1Z6XA

Structure of human adp-ribosylation factor 4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
175
Chain Sequence
TISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 4
publication title Structure Of Human ADP-Ribosylation Factor 4
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 54
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z6xA00
3MJHA 1SHKA 2ZPTX 5KSPA 5LB2A 3SS8A 5AJXA 3I5YA 1QHIA 4M1TA 1AS2A 3D3QA 2P5SA 1K6MA 1JPJA 2CBZA 1JNYA 2JLSA 3BD9A 1E69A 2AK3A 3M1IA 4KU4A 5KU1A 5KNDA 3GLGB 2DFKB 1ZU4A 2C9CA 1E0SA 4IVPA 3VU9A 3A1SA 2B7CA 2ZE8A 4H1VA 4A2WA 2Q21A 4PHFA 4EDHA 4RD1A 3SFZA 1LNZA 1S4QA 1KDPA 1OHHA 1T3HA 3I92A 1Q20A 5CLQA 3RYTC 4ERNA 2MMGA 1IY1A 4QC2A 4M1SA 4HLQB 1HURA 4RSGA 4ZV4A 4O25A 3U44A 1CR1A 2ANCA 5CK5A 4AKGA 1SKQA 3I3SR 3TGPA 4NZYA 3ZDQA 4NCJA 3K0SA 2WJHA 1U9IC 3QUSA 2BMJA 4CZ2A 2QI9C 4Q9JA 1FUUA 1YZGA 3U61B 4EFMA 5L3QA 1ZNWA 1SVKA 4LYHA 1D5CA 3RS2A 2ATXA 3GJ0A 5KPJA 3K9NA 1VCNA 4D0GA 2EYUA 1D2EA 3CX8A 3RS3A 3R8CA 4DBLC 4MH0R 1KI1A 2LWIA 3HR8A 3AP2A 2RH5A 3DKPA 3VNUA 2R2AA 4C30A 1MO4A 1RJ9A 4NYIQ 5JS7A 1DG1G 3FKQA 2BMEA 3TR5A 1G3MA 4IJMA 4US1R 1RVDA 1GNQA 5LB4A 2AR7A 3WNBA 4TLBA 4J0QA 2JAQA 2QE7D 1KIMA 3SBEA 1E9SA 3FPAA 1P73A 1OKKA 2NO7A 2XNDD 1SKYE 3ZIAD 5FR1A 4Q1FA 2GJ8A 2YWEA 4ACAA 1OLOA 1KO5A 3X1XA 1D6JA 1GAJA 3Q7PA 4FWIB 4DDTA 1G9XA 2WAXA 3NIBA 4YMWA 4DLXA 4AC9A 3GEEA 2YOHA 1G5RA 5KSZA 5FPKA 3I62A 3L82B 3QIAA 2C2HA 3SDZA 1KO8A 2D06A 1XWIA 1KI3A 2BM1A 3WYAA 4ACBA 3A37A 1X8LA 5CB6A 3BS4A 1KAOA 2JLXA 4C3ZA 3KKQA 1TMKA 2HT1A 1I4DD 4OHXA 3FB4A 1ZW6A 5HR5A 1XTQA 2P6NA 1HUQA 1U90A 3PEVA 2BWJA 3EZ2A 4GOXA 2BIFA 3W3AA 4AYXA 3K9HA 2F6RA 4IVRA 4Q7LA 4ZI2A 3K1JA 1ZMXA 2BBWA 3LXRA 4KODA 3RRMA 3SYKA 1EESA 1J2JA 1DARA 2J0UB 1KDRA 1W46A 2ZRMA 3LBNA 4PZYA 1RPZA 4HDQB 2TMKA 2JJ8A 2GKSA 2HV8A 2XSZD 3P27A 2JLUA 1UPTA 3V9PA 1XXHB 2F3RA 1JQJC 1Z83A 1ZNZA 3C16C 1YR8A 4JMPA 3VMFA 5CYPA 1W36C 1R8QA 4MA4A 3DVLA 4MKHA 5AJVB 3DPUA 4FMBB 1SVSA 3B8HA 3BH7A 4TT3D 2BV3A 5B58C 1YE8A 1HTWA 2WZQA 3I32A 2VP2A 4HUQB 1Z63A 2DB3A 4ZO4A 4AYTA 1F60A 1CR2A 4Q1AA 3K09C 4QJ4A 4DLRA 3PG5A 4M1YA 3PITA 4UNSA 2ZJBA 2R6CA 1W49A 1CIPA 1Z2CA 4OBEA 1PUIA 1KHTA 5EP1A 3PXGA 2QEQA 1YJ5A 3N2IA 3AH8A 3VNVA 4DC9A 1NF3A 2D74A 4M53A 1G64A 3R7WA 2QTHA 2WJJA 2W0SA 4P4SA 4DCUA 2IX3A 2YHSA 4V0ME 2CHVA 4LX0A 3FHTA 1S1CA 1Q22A 4GPTA 4V0LA 3D8BA 3OHMA 3PQCA 3QI2A 3P4XA 2GAAA 4JLVA 2OFXA 4JJZA 1US8B 5KPDA 1U9IA 4NP6A 2GA8A 5HKKA 4CEHB 1QHNA 2A5GA 5GJWC 1FMJA 2F3TA 4HATA 4ABYA 5FPHA 2C96A 3EAQA 4LBZA 1XMVA 5FOUA 5D3MA 821PA 4MRRA 2IS2A 1LB1B 2J45A 3CZPA 2WIBA 3AGPA 4D2IA 4BLTA 2O8FA 4KVGA 1P75A 3MWKA 4F4IA 5B30A 1ZRHA 5EE9A 3X2SA 4PC6A 4BECA 2OG2A 2WSMA 4AKEA 2VHCA 1IONA 4OQMA 5IHPA 2OLKA 1N5KA 4HAUA 2ZRDA 4S35A 4AG5A 2IWHA 4AIIA 2ZI4A 4L15A 2EWVA 3W6PA 3GLIA 1YKSA 4NCKA 4NYMR 4TMVA 4V0NA 1OXXK 1E9FA 3FKSA 4BFUA 4EJSB 4Y0AA 4XTCS 3KKOA 5FOXA 6Q21A 1DELA 4KJZA 1E4YA 2JLRA 4RKEA 3KUDA 4ZCLA 3RNLA 1XRJA 1Z6YA 3CH5A 3WHLA 2FF7A 4RZ3A 4UNPA 1DAIA 1WCV1 1S1MA 4C0QC 5L8VA 1B0UA 4WAUA 3VR4A 1J70A 1P3JA 4YXWD 1GRQA 3ZZTA 1M7BA 4URUR 3GFTA 4B35A 5KDOA 3LAWA 1S3SA 5CLLA 3T06B 3AF0A 2CHGA 4AURA 1G7CA 1WRBA 3JVUA 3TVDA 4RCZA 1OT3A 4D25A 3A6PC 1G7TA 3EC1A 3KKPA 1G16A 2LKDA 3U4QB 4Q7KA 5C2JB 2C98A 2GVDC 5JEDA 3KQUA 3ZVNA 1T6NA 1W5SA 3CBQA 2ODWA 2IK8A 3QXCA 1KSGA 5JRZA 2FV8A 3N70A 1Z6GA 4BFWA 5E7MA 3TAHA 1EFUA 5J4YA 3I72A 4KO8A 5JCZA 5FTJA 1SKYB 2ZRBA 2ZUBA 1BO6A 2GILA 4W7SA 4UJ3A 1W5TA 2JA1A 1ZIOA 3LBHA 2QU8A 3BK7A 4RFSB 2F1HA 3DL0A 4PO9A 3KZ1E 2ZJ5A 1VYTA 1HE8B 2W58A 2SHKA 2BEKA 1IBRA 3K53A 3EZ7A 1E94E 4QRHA 4D80A 4B74A 4ILEA 3REFA 1Z6XA 1W7AA 4QM6A 2A5DA 3E1SA 5DO9A 1E1QA 3CX7A 2OBLA 2ZU6A 3H84A 5TVKA 2NO9A 5HZKA 1QG2A 3AV0B 5G3ZA 1AS3A 1EXMA 1Z0IA 4MUAA 1XF9A 1ZM2A 2IYRA 3EPKA 3RSOA 1Z0JA 1R4AA 3U6BA 1NY5A 1FZQA 3RDPA 3U2QA 1HQCA 1N6PA 1P62B 3T15A 1G5PA 1OFHA 3QG5A 4EUNA 5JSZA 5BQ5A 4A0GA 4IEEA 2J9RA 3MRSA 2VO1A 2ODNA 1N0UA 5FOWA 1CJKC 1NSTA 5JI3E 2A9KA 3K0EA 5J4LA 3CNNA 2G0NA 4JYBA 1NI3A 4TL6A 4KHZA 5HKKD 4B3CA 4LJ5A 4AK9A 2V9PA 1G7RA 1XTJA 1SVIA 2R62A 2WSSD 3OIVA 3HYRA 1GVNB 4L8GA 4C2TA 2QP9X 3UK6A 1Z29A 2N42A 3PV0A 1KZGB 3BFKA 1XMJA 5EXXA 2FH5B 2IYYA 5AUOB 1XEXA 1AZSC 2E87A 4G5SA 1BS1A 3I1FA 1N6HA 2FMXA 3PR1A 3A1VA 1Z5ZA 3QXHA 3IEVA 4IEIA 5CIWA 4AKIA 4OK3A 3HU1A 1FX0B 2V7QA 1Z0FA 3U7GA 1XJ0A 2NZJA 1ZBDA 2G83A 2IA5A 1XD2B 1DAFA 2H5EA 4URVR 3Q7QA 3RS5A 4Q1CA 2V55B 2WMOB 1CTQA 4NH0A 4RZXA 2FEMA 4IOJA 1E79A 1E1RA 2V54A 3QY0A 4O2LA 4PO8A 2J7KA 5EE5B 4TSFA 1XD9A 2VP9A 4A82A 3AVPA 3VAAA 3PUZA 4ESVA 4N1AA 2QTFA 2PMKA 1JXOA 3ZZ0A 2HXSA 1TADA 3U6KA 1QF9A 3SJZA 2HCBA 4TTPA 2GXQA 1N25A 1R5NA 1R8SA 2A7QA 2FSHA 4BUJA 1W2GA 4KITB 3LD9A 1SZPA 5H1YA 4LV8B 4ASUD 1G6HA 5DLQC 1IN8A 5DNYB 3AKDA 3DM5A 2GETA 1FNMA 4PAQA 1WMSA 1GDDA 2E9SA 1UBGA 3VU9B 3BERA 1YVDA 2VSXA 3LBIA 1XBTA 1YZUA 5TV2A 4Q01A 5BYKA 1G1MA 2F1RA 4LHVA 3V00A 3EIHA 2ZTSA 2XTZA 1Q44A 2A5YB 4YMTA 3H1TA 1H8ED 3WNCA 2QMOA 1G7SA 3BORA 2BJWA 2YZ2A 3RS0A 2J5XA 2WHXA 2GCOA 4NDZA 3CWQA 3U44B 4BLOA 2YC4C 1KGDA 3AP1A 4Z51A 2ZANA 1PLJA 4BLRA 4KFUA 4TN1A 1Z2AA 4LJ7A 4URWR 2WWIA 1VCMA 3ADDA 3QVUA 1WF3A 4R2HA 3IPYA 4V0OA 5L3QB 1ETUA 1CU1A 5CDFA 1S3GA 5EXSA 4M1MA 1AM4D 4GFDA 3QKSB 2E1RA 3RHFA 3OE7D 2QGNA 3GFPA 1WXQA 5KNCA 4OK5A 2H8KA 2DWPA 1E1QD 3I4LA 4PPNA 5DIFA 4B3XA 3FMFA 4TQUS 1S9HA 1XEFA 1RJ9B 3K0CC 2YOGA 3W5JA 1XDBA 3ZH9B 1KI6A 4W5JA 1QZXA 1UKYA 1H65A 4HLCA 3TE6A 2B92A 2Q9CA 1NN5A 3WRXC 1ZVQA 5GJBA 1SULA 1IN7A 5G3YA 4E09A 4BEJA 1M6NA 1ESMA 221PA 4LJ8A 3W8RA 4CT4B 5KNBA 5IRCD 1G3UA 4D4LA 2P65A 5EE3A 1NLYA 5JZVA 4P32A 3C5CA 2ZRJA 4KSBA 4B3GA 3BB4A 4NCHA 3VFDA 1OJLA 3K0FB 4QKQA 4LBWA 1NBMA 4BE7B 2ECKA 521PA 4GL2A 4M9QA 1QVAA 5LBIA 5IF9A 5JMTA 4PZZA 1SHZA 3T35A 2I4IA 1EGAA 2DYKA 3QXJA 4M9ZA 2QT0A 2JJ2A 2QAGA 4IDNA 4OI2A 4F92B 4I4LA 2F55A 2OCAA 4HLUC 4MKGA 4Q9KA 4WA7A 3LX5A 2CE2X 1X1SA 3B1VA 1KJYA 1HA3A 4MGZR 1OH6A 3EW9A 4YLGA 4BPBA 3ONWA 2X8AA 4PC1A 3TJZA 3ZJYA 1AN0A 2W2TA 2NIPA 2ZUCA 5FUXA 1G3QA 1OFTA 1IXZA 4KSCA 3CF6R 3GFOA 4I81A 2JLZA 2ZRGA 1UBFA 3PENA 2WV9A 4XIGS 1JECA 1QHSA 5DYIA 1NN1A 1SGWA 2OE2A 2N1BA 2B8WA 1E2KA 2V7QD 3I8XA 3T1VA 3KJGA 4QL3A 1YZTA 3U7FB 1QHXA 5FR2A 3QF7A 3VR1A 4ARZB 5AWFC 3CX6A 2DPXA 3PFIA 3GLHA 4URYR 1D8TA 2GHIA 5FPYA 4TZ0A 4IDHA 4FN5A 4HI0E 4C7OA 2FFHA 2GTPA 4BWYA 4DCNA 3B1ZA 4JLAA 4A0HA 4TZ6A 2GRJA 2PEYA 2QG6A 1Z0DA 3OZXA 5C18A 1GKUB 1Q12A 1UJ2A 5DGXA 1CEEA 4IHQA 2WAYA 4HB4A 2QQEA 2OLJA 3A1UA 1TQ6A 4JVLA 2Q3FA 2F9MA 4QNRA 2ZJAA 5FUVA 1G8FA 1EX7A 4CF7A 2BVNA 1NKSA 1HV8A 2IUUA 4Q7JB 1F2UA 3NEYA 3UG6A 4NONA 2XXAA 2RMKA 1KJZA 4BLQA 2LKCA 4A6PA 1ZUHA 1DE0A 4NE2A 1OIWA 1PLKA 3FDIA 3NBFA 4Y0VA 3T1TA 3A8TA 5EP4A 3E70C 1F3OA 3D31A 4KV9A 4MUBA 1EWRA 3DM9B 3A4LA 2G77B 1DO2A 5TXGA 3R7WB 4ITRC 1RRCA 4P4SB 3U3RA 2EFDB 2ERXA 4LRWA 4JYCA 3BB1A 4XTRA 4M8NE 3IKJA 2PT7A 3TSOA 5FH9A 1U0HC 2WOJA 1MOZA 1GIAA 4B48A 2FPLA 5GVRA 3PUXA 1UADA 4JL8A 1NMXA 3AF2A 5IT5A 2D2EA 3QJYA 5JI2E 4N0EA 3UG7A 2FFAA 3FTQA 2J7PA 4QOSA 1E9EA 2D3WA 5DE3A 1Z06A 4DSOA 1TPZA 4P33A 3Q5EA 1XTSA 2V6JA 4KFTA 1DAHA 3QKUA 2HJGA 3C14C 4UXIA 2O8FB 4DKXA 2Z5FA 4TMTA 4ON9A 2PEZA 2QPTA 1FNNA 2Z43A 1G19A 1U98A 3CNLA 5EE0A 3NBZC 4XWKA 2IW3A 1CR0A 4X8MA 5ANRB 3EPLA 1I4TD 4LHZA 4NYIR 2O0KA 2NO0A 2VF8A 3BH6A 4POAA 421PA 3AVWA 1HH4A 1EX6A 3BFXA 4TTRA 3AKCA 4RY2A 4O0MA 2BBSA 1KO7A 3PEUA 1DAKA 1CLUA 1Z08A 1UF9A 3N5CA 4JLPA 4JVSB 1ZD8A 3GLFE 2F43A 2OFWA 2W6JA 3GJXC 3QKTA 2ZRHA 3HR7A 4PTLA 1SQ5A 4Q21A 4U00A 3ZS8A 3G0HA 4M1KA 1WDTA 5FBRB 1E2IA 3RRYA 4DUGA 5BYJA 5K8UA 1W4CA 4F38A 3IBYA 4KLZA 5TDHA 4Z54A 3CF2A 3O8DA 1B23P 1ZM7A 1JR3A 4DCVA 2A78A 1NBMD 2QM7A 2XJ9A 2Z0MA 1W0JA 1CP2A 3BE4A 4R98A 2KBFA 5EZ5A 1KK3A 2ZAOA 4FD2A 2QBYB 4OI0A 3EIQA 2AWNA 3IEUA 1GKYA 3IDQA 3B13B 4C9BA 4PFSA 3M0EA 4HEJA 4Q00A 3SN6A 3UMRA 1IN5A 1GOTA 1DAMA 1FUKA 2QROA 2NPIA 3EC2A 3RC3A 1A2BA 1TL7C 2CCJA 2PT5A 2WWXA 3R8FA 4HZUA 1TQ4A 5KDLA 2JJ1A 4L9SA 5C1BA 2CL0X 1N2CE 2QMUA 3SJBA 3TKLA 3LDAA 2ZRCA 4IOMA 5KO2A 4FWTA 4BEBA 1AJEA 5KHOC 2G1KA 4TL9A 4AYWA 1A7JA 2FX3A 1E2LA 1MRNA 1J8MF 3OEEA 1M34E 4C2UA 3KQHA 3CUEF 4KFSA 5FTLA 2PCJA 4TMZA 4UQOA 4DB4A 4A2PA 2FGJA 4LC1A 3FHOA 2XEXA 5AJZA 4AD8A 2RHMA 3KX2A 2FEOA 2P6UA 2RGXA 3AKYA 1MO3A 4G5QA 5H68A 3RANA 1R0WA 3SI7A 4EFNA 2ODEA 4EPXA 1TUEA 5JFGA 2YWGA 5JJLA 1ZNYA 1P5ZB 4Q19A 2ZYUX 2IYVA 4PZLA 1SXJA 3CRW1 2RGAA 4KYIB 4DCTA 3D7MA 1GRRA 5C4GB 2PMDA 3DZ8A 2ZS9A 1GNPA 4P4UA 5FOVA 4DCSA 3CZQA 3TRFA 3SEAA 1ZNXA 2JLWA 5LD2C 5G53C 3HU2A 2CNWA 1CBUA 3KKMA 4JLNA 5JBQA 2JATA 3CIOA 2OT3B 2QL6A 4O3MA 3TIFA 3M6AA 2MSEB 3W9YA 3HPRA 1Q1ZA 1KSJA 2ZRAA 4PANA 4R71A 2Z6VA 4BASA 3B9QA 4Q03A 4K46A 1CXZA 1JB1A 4RD4A 3PUWA 5K8TA 5FTNA 2OXRA 3S1AA 621PA 2X1VA 4U5XA 2IHBA 5J5CA 3K70D 3WNDA 1EFRA 3NDBB 5AUQA 2WJGA 1CJVC 4A4DA 2VHUA 4DLUA 2ZAMA 2FOLA 1OH8A 1C4OA 3GJ6A 3C7KA 1XEXB 3A36A 3CB4A 1TQ2A 4JLJA 3W90A 1NJGA 4Q4AB 1XPRA 2QQ0A 2GJAA 4X8HA 1G8PA 4JIMA 4OHZA 4ZPXA 1P7CA 2YINC 3HWSA 4XH9B 2OBMA 4JJKA 5M04A 1P9RA 2VYFA 1YHNA 2BC9A 2EWWA 2GF0A 2ZROA 4CDGA 3TR0A 3AVUA 3CNOA 1SVOA 3LFUA 1KI2A 5HPYB 1E2QA 3CWZA 1JI0A 2NTYC 2QORA 4PC3A 3WMGA 3ZZUA 1NN0A 4YDHB 3EWAA 2CEAA 2EU8A 1E2PA 2W6JD 2EYQA 2XITA 4PPGA 2HF9A 5AJWA 3UMFA 2AD5A 4JZKA 1YR9A 4A8JA 1G3IA 4DUGD 4DDUA 2RGGA 3IUYA 1RKBA 4DHEA 2OXCA 1KK0A 4GRAA 4JBWA 4PSAA 4RD2A 1TX4B 1XPUA 1MABA 1DO0A 2XB2A 4M21A 5FI1B 1DADA 4QHYA 4TMXA 1VIYA 3THYB 4XVQA 3ETLA 3W34A 1W0JD 3CRQA 1V43A 1FW6A 3NHAA 4MYHA 4GNKA 4D4KA 4RFVA 1M2OB 1OPXA 3HYTA 1OXUA 1KKLA 4A1FA 5DN6A 3QEJA 2PCLA 3SYLA 2EVWX 3DOEA 1II9A 3VTKA 1T3SA 2WWHA 1HYQA 1LFDB 3FGNA 1I2MA 2ORIA 1AA9A 2JJ1D 2X2FA 1JEDA 4RD6A 3GLFB 3KJHA 3U3KA 4G5OA 3TQCA 2QT1A 3TH5A 4OKSA 8OHMA 4B3FX 4TQ9A 1N0VC 2XOKA 2GZHA 4QNMA 2G9NA 2QAJA 2R6AA 2VHQA 1FTSA 1OHHD 4MDFA 1VG9B 2CLSA 1BH2A 1AGPA 1MKYA 2MSDB 4URZR 5JEEA 2VSOA 3CONA 2XTMA 3OEED 4N3NA 3ZGXA 1FL9A 3BAFA 3QF4B 3L0OA 3ADBA 4MRVA 1G8HA 4JT2A 3RS7A 1QRAA 2FSGA 2IEYA 2RGDA 3MWLA 2OCPA 4FIDA 3VR2A 4DDWA 2UZ3A 2CE7A 4B6FA 2GF9A 1BIFA 4MKFA 2HYIC 4MKIA 4Q1BA 1NVUQ 1SXJD 3QPVA 4I1OA 2V4ZA 4C0HA 4LV5B 1E4VA 1TTTA 4EPRA 1NL3A 1T91A 1K5DA 3OFNA 4GI7A 4M2LA 5FL7A 4LHWA 2C78A 3V4RA 5JJKA 2P67A 2ZSEA 4A6XA 3UATA 1D2MA 2H57A 2QP4A 2W2VA 3QKRA 4QBGB 1KMQA 3PCRB 1KI6B 1KNXA 4A36A 2ZJZA 3PEWA 4II7A 2NPFA 2OO7A 3AB3A 4PAMA 2ZEJA 4US0R 3JVVA 3BRWD 4UXHA 1SVLA 5DI9A 1ZM3A 2VLIA 1E9AA 1GSIA 3ZQJA 4UKDA 4H1UA 2J0QA 2CLCX 2J0VA 1XFAA 4FI3C 2GBLC 3ZVLA 2ZJ8A 3QG1A 3PIRA 1OKKD 2AHOA 5FUWA 2C95A 4QGAA 1ANKA 3THXA 4JLDA 3IQXA 1IN4A 2QAGB 2LCFA 2G88A 1JJVA 4KFRA 4ZI3A 3JZMA 2ZITA 1T0HB 2BM0A 5F9FA 1EFRD 1UEJA 2HEIA 2UKDA 3LA6A 5L3SA 2P2LA 4IDPA 4JSTA 4LYJA 1W4BA 3T1QA 3Q72A 4L9WA 3EG5A 3KXLA 1R0YA 2IBMA 1YZKA 1BOFA 3Q3JB 1NIPA 5CM8B 2O8DA 5SZJA 3TSZA 3NH9A 4TL7A 2V3CC 4XWOA 1NNEA 4KVAA 1U8YA 2ZRLA 1QHGA 1IXSB 1NY6A 1OYWA 1Q1QA 1TF5A 2C8VA 4G01B 3VQTA 3GD7A 3W5IA 4QFMA 2ZRPA 4ZKEA 2CL7X 4DVGA 3SHWA 4I1VA 3GLHB 1KK1A 2IHYA 3MWJA 3WRYC 1E9DA 4JLBA 3N2EA 3GLGA 4CEIA 3R9XA 1DTSA 1X8KA 4Q66C 3MGCA 1E98A 2XX3A 1NG1A 2ZYTX 4PC7A 3RWOA 1D9XA 4GMXA 2I1VB 3WMFA 4AI6A 2Y8EA 1XNJA 1T8UA 5FL3A 4F4JA 5HZHA 3KXKA 2CJWB 1CR4A 3KXIA 4OYHA 2VIIA 2DBYA 3K09A 4NL4H 4I1UA 4FW9A 1A1VA 1NG9A 1XCGB 4PQYA 3QOFA 1F2UB 2HF8A 3CPEA 2KSQA 5JCPA 2XXAB 2FSIA 4E03A 5FFMA 1RIFA 3KTAA 5EXTA 2VL7A 3TVTA 4HYYA 1BYIA 1XB2A 2ANBA 2GJ9A 3Q9LA 1E96A 1RRFA 2RAPA 4IXNA 4JL6A 4ZDKA 1KYIA 1RRGA 1E3MA 4Q1DA 1RE0A 4DSUA 4BLPA 2Z83A 1NSFA 4BZQA 1E0AA 5JLJA 3T34A 3REGA 1E9RA 4LYAA 1JPNA 1G21E 1R6BX 2H17A 4QBIA 4G3XA 4L5BA 1HT2E 3P32A 4MYTA 4GOJA 2F1IA 3H0KA 1L2TA 1XMIA 4RZUA 5DISB 5FBQB 1LW7A 4B33A 3L43A 2GDJA 5J47A 3KL4A 2ZYWX 1S96A 3K70B 5UKDA 3SE0A 4DLYA 3OF5A 1G3RA 3ASZA 4IDOA 4JKYA 3I61A 1P2SA 4EJSC 2ZVPX 4A0RA 1U8ZA 1S2MA 1O87A 2NMVA 2O8CA 2J1LA 3IGFA 3IPXA 4D6PA 1IQPA 2F7SA 1Z07A 4FCWA 4OHYA 4LGMA 5FL7D 2D7CA 3EIEA 2O8BB 5A5GA 5KSOA 3UMSA 1OXSC 3GP8A 1I2DA 3O47A 2IYSA 4BRWA 1AKEA 3T5GA 1PZNA 2PJRA 1P60A 2J59A 2ZRKA 4ZDWA 1E2GA 3LVRE 3JZAA 4QJ3A 3A1WA 4F4CA 1E2DA 1G291 5HE9A 4CEJA 1D9ZA 1PUJA 3FKSD 2GK6A 2ZS7A 1YRAA 3BH0A 1NJFA 4M0LA 3VHLB 5KYKA 1U0LA 4Z8XA 3EWSA 2A5JA 2JGNA 1P6XA 5E4FA 1A5TA 1KY2A 1AGRA 5CIQA 2WWGA 4RVCA 1UFQA 3CM0A 3RWMB 4HB0A 2XZOA 2VBCA 2DY1A 3DO6A 1E9CA 2J0UA 3B60A 3BFVA 3LW7A 3NDPA 3LQQA 4GZMA 5HTKA 4HDCA 4B47A 1C1YA 3A58B 4HDOB 1HE1C 2IXEA 3NBXX 2PZGA 5A4JA 4US2R 4QM7A 1XXHA 3EARA 1MR3F 4LOAA 2XAUA 2REBA 2OILA 1UBCA 1KDTA 4HZUB 5EE1A 2C04A 4PSVA 3RSLA 5ELXA 1Z28A 3U3OA 1JBKA 5JWOA 2XB4A 3W8NA 3VKGA 2PH1A 2AFIE 2BCJQ 1IY2A 1QHHA 1TEVA 1U99A 2BHRA 1JQLB 3C5HA 3AVQA 4TWZA 2G3YA 5K8IA 4XJXA 1RYHA 3K0AA 5DH9A 5EP3A 1OH5A 1F48A 2Z4SA 4TYQA 4DZZA 3GLIE 2ORWA 1Z0KA 1C9KA 1QBKC 3FMIA 4CIDA 2D4HA 2ZQ5A 3ZVRA 3HDTA 4A9AA 3QENA 4E5UA 3NXSA 1GRNA 1CJTC 3P4YA 1ODFA 2GEDA 4F7WA 4DT1A 2CK3A 2WKQA 1W36D 3DHWC 3BC1A 1MRSA 4MGYR 5JHGB 2IS4A 3CRVA 1TNDA 2GCPA 1F6BA 1SXJB 1VYVA 3TQFA 3VR6A 4B2LA 4EQ6A 1JEEA 1LF5A 1XD8A 2J87A 4OQFA 1Z0AA 4LJ6A 5AK0A 3DMNA 1F2TA 2WMNB 4WXPA 4CEHA 1X1RA 3Q5DA 2KBEA 4CT5A 4URXR 4WW0A 3EPJA 4G0NA 3TW4A 4ZKDA 1X8JA 1XU4A 3LWNA 5E95A 4X8LA 1G41A 4C0AC 2J46A 1N0WA 3IIMA 4B76A 1VDZA 2WWWA 3HP1A 4OQNA 2J41A 4LZZA 3KJIA 4NU0A 1KMHA 4RKFA 5SZHB 2QPAA 4BFYA 1AQUA 1NMYA 1TEXA 2NG1A 2O0HA 2WJVA 4IOKA 5FPTA 4E07A 4DDVA 4HAVA 2BOVA 3S1AB 4GZLA 1WB9A 1VTKA 4TYPA 4NHOA 1P2VA 1NVVR 1G20E 4TLAA 1XCMA 2DCUA 1KI9A 2GESA 3ICEA 4EPWA 4W5WA 3ZD6A 1E2MA 3DZDA 4YMVA 3UANA 4JBYA 5H70A 3OAAA 4Q48A 1FQJA 3GJ5A 3BIFA 2ZRNA 2KJQA 4C4PA 2JCSA 2EFCB 1FFHA 1X86B 1ZM4A 3B78A 3NKVA 4IDQA 4V03A 2ZI3A 1LVGA 2C99A 2VA8A 2GAOA 1AIPA 3CF0A 3B82A 3ADKA 1E79D 4R9UC 2WIAA 1E1RD 2AD1A 2YYZA 2RGEA 5J4KA 1EFTA 4RD0A 4TSFD 3AUYA 4JSYA 4V02A 4WZBE 4YQFA 1Q3HA 3QEOA 4A8JB 2QA5A 4LBVA 2H92A 1KSHA 1BKDR 1E2HA 2ZSBA 2ZE7A 4KLNA 2XGJA 3GJ4A 1MABB 3BBPA 2D7DA 1CULC 4I99A 4TLCA 2DWOA 3U3MA 3X1DA 1EFCA 2R44A 3MAAC 4HAYA 3FYHA 1W1WA 5JWRA 1XX6A 1OIXA 2QN6A 2D62A 2BMFA 1EFHA 5KTYA 1GUAA 4RFSA 2L0XA 3T5DA 3W3ZB 1S8FA 4M9XA 3FE2A 1YRBA 4A0FA 2R8RA 2VF7A 4GP7A 1K5GA 4BFVA 4ZCIA 4KXFB 3AGQA 1YZNA 4TLDA 2DFLA 2YC2C 1TU4A 2X19A 3QVVA 3KJEA 4LWZA 3LY5A 4UXJA 5HCIA 2NQ2C 1AKYA 1YU9A 2ZJOA 4PC2A 1L8QA 2QPOA 2ZXUA 1P9NA 2VP4A 3LO5A 5FTKA 2IF2A 1X3SA 1JR6A 2DR3A 1T0JB 2XZPA 1WE2A 3KQKA 5F9HA 4ESHA 1XJQA 2GZDA 2OBNA 3CPHA 2YKGA 1FMLA 5BWMA 2K5UA 1KY3A 4NCIA 3VR5A 1RZ3A 5F98A 4HLDA 4O2RA 4R7ZA 3IQWA 4DLWA 4Q4LA 5F2EA 1W48A 5D3MB 5F3WB 1NVVQ 3GJ8A 4D26A 2FDCA 3IO3A 4UJ5A 2CK3D 3EX7C 1OB2A 2QE7A 1G5TA 2WOOA 4TMKA 1YR6A 2W83A 2PX0A 3OESA 1N5IA 4MRSA 3AVYA 4NYJR 5AUPB 1CS4C 3ZIAA 1R0XA 2W6IA 3EZ6A 1S9DA 3IIJA 3K0CA 1E2JA 2G6BA 2B6HA 1OE0A 2GJSA 2ZR9A 3B9PA 1DEKA 4XSGA 3ADCA 1L7VC 2AKAB 4FCTA 2O5VA 3GJ7A 1G6OA 3NC1C 3QKRB 1IN6A 1N5LA 1T4GA 2FN4A 2IWRA 1HT1E 5SZKB 2RGCA 3GLIB 3U5ZB 2IS1A 2IXFA 1GKIA 3GMTA 5B2ZA 3CKLA 5EZ6B 5HCNA 4LPKA 4BGDA 3I8SA 3NG1A 4P31A 1UAAA 1M7HA 3VKHA 2IEZA 4BZXA 2QENA 1P2UA 2FZ4A 4IW3B 3OIWA 4LI0A 2QNRA 2KB0A 2IT1A 4V0MA 5J40A 3O8RA 2AK2A 1KI8A 1M7GA 2XZLA 3RAPR 4BRUA 4UNRA 3THXB 2VP5A 4HLUA 4K81B 2ZM5A 2JJ2D 3WBJA 5BXQC 3TBKA 2J3EA 4DJTA 2WPDA 2XJ4A 1TF2A 3QBVA 2VP6A 5E7IA 4U02A 3LVQE 1GFIA 1G4AE 4QGHA 3WYFA 5L3SB 5TB5A 3J81k 5JS8A 2V1XA 2OFOA 4OQXA 5CDFE 3BB3A 4OQLA 3LQRA 1J7KA 2IYXA 4KI0A 4QXAA 1QHYA 2CCKA 1UKEA 4M9SA 1W4AA 2ZE6A 1L4YA 4LCBA 4BZPA 2ORVA 1VCOA 1ZYUA 5DHFA 5GADl 1OFIA 3ND8A 4W9MC 2PJZA 4Q9HA 1ZCBA 3A1TA 1EK0A 1AS0A 3FFAA 4CW7A 5CB8A 1XEWY 4CEIB 1T5IA 2PZEA 3TUJC 1CF4A 4OL0A 1LY1A 2HJVA 3SR0A 1IAQA 5DI3A 3T12A 1W36B 2O8EA 3PUYA 3NEJA 3AUXA 1W2HA 2REOA 2RB4A 1OH7A 3ECCA 1CJUC 2DFTA 3CO5A 5A0FA 1NBME 1W4RA 4QJ5A 2OCYC 4HAWA 4LK2A 4Q5IA 1MV5A 4BLSA 1NIJA 1BMFA 2KE5A 4RCYA 2ZR7A 4NYJQ 4H9GA 4C0KA 5GVSA 3B6EA 5JECA 2EFHB 2YWFA 1E32A 3B2EA 2Q3HA 3QBTA 2G0TA 3KTAB 2YOFA 4K8OA 3R9IA 2ZU0C 2RGNC 1VYUA 3VHXA 4GBMA 2VHJA 2WM9B 1T3LA 3DEFA 4KCGA 3QQ5A 3TW8B 4GOKA 2G1JA 1G17A 3U60B 1OV4A 1ZUNB 1XPOA 4FMDB 4Q02A 4TYYA 2YWHA 3QKSA 5JRJA 3KKNA 2CCGA 2UVQA 5JSZB 3X1WA 2HXYA 3KB1A 3MLEA 4TYWA 4OI1A 2ZREA 2O52A 3Q8XB 4XWAA 4CVNA 4CGZA 1W44A 3GLHE 2IYTA 4C0BA 5DSZA 4EFLA 3WXMA 3U3JA 1NLZA 4DLZA 3RRNA 3IBGA 4GMDA 1KNQA 4A15A 1R5BA 2Z4RA 1XJCA 4UNNA 4C0LA 2J7PD 2CHQA 1KK2A 2BKEA 4R2IA 1O3YA 3SU8A 1TF7A 3Q85A 2FWRA 1T8TA 2CVHA 4GP6A 2PL3A 1OXTA 1NKTA 3K0FA 3SC3A 1OW3B 2ATVA 4DEYA 2O8CB 2W6ID 2WWFA 3C8UA 3QE0A 1N5JA 1U0JA 4G1UC 2OESA 4YXWA 5B64A 1GL6A 1VIAA 2XTNA 4OK6A 3MJRA 4B2IA 4ZDJA 2REXB 2VRWA 3KFXA 3KDSE 1DVRA 1G18A 1ZCAA 2GWHA 2I3BA 2JDIA 2GEUA 1II0A 1TUIA 4WOPA 2WBLC 3NVAA 4F93B 1NRJB 2WTUA 4CEJB 3AKEA 3TNFA 1M8PA 2MMCA 1VG0B 4AKHA 4B3DA 1FTNA 1ZC4A 3VKWA 4DWJA 3GCGA 3A4MA 3RS4A 1U8AA 2KWIA 2MSCB 1LF0A 4IFBA 3KQLA 2B21A 4DXAA 2OAP1 3LH5A 4JLMA 2CVFA 4DLVA 1JR3D 3HJNA 3TUIC 3AVOA 5H8WA 3IHWA 5EUMA 2AXPA 4ARZA 1Q21A 2CDNA 3LXXA 1IY0A 4FINA 5E7JA 1GP2A 1Z6AA 2WPDD 4QGGA 1PJRA 3R20A 1P9WA 3NHBA 3DKVA 4PXAA 3NTUA 1RYFA 3ND9A 1K8RA 1N6RA 5G40A 3ASYA 2FA9A 1OFUX 1YZQA 4KBFA 5FOSA 4B44A 3AF3A 4TL8A 1PLLA 4PHTA 3IO5A 1YR7A 5CM9C 2JLVA 2FE4A 1GWNA 1LV7A 1VHLA 3MD0A 1QHHB 2F1JA 4LV6A 1Z8FA 1UEIA 4NMMA 4B6EA 1IHUA 4MYCA 4Z8YA 3A4NA 2R6FA 1XP8A 4IRUB 2IYZA 1XTKA 2EFGA 3K0AB 2GCOB 2GCNA 1E2FA 5AJYA 4MRPA 4D0NA 4BFSA 4GSYA 2PX3A 3WMEA 1ZINA 2R6GA 4Q18A 4WVFA 1UDXA 1ZIPA 1S0UA 4V0KA 4DLSA 4DT1B 3L2OB 3TAUA 2QM8A 2CMKA 1ESNA 3X1YA 1E99A 1IM2A 2FSFA 3H86A 1VKJA 1JR3E 3F5FA 4LJYA 4Q4JA 5GJCA 2H7VA 4IFEA 4AY2A 1AQYA 1II8A 4B71A 4EQ6B 1UKZA 4MITA 1BMFD 1VG8A 3KUCA 5FBWB 3WBKA 5K8LA 1A2KC 3TK1A 3OIUA 1F2TB 2A5FA 4PPFA 1IJEA 4QHSA 3QXXA 1JALA 3EZ9A 1LS1A 2RGNA 1VG1A 2WSSA 2QMHA 1V5WA 5FTMA 3LX8A 1LTQA 1N6IA 4Z1MA 1EG7A 2CNWD 2OV2A 5TARA 1ZP6A 2WICA 1RW4A 5TY0A 3TMKA 1KJWA 2CXXA 3TSWA 1WA5A 1Z47A 2BJVA 1NMZA 2AN9A 1CJMA 3ZYCA 1N6LA 4OJQA 1FOEB 1N6OA 1QG4A 1QDEA 2HCJB 3THWA 1KMHB 2IL1A 2P3SA 4DLTA 1XTRA 2FU5C 1N6NA 4Q1EA 1R7RA 3QXSA 1OF1A 4F91B 1UDWA 3NC0C 4Q4HA 3MFYA 5CYOA 4PAOA 2ZIAA 2IYUA 2YNMA 3AEZA 1CRQA 1ZAKA 4BFTA 1J99A 2IYLD 5D3QA 4MQBA 2QTVB 1KI4A 3DOFA 4NKRA 721PA 4QBHA 4WXRA 3EA0A 1Y63A 3H2YA 4EPTA 4B32A 2QSZA 2Q3MA 2JASA 1SXJE 4YC7A 3GEIA 4DSNA 3AVTA 3M4YA 2WJIA 1WBBA 1GL7A 4WZ6A 4L4UA 1ZC3A 1HY3A 2H1LA 2GJKA 3C4JA 4MGIR 5EJEA 4FMCF 2QBYA 1EWQA 4ASUA 4ZIRA 1J8YF 4N0DA 1Q1EA 2W00A 3TLXA 4OHWA 2BEJA 1JXMA 2JDID 3FFBA 1NP6A 4JBXA 4C7OB 1COWA 1W0KA 4GDFA 2JIZA 1W47A 3D6TB 2C9YA 2QRNA 1OYYA 3WP1B 3CR8A 2RGBA 2V6IA 2PZFA 4BFXA 1I4LD 2IC5A 3C41J 1H8EA 2WKPA 2P5TB 3OEHA 3QNUA 1CKEA 4NBSA 3PEYA 2VEDA 4XD7A 3VX4A 2P6RA 2PLFA 4UNQA 1XEWX 1KO4A 3L8YA 4ZIRB 2ZRFA 3CLVA 3SJAA 1XCPA 2B7BA 3TUZC 2GEVA 2CL6X 4P0TA 3CPJB 3MSXA 5FPSA 4HAXA 2ZRIA 2A30A 1T9HA 4WZAE 5DN6D 2FG5A 3EZFA 1MH1A 3QPUA 3BWDD 1XZQA 3DMDA 2AFHE 3FMOB 4KYUA 5AUNB 2CLDX 1VMAA 2NZ8A 4IOLA 2V1UA 3T61A 3GEHA 2JLQA 3OE7A 4IKEA 4FMDF 1KO1A 2DHRA 1YQTA 2XOKD 3SZRA 2ZJ2A 2J0SA 4D81A 2PBRA 1ELOA 4W5HA 3LLUA 2GK7A 1E0JA 3AF4A 1KKMA 1DS6A 1G8YA 2DFNA 3L0IB 5HE8A 1N6KA 1ZM9A 1ZU5A 3MWYW 1KTVA 4JKIA 4JL5A 1ZJ6A 2OEPA 4QBFA 4Q9LA 4LHXA 4MRNA 5LDDC 4B75A 1CRPA 2C5LA 3VX3A 1KI7A 4CRWB 5BW8A 2ODBA 4NYMQ 2C03A 1R0ZA 4B2PA 2HT6A 1ZUIA 1SVWA 2RCNA 3UKDA 2HLDA 1VECA 3NWJA 4PO1A 5DHAA 2ZSAA 2BCGY 2QMEA 3P20A 3AP3A 1DG3A 1FP7A 3OFND 1NVXQ 3RABA 1WP9A 4YONB 4YDSA 3CW2A 3B1YA 4MGKR 2GXSA 4BFZA 5DYGA 4NCNA 1JJ7A 1P72A 2QAGC 1H8HA 3O8BA 1P61B 1JAIA 4TTQA 1GNRA 4E22A 1ZD1A 2WVJA 4Z1MD 4FXPA 1XTIA 3O8CA 3L0PA 3PVSA 2F43B 3UXMA 3OIYA 3BJIC 2FNAA 3RRZA 1AZTA 2IF0A 4Q4AA 2NO6A 1TAGA 1D2NA 2GBLA 1J90A 3F8TA 4G5RA 4Q9IA 3DDCA 3THOA 4PQRA 3EPHA 4LBYA 3GJ3A 4LJ4A 2OUKA 2FZLA 4XSHA 3ZVMA 5L3VA 2GXUA 2OM2A 2AKYA 2PLRA 3MMPA 5JJIA 1E9BA 1E0KA 2BDTA 3L0SA 4WIAA 2WKRA 1UKVY 3BGWA 5LPNA 4XVUA 5CJPA 1IJFA 2VPPA 4YMUA 4OHVA 2BMDA 1G4UR 5GJVC 4MYUA 4EPVA 3F0TA 2VP0A 3B85A 3KQNA 3B1XA 4PSKA 5P21A 3SHFA 1NLFA 4Q7MB 4DIEA 2QP3A 4RD3A 3ZQ6A 3F3YA 3B1WA 3CH4B 4PHHA 1A4RA 2IXGA 4X8OA 4C0JA 2IUTA 3BOSA 3LLMA 4HUQA 2GNOA 3THYA 4KBGA 1Q57A 5FUYA 4D4JA 3AVXA 3LW8A 5IK2A 2H18A 3T1OA 4D4MA 2FFQA 1DPFA 3WY9A 4B34A 1KSFX 1E2NA 5C46F 4EIWA 3SJCA 1A82A 1OSNA 1COWD 1W0KD 2YJTD 1OXVA 3SBDA 2A3RA 2JIZD 5KOYA 3GLFA 2ERYA 4CYMA 4D0LB 5DI3B 3U7HB 1MT0A 5BN5A 2O8EB 2BBOA 3AF1A 3WYGA 4LPSA 4QGFA 1E6CA 2OAQ1 2EFEB 2QSYA 2QRZA 3OEHD 4JS0A 2JEOA 4P3YA 4XD7D 5B57C 5AR1A 1DBSA 2VHTA 2NO1A 5L3RA 3UWOA 4U7DA 1US8A 3EASA 1KOFA 2D2FA 3NBYC 3QF4A 3LV8A 3FOZA 2RKOA 2XNSA 1P4SA 1DAEA 1NN3A 2ZI5A 1GITA 4PX9A 2I1QA 3K70C 3WP0A 4TYNA 2FPMA 3K8YA 1MO5A 4LDJA 3QSYA 5KUTA 2X77A 2KI5A 3P1JA 3QPWA 2GZAA 5TMPA 2QZ4A 3SFVA 2VSFA 5SZIA 4LJAA 3RC8A 4XOIA 1GL9B 4NTZA 1FPMA 2FFBA 1L4UA 2ZI6A 3P26A 4TQAA 4EAQA 4TLEA 3SQWA 1KAGA 2ZS8A 5JWHA 3GLGE 2BBTA 1U94A 1Y3AA 121PA 2R9VA 4HB2A 2A2ZA 4JLKA 1UBEA 1GZSA 4L16A 1RRPA 4OJKA 5G41A 2RHDA 4EJSA 2N46A 3G82C 2NGRA 3HPQA 3CRMA 2Q9BA 2IUSA 4B73A 3RVBA 1N3BA 3NH6A 2UZIR 2WWYA 2HLDD 4JVMA 1HQYE 4S2EA 3SYNA 1IXRC 5KDDA 1AK2A 1GM5A 2NOAA 2F9LA 1DAGA 1UM8A 3H4MA 4LUCA 2ZETA 5BN4A 2ZE5A 1H8HD 2ASEA 3U7EB 4B43A 2VQSA 2X2EA 2OHFA 1Q0UA 4DB2A 2IYQA 1ONBA 3U4QA 1KZ7B 1OIVA 1M1YE 3LNCA 3R9WA 3I5XA 3W6OA 2IYWA 4GT1A 1DOAA 3RLFA 5J4VA 2FJUA 1KDOA 1G8GA 2OCBA 3HU3A 5CK4A 3G5UA 2ZUDA 4DRZA 1Z22A 3E5HA 4HZIA 4HSEA 5FOTA 2V8OA 2ZVQX 3CRRA 2YV5A 2GVZC 4LY6A 5J4HA 2HYDA 5CJ2A 4RZ2A 5C4MA 1R5OA 2R6DA 3W6NA 4DIDA 1WQ1R 1XMSA 1TQDA 2ZJYA 2VTKA 2B8TA 2AWOA 4JLOA 2P0EA 3L8ZA 4JT4A 4M4SA 4B3BA 1U81A 2YVUA 3AM1A 2C9OA 4Q47A 4HB3A 1RFLA 1XZPA 2EQBA 2C77A 3B7GA 4BQSA 1PVOA 3MUFA 1FP6A 3FWYA 4D82A 3UWKA 1PV4A 4RJLA 1TU3A 1FQKA 1IOZA 3FVQA 3UPUA 3MCAA 4IXMA 4EKDA 1P2TA 5EP2A 2R65A 5FBLB 2CJWA 2W2XA 2AXNA 3KB2A 5KSYA 4M1WA 1SXJC 1VHTA 4G5GA 4QG7A 3IILA 1R10A 3ZD7A 2ZSDA 1OB5A 3PUVA 1VCIA 1U2RA 5IK2D 5IDVA 3ICQB 3ZLJA 4LSGA 2ONJA 2O0JA 4M22A 4TMWA 3GPLA 4A2QA 1WBDA 1Z3IX 3AVVA 1QVRA 5EQTA 4DSTA 2ZSFA 5BN3A 4LC0A 4XVRA 4AG6A 3C15C 1HEIA 4Q4JB 4A92A 3K9GA 2FPKA 3FMPB 2ONKA 4I1SA 3PJRA 4KAXA 2XNDA 2OZEA 3IIKA 1II8B 3SNHA 5EUQB 3IHLA 1BYUA 1M74A 2QGZA 2AL7A 2ZI9A 4LHYA 4JVNA 1NVWQ 4WBSA 2HUPA 2VH5R 3E2IA 5LD2B 1Z6TA 3VR3A 5EXPA 5CITA 3K9LA 2EW1A 4P4TA 2OSBA 2Q6TA 4YMSA 1XXHE 1JAHA 1F5NA 4ZCMA 4PPQA 4C0SA 1MO6A 4NPHA 1RC8A 1X6VA 3MG9A 4AWXA 3B5JA 2FGKA 4QHTA 4LYFA 3AQ4A 2W0MA 4MDEA 4EPYA 4OI4A 1R2QA 3THWB 1GG2A 2WJYA 2ZR0A 2ZI7A 2GXAA 1FX0A 2ZYVX 2O8BA 5FBVB 1XD2A 3ZS9A 4HUTA 2Q0HA 5JHHB 4DEXA 1ZD9A 1VPLA 1E2EA 3EXAA 4Q4HB 3GQBA 1YZLA 2QY9A 2AX4A 3SQXA 3V4FA 3SOPA 1SVMA 3BXZA 2IS6A 4LJ9A 2BKUA 2Q9AA 3LRPA 3X1ZA 2HDNB 1T5LA 2XSZA 3CR7A 4A8JC 1GILA 4FCVA 4PHGA 4ZDIA 3FHCB 1Q1BA 3WHKA 2O8DB 3EA5A 3OAAD 4TT3A 3KFVA 5E3HA 2DWQA 3I73A 1LS6A 2JLYA 1Q3TA 1GTVA 2QUZA 4IVQA 4M1OA 4FMCB 4PQFA 3UIEA 4PR0A 2H16A 5FI0B 4HAZA
chains in the Genus database with same CATH superfamily
3MJHA 1O0SA 3MJVA 2CNBA 4XIIA 5KSPA 5LB2A 3G8YA 5A04A 2CXTA 3KTOA 1AS2A 1JPJA 4ZEXA 3BD9A 3W77A 3M1IA 5KNDA 2DFKB 2P1ZA 1ZU4A 1P7PA 1CB0A 2C9CA 5IM4A 3VU9A 1T9CA 2B7CA 4DIKA 3LHSA 3TB4A 1VRVA 4BU1A 1DJNA 1Z73A 4EDHA 4RF5A 3S7ZA 5KKCA 4AECA 3SFZA 1LNZA 3FLMA 4OQ4A 2HA0A 1IQ0A 1K86A 1KDPA 1PJSA 1T3HA 1Q20A 2P2NA 2RI1A 2AR9A 2X22A 3RYTC 2VXCA 5HMLA 1Z4NA 1SOMA 5IJXA 5JH7F 4M1SA 4HLQB 3U44A 5EIHA 3HYLA 4ZRNA 1VJ5A 2ANCA 4NDAA 5CK5A 3WK6A 5K0SA 9MHTA 3ZDQA 1GARA 4NCJA 4Z3KA 3G23A 1U9IC 1JJFA 1V8DA 1CUGA 4Q9JA 4LFBB 3WICA 1NVTA 3A06A 3U61B 5L3QA 4LYHA 4QEZA 1D5CA 1M2VA 1PBTA 3MGKA 5CDHA 3RARA 5CYGA 4MWEA 2VHVA 3D59A 3I6IA 3K9NA 3I42A 1VCNA 4PLCA 2EYUA 5FLYA 4M86A 3SYMA 3DLCA 3ER9A 1YCDA 2P30A 2PVCA 3RS3A 2NSDA 3R8CA 4MH0R 1SA0B 4PXYA 3FVWA 4ZHQB 4OLHA 2RH5A 1B76A 4JBIA 4X9XA 2GN4A 1RJ9A 1U3CA 3HB5X 3KT0A 3PFFA 4P7BA 1Z34A 1RQPA 1NM5C 3OZAA 3KEMA 4L4SA 4OEHA 4IJMA 3HV0A 1RZRD 2A59A 3BRWA 4EW6A 3GNQA 2PL5A 1BHQ1 3WNBA 4DHWA 3ASUA 1YGYA 1TC1A 1X7WB 3C3CA 3AJDA 2DLNA 4UHDA 1Z7BA 1DBWA 4J7UA 4P7KA 2Q3EA 1LEHA 1N3LA 3CN7A 3UJPA 4W8HA 1ZD2P 2PKQP 2XNDD 1Y3BE 2ZCUA 2NTEA 2RGWA 1PQYA 1BOOA 2GJ8A 2YWEA 5DM1A 5TQ0B 5K8VA 1DIBA 1QIIA 2ZT5A 5CDUA 3FB1A 3BCRA 4MEJA 2JD0A 3LUBA 1G5FA 4PG8A 1Z35A 3KRTA 2LIVA 3MA0A 5FPPA 1W8IA 2CWDA 1T2AA 3NIBA 5LLDA 4PBSA 2JFQA 2P2ZA 1EUZA 1SN7A 3OTWA 5DOVA 4GKVA 4AC9A 3UFXA 1G5RA 3N8KA 4IIJB 3WBFA 4COKA 1M5RA 5LP6C 1H93A 2C2HA 2C2WA 1GG9A 2ZJ1A 1BQEA 1ZSVA 3QIAA 1K7SN 1KI3A 4GZ6A 1RMTA 4ACBA 1EK6A 1MQAA 3NYWA 5CB6A 3L01A 3BS4A 4NBNA 5DASA 2E21A 2VOEA 2PH3A 4HGQA 3M6VA 1I51A 1P0FA 2QYHA 2YHIA 2HT1A 5JARA 1KFJB 1L8XA 2R87A 1GFWA 3K7EA 3PDCA 1P2DA 3AOEA 2BIFA 3B3FA 4GOXA 1KOLA 3WK8A 1VSBA 2QG9A 5EKUA 2F6RA 2VQ3A 4Q7LA 5DTQA 4L02A 1L5KA 1DCKA 3SC4A 4I1PA 1ZMXA 2C0CA 1FLAA 3T4UA 3KQWA 4P0QB 3VSBA 1SUAA 3JWIA 1W46A 1P18A 2XUPA 2EBUA 3K5IA 4G8BA 2HCTA 2GKSA 3Q8KA 4ZRDA 2MYTA 4Q24A 2Y67A 3C16C 4TV9F 2BZGA 2WE8A 4B3IA 4KE9A 5CYPA 2OOKA 3I04M 5DBFA 1T29A 3LQ1A 5LZ7A 2YCLA 4D0RA 3B2QA 2G9UA 4BMVA 2H65A 4C4XA 4S3MA 4TT3D 3WWYA 1FRVA 1HTWA 3IA2A 1YRWA 2DB3A 1GR0A 4QFDA 5E8JA 4RLQA 1F60A 1YZYA 3BXFA 1CR2A 3C4QA 3NDRA 3KKZA 5B6PA 2OC4A 1QGUB 3K09C 1SHJA 5DFAA 5TR9A 1VRCA 4XUEA 3R7AA 2FXIA 1XDWA 4DLRA 1MAWA 5EKDA 2H2HA 3ROPA 4F96A 1CUAA 2ZJBA 1W49A 3GEBA 4M76B 4TKMA 1WO8A 2D59A 1O6BA 1O94A 2HPHA 5GGYA 2QEQA 3GUVA 4AN4A 3VNVA 3S2GA 2D74A 1G64A 1EP2B 1SBHA 3UXHA 2XRZA 1JQKA 2W0SA 3EVCA 5JZSA 1EK5A 1NW7A 2Z9CA 2X2PA 4V0ME 4Y1RA 4LX0A 3HABA 1EA7A 1Q22A 2BDEA 3L6OO 4CCSA 3D8BA 3P7MA 4YWJA 1L5HB 3P4XA 3RSHA 4D3XA 2JK0A 2CNOA 4GOLD 4RTNA 2GKOA 1BDBA 1U2GA 5FPQA 3I9JA 2AN1A 2QTLA 4S1NA 3TIVA 1X9GA 4NP6A 4CEHB 5GJWC 1XT6A 3E61A 4C05A 1BW9A 2F3TA 3IVAA 3L41A 3GRAA 4HATA 3EAQA 4IQFA 3UFBA 2PG3A 3B36A 4CGYA 1JU4A 1M1NA 4MRRA 1LZLA 1V96A 2GERA 1OTHA 2ARKA 1LI7A 3CZPA 3KWJA 3ODGA 4BBPA 2GR9A 3KCQA 2HMYB 1JFFB 3HVJA 4Y9SA 2FCRA 1UL1X 4C7XA 2O8FA 2BEUB 4F4IA 4JX8A 3I6QA 4TMYA 2B94A 1ZRHA 3WYBA 5EE9A 2R2GA 2Q3JA 2XE8A 5K6AC 3E15A 4FE4A 4DV2B 1T10A 3FOWA 4OQMA 1JFTA 3R75A 1YB5A 4LZAA 5LOVF 2OLKA 4H1TA 2ZZNA 2ZK7A 2ZRDA 4S35A 1XWFA 2HCFA 2EDCA 2ZI4A 3HJRA 3L7AA 4PG7A 2EWVA 5AW9A 4AG5A 4DUZB 1BQ3A 1YHZA 4FYPA 1YKSA 3GLIA 5F5NA 1GZ7A 1YBHA 3DZHA 1HYEA 4NCKA 4NYMR 5CPFA 1IG3A 2PANA 1SU6A 1YQQA 2X3FA 5CDGA 4V0NA 1O57A 2IE0A 4G09A 3FKSA 4BFUA 1T4BA 3KKOA 4OXQA 2GD1O 1DELA 3NATA 3CISA 3DCIA 4RKEA 3WLFA 4A6EA 4Y18A 4RY9A 4DTIA 5JOQA 1SURA 3KBOA 4LXTA 2PKEA 4KR9A 4DR5B 2D1FA 1JLRA 3G7UA 2CDBA 4PSCA 1WCV1 3ZXIA 1DPGA 2RIPA 4WAUA 4EB0A 2ES4A 2FFJA 3VR4A 2HJWA 2EKLA 2W4IA 2JB9A 2JKZA 3HCDA 1NX9A 2JFUA 1P3JA 2WHPB 1WCXA 1Z17A 4B35A 3FOBA 3BKWA 5DP1A 1S3SA 4E30A 3JQGB 1QVWA 3AF0A 1FJGB 3OPNA 2RBKA 4CQMD 3TVDA 1RP7A 4RCZA 1V8FA 5T3UA 4ZN6A 3QJ5A 5FHQA 1G7TA 3EC1A 2O3RA 1G16A 3KKPA 4LNUA 4YRLA 2D5LA 3WQBA 3U4QB 3FD8A 4A7PA 1HORA 2BHNA 2D13A 3AZQA 4GHWA 4R3NA 5EHQA 1CUYA 1W5SA 2Q5FA 4XD2A 3DGEC 1KSGA 1OLUB 4N7JA 4Q3NA 4GW3A 2GSWA 2PKYX 2FV8A 3S3TA 1DBPA 1YB6A 4EW1A 3CXRA 2IV2X 4BNUA 4AS3A 2CC2A 1LPNA 3BWMA 3I72A 5J4YA 3H2SA 2AG8A 4H7PA 4AMGA 1ZCFA 1ZZGA 2ZUBA 1BO6A 2GILA 1U2PA 1FDVA 4UAJA 4HRXA 4UJ3A 1W5TA 3VDXA 2JA1A 2Y27A 3WL6A 3PNMA 4UQLA 2IHNA 3VJKA 1KJIA 1V71A 4ZZ3A 2BI4A 3DL0A 3NIFB 3LFTA 3BTUA 3LWZA 3HVUA 3B20A 4G4IA 1HE8B 2Z3WA 2L42A 2SHKA 3N8NA 2IV7A 4YV1A 4Z54A 3QFHA 4JDPA 3K53A 1BDIA 3GLQA 1O95A 1E94E 1P77A 3FBGA 1Z13A 3FDFA 2E3JA 3FX2A 4D80A 2NW6A 3MNFA 3ZK9A 2WUGA 1C9JA 3KAQA 1Z6XA 4YACA 5CVJA 2X8WA 1W7AA 1M6EX 2A5DA 1YIDA 5DF1A 4JQSA 3U4GA 2JCYA 3CX7A 2V7VA 5ICSA 1G38A 3ZWDA 1IATA 2OBLA 5IXJA 1XQ6A 2NO9A 3SYRA 3T7JA 1KVTA 1AS3A 1E7QA 1EXMA 4MUAA 1UOOA 2P7HA 1LBEA 1OFGA 1OXMA 3ETJA 3HCBA 4PEVA 1ZM2A 1D4FA 2YJ5A 1U3WA 1YB4A 2PQ2A 3RSOA 3EPKA 3ETNA 4HRVA 3QPBA 1U1IA 3BWBA 5B1SA 4TVSA 3SS7X 1XRPA 3NORA 3JYLA 1FZQA 3RDPA 1FA9A 4UAVA 3U2QA 2QX8A 1E66A 1G5PA 4CQJA 4Z4EA 1OFHA 4BO1A 1TT5A 3RO7A 4LJRA 2X0NA 4EF4A 1MX1A 3MTJA 3QA9A 4IEEA 2RGYA 3MRSA 4MB6A 4W8GA 2ODNA 3HU5A 3OJEA 2WYUA 1F51E 4N9QA 2A9KA 3JQ9A 3LT4A 1L4LA 1ORHA 1XZNA 2XOXA 3PRKE 3CNNA 4GKBA 5J4LA 1M6WA 2H06A 4V3BA 3MIIA 4A03A 3LC0A 1QORA 2R8OA 5K0GA 1VL0A 1O6FA 3NASA 4JI6B 1XTJA 3WGJA 3OMLA 1I7PA 4AB1A 3UK6A 4IJKA 1SKMA 2AEEA 3X43A 3QA3E 4V39A 3FNGA 4LCJA 4MA5A 4K9KA 1XRSB 3RFTA 1UPXA 3W06A 2OZLB 3EVEA 4X7PA 2WK1A 4RZSA 4M3NA 1X14A 1Y9AA 3HDJA 1U5AA 1Z5ZA 2WTMA 3A1VA 3DKIA 4CE6A 2B78A 2DP4E 5CIWA 4OK3A 3DBLB 1EFAA 2EKBA 2LCIA 3CZ4A 3IEIA 3OWOA 1P4AA 3WB0A 4MVWA 3WWZA 3I30X 4URVR 1KKUA 3M6LA 4MAFA 3ANNA 2WMOB 3PEFA 1HDZA 5CMLA 1BX1A 5L7YA 4C7JA 2X5KO 3JQCA 4D9IA 3QY0A 2VDOB 2HR1A 2EERA 4DRXA 4LOIA 5EE5B 3CLUC 1XD9A 5LBUA 4DLPA 4M37A 1EFLA 1NYLA 2FPSA 3ESAA 1VL2A 3HJAA 5LMZA 7MHTA 1MRZA 4ESVA 4OX9Y 1T2DA 2PMWB 1DOZA 2QTFA 3ER6A 3J7TA 5EQDA 4UBMA 2O5EA 4S0ZA 1SHUX 4N47A 3ZZ0A 5KTSA 1QF9A 3N59A 3SJZA 3ZY4A 2DERA 1ISRA 3EVBA 2FPGA 1OTYA 2AOTA 1ENOA 2NAFA 7ADHA 2XMCA 1CDOA 1SIUA 2VUUA 3ZE0B 1SZPA 4K6OA 4DDMA 5CFQA 1C1DB 2IDJA 4MWOA 1UFKA 4OMDA 4LMRA 5CNMA 4RUKA 4P84A 2Q5OA 4G0UA 4MPDA 1LJ8A 5K6TA 1IN8A 3W9BA 2LUOA 5MFPA 4FJ2A 2WD9A 1DBRA 1UBTS 5HK9A 1GDDA 1GGFA 5AOCA 1HNNA 2E9SA 4G24A 4MROA 3T5MA 4TUYB 1I3MA 3RF7A 3U81A 4BB9A 2P9TA 3LBIA 4GRDA 2X9GA 3P2OA 4RXMA 4HH1A 3MUEA 1VLMA 3UJCA 1M2WA 1PEKE 3NX4A 3KZCA 1JKXA 1NJSA 3MC1A 3BQMB 1MT3A 4KMMA 4Y1GA 3RGWS 4F5YA 1H8ED 2OD7A 1E5DA 1RJGA 3WNCA 2IH4A 1HT0A 1LTHR 1XVVA 4IIDA 4NNPA 1EFDN 4K3UA 5D7NA 3RS0A 3VBCA 2WHXA 2XQKA 3HKEA 2GCOA 3L79A 4J7AA 3AM5A 3CWQA 2GO7A 2XECA 4NDZA 3HBNA 2ZANA 4L9RA 3EAFA 1K68A 1PLJA 3X2EA 2C4HA 4LJ7A 3GEGA 3IV6A 2WWIA 1VCMA 2JFOA 5JSUA 1TVCA 3BD7A 2PSSA 5IFLA 2H2AA 3ZZMA 3ED1A 5ALHA 1ETUA 1BQ4A 1CU1A 3JQAB 4WPGA 5CDFA 4B8ZA 4ZOCA 1SVUA 4HDRB 4ND8A 4UC0A 1KYTA 2C4KA 2J3HA 2R1TA 3FWNA 3PNYA 3QKSB 1KDZA 1VI6A 3RHFA 3UJ7A 5AESA 2NU9A 3DW3X 1E1QD 3OX3A 5DIFA 1Z8DA 1ECJA 3LSYA 1QNFA 2H0AA 3KJFA 2Q62A 1IEWA 3QEAZ 4W5JA 5ECGC 1QZXA 5HM6A 2VDWB 3C3AA 1VHWA 2YMMA 1J23A 3V4LA 5J2UA 3C7TA 1SULA 1U02A 2HDWA 2ZAGA 4J0DA 3L0BA 3IR6A 4JASB 3JY6A 4CT4B 1CZLA 3FPSA 3ZWOA 3ANLA 1G3UA 1LV8A 1SXIA 4KACA 4XFJA 4D4LA 2P65A 3PF8A 2X0DA 4IV0A 5EWJA 3AEQB 1NLYA 3CYFA 2BPOA 5E6SB 4P32A 3MT9A 2B2XA 4UUNA 3D8NA 1CS0B 3T3IA 4QKQA 3M2TA 4U7HA 1X1QA 4HGZA 3S2YA 2UZ1A 3WQSB 5JMTA 2DR0A 4QA9A 3T35A 2DYKA 2UYOA 2JJ2A 4IDNA 4QIHA 3ZBQA 4HLUC 3DE6X 4HNAB 1T5BA 4ZCRA 3B1VA 1DJPA 4L0CA 2QTVA 1I1HA 4YLGA 1PS9A 2O2IA 2AVDA 4BJ5A 2ZUCA 4YO7A 2FB9A 1G3QA 1ZGGA 3E05A 2IJGX 2B36A 5AFSA 4YT5A 2JLZA 2ILVA 4Y2RA 3TZCA 1BGVA 2QRVB 4DJEC 2WV9A 2I66A 1DWQA 5DYIA 3MB8A 1NN1A 4JC5A 1HMPA 3S6JA 5CB4A 2OAGA 2B8WA 1E2KA 5A3JA 1PFKA 3T1VA 4EHJA 4BBAA 1Q16A 2P2DA 4A0QA 2BEVB 3HXMA 3BZUA 1WUYA 3ND6A 3QBEA 3QF7A 4ARZB 1KU6A 5AWFC 3CX6A 3I2JA 5FNVA 4FZVA 3OX4A 4ZAXA 4URYR 3SEQA 3QWFA 3UT0A 1LWOA 3ENZA 3WO0A 1DFHA 2OUIA 2CLFB 4FN5A 4Y2VA 1PR0A 4CUKA 4G25A 2ZBUA 4C7OA 3FROA 4LFCB 1SBZA 2NNLD 2GTPA 1JR2A 2ZKIA 4Q93A 4R4JA 1NVFA 4TZ6A 2GRJA 2GO1A 1Z0DA 1WV0A 3AM4A 2G5PA 5DGXA 1NXVA 1AURA 4MMZB 3BX1A 4HB4A 1H0SA 1G63A 3SX4A 3DVSX 4WFKA 1TQ6A 3HJUA 2C7QA 2GT1A 3ZXXA 1L6RA 2Q3FA 1P8AA 4R68A 4C5AA 2ZJAA 3K1AB 4JBLA 2I55A 3L0ZA 2WHQA 3IPCA 1EX7A 5FUVA 1K4MA 3AESB 3D6NB 2UVDA 4QPCA 1HYGA 1Z2DA 5DCYA 4C6SA 2XXAA 1NONA 4BLQA 2LKCA 2BR3A 1UMBA 3BE8A 3GGSA 4NE2A 3C7AA 4F2WA 4ENRA 3FDIA 3PXCX 2Z6UA 3A8TA 3HKCA 4G1MB 1KVRA 4CMIB 2D1YA 3WIBA 3BT7A 2DLCX 2A0YA 5TEVA 1C8BA 3P8ZA 4MUBA 3BBLA 4QTXA 4WX2B 2HNAA 2QT9A 3O0TA 4JVOA 3DCJA 1DO2A 3PQDA 5TXGA 1RRCA 3OOEA 3Q4GA 1EMDA 2VQEB 1TW2A 2GCIA 3PPYA 3DFUA 5ALIA 4ANFA 2D00A 4RHEA 8AT1A 2XADA 5SY6A 3ISJA 2IXDA 4DEVA 3H5LA 1QHFA 2PT7A 2ZSKA 3PX7A 2CV1A 1P91A 3RUAA 1WEKA 5IKEA 2V8BA 1XN1A 1XL0A 3H2ZA 1NUSA 5IH7A 3PUXA 1FNBA 2D2EA 3V2IA 4QUDA 3KJXA 4IFTA 2FFAA 1SWWA 3FTQA 2J7PA 2XE4A 4QOSA 5A06A 5FWAA 4YAUA 2EL9A 5JANA 2IH5A 3KB8A 2VK8A 3KXPA 3Q5EA 1PT8A 4BQEA 1LZKA 2AG5A 4J29A 2AE2A 3B48A 4G8DA 2Z5FA 3GZTB 2PEZA 3G7SA 1Y7HA 3NBZC 2XQFA 2AN3A 1CR0A 5EIOA 3EPLA 4ETIA 4GUAA 3A2KA 2XGMA 421PA 3AVWA 4YAJA 1KZ4A 4LECA 4U8GA 4YJGB 4DNXA 1RAAA 4RY2A 2YN2A 2AEJA 3ORQA 3IAM1 5EXEA 1CW2B 2BBSA 1KO7A 3PEUA 4M0MA 4WSOA 2GLTA 3GP5A 3SDSA 4AWBA 1CLUA 3L8FA 4XUGB 3N5CA 1GZ3A 3GLFE 3UHFA 3J7AC 2EG5A 2I1LA 3QKTA 1XA0A 1U31A 3HR7A 4Q21A 3ZDZB 4ETNA 3HWRA 4M1KA 4JGIA 4DUGA 5LA6A 4HQ0A 1CDZA 3RTAA 3SF0A 5A9RA 4GF5A 2P79A 1V7ZA 1F4PA 3CF2A 3ZDBA 1SCAA 4P53A 3NIGB 4JU9A 1NBMD 4F5DA 4MUFA 4TRNA 4ZEMA 4O2AA 1CNFA 2Q2NA 3NHKA 5INTA 3H6HA 1FY2A 2UU9B 2CN1A 2C3MA 4R98A 3BQ9A 1FLVA 1KK3A 1JLLA 4RA9A 4FD2A 2PYIA 2AWNA 4C9BA 3IDQA 5E9AA 3M0EA 4Q00A 1GCGA 1JR4A 1ZN8A 3RKRA 3SN6A 4ZJYA 3PHCA 5KJ6A 1MB9A 1WKCA 3FHJA 4RXUA 1P1FA 2AYZA 2REQA 2BYTA 1EX9A 4CHTA 3D3WB 5ALTA 5C1BA 1YA6A 2JIOA 1CUJA 1EQ2A 1N2CE 2EV9A 2IUFA 2IXTA 1XYYA 2AVNA 2QMUA 2W98A 3BXPA 3CVUA 3QUBA 4IOMA 2VT7A 1U4OA 4WKNA 5TPWA 2C7OA 3N1UA 4BO5A 3WYCA 4TL9A 3VVBA 5EQJB 2GNPA 1ZHFA 2B2NA 3TPCA 1KS2A 3KQHA 3CUEF 1FP1D 3NTOA 2PCJA 4TMZA 1VLHA 3DTTA 4UQOA 4DVJA 2POCA 2ID4A 3DMFA 4C4YA 3K31A 4DB4A 1AV7A 1Z5PA 4LC1A 5AJZA 1YRLA 4HN4B 4DLLA 1ZQ9A 2A84A 3SI7A 3WZMA 2UXCB 4ZVVA 3FCUB 4PQGA 2UYCA 1X39A 2HNKA 3LHFA 1ZISA 3HZHA 3UKOA 4J43A 1TUEA 1UBSB 2YWGA 3ML1A 4QEKA 1ZNYA 4UBLA 1XTPA 2XQVA 3DXFA 2PQ6A 2WSIA 3IT2A 3Q12A 2RGAA 1KGSA 2ALJA 4KYIB 4OP1A 1GQQA 1OLSA 4IIUA 5D00A 1E3WA 1KU0A 4KEAA 3D7MA 4IWNA 4II2A 4Y2TA 1NBAA 1JDVA 2DX7A 4AZTA 1EDBA 1ORWA 5L3SA 4EJMA 3RRJA 5CFPA 1GNPA 4DCSA 2MYNA 3TRFA 4FBLA 4ISCA 3A6GA 4HO1X 1EU1A 2ZWMA 5HBGA 4IDFA 3H5NA 1CBUA 3A4IA 3G5TA 4EKIA 3UTCA 3JATA 4G9GA 4JUFA 5BV1A 3CIOA 1ZEMA 4ZCTA 4FDMA 3VKFA 2DG2A 1SU7A 2NM0A 2O50A 1GSOA 3O1IC 4J16A 4TROA 4WZBB 3D3NA 1GUZA 3PVZA 4MVJD 4TRJA 5A5DA 3T5PA 3QW4B 1Q1ZA 4RQAA 5G02A 4PONA 4R71A 1ULBA 2HN9A 1MHPA 2Z6VA 1OILA 3IALA 4LNAA 4CT0A 2G9QA 4LE0A 3PUWA 4YRRA 3SGLA 2OXRA 1DUIA 3QFTA 3SHQA 2BHLA 2P0YA 3M5CA 1PFUA 3SIWA 2X1VA 1QFMA 2MJLA 3RKUA 4C5BA 5JPIA 5C80A 3I2FA 4PYIA 3MCZA 1D2RA 1A3CA 2WDZA 2GARA 1QU2A 2JLBA 1S4MA 2YNMC 3PE6A 3K70D 4KR7A 1EFRA 2OXTA 3RVPA 1H2FA 4DLUA 1L7OA 1OH8A 2FOLA 1P2FA 4DYVA 1R5JA 5ARBA 2QX7A 3GJ6A 1XEXB 3EEBA 1OX6A 2V9ZA 2Z8YA 3A36A 3MJSA 1N92A 5A2GA 3M6MD 4PU0A 1O5TA 3M6WA 4EJ6A 4KQMA 1DQZA 2BFDA 1G8KA 3KAJA 2VJCA 2YZMA 4JIMA 5ALEA 4XH9B 5F23A 1Z56C 2YXBA 3OECA 3OTGA 4JJKA 3SM9A 4G0WA 2GF0A 3HUEA 3OCUA 3QEKA 3TR0A 3LFUA 3LDUA 1B0PA 2K2QB 5HPYB 4U2KA 3DO8A 2Y1OA 1JI0A 3ZZUA 1WTCA 5ES4B 5AM1A 1SC6A 5DNCA 4AJHA 1X1EA 3STXA 3WB9A 4EEKA 3HM2A 2UUOA 4H7EA 1Z4MA 2EU8A 2XITA 5AJWA 2EYQA 3D81A 3UMFA 3CLRC 1O89A 4NZZA 4GXTA 2VWHA 2ZJ6A 1VMIA 3R23A 3MCVA 4JZKA 5CT6A 2JFWA 1I13A 1R0LA 5IT4A 1RKBA 4M7OA 1MGPA 2Y3IA 5BUZA 1SQGA 4G56A 4UQPA 4IICA 2V5UA 4JBWA 1J0CA 2O4CA 4I2VA 3WJAA 1UDAA 2XTJA 3BCSA 2WZCA 3D43A 2GI4A 3MLAA 4MI6A 1VIYA 5IYZF 1BJRE 3W34A 2VATA 3EOAI 1UJBA 1KPHA 1EZZA 3DXZA 3EB9A 4LOJA 1N5DA 3F73A 13PKA 4GLOA 4D4KA 1FW6A 4QBKA 2VKTA 3E22B 1OXUA 2MYPA 3H5AA 1TYZA 2X23A 3VU1A 5J58A 3ROGA 4TV8A 2PCLA 2BN4A 1U2SA 4D9JA 1T3SA 4H17A 2F59A 3F2VA 3QVOA 2FWIA 1AA9A 2G9ZA 2X2FA 1M5UA 4QXMA 1JEDA 3PTLA 5COAA 3KT6A 5ENDA 4G5OA 4AJEA 4MINA 4RK0A 3U13A 1NASA 5IC6A 4I55F 4X93A 3L7OA 1I2BA 4PIPA 4OHRA 2GZHA 3DMYA 4U6SA 5KYWB 4KR2A 3NHFA 2R7NA 2IW1A 1FTSA 3T9FA 2E4UA 3GGCA 4MDFA 1BH2A 2I3ZA 2MSDB 1MKYA 4ZANA 4KR0A 2ZJ4A 1Z18A 2XTMA 4G37A 4N3NA 4XIYA 4LKRA 3ZV6A 5CXUA 3BAFA 4UE2A 4DCCA 3U5ZB 3QF4B 3L0OA 1DJMA 1JQEA 1NFRA 1OAOA 2HRDA 3EXG2 3SOZA 2JIDA 3RS7A 1QRAA 2NU7B 4NV0A 1QSGA 3JSAA 2C5FA 2C5BA 3I6YA 4BNGA 2QVCA 3EGCA 3ZBPA 4FIDA 5JYBA 4DDWA 2FUG1 2WDPA 4NAHA 2PUEA 2HO5A 1XN4A 1MAVA 3UV3A 4YRPA 4J6EA 2GF9A 4MKFA 1SXJD 1TTTA 2DEUA 1PVDA 4LV5B 1MC8A 2AFIA 2O4UX 4CCYA 4QREA 3OFNA 4R40A 3BZBA 4GI7A 4QD3A 3ZHYA 1ORDA 4LHWA 4EOGA 4F2PA 3MGGA 4WHMA 3TIXB 5FUMA 2HLPA 2HU8A 1IVSA 3GVXA 1D2MA 4G5XA 3LK7A 2W2VA 1C4KA 3COYA 1DI0A 3PCRB 1IM5A 5CCDA 4XQ9A 2DU8A 4S05A 1JH8A 2WQ6A 3DUFB 1DJQA 4A36A 1C0KA 3H1BA 1C0LA 2OO5C 3GIWA 2NPFA 2OO7A 5FULA 2BI8A 4Z7OB 3JVVA 4CNQA 4UXHA 5SY9A 1SVLA 4EHFA 1ZM3A 1LBTA 2PAFA 1P3Y1 2FWMX 3UGTA 5IHXA 3ZGZA 3A9WA 4H1UA 4IFIA 3WOVA 3ASVA 2AEFA 2CLCX 3WLQA 1XFAA 1R1DA 1NZJA 2ZJ8A 2CMDA 5F7XA 1CIJA 3TQOA 2BRUA 1HKHA 2J85A 3R3YA 1OKKD 3ZHZA 2VDKB 3SZGA 1ANKA 2O05A 3U4DA 3F96A 3L49A 1P4JA 2QAGB 4IJ5A 5I9MA 4KWHA 3GUUA 2G88A 1K75A 3GA5A 1R4MB 4G1EB 4KFRA 3LUDA 3JZMA 4B5LA 4ZI3A 5KYGA 1T0HB 4BPRA 5EJ9A 3R3UA 2UKDA 2XBUA 3DT8A 3JQBC 3LA6A 4M0FA 1QVVA 4EVSA 4ETMA 1K4KA 4OQPA 5LP6F 4WDQA 3EG5A 3BJEA 2APJA 2AUTA 1R0YA 2IBMA 2NUTA 2QY6A 1BOFA 3Q7SA 2PUCA 4AG3A 4TVOA 3D5QA 4I1YA 4UHBA 4XWOA 3KZNA 5L51A 5AI0A 4AT1A 3D8TA 4CJXA 5DX8A 4K0RA 4YQYA 1PGOA 3RU7A 4ENWA 3F1LA 1HETA 2CL7X 2K87A 1AC5A 1KP2A 3KYCA 2CJXA 2P5YA 1OWMA 3JYPA 3GLHB 3MWJA 4JLBA 3C48A 4RTSA 3C3DA 2DT8A 3ETEA 4G5FA 4IILA 5FWXA 3M1YA 3NHWA 1DTSA 5CEEA 4JJFA 2WU0A 5TF4A 3Q8MA 2RHOA 3IR5A 1KFBB 2ILTA 2XX3A 4XSVA 1NG1A 3YASA 3KAPA 2OHIA 4F0JA 2WM2A 4IUDS 3GEPA 4HN2A 2Y8EA 4CLRB 1D1QA 3U09A 3FSRA 3H16A 2VJBA 4F4JA 5IBPA 5J5AA 1NWHA 1CR4A 2GCGA 3A14A 2VIIA 4M98A 2G76A 5JSFA 3HJTA 4P4SB 3SSAA 1NG9A 2XUAA 3WLSA 3GXBA 4MPRA 3QOFA 1F2UB 5JCPA 1U8FO 2KSQA 4NEQA 1DEAA 1P6UA 1RRKA 1YQXA 2FSIA 3B6MA 2NNWB 3K2BA 4E03A 1CJCA 4JJGA 3IULA 5JO9A 3RSQA 4D98A 4LOHA 1V48A 1JJAA 3FSGD 2ANBA 2C2GA 3EVNA 3QBJA 4P2BA 3TW8A 2HRCA 4JYMA 4OA8A 3KG2A 4IXNA 1Q83A 3IFSA 4JL6A 3SP1A 5G1NA 3WSWA 3K20A 5BV0A 4E1AA 4DZTA 3B6ZA 1M1YA 4GM0A 4JCCA 1RE0A 1LPMA 2H4WA 4RWZA 4BLPA 4PLTA 4ER3A 5D6OA 4IF6A 1R37A 1SRRA 1GRCA 3CUSA 1Y6GA 2QTTA 4MUHA 5JLJA 3DLBA 3CVJA 2H17A 4UOQA 1NXQA 3MCWA 3CXUA 1PT6A 4NFYA 4OHUA 1OVGA 3L4BC 1XKXA 1XQVA 5BOSA 2BGMA 1XMIA 4B4UA 5C4IA 3F4BA 4DMGA 5F5LA 1U7XA 1E63A 3PNBA 5FBQB 1GEGA 1FU7A 2NXNA 5K51A 4B33A 3CURA 4DY4A 2AKEA 3KL4A 1K0FA 2RK6A 1S96A 4D4GA 3HJBA 1Y37A 1U28C 3NEAA 5ALFA 4NSNA 2GTHA 4AWAA 4JKYA 3WLOA 2Q49A 2ZFUA 3C1UA 3ET5A 1YONA 3OF2A 3NOOA 2AG6A 2PL1A 1PZXA 1QGED 4XM0A 3VI3B 3BKXA 4JN6B 4FNGA 4A0RA 5AVVA 2NMVA 2GTIA 1JV2B 1SMKA 3NT2A 2B30A 2X6RA 2ABWA 3IGFA 4IZ6A 2F7SA 3FCOA 4BMOB 4FCWA 4H7FA 5JS1A 1L7MA 1N7HA 4W82A 1E7SA 4CKYA 3LTEA 5A5GA 5AXDA 3UMSA 3VPHA 2YFQA 1I2DA 3GFQA 4WLUA 1AKEA 3T5GA 1PZNA 3GQBB 1P81A 4JMLA 1KIFA 2J59A 5CGQB 3R74A 4ZCMA 5DULA 1XAHA 1FSGA 2ZRKA 1NRIA 3HHPA 4XLZA 1JWLA 4YI5A 3A1WA 3KPVA 3TR6A 1G291 4PLHA 2Q07A 2VPWA 3LQKA 1D9ZA 2V7PA 2YFYA 4WNIA 5E9JA 2Y77A 1XCLA 2I34A 3QLUC 4M0LA 5C8DA 2CV2A 5T67A 1U0LA 2HQSA 1QXSA 3M7IA 4A5SA 1OZ0A 2HSDA 3LY9A 1WZCA 5JU6A 1WM1A 3PGA1 1NDUA 4H2DA 5AHOA 3BYZA 3JASB 3LDHA 1Y0BA 3F4LA 5HIAA 2E1PA 1AGRA 3HCCA 3COWA 1C7QA 1UFQA 3CM0A 1QB8A 3RWMB 4HB0A 1P5RA 1VLLA 1M3SA 2XZOA 2VBCA 1KEPA 1ECPA 2DY1A 4RMNA 1T8PA 2J0UA 3B60A 3LW7A 4GZMA 1V3TA 3LQQA 3SQNA 3PQ3A 4LRTB 5ALWA 4ZVMA 4MIOA 1UPCA 2CNLA 4K6HA 2OGSA 1C1YA 4HDOB 1A7AA 3M5WA 2VI5A 5F1PA 3ETCA 4QM7A 4Z4GA 1XXHA 4KREA 4PPYA 4HZUB 5GV7A 4DE5A 1CETA 2FDXA 4PSVA 4D4HA 2C5GA 1NC3A 2FVXA 3C3PA 1U6KA 1SC3A 3HBJA 3ZIUA 2QGFA 2PRJA 3TLGB 1JQLB 1FK8A 2VBGA 4FFMA 2XV1A 3ZWMA 5K2OA 2OZKA 5F52A 2QRUA 2C42A 2QZ9A 4BJ1A 5DH9A 1VE7A 3ZDXB 2RHBA 5EP3A 1EP9A 3BWEA 3EPPA 1T6XA 2JIRA 4TYQA 4XGNA 2P78A 5AKLA 5DWVA 5IULC 1Z0KA 1R6TA 3A9RA 1QBKC 4QXRA 2D4HA 2GHQA 1OWPA 4PZDA 1FSSA 1RJWA 2WIDA 2BFPA 3I76A 1UANA 4LKOA 3VU3A 4EWLA 5LSAA 1SBYA 3N5KA 3VPDA 3UMVA 1PU2A 3RYFA 4D99A 2CK3A 5LL6P 1DQPA 1UJNA 1QONA 2X6TA 4MGYR 2EJBA 4D8TA 2JGEA 3WV5A 4OLJA 5ESRA 2H7CA 2WUWE 3ICOA 4KWCA 3IDZA 3TQFA 3VR6A 1FTYA 2O7RA 2ZIFA 2ZWAA 3FOAA 2X0EA 4OQFA 1Z0AA 3RI3A 1J97A 4F1KA 3ZJTA 2UXDB 1DLIA 2R48A 3Q7IA 4EJFA 4R84A 2UV8A 3Q5DA 1KQOA 2QZJA 3KJNA 4H3VA 3AX6A 4ER0A 2PXCA 3QITA 3D6HA 1UBRS 4JCOA 4KZPA 4WW0A 3GXOA 3TDNA 3QWBA 3EPJA 2AYXA 2WJAA 3M3HA 4RZHA 2J9ZB 1X8JA 1XU4A 1RM5A 2H31A 2PM8A 2Q7XA 4I19A 2V0CA 4P93A 2J46A 3UA4A 3IIMA 1G2IA 3W8EA 2PJDA 2YVKA 4H27A 3R24A 1N2JA 4B76A 1ID8A 4BX2A 2CVPA 3OZDA 3HP1A 4NBLA 3PWSA 2J41A 5C8VA 3D64A 3BRCA 4XVHA 3JD3A 5BYBA 4WCFB 2QPAA 2O0LA 1NMYA 4IS3A 1TEXA 1V25A 4BBZA 5EWLA 3KHUA 5KOJB 1RI2A 2XYGA 4RVDA 1RC0A 4TLMB 2MTBA 4ZQBA 1EAMA 1P3DA 2V6MA 2WABA 4N12A 5KYXB 2UYHA 2JFZA 2VCHA 4HZGA 2I2CA 1Y9ZA 1I6LA 3LPDA 1D1TA 3A28A 3QPDA 1T3ZA 1P2VA 3C8MA 4IY1A 2V45A 1NC1A 2NSHA 1I4WA 1I5RA 5E1DA 1C14A 9ABPA 5T5QA 3UAOA 1N8KA 4X6UA 5DEIA 1HPLA 4HQ6A 3EY9A 2EARA 1H0KA 3O8OB 4CMJA 1Y81A 1FSPA 2J5KA 1UQUA 3Q3VA 4EPWA 4BVJA 3ICEA 1E2MA 5IDYA 2OFPA 3LOUA 4XW2A 3FNQA 4F1WA 3EXHA 3KIPA 1H2AS 2H6EA 3FR8A 4JBYA 1TM1E 3OAAA 2H4YA 4TN5A 3GRVA 1APBA 4HOYA 5L40A 1GLVA 3COSA 4MCAA 3TECE 3GT7A 5KMGB 1AUVA 2JCSA 1HKUA 4FEAA 1J8DA 4A3SA 2EFCB 2MU1A 1ZM4A 1QIEA 1WZUA 1X86B 3B78A 3C6MA 3EC7A 2PD6A 3NKVA 5TPZA 1G21B 4H1HA 4YJKA 3DOUA 2D1SA 3W1EA 1YMVA 3ANTA 1IIBA 4K7JA 5JVDB 4TVBA 2HIHA 1J0EA 3CO0S 3VZBA 1WEHA 4DZRA 1E79D 4R9UC 1E1RD 1C29B 1B8PA 2AD1A 5DIZA 1X38A 3PSAA 1Z5UA 2IZ0A 4RD0A 1CVIA 5CTAA 3ZEIA 4HFJA 4WZBE 1Y33E 1CIVA <