA 3CP2A 4YIRX 2CV0A 3MX2A 3AO5A 2OJED 3K9JA 3ZQIA 1G8XA 3DKWA 2A69F 1RR8C 2P5LC 3MWTA 4NB4A 1K4TA 2HF3A 1EO1A 5FD6A 2GUPA 4L8RB 1MBGA 2DFFA 3I58A 4GV9A 3DJCA 4IHXA 4N76A 3SEZA 5AQKA 2RAEA 2ETHA 4XSZF 1I1GA 1HLUA 2OA4A 2JMWA 1BI2A 1Z91A 3O80A 2FXAA 4N9HA 4FOEA 2PFBA 5CQGA 5TRDA 4CZJA 2IDOA 1Z6RA 4UUSB 3ERED 3NVMA 2M0CA 2JUGA 4QLCU 5AQQA 1ETOA 2Q36A 1S6LA 4WWCA 4CI6A 3VEOA 4ICLA 1IV8A 3CD6N 2P51A 3E5QA 4HPQA 2OCCH 4DU1A 2PMZA 2FEZA 1KYWA 2JWLA 4WYBA 2Y69H 4WF9L 4CERA 1ZG5A 4ZHRA 5DM7L 2XC7A 5CYVA 2NZTA 1XN7A 1IUFA 1K7AA 3HM9A 1NJWA 3G6EI 5HRRA 2Z2SB 4ZYEA 3VTIA 4F55A 3G4SI 4HUEA 1HKSA 3EYIA 4FJKA 2DI3A 4FJHA 2EQRA 4UQGA 1U8BA 3IH2A 5B1BH 1BJZA 4ON0A 2RQQA 1O4XA 4AIJA 2QQ9A 3AO1A 4CEBA 4KIFA 3ZT4A 4FJ7A 4IO9F 2HVSA 3Q7BA 4ZTJA 2QZ8A 3F8BA 4ISEA 4DF4A 1M90O 4CGIA 3QYEA 3ULDA 1WRJA 1YIJI 2H94A 5AR0A 2JN6A 5EDNA 4FL9A 5HNFA 3DM2A 4KYWA 4RAZA 2MFZA 4F2RA 1R5GA 2H1KA 4J2EA 2GBYA 3HYIA 3HTVA 3FLCO 1VQ6N 4BQQA 1N75A 2LC2A 3VQ6A 1Q9XA 4U7DA 3RZOJ 3DF8A 1R49A 2M4KA 3K4MA 1BI3A 3CCRN 3D5SC 3NWTA 1LDJA 3MD2A 4Y17A 1T6DA 2EIKH 4BQOA 4ZYAA 1P6RA 1J5OA 4RB1A 1OCOH 2O03A 1TWAJ 1OFCX 1K79A 1S1WA 3LM9A 3M8FA 4L0ZB 5HS9A 1B72A 3FMQA 4MNUA 2BXYA 3KLEA 3MECA 1B8IA 3KYCB 1SAUA 1RDWX 2IVMA 4YNQA 1FY7A 4GMJB 1NBWA 3O08A 1P92A 3DTIA 3K70D 3FKJA 1EWRA 3J81K 2JA8J 4XRSG 1R58A 1BQNA 2DTUA 4JI6K 3DLBA 2QGUA 1RT4A 4ILHA 4FK2A 2YKMA 4I2PA 3BG6A 2FQ4A 2JA2A 4CHUA 1GLEG 1T44A 5F0HA 2BY1A 1O13A 3KKRA 2PI0A 3HSFA 2Y30A 1TVRA 1XX5A 3Q7CA 1S5LC 4J8FA 3M8QA 3PUFA 2JSCA 3D0PA 3VESA 3J80Z 4KHWA 4B9LA 4JK9A 5E3MA 1MU2A 4ASNA 1C0WA 3CFRA 3JW4A 4IWVA 5LHIA 3CDHA 2RPIA 3IWFA 4WXDA 3N97A 1N25A 2KHOA 2XF7A 4I99C 5LBQA 4A3GJ 2NS0A 2H6BA 2H27A 2NVXJ 3NF8A 3RKYA 1SL1A 3L09A 1EA3A 5FB2A 4IG3A 2HNZA 4LMYA 1E3PA 1B8IB 3V81A 3CCUI 3M9AA 4CGZA 1B92A 4KN7X 3VEPA 3K58A 5J2MA 4FJNA 4P55A 2HWVA 3D5RC 5EZGA 1OKJA 1M1KO 1SVLA 4BY7J 3GFIA 1MMNA 2RKIA 2ZXJA 3K0SA 4I01A 2KW4A 4BJ5C 4FTHA 3LP1A 1R22A 1KD1O 2IS2A 4YFXF 3J80O 4R5PA 1C1AA 2FOWA 3OR1C 1DDNA 4B1RA 2HNYA 3H08A 4BR9A 1OH5A 2AP1A 4C1NK 4GRIA 1LOTB 5ICGA 5BPNA 4AIHA 1LNWA 2VQLA 3CQ8A 3QMLA 1MGTA 5KPZA 4D7NA 3ULEA 4I7FA 2L01A 2AQFA 1ZYQA 1O7FA 2AHQA 2E6LA 2PBIA 3CMEI 3K10A 1A5JA 3T7ZA 3DI6A 1J5YA 3PFYA 1VQMN 2MLKA 1UHMA 5IP6A 3PL8A 4RGSA 4FWRA 2ISYA 4EAHD 1VF9A 3L8BA 2WB1N 4ENKA 3ZSQA 4RM2A 1AKHB 2G8WA 3VF6A 2XAQA 2TCTA 5FROA 2D4WA 1DPUA 2DT6A 3ZN1A 2CQ7A 1RUOA 4GGGA 1R23A 2HF4A 3AGRA 3VQ4A 4C1NI 2IGIA 4BE1A 1I3AA 2XAJA 5FKOA 5M1PA 2KFZA 1D5AA 5L3FA 1LWFA 3KLFA 1RBSA 4Y3OA 2M87A 3A4CA 3IH3A 3SPYA 1ATSA 1IKYA 3ABTA 3AA2A 3I0SA 4A5BA 1WWXA 4NBQA 2IS3A 5HBMA 4U0WA 3ZMDA 3T69A 2DA1A 1Y97A 2VGNA 3CCVI 4DLEA 1GOCA 3ULEB 1XMOK 1LB2A 3KJVA 5JS2A 5EU7A 2LK2A 3R6MA 4Z6YA 3IMXA 4B3OA 1G3TA 1SD5A 2R93J 3AA5X 1R00A 1HPMA 2LRDA 1SAZA 1QS4A 3KK2A 3FFIA 4B1ZA 4S0HB 2R7WA 4BH9A 4AD9A 3NARA 1Q82O 2VE9A 3N4QA 4DTSA 1OR7C 2V9PA 2P5VA 2G9WA 4AILC 4DWIA 2ZF5O 2A68F 2ZC2A 1KC8O 2E19A 4CF9A 3FIWA 3LWMA 2G8IA 2ADUA 5KAIC 1ZARA 2ASOA 5C4XJ 2XRLA 4C30A 3G6EN 3QEXA 2DMQA 2GELA 2GTDA 3ZMTA 2UXBK 3G4SN 3FZFA 3EQLF 5C12A 1Z05A 2I8DA 3TAPA 4M3RA 4M3YA 3ASMA 3NE6A 4RW6A 1D8YA 4DR3K 3LOCA 1KVCA 4CZHA 3PV8A 3BJ6A 4M3ZA 1VFCA 2ZJRF 1N36K 1IN7A 2L4MA 3JRIA 5LL6Z 1DTQA 3SCXA 1R5ID 1SL0A 1N8RO 1G3SA 4H4KC 4ITVA 1KZHA 2FBVA 4KKOA 2KRFA 3DKXA 5KGXA 5H2FC 4C8MA 1X9MA 3S16J 3P9KA 5E8GA 1K61A 1B59A 4M72A 5JLHA 1W9HA 1Z67A 2MLGA 1FW6A 1YIJN 4M3TA 4FZYA 1ERDA 1RCHA 4JX6A 1YJWI 3ZEUA 3CJCA 4XLCA 2E1OA 3S8PA 4B1WB 3EEQA 4E7HA 1ZAOA 4O5VA 3A5MC 3VSKA 3NWSA 2XPWA 4F92B 1SL2A 2E4LA 3HRMA 1X2MA 3IUOA 2O5RA 1IGNA 3F8FA 1N78A 3WTUC 5C2DA 1Z3YA 3G1LA 2M30A 2ZXHA 3CDLA 4FM2A 2WY8Q 3EL2A 2BVLA 5CLSA 3WXKA 4D1QA 4Y7NJ 2PJRB 3R4KA 3K57A 2A3ZA 4CJSA 3NGIA 3UB5A 3LSGA 5HRNA 3ONQA 3U6FA 4WFAL 5GTHC 4XQFA 3K5OA 2QI2A 3T0YA 2WADA 1U9OA 4PL7A 3HM8A 4BXXJ 3GZ5A 3BZCA 4YFNF 2A61A 3BG5A 1U5TA 2DFEA 4DBRA 2XF6A 3TAMA 4B3MK 3BQYA 5JVGF 3ZEUB 2RN2A 1TUUA 4FLWA 4FWKA 4BRKA 2Z99A 3CERA 2V79A 1MJBA 4H5TA 3CCJI 1ZG1A 1FPQA 4DQ2A 5J8CA 3CC7I 4X62K 2W7NA 4LH4A 1IRGA 3HOYJ 2VN2A 2VOOA 1KAXA 3CCYA 4FM1A 3AVBA 4F7ZA 4RS8A 3THYA 1PVEA 1BIUA 1VSIA 2FJ1A 3OW2M 3WHCA 4BDPA 1LE8A 3DLLL 2MD5A 1HNXK 4XLNF 1WB9A 3OSGA 4KTWA 4BR4A 3FE1A 2KLOA 1OLTA 3R0AA 3SQ2A 1JJ6C 3DRRA 3CCMI 1FJGK 4CSWA 1KU9A 3TAQA 5C10A 1XNRK 2DQLA 3CCUN 4D7MA 3B6OA 3TO6A 1V54H 1E0EA 2QK9A 2EWNA 1UB9A 3RMDA 4WQ5C 3M1EA 1VQKI 3WTWC 2LH9A 1XCBA 3OYHA 3P83D 3O3KA 1W2BM 2XPUA 4FO0A 3HXMA 3VTHA 2TDXA 4LC9B 5I42A 4AF1A 3C18A 3U9ZA 1NKCA 2DPNA 4WE1A 2BW3A 5L3BA 4CJWA 3E9LA 4DLGA 4CO8A 2LYCA 1RFQA 2HQ5A 3NHGA 1J9IA 1PUEE 2OCEA 3VQ5A 5IYCJ 3J81Z 2P9SA 1U0JA 3GUDA 1LE8B 1ZKGA 1C0GA 2X48A 2FBHA 3EDPA 2H8RA 5CVIA 4IVNA 4EIAA 3CYMA 5TJJA 3AVFA 4BC3A 1F9NA 4H0TB 4GNIA 3VEYA 2VQHA 2A5WA 5FPNA 2ZB9A 2YU3A 5LGNA 4YOWA 1FNNA 1A6IA 3CMEN 3LP3A 4RAYA 3AFHA 2R0QC 3O6BB 1QPIA 2W1OA 3AG1H 2XRIA 1NJYA 2OPSA 1VQ8I 2OUMA 3KD5E 2RREA 2ZGZA 4EJTA 3DLRA 1YE9A 3DOKA 1UWBA 4BR7A 3CHWA 2O8BB 2O9LA 3QB0A 3Q9SA 1P4WA 4XLFA 4XR6A 4PGHA 3C7NA 2BW3B 1OYIA 3IAYA 4UUVA 2RV8A 1HOMA 3CJNA 1S72I 4RW7A 4ELVA 2L7FP 3A8YA 1AU7A 5FPMA 2ZMEA 1BQMA 3J81O 2HBMA 1Z0XA 2BBYA 1L3SA 2P9SB 1GLJO 2R5ZB 1REPC 5CJ9A 3U1KA 1T95A 3J7YP 2P9UA 5J6XA 2EV0A 3AVHA 1LDDA 4HRIA 3CCVN 1R1VA 2PFUA 4XKCA 5KAFC 4G6QA 1ZR2A 3FR0A 4M3DA 2CMPA 1WLJA 1R0AA 3HB9A 5KPTA 4BKXA 3WTSC 1GOAA 2B5JA 1U2WA 3PQKA 4C8OA 3JSOA 4XONA 1JJ8C 4B1UB 2HYJA 2CG4A 5KRTA 5E1XA 2VE8A 2KIFA 3G1MA 3ATUA 2K4BA 4CEDA 4YDUA 1TKZA 1JGSA 1W5SA 4CCLA 2LVSA 3QP5A 4U87A 2UYTA 3QBXA 3BDDA 1FBSA 2E6MA 3C7NB 3AO3A 1C0MA 4CGGA 1WJBA 5HS7A 4RWTA 4KHNA 4Q48A 3ZT3A 4HNTA 1DEJA 3KK1A 3CUQC 2TRTA 2ZMEB 4BY1J 3REOA 4BRQA 2E7WA 3W6JB 1NJIO 3V42A 2ITMA 3CC4I 4EJVA 4IHSA 2HMIA 3BTLA 2P9UB 3OIQA 1G15A 1JL2A 2I10A 2M8EA 3ZQFA 5AZIA 1RTHA 1QVUA 2VJ4A 1QQNA 5KCMA 4DG1A 1SUQA 1BOBA 5IYBJ 1IBMK 2OD5A 2FBIA 5CKTA 4EFHA 1YJWN 4XRMA 4IKFA 1F36A 2E34A 4CJTA 3VGKA 4BG8A 1H9GA 2VT2A 4MLOA 5GPCA 5KI6A 2EHGA 1NJXA 3BCBA 1UAXA 4CJ3A 3K7AJ 5D5VB 4XM3A 1O3QA 3UKGA 3ZPLA 2PMHA 3DEWA 3MKWB 3VEZA 3LA7A 4DS4A 1SD6A 4YHHK 3MMYB 1MNMC 3RYPA 4BQLA 4CJVA 3THXA 2HOSA 2G8KA 4OJRA 3U21A 3E6BA 2R7YA 4MO4A 4W5TA 1W0TA 4FJ8A 3BJOA 3I4NJ 1JUSA 5AQLA 1OH6A 4HF2A 3TU5A 1J59A 4IXAA 1O3RA 1T2KA 1RZ4A 5L3CA 3H35A 1WJEA 3COAC 5DM7F 4Z4HA 1WNSA 5AZIB 1L5UA 1JKQC 2K9LA 1X3WB 3QEPA 4ILJA 1FSEA 4JHDA 1EJ9A 4KFCA 4DSEA 2XGDA 1HKGA 2D1HA 1WBDA 4DV5K 1VSFA 3T8RA 5CYMA 5AQHA 3TBIA 2HQNA 4F4KA 3L00A 3ZSWA 2F2EA 3CCJN 2E2IJ 3GMEA 1RESA 3CC7N 4JEPA 1BI0A 3WE3A 3FZVA 4PKGA 4UVAA 2VKHA 1TKDA 3I8BA 1BI4A 1ZBLA 1D0XA 4IXCA 4DFKA 3JRFA 3RCOA 2ZJ2A 3LQQA 3T8TA 1KFSA 3KLNA 4QS8A 3BTIA 5K5OA 3CCMN 3MXJA 4FPBA 2STWA 5JLXA 1VSLA 5AQTA 1QVGM 3SJMA 3JS6A 3GTKJ 2Q1ZB 2GEMA 2FNPA 3ABMH 3V9SA 4NLBA 1SVMA 3P38A 4LG3A 3TO9A 3RI4A 3H6EA 1R1UA 2ZJPF 2D1KA 1VQKN 1IG9A 3I71A 3MN2A 1WSEA 4MTDA 3ALYA 5FLXZ 1X9WA 4CD3A 5B3SH 4JI4K 1MIJA 1BCMA 1EKEA 3V7SA 3X2QH 1ILYA 4HVJA 2UUCK 2LKXA 1BI4B 1HW2A 1EQYA 4IPAA 4GVEA 2ISZA 4E7ZA 3PNTA 2F5FA 2JWKA 3FKIJ 1TWCJ 3RJPA 3R9PA 3ZSVA 3LSHA 4C3HJ 3MEXA 2VG6A 1YTUA 4JI1K 2HTJA 2LMDA 2CGKA 3DXKA 2GXBA 3C6HA 1SVOA 1WSFA 2JQ7A 1VSKA 1XMAA 2Y1JA 4C8KA 3LNQA 5BS6A 1D4XA 2D0OA 4DV1K 2FD5A 3P1GA 2K40A 2D0BA 2HOTA 1QNTA 4DUZK 3CF5F 3K5NA 2VQFK 3FBNB 4RLFA 4B3TK 1VQ8N 3TQNA 2ZM6K 1XI1A 4CJ5A 5FLXO 4DR6K 2MBFA 1QQIA 5AZJA 1XTAA 2WC2A 4JI8K 2I7PA 1FYLA 4CUGA 3HT3A 1B4AA 5AFUA 1S72N 4JBAA 3LDQA 5EG0A 2V51B 2JRMA 1JCGA 2Y0SN 3OYNA 2E8AA 1VQ9I 3KIOA 3TSUA 1TYQA 2R7RA 1S1TA 2X6SA 4PL8A 2P4WA 3WGGA 3O9UA 1B1BA 3D0SA 4LK1F 2OQGA 4LLGF 3DU5A 2K4JA 1RC9A 2ZFWA 3NRVA 2W48A 3K4NA 3Q3SA 4DNCA 4BJTA 3DXKB 2KZZA 5KK1A 1HYSA 1HQEA 4XKVA 4CHOA 2V1XA 2KZGA 3BPVA 1ETXA 2X85A 2KPMA 1YO5C 2DOFA 2IA2A 2XY6A 4IDHA 4ABZA 3R0JA 2IA0A 3O1BA 3ROUA 4F52A 2VIXA 3ASOH 1J0RA 2IAIA 2KQRA 2QWLA 4HUFA 5AZJB 4JRQA 1UAAA 1BR1A 4KO0A 4BUPA 1Q1VA 1IV6A 1J75A 3J7YJ 1D9FA 4CBUA 4LLNA 3ZOBA 1SFKA 2ELJA 4K25A 5LJVA 3PIOL 4OIRF 3AO4A 4CW7B 2J5PA 1JLQA 3RPUA 3R1XA 1KCFA 3TEDA 1G6NA 3J7AO 4A3LJ 1TYQB 3OYKA 1VSHA 3SHFA 4AYBN 2G8VA 2KQ2A 4BC5A 3CC4N 1H1VA 3LWLA 2DW4A 3LALA 2DK5A 4BR5A 1J6ZA 2XB0X 2QUFA 4C23A 1RIOH 4NC8A 4CCKA 3HOUJ 3UKUA 4O5BA 5CE3A 2KP6A 1C6VA 2XO7A 2A41A 2IVOA 4BRHA 4PCQA 2F48A 1X1AA 4OOIA 1WN7A 4ILGB 3G71I 3SZ2A 3F8MA 4MEYF 4F91B 2R4GA 3ZCMA 3U4LA 1S5JA 1P4XA 2FBYA 4W5OA 3CG7A 1TWFJ 5IP9J 3L3VA 2VASA 4DTMA 1X4PA 2MGQA 5BOXA 4JK1X 1G4DA 1RT5A 2RN7A 3ZETA 5D6EA 1ZGJA 1LWEA 1ON2A 3SZGA 1VQ5I 2XSDC 4CH7A 4AHRA 1LV5A 1Y8RB 2G7UA 1D1CA 4A0XA 3ESWB 3TAEA 3TL4X 4OKKA 4QWQA 4EHUA 1GLFO 1JLBA 3FXMA 1YS7A 2IVNA 2OTLI 3UKUB 3IV5A 4FLZA 4IJNA 3T1HK 2O3FA 1Y8QB 4N56A 1QSYA 3I5UA 3HSTB 4BXUA 1C0UA 2FNAA 3QPLA 1RNLA 2RQPA 4KTQA 1GXPA 2YHXA 3P9CA 4IO9L 1MD0A 1MJ9A 2L3DA 4TV7A 4E1JA 4DTRA 4BRNA 3OOUA 4BRIA 1XGNA 2X6NA 3L2QA 1TBXA 3KP7A 3OY9A 2GXGA 3OTOK 3ZETB 2Y1IA 1TGOA 5CYQA 1Z21A 2KIQA 2DA7A 2VQGA 1BOTO 2BHYA 1ZGWA 5AQRA 2A05A 3M1FA 5M5YJ 3S2WA 1H9TA 2NUBA 4K42A 1DLOA 3IKVA 3NF6A 5GADP 3CJ7A 4BWJA 5H6RA 4OPHA 1ONVA 2DFIA 4PFOA 4DR5K 4AQYK 3M8RA 3GX4X 2E7XA 4OIOF 3BOQA 4V19S 1IBKK 1PJRA 2CGLA 4IOXA 2LY1A 5FKNA 4Y0WA 4BQZA 3AAQA 5HDKA 4DFMA 3QERA 2V52B 4V19K 1FTTA 1BC8C 3ABLH 3BQZA 3SFZA 2HHXA 2HHSA 4XKBA 1SMTA 2WBNA 1XSVA 3N05A 1IRZA 3M3ZA 3IL2A 2P5KA 3QFPA 4C9YA 1BW6A 4HNUA 4V2FA 1CZAN 5KRSA 2O0YA 2K86A 2NOJB 3HXLA 4P1WA 3BT9A 3C7JA 1QZZA 5DD4A 1B6AA 2Q3SA 5J4YA 4NHJA 4KTZA 1FMVA 4PJNA 4MDAA 3W2AA 1IDZA 3PO5A 3QYFA 2IP2A 3UE5A 2DBBA 3KLHA 4O8KA 1KLMA 2P81A 5EGOB 1WH5A 5F0XA 1SD7A 4WCEL 1B9FA 3RPUD 4LG0B 1W0HA 3LDLA 3V9XA 3L2RA 5IP7J 1R4NB 1NGFA 2E5LK 3WG9A 3S15J 2OPQA 3LFUA 4M9SA 3MAJA 3GBTA 2ACJA 2G0EA 1RDBA 4UUTA 4E7JA 4PKIA 3I3LA 1QVFM 1JTXA 1OMIA 3LPTA 3VQPA 2X6WA 3QBWA 3PX0A 5LGUA 3RVCA 4YIIA 3ZSZA 1D8JA 2WAQA 3UR3C 1T6CA 1VQ9N 3OHRA 4B1XB 3JSPA 2DT5A 3SAGA 4CJKA 1S1XA 1FT9A 2PX9A 2ZFUA 3KYDB 4A3EJ 1XSXA 4OPAA 3TP3A 2X0LA 2COMA 4MLEA 2A5YB 3MVPA 4R1HA 4PWDA 2Z1DA 4DQIA 2IS6A 3DV8A 1ODDA 3MZYA 4XMYA 3B6CA 5DUKA 3HSCA 5LRRA 2DQRA 4A0YA 1SFUA 3PX6A 1KVAA 1XMXA 4XRFA 2I5JA 2Z3YA 3B6PA 3LL3A 3PLAA 2H3GX 5IY5H 1FXXA 3F9MA 2FSJA 1ITYA 4G8XA 2W25A 1RI7A 2XAHA 3I8DA 2F4VK 1K9MO 2DJNA 1K4SA 1PUFA 1LWCA 1X3MA 1WJAA 5AJ3K 4M3UA 5GIPA 1UA1A 4DTJA 4JKAA 1GT0C 1J54A 2F4IA 4I6MA 3AVNA 3MCZA 3LDOA 4LF4K 3PNYA 1MSEC 4YELA 3O4NA 1HNWK 3WEEB 3O3GA 4IOAF 1T33A 3DOLA 1E3MA 4HLXA 1HYVA 3WGHA 3PFIA 4FWNA 3DBHB 2FF4A 5JHUA 1OQYA 1U6GA 1ZBUA 2XY8A 4OAZA 4AHTA 4CJLA 1QE1A 4HDVA 4DF8A 1RKWA 1XPXA 3SMSA 3WXIA 4IZZA 4XL9A 4KHSA 1QSSA 4D5CA 1V5FA 3BWGA 3W2VA 2UXCK 4L9JA 5H20A 1NHAA 1KQ0A 4GO1A 5DTDA 1GVJA 3G71N 4DR2K 4KITB 4ZZDA 2HPIA 3O6WA 3SAHA 3I4PA 3RR8A 2Q1NA 2ZO4A 2D5VA 1WSIA 1S7EA 4FVUA 1NWKA 1RDAA 3J7ZI 1BW5A 4CF8A 1I39A 2WBMA 3AY9A 4CEAA 4Z4FA 1V3FA 1VQNI 1PUFB 3WU2C 5HROA 4I76A 4ENMA 4MFEA 3E97A 1XDSA 1CXUA 4I6MB 1Q18A 1VQ5N 1T3VA 3KLOA 4FW1A 2Q0OA 1HR0K 3OIPA 4EJWA 1U49A 1TK5A 1LW0A 1U78A 2QSHX 4F2SA 3ZN0A 2EH3A 1USSA 1BL3A 4MGRA 1DP7P 2OTLN 2E1MC 3RMAA 1T8EA 1IN5A 4NLCA 1R36A 3WXMB 2X51A 2GXAA 2QSGX 4KT6A 2IBDA 3E1SA 4HZFA 2ZJRL 2W40A 5AIQA 5F0CA 4HTUA 3A1YA 5E26A 1YT3A 1RDCA 5EY4A 3A5NC 1WSGA 2K02A 4N4NB 4UHTA 3CIPA 3RZDJ 2CS3A 3V7CA 3FGUA 1BWFO 2CSOA 3E6DA 2CH6A 3M1CA 3I0TA 3VERA 1LW2A 3V7RA 4NXMK 2OTJI 2XAFA 1C1BA 1W5CC 2IIRA 3L9FA 2E2QA 3K0LA 4FWPA 4H4MA 2WY7Q 3HUGB 3E9OA 3VQAA 2W82A 4BRPA 3O3FA 4CHYA 1KAYA 1FP1D 3QPSA 1XHXA 2ECBA 3GFJA 2HKOA 3TO7A 2P9LA 3ZQLA 1UMQA 3GZNB 2BVMA 2IRFG 1MNDA 3VEWA 1S3JA 4B3SK 2FQ3A 1ASVA 2HBLA 1XGSA 1CZ9A 3LL7A 1T56A 1QRYA 3IRRA 3FK6A 2OV7A 5EVZA 4WF2A 2KT0A 3O8GA 2E2NA 1QQOA 2GWKA 1E2XA 3SZTA 4J19A 3LSTA 4DCHA 4MQVA 5AQGA 4HAMA 4E70A 1JCFA 1Y39A 5HOOA 2E36A 2MA3A 1M1EB 4RBOA 3GTLJ 1MMGA 2VKVA 1NG7A 5D8KB 1A6QA 3I0RA 3VEXA 4DIQA 2CUFA 1Q81O 3O8MA 4JNEA 5J2QA 3JRAA 3D45A 2P9KA 4B9NA 2EV6A 1FBUA 2OQRA 2VQCA 4Z4CA 5GADJ 5D4RA 4RA2A 1D0ZA 3V1RA 5JVGL 3RKQA 4AHSA 1DU0A 1FOYA 4CF0A 1NJZA 3BZ6A 4P9UA 5FGMA 2VT3A 4G7ZF 1HLVA 1KGSA 3EKSA 2P9LB 5LEJA 2ZD1A 3OS1A 4GXOA 1LJ9A 4QS9A 5FFZA 5HP1A 3HHGA 4N47A 4I09A 2Y9ZA 1KAZA 4CCHA 2CYYA 1YF5L 3I53A 1H0MA 1B9NA 3MWPA 3LFKA 3QDKA 5HNHA 3QEWA 3WNGA 3H5AA 4YOVA 1P7JA 4GV6A 2NS7A 2WV0A 1IKXA 4UB8C 1ITGA 1MBFA 3LAJA 4KH4A 3PJRA 2FMLA 3H9JA 1IZ1A 4ZZLA 2NNWA 4B9MA 4LK0F 3QINA 1OKRA 5F1XA 5JFRA 4HQMA 3W2WA 2P9KB 3W3DA 1X1DA 2VKDA 1JKRC 4CGDA 1HW1A 4B3XA 3OBYA 3CXCM 3BY6A 1QZ5A 3AL0B 1IJJA 3GLLA 4HWIA 1OCTC 1YG2A 3TGNA 2HTSA 1KU3A 1LCUA 1YW7A 3L2VA 4FZXC 4RB2C 5IYDJ 1SQKA 2QLZA 1JT0A 1YAGA 3M7GA 2WAFA 5ILSA 4NCBA 2W41A 1NGHA 1TNTA 2EZHA 3MEGA 3E6MA 4OKJA 3ID6A 4IG0A 2HSTA 4ISFA 1TQPA 1S1VA 2L0KA 5F08A 2QKMB 1DGRM 4M3WA 2ZJQF 1L0OC 4WK8F 1C0FA 5HRSA 4G9YA 3PO4A 1ORKA 3KHYA 2IT0A 3MN7A 1REVA 4M7XA 4CJ7A 1HA8A 4FWLA 3MKLA 1KXPA 1BC7C 2NS8A 1JTYA 3TABA 3WUHA 3LAMA 2UUAK 1WCMJ 4LFCK 4EP5A 3I54A 5J8FA 2JPBA 1RTDA 1F1ZA 4BGBA 3OYFA 4EHTA 4ELTA 3H36A 1G2HA 4KHYA 4RW9A 2LP0A 3MN6A 3EUHA 3SK3A 2YPRA 2ESNA 4O0JA 1NG6A 1K78A 1B9MA 2VBXA 4B4CA 3E7LA 1FC3A 2OF7A 4JOMA 4DTNA 5BRFA 4DTXA 1ZH5A 1VRUA 3VQBA 4CYDA 2B6AA 3K4CA 3TSPA 2X9DA 4HSTA 4CVNE 3ITHA 1W5TA 1DUXC 4I98B 1G99A 2E2HJ 2YHYA 1VNDA 1Y6IA 3U3GA 1JT6A 3OBWA 1RBTA 1VHXA 3CCQI 1MSFC 4KH5A 3MXMA 3L4QA 1MJAA 3VF2A 4A2UA 1VSEA 1VQNN 4DQSA 1QSLA 3BTJA 4DV3K 1GOBA 1W0UA 4OGCA 3TKYA 2L7MP 1Z7UA 1VQOI 4E6KG 4FPAA 4JI3K 2W85A 4XKWA 4XLEA 5AIPA 1S22A 3VOVA 4A5AA 3HOWJ 1Z9CA 1R4MB 4CJQA 4B8AB 3U8XA 1WAJA 4CCMA 4XEIA 2LBFB 2NVTJ 4KAZA 1SKSA 5DK5A 1K78B 4BDYA 4B9TA 2IEKA 2KJBA 2EZLA 5HODA 2HVHA 3ZSYA 1WGXA 3V1QA 3OSFA 4GY2B 3GDQA 4CK3A 2A42A 3PIOF 2VJIA 4J2BA 3D1NI 3CJQB 4IO8A 2GWJA 4XNFA 4O4GA 3VEVA 4A6EA 4FJJA 2HHVA 2BYVE 5ILUA 1U2VA 2VWJA 3KD1E 3ZR8X 1TT0A 3HIFA 3OS0A 2FMYA 1YJNI 2PQ8A 1SC7A 1BIBA 3AARA 2OZ6A 1NK9A 4I0AA 4BHPA 3H3OB 3GYHX 2OTJN 3CJRB 3VB2A 2DYRH 5J1YA 1T7PA 2HNDA 4EEFG 5E17F 4E89A 4KRFA 3HM5A 2BH1A 3LAKA 3AG3H 4QOZB 1K6OA 3H9GA 4CZMA 4FLTA 4OIPF 4HF0A 5K5QA 4Z4IA 4DKWA 5K7HA 3QETA 2KFNA 4Z2YA 1DGWY 3CCEI 4N5SA 3MEDA 1POGA 1WKMA 1GV5A 1FIAA 1CF7A 4CZLA 1HMVA 4A57A 3J7ZO 3PSIA 4YORA 2WFBA 2GLOA 4KFBA 1T0FA 2E2OA 1MWKA 4JK7A 4PY5A 5JS1A 2A40A 1U2VB 3EPZA 2HHUA 2Q31A 1ZXOA 2YU9J 1XS9A 3BY5A 4CF2A 1HSTA 2B7EA 3MX5A 4EJUA 1TZLA 1HNIA 4DSIA 2QKBA 5FLMJ 2NVQJ 5AQOA 1DTTA 4UVBA 2L5QA 1P8ZA 1IDYA 4HHTA 2F7TA 4DZJA 3MMVA 1KQ9A 4CJRA 1A5XA 3VWBA 3D2FA 2YSRA 2JSPA 2UXDK 1FK9A 2XY5A 5GAGJ 2QWPA 3CMYA 1I1SA 5D5UB 3THVA 4HEA2 3K1MA 2HFHA 1WPKA 4QTRA 1W36C 4RDUA 2KMUA 4M9ZA 4JKEA 4FXDA 3FX3A 1O7LA 2DMNA 2R7XA 4DTPA 1ZR4A 5E1WA 5KVRA 1S6PA 1ZLKA 4CZCA 2ITGA 4BRFA 1MNEA 1YW9A 4JLHA 1MA9B 3KZYA 3TDUC 4UNOA 3F72A 3H3ZA 3FM5A 3GEZA 1S8NA 3HBLA 1S29A 3A2FA 1V4TA 4PJJA 4FYDA 4KMFA 2KKOA 3P31A 2AXLA 3GL1A 1RR7A 5AQUA 3B02A 1RT6A 5DUIA 2FBXA 2WUSA 5FRNA 3NDKA 2ZJPL 3QAHA 1LQ1A 2NRAC 5BPMA 2E1NA 4UXNA 1JE8A 1FWZA 2J4RA 1W7PA 3B73A 4X6AJ 2A6AA 3DLEA 1XMQK 1QHGA 3U9GA 3D2FB 4LF5K 5SZTA 4NCAA 3T1YK 2QQ8A 3E01A 4RB0A 3FMSA 4DR7K 1WI9A 3F23A 1P7IA 3SJJA 4H0VB 2YJFA 3L0QA 4DSLA 5CVUA 1I5ZA 4A3FJ 1SKWA 1X9SA 2IA1A 2R7FA 4BRCA 5AQIA 1E4FT 2UXNA 2R5YA 2L9RA 3AVAA 2FSKA 5CVVA 1YI2I 4X64K 3VYTB 3GWZA 3T3FA 4WQ4C 1NGCA 1O3SA 3HG9A 1Y56A 3DLAA 4F9OA 2O8EA 3Q0UA 4B9SA 3CF5L 3FFKB 3LSKA 4ZDLA 3QYBA 3C0BA 2L4AA 3AVIA 3EE8A 5EZHA 2ZBKA 2KKZA 2WV1A 2JTVA 1HKTA 2HU9A 5SWMA 1V4RA 3C65A 2GZWA 1X58A 2E71A 1JXSA 2CH5A 2LG4A 3S3MA 3TR8A 2LY9A 3G0ZA 3DRPA 1B72B 2A1RA 3MKYB 1WOQA 2HPMA 3HPOA 3HP6A 4Y52J 1O3TA 3BG7A 1YFHA 3HOZJ 3O9TA 4RW8A 5A2QK 4J00A 1YOVB 4CFBA 2C6YA 1TV6A 3CCQN 5J3LA 4IEJA 1YUWA 1FLIA 2LSNA 1JL1A 1KRPA 1BBYA 2GIZA 3I9V2 5HDGA 5D8LB 2OYQA 3MXIA 2A3SA 1VQON 2NRTA 1NTCA 1Z25A 3A03A 2O8EB 1W4MA 4QPOA 5BQTA 3L4IA 3C94A 4IFEA 3HGYA 4DYCA 3HVRA 3PIPF 2OZMA 5TGTA 3N4PA 3KP2A 3T19A 3TTDA 1ZBIA 1R7JA 3HEFA 3F9KA 4J2DA 1WJ5A 1BCOA 1QQMA 2Z1HA 4HV6A 2IPQX 3V8JA 5L3EA 2DA4A 3OV8A 2XGEA 2FLOA 4CICA 2LFBA 3SQ1A 3K4JA 4RGXA 5K14A 2VXZA 3ENBA 1TKXA 2LKPA 3AG4H 1D1BA 4G12A 5J2PA 4KA4A 3WGIA 2M7AA 1KTQA 3F6OA 1GLNA 1YJNN 4CDGA 1T98A 4HLYA 3HK2A 2UUBK 3KVGA 5FKLA 5BNGA 1X1BA 1C1CA 3H9QA 1GLAG 3A0IX 3ASNH 3ELKA 4KDPA 2V7YA 5I3UA 2OZUA 4XOTA 4BNCA 1VK0A 4ANJA 2HR3A 4JI0K 1HF0A 1J9AA 2FE3A 2WA0A 2CUEA 1JGGA 1ZC6A 1BG3A 3U9DA 2WTUA 1TC3C 1NMDA 1QZ6A 3ZT2A 3CCEN 1BA5A 4UV9A 4I6ZA 1P4AA 1NMNA 1R59O 1NM1A 3KP6A 1UCRA 1HC8A 4BHCA 2AJQA 5KHDA 1W7PD 3K1PA 3LZJA 3J7AP 4A3JJ 1TQMA 5LHHA 3CUOA 3RMBA 3TSQA 4W5RA 2ZGYA 4IBNA 1BHLA 3ABUA 3HDDA 2DYSH 4K0KK 3VYSB 1OISA 3VGMA 3E9PA 5C0YA 4A3KJ 3EZWA 2W84A 2OC6A 1FX7A 2L2OA 3VQQA 4K43A 2E5NA 3S17J 3HRGA 1FYMA 1K8KA 4DR1K 1IN8A 4O44A 3K70C 2JK3A 4ENNA 1ZBHA 1OPCA 2ATQA 5B5EC 3M8SA 3LA3A 2JVHA 3UNGC 5K7ZA 3GFLA 4RTFD 1MDMA 2RVCA 4M9XA 1TK0A 4YG2F 1X3ZB 5ADXH 3PO3J 1NGJA 3WTYC 3ZMUA 3E3VA 4BRAA 4AM7A 4BR2A 1GXQA 3DEEA 2IJLA 2NRXA 3ATVA 3VYUB 3MN5A 2F9WA 4IHVA 3EUKL 3FDYA 1SKRA 4BL0B 3RKXA 5C3EJ 1LUJB 3ENHA 4XN3A 4RCHA 2YJEA 4PHTX 2HHHK 2FUG2 4Y4RA 2OANA 3V4IA 3SLCA 1PYVA 4B8CA 3VF4A 1DKGD 2O8KA 1RT7A 3PX4A 4FK0A 1EF4A 4FSVA 2XKPA 3TWHA 1O57A 3VN5A 2XHBA 4B8XA 4EQQA 2RHKA 5ICCA 2F8SA 4CJPA 1TK8A 4XN0A 3HTSB 3F5TA 1ZK8A 1YIOA 4AIDA 4FJIA 1XQSC 2WAQN 3ISPA 4Q47A 4DTOA 3IAM2 1K8KB 3TPQA 5CZ2A 4PJMA 4O55A 2QENA 4L0YB 2R7ZJ 4CJEA 2M7BA 1VI0A 3SV3A 1HX1A 1FOXA 1Y1WJ 1I27A 4AIKA 1MDMB 4CEQA 3KEOA 4II2A 1AA7A 4IHYA 4YY3K 2P9NA 2MSYA 1E4GT 5B66C 2ECCA 5CY4A 4E0DA 4DQ8A 4HX7A 4DSFA 1XDUA 1ZRCA 3H0GJ 2MC3A 1AWCA 1U4BA 1TAUA 3ZP5A 4MQ3A 3LDPA 3AKZA 3ZX2A 4JYAK 4L9VA 2BZTA 5M1FA 4KHPK 3QPTA 1U3EM 4AVZA 3D2EA 2DY4A 2P6TA 1UELB 1YJ9I 4RW4A 3QRFF 1DGKN 3AVCA 3DQVC 1IC8A 3QO9A 4CE9A 1UG2A 3JTGA 1BIAA 3DMJA 1XC3A 2NRWA 1S9GA 3FM3A 3QFUA 1QQCA 3RKWA 1JHHA 3ZLJA 4JKBA 3LWFA 1J2XA 2QQBA 3R61A 5M5WJ 1WSHA 3QIOA 4XORA 1HQUA 1JUMA 2BE2A 5LJWA 4CZGA 4BRMA 2LR8A 1NK2P 3FMRA 4X0GA 5J2NA 1D1AA 1ZRFA 1SANA 1WJDA 3ZXSA 1U5TB 4WXCA 3SNNA 4XOPA 4E3SA 4J2AA 3HBTA 5ILVA 1WJFA 5E20A 1U8RA 4FJXA 1ATRA 4BBRJ 2DMPA 1U9NA 1SFXA 3D2EB 4E7SA 4JKGA 2ID6A 1BO5O 2JA6J 2M9HA 3OYEA 3VQEA 1IO2A 2BXZA 1RTJA 3SUPA 3THYB 1XGMA 5FO5A 3HL8A 3ZX3A 4GV3A 3IKMA 2W24A 2K27A 5HLHA 1RPWA 5M3FJ 2EFQA 3FZKA 2MC4A 3FXKA 1ESVA 3ENOA 3H3UA 3OA9A 3OMYA 2KHMA 4IRIA 3EETA 1V5GA 2CV2A 4A93J 3TOAA 4JKCA 3ZQGA 4LD5A 1N5YA 1TNSA 4OU0A 4ZTFA 4BS9A 3OYMA 2IXSA 4YFKF 2I7NA 3DPTA 4IOAL 1AHDP 2F6CA 2EILH 2WWYA 4KREA 5HS8A 1OR7A 4E7IA