1Z6XA

Structure of human adp-ribosylation factor 4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
175
Chain Sequence
TISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Of Human ADP-Ribosylation Factor 4
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords ADP-ribosylation factor 4
total genus 54
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z6xA00
5FOSA 2BVNA 4C0QC 1PZNA 3TNFA 4P33A 1KDPA 3X2SA 2EVWX 4Z1MA 1XD8A 1NN0A 4PPFA 2WWGA 3FWYA 1OH6A 1YZQA 1ZU4A 3V9PA 5AR1A 3SBEA 4QBGB 1GG2A 1W47A 1IOZA 1GAJA 1WCV1 4ZDJA 1FZQA 3N70A 2Y8EA 2I3BA 4W9MC 1HEIA 3RWOA 1Z6XA 4PANA 5JRJA 4YLGA 3HU3A 2WWHA 3JZAA 2GZDA 1GNPA 2Z83A 5JBQA 3GLGB 3T06B 1R10A 4UNNA 3DVLA 3GQBA 2FFHA 4V0KA 3FOZA 1TF7A 2J46A 2BBWA 2QBYA 1RFLA 4LHYA 3ADDA 3ZD6A 3FKSA 2V7QD 3NH9A 3B1VA 1DAHA 3QPWA 2EWWA 2WIBA 3IQWA 1GKIA 4IOJA 4WXRA 5GJCA 5J47A 1CBUA 4MQBA 5SZKB 3TRFA 2ZUCA 2IYUA 1UEJA 1U98A 3U3JA 3QG1A 4Q4JA 1D6JA 2OBLA 2QTVB 2X2FA 4CEJB 4A2QA 1D2EA 5TY0A 3EIEA 1NSFA 2VYFA 2J9RA 3QEJA 4H1VA 4DBLC 2GCPA 3QQ5A 3GLHA 3KXKA 4M9SA 2OLKA 5FL3A 3BB3A 3K9LA 5UKDA 1FNNA 2RGNC 4KODA 4DT1A 2J0SA 1AQUA 1Z08A 1BS1A 1UBGA 2V55B 4MGIR 2UZ3A 4C0BA 1QHHB 1JNYA 4P4TA 2J59A 4PX9A 4QOSA 3RRZA 4HUQB 1JQJC 1P9RA 2BCGY 4B44A 4PZZA 5CIQA 4S2EA 5KDLA 3K0SA 2AD5A 1BYUA 1JBKA 4OK3A 1FL9A 1JPJA 4Q02A 2FEOA 2QUZA 2BKUA 3N2EA 4MH0R 3W3ZB 1JAHA 2AXPA 2FMXA 1Q21A 5HE8A 5BN3A 4R2IA 1RE0A 2OBMA 4HB3A 4LJ7A 2O0HA 4AG5A 1AKYA 4DCVA 1B23P 1SVIA 4JJKA 3LA6A 2ODEA 5KPJA 4G5QA 2QSYA 2XNDD 3VTKA 3LQRA 4EFLA 1MABA 4DT1B 1K5GA 5JLJA 4DDUA 3V00A 4II7A 3LVQE 2XB2A 2IS2A 1CIPA 1ELOA 5JJKA 4AK9A 121PA 1YZLA 2DY1A 2R62A 2C9OA 1BH2A 2RGGA 3TUIC 3KQUA 4W5HA 3BS4A 2P6RA 2AXNA 1R4AA 2BHRA 4PPGA 1EX6A 4G01B 4GMXA 4CEJA 1COWA 2PX0A 5JECA 3U7GA 3FHTA 4M9XA 1YZNA 2YV5A 1VYTA 3OESA 4NPHA 4NL4H 3OAAD 2ZTSA 4KFSA 1H65A 4B3DA 4D4JA 4Z1MD 4EQ6B 2ERXA 3LO5A 5EE9A 2GXQA 1KI7A 4AIIA 4LHWA 1NL3A 1NBME 3OIYA 2W0MA 4GI7A 3VR5A 1NKTA 5IRCD 1A4RA 4PPQA 4XSGA 3TAHA 4BLQA 5L3SB 1PVOA 1X1SA 2VBCA 2HJVA 2YVUA 5G3ZA 4OHYA 2Q3FA 2Q3HA 4QXAA 3AVOA 4UXJA 1VKJA 2ATVA 2CVHA 3GEHA 3KL4A 2I1VB 2Z5FA 1TF5A 5GJVC 3KQHA 2V3CC 2IXFA 2QMHA 3EZ2A 4Q66C 3T34A 3CKLA 3TSWA 4BFWA 3EXAA 2Q9CA 2R2AA 2GHIA 3W8RA 3UIEA 4E03A 3T1OA 2X1VA 2EFHB 1R0WA 3DM5A 4TYPA 3OEED 2ZVQX 4MYCA 2CLSA 2ASEA 3TW8B 1OIWA 2EFEB 4IDOA 1Z6GA 5FOXA 3RLFA 4D0GA 1N6HA 4B43A 1P7CA 4Q5IA 5L8VA 2FU5C 1S3SA 2WAYA 4X8HA 3UMSA 4QHSA 1CJVC 3AVTA 2Q9AA 1GNRA 4IVRA 3GLGA 3B9QA 3QKRB 1MT0A 3GJ0A 4HAZA 3KZ1E 4YDSA 2YOHA 1VG9B 4M2LA 3SYLA 4B71A 1UEIA 4WW0A 1UBEA 3HJNA 2AX4A 1W5SA 1IXSB 2V6IA 2DPXA 3DZDA 3U7EB 3EC1A 1XCPA 2VLIA 3H2YA 5TVKA 4DUGD 3KXIA 5EUQB 1KO7A 2ZI5A 3HPQA 5F2EA 1OXTA 5EZ6B 5B30A 2JLQA 4NONA 4YONB 1YRAA 1MRSA 2WMNB 3C5CA 4Q21A 1SKQA 1N6KA 4C30A 2WWXA 3GP8A 1CJUC 1IM2A 4Q7LA 2QENA 1E2MA 1K5DA 2W6JD 4OI2A 4AD8A 5DH9A 2GKSA 4TN1A 2NO9A 2ZU6A 3IDQA 4D0NA 4DC9A 2O8EA 4IXNA 2QG6A 2FZ4A 2QNRA 5A0FA 4I1SA 1L8QA 4TYNA 3ZS9A 4XH9B 2W6JA 3T61A 4LI0A 3VHXA 1OW3B 3L0IB 2ZJ8A 4GP7A 1KMHB 2OAP1 4HZUA 3MUFA 2BM1A 4HLUA 6Q21A 2REXB 2FGKA 2RGDA 1DPFA 3PIRA 1U90A 4M0LA 5C18A 4ASUD 4JLOA 4TWZA 1KNXA 3KTAB 3VR6A 3CZPA 4YMSA 4FD2A 1W44A 1GTVA 2CEAA 4R9UC 4BASA 4Q1EA 5JS8A 2QPOA 1KY3A 1KY2A 1ZIPA 2CL0X 2GBLA 2YINC 4HDCA 3IPXA 1DO0A 1OIXA 1KI1A 3CRRA 4GOKA 1W4BA 2HYIC 2ZS7A 4GPTA 4YDHB 1G19A 1JR6A 1SZPA 2BMEA 2C8VA 4UXIA 1JECA 5FUWA 3AVQA 1U94A 2YWGA 1J8MF 2HYDA 5HKKA 2DB3A 1RYFA 5EXSA 4CT5A 3FHCB 2JGNA 3B78A 2ZXUA 1W4RA 1Z3IX 4DB2A 4EKDA 3EZFA 4ACAA 3ASYA 5IDVA 3K09C 2HF9A 1YR8A 3QKUA 2ZRFA 4PC2A 3CRW1 1J2JA 2VH5R 1KSGA 1N6NA 1U8YA 3SNHA 1II8A 2J3EA 1KOFA 3WBKA 3AGPA 1W36D 4DDVA 4IFBA 1YQTA 5BXQC 2ORIA 1KO5A 3HR8A 4LSGA 2W58A 5FTKA 1NVVQ 1YKSA 5F9HA 2NO1A 3DPUA 1R5NA 1VTKA 3TKLA 4A8JB 4NH0A 2YHSA 4JBWA 1S0UA 1E0KA 3OIUA 5DI3A 3SZRA 3TSZA 3U44B 1DAIA 4KSBA 4ZIRA 4BZQA 3KTAA 3IO3A 3BFXA 1OHHD 1AM4D 3THWA 2GAOA 3MWYW 4RKFA 3FE2A 4PO8A 1I4LD 1Z5ZA 4JSTA 1K8RA 1P2VA 3UG7A 1E2IA 1X6VA 2X19A 4LJ5A 2XGJA 3KKPA 421PA 1KJWA 1IY2A 1O87A 1TAGA 2F9MA 3P32A 1FPMA 2ZI9A 3KJHA 3QKSA 3EAQA 1Q1ZA 1UFQA 1IY1A 4M9QA 3WP0A 5KSOA 4Q01A 1QRAA 4Q7KA 1F2TB 4MYUA 1G8FA 2GEDA 3Q5DA 4M1TA 4C7OB 4GL2A 1G8PA 4WVFA 1H8HA 1GRNA 3U3MA 2W00A 3DHWC 5DYGA 1HYQA 4ZDKA 1ZIOA 2KBFA 4TT3A 4R71A 2UVQA 3IHWA 3AB3A 2MMGA 1HURA 4A4DA 3KFXA 4TQ9A 2GTPA 2C04A 1G3MA 1SXJD 2KSQA 2DFKB 3QKSB 1XMJA 2AK2A 3VQTA 2IEZA 1QHXA 1JALA 2J41A 2WJJA 4G0NA 4L5BA 5CITA 1P6XA 3KFVA 1OXXK 1G4UR 3KB2A 1OB2A 1HE1C 2ZE8A 4CYMA 2H8KA 1FTNA 1A2KC 4PSKA 1FW6A 5FPSA 4HAVA 4ZV4A 1XD9A 5AUPB 2YOFA 3T1QA 1AZTA 1DADA 1LV7A 2B92A 3BXZA 5EE3A 1UDWA 4Q9HA 1G16A 1TEVA 2YC4C 4X8MA 1OXVA 4X8OA 5EUMA 4BLOA 4BPBA 3RSLA 1XP8A 3RS0A 4WAUA 5ELXA 1WBDA 1QHYA 2H57A 3VFDA 5BWMA 2AHOA 2GRJA 2QP4A 3FDIA 3ICQB 2NO7A 2GXAA 3I4LA 1S2MA 1CP2A 1ZUIA 1KI2A 3GPLA 1A7JA 3FKQA 1DAKA 4HAYA 4AWXA 3PEUA 2QMOA 3BGWA 4KJZA 2FOLA 2Z43A 3L8YA 1E2KA 1R0YA 5IK2A 2DFNA 3VX4A 4IVPA 3IHLA 5AWFC 4IDHA 1F2UB 2QZ4A 4TYYA 4NCJA 4YXWD 4MGZR 2RCNA 4OL0A 1YZUA 3VR4A 5FFMA 4XWOA 3CBQA 4LBVA 4A0FA 3NBXX 4BZPA 1UBCA 1E4YA 1P60A 1WP9A 4MGYR 1ZNYA 2C9CA 1XXHE 2JIZD 1EK0A 5TXGA 2VA8A 4Q1CA 1XJ0A 5C1BA 3GMTA 5JCZA 1VCMA 1I2MA 1XMSA 3M0EA 2AL7A 3AKCA 4PC6A 1DELA 2WICA 5LB4A 4K81B 2WWYA 1W0JD 3WNCA 4KVGA 4MGKR 5DLQC 5FUXA 5KSPA 1SHKA 4E07A 3SU8A 1JB1A 4A36A 3IPYA 1L4YA 3CF2A 2GF9A 3N5CA 1VIYA 5DSZA 4PQFA 1L4UA 1SVMA 3DDCA 2IUSA 4GFDA 2G1KA 3R9WA 5D3MA 3FMFA 1M7GA 2H5EA 1P5ZB 2IS4A 5F3WB 4TLAA 3UG6A 3A36A 3OE7D 1N0VC 2W0SA 4L9SA 1LVGA 2HDNB 4P4SA 1P3JA 1Q22A 5KNDA 3K70B 3IIJA 5K8TA 5K8UA 2IYVA 1Z0IA 4QBIA 1E1RD 1Q44A 3X1WA 3DKPA 2FZLA 2H7VA 2AFHE 2ZITA 3PV0A 5FBRB 4Q00A 2VHCA 2OSBA 4RFVA 5K8IA 1HT1E 1NVUQ 3CONA 4U02A 2ZI7A 4BECA 1YE8A 1XNJA 2YC2C 1RRPA 1KK3A 1RYHA 2AK3A 1Z2CA 3KJGA 2KJQA 4LV6A 3P4XA 3QBTA 1P73A 1M2OB 4ZI3A 1T6NA 3DKVA 4QG7A 4JL6A 4WIAA 5KTYA 1G4AE 3I73A 3T35A 1SULA 5FUYA 5CM9C 1C9KA 2V8OA 2ZUBA 1UJ2A 1Z6TA 3S1AB 3K0EA 3BRWD 2V7QA 3DOFA 2NG1A 3SYKA 3AF4A 3N2IA 3I5XA 4LHXA 2ZYWX 3G0HA 3U3RA 2GEUA 2LKDA 1AKEA 1KZ7B 3QSYA 2OCBA 1C1YA 1NBMD 3QF4B 4PAMA 2IUUA 3KXLA 4P0TA 2NTYC 4RD1A 1FP7A 3Q5EA 5FTNA 2CCJA 5AUOB 4OHVA 4DLYA 2R6DA 4XVQA 3R8CA 4NZYA 1V5WA 2NMVA 2EW1A 2D06A 1N5LA 2UZIR 1PUJA 3AF0A 3U60B 2QU8A 2SHKA 3NVAA 1YR7A 4M1KA 2DCUA 4AKEA 3QI2A 4IDPA 1ZM4A 5CLQA 2ZRDA 4URVR 5B57C 1E1RA 3KUCA 1SVLA 4UNPA 1ZCBA 5EP4A 2JLXA 1U0HC 5AJYA 2ZJOA 5IF9A 2A9KA 4F92B 1Z06A 4OBEA 3WHLA 3BIFA 5FTMA 1UPTA 3VHLB 3I32A 2CK3A 4JS0A 3WBJA 4C3ZA 2IYZA 1F2TA 1ODFA 4TZ6A 1UF9A 1YVDA 2GJAA 1E2LA 2QAGB 2G88A 3WXMA 4WXPA 4PFSA 4Q1DA 1OXSC 3Q8XB 1KMQA 3KB1A 4D25A 1GKYA 2H16A 5FR2A 4DUGA 2ZJZA 5JJLA 4L4UA 1XCGB 4JYCA 2GEVA 1VYVA 2WJHA 4ARZA 1SGWA 3REFA 3BWDD 1E2QA 3MMPA 1TU3A 5LDDC 3BH0A 3I5YA 4IVQA 5BN5A 1Z0KA 4IKEA 2WSSA 1TNDA 3HDTA 1MO3A 2OO7A 4KAXA 2JLZA 3B9PA 3B8HA 4L16A 2FPKA 3B5JA 4Q9IA 3W90A 5A4JA 4F91B 3MD0A 2XZOA 4FMCF 2OESA 4JVLA 3RWMB 4YMTA 1KYIA 3CH4B 4B3BA 1GOTA 5E3HA 3EPHA 2QRZA 4Q4AB 1N5KA 5AUNB 3BAFA 4LBWA 4RSGA 2G0TA 3W5IA 3PUVA 4CF7A 4B3CA 1MO4A 4O2LA 4QGGA 1Q57A 5G53C 1SXJC 3KX2A 2HF8A 2PLRA 1RRFA 2E87A 5HCNA 3O8BA 3LQQA 2UKDA 1XEXA 2NOAA 1ZD1A 4RVCA 5GVRA 4D4MA 4A6PA 3F3YA 4JLJA 3U61B 1Z6YA 1X8KA 4C9BA 2B21A 3QEOA 4B6EA 1ZCAA 2XTMA 2YWHA 4NYIR 1ESNA 4RD2A 4GNKA 3ZQ6A 1S1CA 3DZ8A 3BERA 3TR0A 1U8AA 3QVVA 5FH9A 4URUR 3UPUA 4S35A 4O3MA 1NRJB 4B76A 1XTSA 2O5VA 2ZROA 3AQ4A 4CEIB 4PHGA 4JL5A 5FBQB 3A8TA 3CIOA 3KUDA 1JPNA 3CZQA 1WQ1R 3A4LA 1T9HA 1VDZA 2FSFA 1Q1EA 4HAWA 2OXRA 2FEMA 3EARA 4JJZA 4QGAA 4XTRA 1J8YF 3RRMA 4ERNA 5JRZA 2F55A 3BD9A 3QPUA 4QBHA 2RMKA 3RVBA 1JEDA 4KI0A 3NWJA 521PA 2QP3A 4JKIA 2XTZA 3S1AA 1GSIA 4EPWA 3U5ZB 3VNUA 3V4RA 2DWOA 4N3NA 1E1QA 4OKSA 4TLBA 4LZZA 5E7IA 2BOVA 4OJQA 1ZU5A 4RZXA 4B48A 4OQMA 3Q85A 4TMTA 4F93B 4QKQA 5DE3A 1Z83A 4Z8YA 3T5DA 1KGDA 3VR3A 2G83A 3A1TA 4FN5A 1IXZA 4GT1A 1E9EA 3A1VA 2F43B 2GF0A 2P65A 1IY0A 3AUYA 4UJ3A 1RRGA 3ZGXA 4C0JA 3SJZA 4DCNA 2R65A 2VP5A 1OFUX 3DL0A 5D3QA 3W34A 1GZSA 1Z28A 4NYJQ 3WHKA 1S96A 4V0ME 2PMDA 1J90A 1GVNB 1F60A 3CB4A 1RJ9B 1AIPA 4A2WA 1CR2A 1BKDR 1OFTA 2Q3MA 2ZRIA 3H0KA 4B3XA 1NG1A 1F3OA 4P4UA 1T0JB 3JVUA 1TTTA 1VHTA 1T5LA 2PEYA 4ABYA 2BCJQ 3CLVA 4KLZA 2IYLD 4DXAA 1R0XA 3GLHB 2HXYA 3AP1A 5JSZB 4LCBA 1KK2A 3NHAA 5FPYA 4B33A 3PJRA 1AS2A 5DISB 3M4YA 2R6AA 4HZIA 1R8SA 4BFSA 4PPNA 5FPHA 4G5RA 3LLMA 3PEVA 1G3IA 1TQ4A 3K70C 2VTKA 4AKHA 2IYQA 5JEDA 1D2NA 4ZPXA 3GLFE 1XD2B 3NKVA 2X8AA 2Q0HA 5FOVA 3GLIE 5C4GB 4F4JA 4B3GA 1EFCA 4PR0A 2OLJA 2GJ9A 2HLDD 4W5WA 1IN7A 2NIPA 4PHHA 3GEIA 3H84A 1W2GA 3FYHA 4ZKDA 1M6NA 1AS3A 1GUAA 2VSXA 1II0A 3AGQA 4J0QA 1XRJA 2A30A 1XFAA 1YHNA 4MDFA 4KFTA 5KUTA 3GLIA 3LH5A 2ECKA 2ZRKA 2YOGA 2ZRNA 4RD6A 1KSFX 4TMZA 4AY2A 3R20A 1LTQA 2J5XA 2I4IA 3C4JA 3PCRB 3QNUA 4Q9KA 5J4HA 5C2JB 4M21A 1G7SA 4HLCA 4EAQA 2ZAMA 3K8YA 1P4SA 2H18A 2OFXA 2ZVPX 2XZLA 3D3QA 1EFHA 3AKEA 1KMHA 2VPPA 4AKIA 2FNAA 2W6IA 1KI8A 3BJIC 4PQYA 3NXSA 2FX3A 3NTUA 4V03A 3T12A 4MA4A 3NG1A 1TUIA 1MO5A 1ZYUA 2EYUA 1KO1A 4TL7A 5AK0A 1XXHA 4Q9JA 1PLJA 2CVFA 3RDPA 2ZM5A 1OLOA 3PFIA 2ZR7A 3ZDQA 1ZUNB 1QVAA 4E5UA 4ESHA 1U0LA 2XAUA 4DDTA 4NMMA 4MITA 2Q6TA 3NBZC 3EWSA 5B58C 1FP6A 4UKDA 2P6UA 4HI0E 3NDPA 2CBZA 2YZ2A 1BIFA 4P3YA 2EWVA 1F5NA 1YZKA 3IEUA 4NDZA 4DDWA 5FOUA 3DMDA 1Z29A 2A5JA 5DN6A 2PZGA 5L3RA 3VKHA 3HPRA 2IS1A 1G5PA 2QORA 3X1DA 4BFXA 4DSUA 4G5SA 4BFVA 3LAWA 1NLZA 4TLEA 3UXMA 3BH6A 3W6OA 4MUAA 4TSFA 2JLUA 3FMPB 1E2JA 3W8NA 2QM8A 4BRWA 4L8GA 4FMBB 3ICEA 1EFUA 1FMJA 1NMXA 1U9IA 3RS5A 5LD2C 3NC0C 5CB8A 4DEYA 2OE2A 1AA9A 5CK5A 4GBMA 3I92A 3NIBA 5FR1A 4L15A 3T1VA 3KDSE 1E2HA 2L0XA 4DCUA 4DIDA 1IAQA 2ZETA 4IDNA 1E32A 3PG5A 4HB2A 2IC5A 4IHQA 1JR3E 5LB2A 3LX5A 2MMCA 3WMEA 2PEZA 4D2IA 4KYUA 1AQYA 2ZRHA 1E98A 4QM7A 5FBWB 2A3RA 3THOA 4EUNA 4KLNA 1KNQA 3KQLA 3CRQA 1XPRA 2ATXA 4I1UA 4BFZA 4JBYA 1WDTA 4M4SA 2K5UA 4IDQA 5ANRB 4DWJA 3FFAA 3TVDA 5HR5A 4DRZA 4UNRA 4Q1AA 1CEEA 1T0HB 3LWNA 5G3YA 2XITA 3IGFA 3BB4A 1E94E 2J7KA 4DCSA 2ZJYA 4DLVA 3OE7A 4LWZA 3AP3A 1J99A 3ZVLA 3K70D 3OEEA 1VHLA 3ZVNA 1DG3A 1CKEA 4RJLA 2BEKA 4BLRA 4RD0A 2ODBA 4TMXA 3R7WA 1YZTA 2QTHA 2VHTA 4Q4JB 4LPSA 2N1BA 1R5OA 4A0GA 5EQTA 4TMWA 1VG0B 2DYKA 1YU9A 3CPEA 4XSHA 2F1IA 2IS6A 2PBRA 5JS7A 4JL8A 1MR3F 2P5TB 4YMWA 2YKGA 3W9YA 2E1RA 1QZXA 2RGEA 3FMOB 3SDZA 2O8DA 4OI4A 2FH5B 4JLAA 2FGJA 4LYAA 5J4KA 4Q1FA 2FDCA 3WY9A 4QJ3A 2QEQA 3IKJA 4US2R 3SHWA 4PC3A 4QGHA 4U00A 4DSNA 1QHIA 4NYMQ 3EX7C 3L0OA 4PSVA 3HYTA 1E96A 4Z54A 4KVAA 1W0KA 2C78A 4CZ2A 2ZJBA 4LYJA 1RVDA 3G82C 2CL6X 4AI6A 1FOEB 2GETA 2ZU0C 2G77B 1P62B 5HPYB 3ND9A 1LW7A 3CF0A 1X3SA 5B2ZA 4EJSA 2ZRPA 1X8LA 3MGCA 2RGXA 3SEAA 1SXJA 4ITRC 2YYZA 4LJ6A 4LV5B 4LK2A 3J81k 1AN0A 1GDDA 5FBLB 3DM9B 1NF3A 4A6XA 1E6CA 3RYTC 1Z07A 3IQXA 1HH4A 2AWOA 2GDJA 3QY0A 3TVTA 3ZZUA 4M1SA 1CXZA 1OKKA 1SXJE 1X8JA 4JZKA 3T1TA 3R8FA 5EJEA 4GRAA 5K8LA 4US1R 4A0HA 3GLFB 5EP3A 3EZ6A 1ZP6A 1FTSA 2NGRA 2NO0A 2FFQA 2DWPA 1M34E 4M1OA 2R6FA 4M22A 1NVXQ 2JJ8A 4NCHA 1G9XA 3B6EA 2OFWA 5SZJA 3VR2A 4TSFD 3K9HA 3RS3A 5GVSA 1OH8A 1HA3A 3GJ5A 4PZLA 3EZ9A 4AYWA 3CW2A 2J0UB 1SVOA 2CE7A 5KYKA 4Y0AA 1XTQA 1TU4A 4K46A 2NPIA 4AYXA 4C0AC 3UANA 5FPTA 1GRQA 4TLDA 1R2QA 3MCAA 5EXXA 3D8BA 2B8TA 1NY6A 1OIVA 3EASA 3NEYA 4Q03A 1P2UA 3OHMA 3VX3A 2BIFA 2C2HA 1H8EA 2ZRMA 2PMKA 5P21A 5J4YA 3NH6A 4B6FA 2W2VA 3FGNA 1ZC4A 2FF7A 4KHZA 5B64A 1OFIA 4QNMA 2GK6A 1UKZA 1LNZA 4D82A 2ERYA 2F1HA 4EFMA 3TUZC 4NBSA 1QVRA 4ZDIA 3KKNA 4QC2A 1W36C 3MSXA 1KAGA 4R98A 3A1WA 1II8B 4D0LB 2O8EB 4ON9A 3TSOA 1V43A 2PCJA 3DMNA 1D9XA 3Q9LA 3LVRE 1OSNA 4HDQB 4IFEA 4YMVA 1E2NA 1ZINA 2CHVA 2Z4SA 3TAUA 2VL7A 3ZZ0A 4KBFA 3SFZA 2XXAA 4GOXA 2QAGC 4BLPA 2J7PD 1I4TD 3P20A 2IX3A 3I61A 1A2BA 2P0EA 4H9GA 1KDOA 1B0UA 3IIMA 4QM6A 3VR1A 4NYJR 4F4IA 1Z8FA 4Q19A 3QF7A 2QT1A 2GXSA 3C15C 5CYPA 1NKSA 1W1WA 3CNOA 3O8CA 2G1JA 2QQ0A 3C8UA 4A0RA 1HUQA 3OFND 4I4LA 3PUZA 1Z0FA 2RGBA 4BZXA 1BOFA 4YC7A 5L3VA 4OI0A 5GJWC 4Z8XA 2OEPA 1XMVA 1NMYA 4Q48A 1CR0A 3QKTA 1XJCA 4FMCB 2EFDB 5TB5A 2NZ8A 4DSOA 4NHOA 1Z0JA 3LBIA 4IOMA 2WSSD 4Z51A 2ZR9A 3WRXC 2EQBA 5HKKD 1DE0A 2CCGA 4OQFA 5AJWA 3GLGE 3ADKA 1NMZA 4V0LA 4KYIB 4V0OA 1ZNXA 2JDIA 1QHSA 2NZJA 1YZGA 2WJVA 2OUKA 2HUPA 4DSTA 4AYTA 4KFUA 2IYXA 2QRNA 3UKDA 1WB9A 2KB0A 3ASZA 3AVPA 4FXPA 4WBSA 3K1JA 5G41A 5EXPA 4CEIA 4LC0A 4JT4A 1ZNZA 2F9LA 1D8TA 2CJWB 4Q1BA 1VYUA 4NCNA 2IUTA 3UK6A 1UBFA 3VKWA 1S9HA 2IT1A 3AUXA 3NEJA 2R44A 2ZE6A 1GFIA 2ZE7A 4BLSA 3QENA 4Q7JB 1MRNA 4TL8A 3LXXA 1XTIA 4Q9LA 3BB1A 5TARA 1MO6A 3G5UA 3CRVA 3PENA 3LD9A 3UMFA 4BLTA 4BEBA 1SHZA 4LX0A 2KBEA 2VHJA 5H1YA 4A9AA 1ZNWA 2FA9A 3HR7A 1RRCA 4PXAA 1G7RA 3TH5A 4PO1A 4XWAA 1XPUA 3SJCA 3VU9B 3ZIAA 2QGZA 4ARZB 1AK2A 3LW7A 4I1OA 3WYGA 3I62A 2PZFA 4G5OA 4UXHA 3EA0A 1Z0AA 3RC3A 1L2TA 1I4DD 3THYA 1DBSA 4LDJA 2FJUA 2BBTA 1OYYA 1T8TA 1MABB 3UWKA 5FI1B 5KO2A 4OHWA 3SOPA 1G7CA 5HZHA 5L3QA 1U9IC 1A5TA 3ZVRA 5HZKA 4Q7MB 4WZAE 2HEIA 1XTKA 3B82A 1TUEA 3HYRA 4BRUA 3LBNA 4X8LA 1A1VA 4I81A 1KK1A 1EX7A 2WAXA 2VQSA 2JLVA 2QL6A 4KSCA 2ODWA 2WWIA 4O2RA 3K0FA 2JLSA 4M1MA 3PEYA 2CJWA 5LBIA 1LS6A 2XXAB 1D2MA 1N6PA 2MSCB 4O25A 1NLFA 3IIKA 4A82A 2BKEA 1TQDA 2J45A 1AGPA 3UWOA 3LXRA 3CWQA 3TQCA 5DIFA 5KDOA 1GL6A 1LFDB 3ADBA 2LKCA 2PX3A 1RC8A 1D9ZA 1II9A 3C7KA 1NVVR 1S1MA 2IYWA 2EFGA 1W49A 1E1QD 4MUBA 2PH1A 2IXGA 1T8UA 2AKAB 1Q0UA 3AEZA 3I3SR 4FW9A 2FFBA 4JLBA 2ORVA 2AR7A 2D74A 1KI4A 4YMUA 1TADA 1XF9A 1G3UA 2QPTA 1E2EA 2QA5A 3BK7A 3H86A 3IBGA 4OJKA 2PJZA 4TQUS 3AVXA 3U4QB 2ONKA 3BBPA 1G3QA 1SVWA 3B1XA 1R0ZA 1NN5A 2F7SA 1TX4B 1JJ7A 4B2PA 4Y0VA 2DHRA 3LX8A 5EP1A 5AUQA 1N6RA 4DIEA 3GFTA 4A8JC 1ZD9A 3B13B 3KJIA 1VCOA 4LJYA 2ANBA 2O0JA 4DEXA 1EFRA 1ZM7A 3E70C 3FB4A 4LJAA 4AC9A 1GILA 2JJ2A 1WA5A 2JEOA 2IL1A 4ZDWA 2GJSA 1JI0A 2BV3A 2QROA 2ZQ5A 1XXHB 4LUCA 4EPYA 5JSZA 1CU1A 2KI5A 1IHUA 2W2TA 1S4QA 1FNMA 2OAQ1 4TMKA 3FPAA 3VNVA 4R2HA 2XSZA 4N0DA 3LFUA 4TT3D 2O8FA 4LBYA 1JEEA 2O0KA 1G291 3REGA 2JJ1D 2OZEA 3U2QA 3NDBB 2YWEA 2QAJA 1DS6A 4NTZA 2HT1A 1H8HD 1EWQA 1QHNA 3CO5A 4WZBE 5CDFA 1E9RA 2ZJ5A 4HYYA 3P1JA 4ZCLA 2ZUDA 2QM7A 1XWIA 1P75A 5JMTA 3SHFA 1KDRA 4GOJA 4N0EA 3SR0A 3MWKA 2GESA 1W4CA 2QP9X 2ZANA 3A1UA 3EG5A 4HAXA 2V6JA 1ANKA 3LW8A 3UMRA 3ND8A 2CE2X 3AV0B 4WZ6A 1SKYB 4EJSB 2A5FA 4FINA 3X1XA 1CR1A 1UAAA 3X1YA 1Q20A 3ETLA 2ZSFA 4JVNA 2F1JA 2ZRAA 3H4MA 4A2PA 1T3LA 2TMKA 4GZLA 2F3RA 1JAIA 4C2TA 3QG5A 3CX7A 3SJAA 4DJTA 2YNMA 1FQKA 3QIAA 5KSYA 2V1UA 4IEEA 4M53A 2OG2A 3LNCA 4EDHA 4EQ6A 4D4KA 1P72A 1SKYE 3B85A 1N3BA 3D7MA 3LDAA 4NYMR 5D3MB 4JMPA 2ZI4A 3FHOA 4DLXA 5M04A 4V02A 4KITB 4ZIRB 1VMAA 3CRMA 4B2IA 1ZBDA 2VSFA 3X1ZA 1GM5A 1RW4A 3I8SA 1KI6B 4ZCMA 3GJ7A 1XTJA 1KK0A 1NP6A 1C4OA 4HLQB 3GD7A 2XNSA 2V54A 4K8OA 1AGRA 2O8DB 4HEJA 3A58B 2RGAA 4LHZA 4ESVA 1R5BA 3DOEA 1KO8A 3AP2A 1E9DA 3W6NA 4PTLA 2BEJA 1GRRA 1BMFA 1RJ9A 2XOKA 4GDFA 3IUYA 2VIIA 2DR3A 4OK6A 1JXOA 5KDDA 4W7SA 1D5CA 1WRBA 3FTQA 1FMLA 4LOAA 2C98A 4W5JA 3U3OA 2D4HA 2ZE5A 4LHVA 2CCKA 4TTPA 2A7QA 2EFCB 1SVKA 5HCIA 821PA 4CDGA 2IXEA 2RKOA 3TGPA 1CTQA 4MYHA 3AF1A 4XJXA 5JI3E 4MDEA 1WE2A 3FMIA 2QPAA 3R9IA 2G6BA 2XNDA 3D6TB 4Q4HB 1UM8A 1E9CA 1XCMA 1Z2AA 3RS7A 1G18A 2J1LA 2FPLA 4A92A 3MFYA 1M1YE 1TPZA 4B75A 5DNYB 2GZAA 2GA8A 2WMOB 3BORA 4NU0A 1OHHA 5DYIA 1G6OA 1UADA 5JWHA 5EZ5A 4LV8B 5EXTA 2D3WA 5GADl 2MSDB 4JVMA 4OQXA 5TDHA 4BQSA 3TJZA 1N2CE 2GNOA 1XB2A 1FUUA 3THYB 4PAOA 3OFNA 2Q21A 1U8ZA 4EPVA 5EE1A 4F7WA 4E09A 4RCZA 1TEXA 3QPVA 3OZXA 4C0HA 5E95A 4QFMA 3MAAC 2O52A 4DLZA 1W0KD 5A5GA 3U6BA 2CLDX 1HT2E 3PEWA 4EJSC 5J4LA 2GXUA 2RGCA 1MH1A 4DB4A 2OHFA 3NBYC 3Q7QA 3MWJA 1HE8B 4EIWA 2WTUA 3T15A 1IN8A 4QJ4A 1UDXA 2FSHA 3B2EA 3MLEA 3MRSA 3OIWA 2WWWA 3SC3A 2WSMA 5LD2B 3RRYA 1JR3D 1QBKC 2ZRBA 1OE0A 1FX0B 2IYSA 2RHDA 1EXMA 2QT0A 4IEIA 2A5DA 2OT3B 4V0MA 5HTKA 1CLUA 5FL7D 2IBMA 4FWIB 4KU4A 3ONWA 3AM1A 2OBNA 3K9NA 4TYQA 3C14C 3TR5A 2BBOA 2JAQA 2WOOA 2Z0MA 1JR3A 4XOIA 5BYKA 1NN3A 1CS4C 5C46F 2JLYA 3U7FB 2QSZA 4QJ5A 5SZHB 5IT5A 1JQLB 2JJ1A 4ILEA 4Q4LA 4PO9A 3I1FA 1KZGB 2VP9A 2F6RA 4M8NE 4CEHA 3W6PA 1Q3TA 2ZRCA 1E3MA 1NG9A 1E2PA 1G21E 4HDOB 4NCIA 1T3HA 2BDTA 1P2SA 4R7ZA 3PR1A 1L7VC 1ZMXA 1CJKC 4I1VA 4OHXA 2VF8A 2BWJA 4XTCS 1E79A 2WKPA 3LY5A 3TLXA 3PQCA 2XEXA 4N1AA 4HUQA 3QXXA 4Q4AA 3BFVA 3AKDA 1NVWQ 1HQYE 1MOZA 1WMSA 1XEFA 4BFUA 1P2TA 2IA5A 3LV8A 4IOKA 3TK1A 1U2RA 2ZRLA 3QOFA 2GAAA 2PZEA 1Q12A 4LYFA 4RFSB 1J7KA 4RCYA 1IXRC 3K0CC 2H17A 1DOAA 4UNSA 3A4MA 3WNBA 4D6PA 5L3QB 1QHHA 4JKYA 2P67A 1KAOA 1ZC3A 4PZYA 2GBLC 1M74A 1Z22A 2BBSA 3GJXC 1TL7C 1CR4A 5CDFE 1NSTA 3JZMA 1OPXA 1LY1A 4MKHA 4ZO4A 1YR6A 5AJZA 3WNDA 4DLWA 1IJEA 1IN4A 3ADCA 3ZYCA 2IHBA 1EGAA 3CNLA 2JA1A 2QAGA 1N0UA 4URZR 4QHTA 3B1WA 3FFBA 3Q3JB 4OI1A 2ZI6A 2NPFA 3BFKA 2BM0A 3V4FA 4OQLA 2RHMA 2VF7A 2BMJA 2ANCA 4IXMA 1LF0A 4DLUA 4HAUA 3SE0A 1E69A 1GP2A 3WYFA 2GK7A 2WZQA 1OH5A 3PUXA 1Q1BA 4JYBA 3EPJA 4PSAA 3CM0A 3O8RA 1ZM3A 2OCPA 3FVQA 5BN4A 2AD1A 4JIMA 2KE5A 1TMKA 2GJ8A 2HV8A 4PC7A 2JDID 4FCVA 1KDTA 2VP4A 4HB4A 1BMFD 4FMDB 3U7HB 4CGZA 2X77A 3AF2A 2ZEJA 2IWHA 5DHAA 4JVSB 4ZI2A 2VO1A 1AS0A 1NIJA 2HT6A 3K09A 5LPNA 4QBFA 3THXA 2W2XA 1KHTA 4L9WA 4KBGA 3TBKA 4EPTA 1XZQA 1N25A 2EYQA 4JLDA 2FSIA 2BJWA 4RFSA 4Q47A 3CX8A 5G40A 2DWQA 5FI0B 1GNQA 2B7CA 1OF1A 2QBYB 1KSJA 2GWHA 5JZVA 1FX0A 3L82B 2IF0A 1W46A 5CJPA 2GJKA 4ASUA 3SJBA 2IK8A 2I1QA 3RSOA 4DVGA 4FIDA 3A4NA 2C03A 2ZRGA 1DARA 2ZYTX 3CR7A 3E2IA 3HU1A 2WHXA 2WIAA 3T5GA 2ZR0A 1N6LA 2ZPTX 3GJ8A 3PITA 3L0SA 1KKMA 1KSHA 2B7BA 1XJQA 4HB0A 4B34A 4MYTA 2D7DA 721PA 1DAGA 3EIHA 4I99A 1VPLA 1G5RA 4URWR 4EPRA 2WPDA 3EW9A 1LF5A 4JSYA 2VRWA 4UQOA 5J40A 2Z6VA 1E2DA 1KIMA 2A5YB 2IYRA 2ZSDA 1HY3A 3CNNA 4GSYA 4QGFA 1N6IA 3D31A 1E9AA 1N5IA 2WV9A 1QDEA 4D26A 2V4ZA 4LJ9A 3KKQA 3RANA 1WXQA 2ODNA 2HCBA 4LRWA 4TQAA 3RC8A 2OM2A 1CRPA 4TYWA 4B35A 3QXHA 2QTFA 2F1RA 3ECCA 1P61B 4FMDF 1DTSA 3NC1C 4KV9A 2OCAA 3CPJB 4FWTA 2J87A 4EFNA 3IEVA 2J0UA 3AVWA 3K0AB 3BOSA 2AKYA 1YRBA 1HV8A 1NJFA 3ZD7A 1RZ3A 5E7JA 4B3FX 2WM9B 2ZRJA 4G1UC 4DLRA 3ZLJA 1PUIA 5KNCA 1ZAKA 5FPKA 2O8CB 3EZ7A 5JWRA 3PUYA 3GJ6A 3H1TA 2O8BA 4GMDA 3HU2A 3VU9A 1QG2A 3OIVA 2DFTA 2P2LA 1NI3A 2N42A 4PAQA 4JBXA 2G9NA 3RRNA 2VSOA 1E99A 2EU8A 2ZS8A 4JLVA 5FBVB 5JJIA 2JATA 2IYTA 3L43A 4HLDA 5AJVB 1OKKD 1XBTA 2B6HA 3NHBA 4RZUA 3SI7A 4UJ5A 1NN1A 3L0PA 3QE0A 2RGNA 4QNRA 3A6PC 2JIZA 4JLPA 3MWLA 1OFHA 3QBVA 4V0NA 2JLRA 2ZS9A 1Z63A 1KJYA 1YR9A 2NQ2C 1P9NA 1ZW6A 4IJMA 5FOTA 3PXGA 3SFVA 1SVSA 5KU1A 1XX6A 2CL7X 1Q3HA 1F48A 1WBBA 1PJRA 1E2FA 1JJVA 1UKYA 3THXB 1E9FA 1US8B 4KO8A 1CJMA 1G1MA 1KI9A 3OEHA 2F43A 1G6HA 1E2GA 2VHQA 2YWFA 3LRPA 3QXSA 1FFHA 4PHFA 2XB4A 3CPHA 3TW4A 2CHQA 3GJ4A 1N5JA 3M6AA 4C0LA 1ZM2A 3RAPR 4D81A 1FQJA 2KWIA 5FOWA 4U7DA 4G5GA 2IEYA 4BFTA 4TZ0A 1G41A 2FWRA 3K53A 3OEHD 3M1IA 5CIWA 2HCJB 3A37A 3ZS8A 4QL3A 2XSZD 3PUWA 3VAAA 4ACBA 2A2ZA 3P4YA 4XVUA 3VMFA 1GIAA 3B7GA 1R6BX 2FN4A 2W83A 2AN9A 2OILA 4BE7B 2CMKA 5DI9A 2MSEB 2IHYA 5GJBA 1BYIA 1M8PA 2CHGA 3C41J 2C99A 2WJIA 5J5CA 5KNBA 3THWB 2C9YA 2LWIA 2D62A 1PLLA 4ZCIA 4C0KA 1DVRA 3SS8A 1W48A 2OCYC 4OHZA 2LCFA 1G5TA 2J0VA 2JCSA 2QGNA 1E0JA 2X2EA 3ZZTA 3C16C 5FTLA 1Y3AA 2J0QA 2IW3A 1G17A 1XEWX 4C4PA 3GEEA 4IRUB 4CT4B 4DZZA 4MKIA 1XZPA 1N0WA 1GL7A 2R8RA 4HATA 1OT3A 2H92A 2OFOA 2VP6A 4LPKA 5F98A 2BJVA 2FSGA 2QY9A 3E1SA 4ZKEA 1CF4A 1VCIA 2FE4A 2IF2A 1T91A 2CXXA 3ZVMA 1IONA 2DBYA 5DHFA 1SXJB 2QE7A 2PL3A 1XTRA 1OH7A 3GLHE 1EFRD 3EPKA 2OXCA 1GL9B 4BFYA 1VG8A 4C0SA 1IN5A 2BMDA 2PCLA 1OB5A 1EWRA 2ZSEA 3IO5A 1TF2A 1OJLA 3TIFA 4AKGA 2AWNA 5CB6A 1XDBA 4YQFA 5BW8A 2FFAA 5JHHB 3LLUA 5JCPA 4NE2A 3GJ3A 2WJYA 2QQEA 4B32A 5C4MA 1RIFA 2QMUA 3SBDA 2GCOA 3DEFA 4BUJA 4KCGA 5H70A 3GFOA 4XWKA 4RZ3A 1W4AA 3OAAA 1XPOA 3GFPA 3Q72A 3F5FA 4POAA 2WBLC 5H68A 3C5HA 3QJYA 1MKYA 1U0JA 4TL6A 1DAEA 4P4SB 2R6CA 1PLKA 5KPDA 1ESMA 2JLWA 4TTRA 3DO6A 1NNEA 1RKBA 4F4CA 2QI9C 3GCGA 2ORWA 1Y63A 1G64A 1OYWA 3K0CA 3ZJYA 3CF6R 2REBA 1LS1A 1S3GA 1NJGA 3A1SA 1CULC 4IW3B 1TQ2A 2C77A 5EE5B 5KHOC 4CIDA 1K6MA 3WRYC 5JEEA 4RD3A 1AZSC 4TTQA 5TMPA 1VIAA 2WKRA 3WP1B 3AKYA 5FL7A 4A15A 2ZYVX 3RNLA 3B1ZA 3HWSA 3RABA 1QHGA 2GVZC 1SQ5A 1HTWA 3AH8A 2A5GA 4WA7A 4B47A 2QMEA 5CK4A 3I72A 2JASA 2D2FA 4HLUC 2W6ID 3P27A 5DI3B 1BO6A 2PT5A 4HZUB 3U44A 3U4QA 4URXR 2WKQA 3EWAA 3MJHA 4FI3C 2R6GA 1F2UA 4AURA 3CWZA 3PVSA 1ZVQA 5AJXA 3KQKA 1H8ED 3QUSA 3RS4A 2G0NA 1NY5A 4TL9A 2ZSBA 3SN6A 2YJTD 2J7PA 1CJTC 1MV5A 4LJ4A 1G8GA 4EPXA 5FUVA 2NO6A 1OV4A 4FCTA 2XJ9A 4C7OA 3W5JA 4LJ8A 2GVDC 1S9DA 1M7BA 1W36B 1IQPA 1XD2A 2BMFA 1WF3A 4RD4A 3NBFA 1J70A 1VCNA 4G3XA 3K9GA 1U81A 1ZRHA 4CVNA 2WOJA 4DLTA 3ZIAD 1KJZA 1KI6A 4D80A 3IILA 4P31A 2HLDA 2CNWA 3AVYA 1M7HA 1E0AA 1DO2A 1JXMA 3KKMA 1G8HA 4KFRA 4MKGA 5F9FA 2ZSAA 2HXSA 1XEWY 3K0AA 4LC1A 2WVJA 5FTJA 2XX3A 4US0R 4F38A 4JLKA 3UATA 2CK3D 2HJGA 3FKSD 2C96A 5DN6D 1DAMA 4XVRA 4JLMA 3RS2A 2QN6A 1G20E 3GLFA 5JFGA 2ZIAA 4XD7A 4YXWA 2ZI3A 3QVUA 1FUKA 2JJ2D 1R8QA 4TLCA 4OK5A 3TE6A 1S8FA 1W2HA 4RY2A 5CJ2A 4DCTA 3AF3A 2PJRA 2O8BB 4GZMA 3JVVA 3VKGA 2O8CA 3CH5A 3F8TA 4LY6A 621PA 5E4FA 5JHGB 3QKRA 3MJRA 3WMGA 3WMFA 1VECA 4B74A 1IJFA 2PLFA 3P26A 2Z4RA 5TV2A 1R7RA 1ZUHA 2D7CA 1U99A 2VEDA 3Q7PA 3TQFA 4CW7A 5DO9A 3EPLA 1G3RA 5BYJA 1E9BA 3EC2A 1UKVY 1ZM9A 3HP1A 5BQ5A 1DEKA 4MRNA 3I8XA 4M1YA 1T4GA 2XTNA 1ZJ6A 3W3AA 2WWFA 3L8ZA 2ZJAA 4DKXA 2BC9A 2GZHA 3SYNA 4A1FA 2VHUA 221PA 4B2LA 2VP2A 4NP6A 4M9ZA 4DHEA 3TUJC 1EESA 2XJ4A 1NLYA 3ZQJA 4PHTA 3R9XA 3AVVA 2FG5A 3MG9A 2ZAOA 2CLCX 1TQ6A 5L3SA 4U5XA 1CRQA 4XIGS 2IYYA 1IBRA 4BWYA 3QF4A 4CRWB 1XEXB 2RB4A 1X86B 1IN6A 1EG7A 3BC1A 1G7TA 1NIPA 3B1YA 4XD7D 2F3TA 3QXCA 2P5SA 4PQRA 3TMKA 1DAFA 2DFLA 1YJ5A 1QF9A 2CDNA 3OF5A 2QE7D 3AVUA 3KKOA 4AG6A 2FV8A 1Q1QA 5H8WA 2RH5A 2A78A 3B60A 3EIQA 5KSZA 1W5TA 1ONBA 4TMVA 1ZD8A 4URYR 2P6NA 5EE0A 3QXJA 3O47A 4OYHA 1COWD 3GLIB 2G3YA 2H1LA 4FCWA 4LYHA 1P9WA 4RKEA 2WJGA 2O8FB 1T3SA 1KI3A 4C2UA 2VP0A 1XMIA 3ZH9B 4OQNA 1E4VA 4O0MA 2CNWD 3F0TA 1A82A 2R9VA 4LGMA 4Q4HA 1KKLA 4BEJA 3LBHA 5CM8B 2OV2A 2IWRA 2V9PA 3R7WB 3IBYA 4BGDA 4QHYA 4MRSA 2FPMA 2V1XA 1UKEA 1PV4A 1Z0DA 1N6OA 2GILA 1Z47A 4CEHB 5J4VA 1E79D 2AFIE 3CUEF 5KOYA 3SQWA 1W7AA 3SQXA 1W0JA 1E9SA 4MRPA 4NKRA 4WOPA 3CX6A 4UNQA 5CYOA 2Q9BA 2B8WA 4LBZA 2N46A 3U3KA 4DLSA 4B73A 1GWNA 5E7MA 2C5LA 2RAPA 1DG1G 2D2EA 4H1UA 5IK2D 2GCNA 1LB1B 2ZJ2A 2ZYUX 2E9SA 5DGXA 1QG4A 1F6BA 3BH7A 3BE4A 4MKFA 5CLLA 2ZREA 8OHMA 2PT7A 3O8DA 3RHFA 4E22A 4A8JA 4M1WA 5EP2A 2GCOB 4MRVA 1HQCA 1US8A 2REOA 3KJEA 1AJEA 1OXUA 1KTVA 4IOLA 5JI2E 3K0FB 4HSEA 4P32A 1T5IA 3EA5A 4RZ2A 5HE9A 4GP6A 1E0SA 2P3SA 4HUTA 1Z6AA 1ETUA 1EFTA 1VG1A 1X1RA 3L2OB 1GKUB 4NCKA 2XZPA 1O3YA 1NBMA 5SZIA 3E5HA 3KQNA 1RPZA 4D4LA 4JLNA 4NYIQ 1KO4A 4KXFB 4Q18A 3WYAA 5JWOA 3U6KA 4QRHA 3CR8A 4JT2A 2WPDD 2XOKD 4MRRA 5IHPA 1I2DA 4PC1A 1XU4A 2ONJA 2C95A 1G8YA 1GITA
chains in the Genus database with same CATH superfamily
2G8NA 3PICA 1GUDA 2BF7A 2DQKA 5FR2A 3X2SA 5KS2A 1YBVA 4Z1MA 4DPMA 1NN0A 1U2TA 1ZXBA 5HS4A 2WWGA 3FWYA 1ZCZA 2RK3A 5DHPA 1EDDA 1DRVA 1JFRA 5ALIA 4B83A 2IPNA 2XMPA 4BWVA 1FFGA 1QAMA 2I6XA 1GG2A 1WCV1 1GAJA 3C8DA 2CNNA 3KOZA 1JE1A 3OX3A 2WHEA 3N70A 2IHTA 5TQ2A 3CVOA 1HEIA 2SCUA 1JT9A 3W7BA 5JRJA 3OX2A 1T6BY 3R0VA 1NP7A 3OCVA 4BO8A 5CLFA 2GZDA 1GNPA 1XZDA 5K0FA 2K7FA 1QFSA 5KYNA 3G6KA 4TUYA 2IEBA 3QLVA 2CNBA 4MPDA 1RLOA 3MTDA 4CM8B 4A6EA 1I30A 3QVOA 4B4KA 3AM5A 1UQTA 1GKIA 2C59A 1DRKA 2JRLA 4B85A 1HBJA 5IVPA 5ADHA 1SHLA 5SZKB 4HGYA 4KTVE 1G2OA 4M0PA 1QKIA 2B4QA 1UEJA 3G79A 1U98A 3I12A 1H3FA 2BGTA 2HADA 3QW4B 5KHAA 5KTKA 3WWCA 1UXKA 2R79A 2QTVB 2X2FA 2OO5C 4YGXB 5DTQA 2REQA 4GLOA 3LUAA 1SQGA 5LLSA 4C3VA 2VYFA 1J33A 4I9FA 2O2GA 1Z6ZA 1EUCA 3QEJA 1GN9A 3F98A 2JVJA 1UDBA 3QQ5A 4M38A 4QPZA 4XQEA 3GLHA 3P8ZA 1GAWA 2WUFA 3AHJA 5FL3A 4R6XA 2OOKA 4R2LA 4RKRA 4PRKA 2W98A 1OLSB 3IJRA 3O3NB 2GWRA 2Y05A 2J6CA 1AQUA 1T8RA 3O1LA 4U7GA 4XIFA 1Q95A 5IAJA 1XA4A 2YJ5A 2UZ3A 3D0KA 2IX9A 4QBGB 4C0BA 4PX9A 1JNYA 3T4EA 1FJXA 4QOSA 1ZK4A 3R09A 1H22A 1JQJC 1P9RA 5BR8B 4B44A 3LBYA 1BYUA 2V7BA 3PJFA 4LZPA 4M6WB 1FL9A 4UM8B 1DP4A 2BKUA 3NALA 3TN7A 2FVXA 2E4WA 4KIJA 3TGLA 1TKAA 3L0YA 2IEAA 1IZYA 5CX1A 3EYAA 3OPQA 1SBTA 3E23A 2O0HA 1PJTA 5K03A 3OCYA 4CT0A 4MVJM 3FTCA 5KJ1A 3GARA 4JJKA 3RF6A 2ODEA 2VJMB 3AUFA 1CF9A 3QH4A 4W5NA 2XNDD 1AK1A 1J2UA 4P2BA 1WSAA 1P6UA 5DFAA 1MABA 4KXXA 4EFLA 4HQFA 2XB2A 1ELOA 1RI4A 2IP1A 121PA 4MR7B 3NTRA 1FDIA 1GRVA 1R00A 5DOVA 2A1TR 1AXEA 1X38A 4ZAFA 1BH2A 1N7GA 1U0RA 2RGGA 4HEA6 3DL2A 1S3IA 3OMLA 4J4TA 4PSUA 2FZWA 2OHVA 3BHNA 3PCXA 5K9ZA 1A71A 1C14A 2BHRA 3ZCTA 1IBSA 4PPGA 1EX6A 5B1HA 2AQ8A 2GBPA 4XASA 2IZZA 2PX0A 5JECA 3HCWA 3LUHA 2PU5A 3HB1A 3QEAZ 3JTMA 4F3NA 3OESA 1Z4KA 2R85A 4NL4H 1H65A 4B3DA 4YACA 5ALNA 3NAGA 1ZZGA 1DRWA 3SX2A 4LHWA 2DF8A 4QQNA 5JXJA 3OIYA 4M37A 4QUJA 4UPEA 2W0MA 4P5EA 3C70A 3H5WA 1MW8X 5L3SB 1OBFO 4YAWA 4I6EA 2DQSA 1X1SA 5G3ZA 2XEDA 3E2MA 4GBJA 4PNEA 2HMYB 2Q3HA 3KLPX 5AKHA 1N1EA 2EDCA 2I0FA 5GJVC 2ZAYA 5BQXA 4LTDA 4K6HA 2QMHA 3CEHA 5FT9A 3JZIA 4E15A 1XCJA 3CKLA 4EAAA 3QGMA 3H6HA 2Q9CA 3P0EA 3VYRB 1JV2B 4CIBA 2X1VA 2BI7A 3TW8B 3DM5A 4TYPA 2FRVA 2ZVQX 2JF0A 4RTNA 4D41A 1KJIA 3DHEA 1KL7A 1OX4B 4HKTA 4IDOA 3RLFA 1N6HA 3T7EA 1XLUA 4NS1A 4C6TB 4DLBA 2WAYA 3UMSA 4BLWA 1CJVC 2X2PA 1GNRA 4IVRA 2H85A 3GLGA 3B9QA 1Z7EA 2JFGA 2WDZA 4LXUA 4CM5A 4MAFA 5TIIA 2Q3CA 3L7BA 3QKRB 1V1MA 4HAZA 1IYZA 4AO8A 4C88A 5J2TA 2BH2A 3L6OO 3NV7A 3AJAA 4YCSA 5K3AA 5I7FA 2HRCA 3QMPA 2PLNA 1GV1A 5IAEA 4M2LA 3SQDA 1K8YB 1NWHA 2XHEA 5FLXA 4WW0A 4ZZ0A 1M1YA 3NU1A 1DQZA 1LJLA 2YHIB 3I9FA 2DPXA 3Q0TA 3FYUB 3EC1A 1KBQA 3H2YA 3OZDA 2HC9A 4DUGD 4EYEA 3E9QA 8ADHA 4MVJP 4X1YB 5KNCH 1I1QB 3GA5A 3QOXA 3IPLA 4IG9A 5K3FA 5H80A 3W1WA 5LZ2A 2JLQA 2X7XA 3ANSA 4NONA 4KPFC 1YRAA 2BL4A 3A9UA 3DE3X 1KIAA 3M2PA 3WNQA 3V1NA 5KAPA 4LZJA 4ES6A 3T3NA 1EP2B 2WM8A 2DSNA 3I0MA 4FZRA 4F1KA 4G0QA 4NAHA 1I32A 3VPAA 1DJQA 1E2MA 5GOTA 4YRSA 3B2QA 2IDKA 1ILEA 1P81A 3G8AA 5DH9A 2GKSA 4TN1A 4G23A 2XF8A 4DC9A 2HREA 2GAJA 4GLJA 5IVHA 5A0FA 1UODA 1O97D 1QDLB 1OBHA 4KR2A 2D1FA 3LIIA 1L8QA 4UHHA 2AFHA 4XWGA 2NU9B 2HNAA 4QD3A 4DBVO 4XH9B 1QPZA 3T61A 1OW3B 2LCQA 1WCWA 1JU9A 1V4VA 2ZJ8A 3C3CA 5D87A 5AM5A 4GP7A 3TLBA 4R0MA 5ESRA 3EPPA 1KKUA 3D8SA 4HLUA 1UWCA 1XK7A 1VI6A 2BEWB 2XCOA 2RGDA 3F2IA 4AUEA 4J0HA 1H9AA 1KEPA 1UBNA 1W59A 3OPNA 2A92A 1D2CA 3DTNA 3CZPA 4PQEA 2ZSIA 4YMSA 3VR6A 1J1IA 2B5OA 2HXGA 3EGXA 1AGXA 5BN5B 2QLJA 4HDSA 3JQ8A 3JQEA 2GJ4A 3NAZA 4E2YA 4KK3A 3G8BA 5FUMA 3ZWNA 5LMZA 2I03A 2FW1A 1C2YA 1UFRA 4TKVB 2IUFA 3TLZA 4HDCA 1F0NA 1TLFA 1KI1A 3CRRA 3FYTA 3U1VA 4A8HA 2QW0X 3BRQA 4ZI7B 4OBXA 1FP1D 4QYIB 1JR6A 2A9VA 4IIJA 2O19A 2Y4OA 3OQVA 3BSWA 1HNNA 1JS1X 5JT1A 3GGPA 1CUXA 2GUWA 4QDXA 5DCYA 3V2IA 5FFNA 2HYDA 5HKKA 2DB3A 3FSEA 1RYFA 3PQDA 2B5WA 1P0MA 1R0LA 5BSVA 4MVJG 3WTCA 1XTBA 3CVUA 1TTQB 3FKJA 2XUZA 4NZ9A 4B3HA 1W4RA 1Z3IX 3TNYA 4DB2A 1D7AA 2PU7A 5IDVA 1JQKA 2PUGA 4H7KA 1ZRNA 3RAFC 3EW7A 3V7UA 1MJNA 4KDFA 1J2JA 3G59A 2WJ3A 1U8YA 5F78A 2WAAA 3HY4A 3OQIB 1KOFA 2XW6A 2EKDA 3HB4X 3VC2A 1CS0B 1SCNE 2DRIA 1YQTA 1M2NA 2HBYA 4FJ0A 4J8PA 4FGLA 4XOUA 2GARA 2ORIA 5E6SA 4EG7A 3HR8A 4LSGA 1DTWB 2W58A 2JAHA 1NVVQ 5FTKA 1IB6A 1X7WB 4CUJA 3DPUA 1R5NA 1VTKA 4XJTA 1ML4A 4NH0A 4A8JB 1Y7LA 4CCWA 2BEUB 4LHSA 3K2BA 5DI3A 5ALYA 4YP7A 2YCLA 2RHHA 3ZUGA 1QVVA 3U5TA 5KQGA 3V1UA 4BZQA 3I37X 2PJDA 3IO3A 3PQ4A 5DGCA 3D8UA 4BX0A 1IDOA 1OHHD 4PM4A 2B5VA 1DLIA 5F77A 4BPRA 3FE2A 1P2VA 3AB7A 1P0QA 3N3AC 1E2IA 3HWX1 421PA 1TAGA 2F9MA 1FSFA 1HE4A 3FCOA 2I87A 5EJ7A 4PE5B 3EAQA 1Q1ZA 1K27A 4R1OA 1Y42X 2O48X 1S2LA 4JJ6A 1L5NA 1LZLA 3H3JA 5KSOA 5I3CA 1MB0A 1QRAA 4Q7KA 4MYUA 1G8FA 2GEDA 2IELA 1SPBS 2WHPB 4NBLA 2Y71A 5HMLA 4WVFA 3TZQA 3Q98A 1H8HA 2XCQA 2ZJ1A 3I9OA 4WSOA 3U3MA 2G1AA 1QGUA 1DJOA 3QA9A 4LMRA 1A4IA 2BRUA 4X9XA 4ZDKA 4YS6A 4GM1A 1GNVA 4UZSA 2PPLA 1WR8A 4Z9XA 4IBOA 1VRCA 1JVNA 2UVQA 1WTAA 2PZAA 3QWBA 3B51X 4J0JA 1E1CB 2CNDA 1EKXA 2MMGA 1IIBA 2ZG6A 5DVZA 3R44A 1UDCA 1UT5A 4TQ9A 1V8DA 4ZPJA 4IP0A 2ZIEA 1BD3A 3MF4A 4YCLA 4M0FA 4TWAA 2QOEA 1PJSA 4I50A 1Z6QA 3ESYA 3QKSB 4HN9A 1XMJA 4COKA 1TUGA 3N2KB 3DE4X 1W8DA 1K5HA 3RASA 1AKRA 3SNKA 1J9ZA 3DDSA 3GK3A 5JY1A 2PKQP 2XODA 3PCTA 4IY1A 4PG5A 1IN1A 1QJCA 1NYQA 1LPOA 3KFVA 3LS2A 4RNCA 3WGOA 3ZE1B 3C87A 4R0NA 1OB2A 5DOZA 2Q7DA 1F1JA 5FXMA 4U7WA 2ZE8A 3A6LA 4HTFB 4YJHB 3WLIA 1H85A 1U1DA 1FTNA 5D6OA 1A2KC 1FW6A 1RFGE 3DUFB 5FPSA 4HAVA 2IE8A 3MPUA 4BKUA 5LNK6 1CJCA 2YOFA 1AZTA 2Z08A 2B92A 1LV7A 3IHTA 2IE0A 5EE3A 4AX8A 3N8KA 1K9SA 1LRKA 3A1EA 4BLOA 1OXVA 5EUMA 5HUJA 1N5DA 1Q3KA 3U16A 3MLAA 1WAMA 2QJWA 3K6KA 4LQDA 1PT5A 4WAUA 1L7DA 4YP0A 4N3GA 3SBOA 4U9IS 1VKHA 3FPHA 1NJ1A 3VFDA 1IZ7A 1B43A 4IIXA 3RFTA 3RQIA 4F6RB 4EA6A 3LP6A 3R9KA 4P7GA 3ICQB 3IMEA 1GQQA 3OETA 4GOMD 5BWLA 3LUBA 3PB3A 4G0VA 4WKBA 1T4CB 4RWZA 1PDOA 3STYA 1ZUIA 2JCBA 1A76A 5FQOA 2I8AA 2IZ0A 3GPLA 1DAKA 3MYRA 3RSZA 4AWXA 1XRPA 1OLXA 2GERA 2J31A 1D2RA 4KJZA 4W5QA 4RDHA 4CBVA 5LQRA 3ITDA 3BGOS 4GKKB 2ODTX 1CUHA 2VJYA 4WBNB 1U2EA 4WLFA 1SBZA 5AWFC 1F2UB 3KOYA 4ENQA 4NCJA 2CN1A 5DM4A 5JMPA 3QEMA 4BATA 3OZIA 1C9DB 4HH1A 1Q74A 3HXOA 4LBVA 4EJ0A 4OHCA 4PG7A 2GBIA 4BFCA 1HRDA 1P60A 2N0SA 2Q1TA 3JWIA 3KD2A 1ZISA 5TXGA 1WBJB 2VA8A 3L5KA 4J03A 5BW6B 4GWKA 5FP0A 5JCZA 1Y37A 1I2MA 1XMSA 1Y7TA 4K9DA 2AS0A 3NNNA 2O07A 3H2KA 4FXOA 4K81B 4YECA 5EQDA 1R9MA 1EGQA 3SS7X 4C7BA 4GZ5A 1NR7A 5ICEA 2PWZA 1IVNA 1L5ZA 2CF6A 3L1KA 3A06A 3AYZB 1Z7GA 2I4RA 2NSYA 1SHKA 4WKCA 1DZ3A 2QYHA 5AH0A 2AQKA 3FETA 3SU8A 4A36A 2H3HA 3AMVA 1L4YA 2CVQA 3CF2A 3KWMA 7MDHA 3N5CA 1YVPA 2JFVA 4NBTA 4TTJA 2H1OA 3JQ7B 4R9SA 4BX2A 5AVXA 1GHTA 3O6VA 1USVA 4S2UA 2IUSA 4GFDA 1VSTA 4PZEA 5ITZA 4N5LA 2NLOA 5EJ4A 1T6ZA 4WFJA 2VTEA 2IS4A 3FAZA 2AFHB 2NU9A 3UG6A 3EVBA 2X8WA 3K1YA 4MR9B 4U2FA 4P7JA 4GC9A 3F1KA 1JYFA 4AB1A 1EDEA 3K0BA 1RZRD 1F8UA 3M5DA 2FSUA 2VUSA 2CLOB 4E7OA 1RPTA 2L42A 2VSNA 5DHQA 3EVNA 3ITEA 3C5EA 2Q49A 1EJBA 4ZVVA 3EFOB 4E70A 4CG1A 2MINB 4EHDA 2W6OA 1NQVA 3UW1A 1FQOA 1KU6A 1YRWA 2ACWA 3LJKA 1WKCA 4I1IA 4UNIA 4Z0TA 5FBRB 5AK5A 4BUZA 2ZUTA 3O21A 1IM5A 4FILA 3WGHA 3ZDDA 2V96A 4INJA 3IQHX 4R4JA 3CLTC 4RFVA 3UUGA 1DC3A 1NVUQ 3ZXIA 1U2PA 3U4HA 5K8IA 3OZTA 3TLYA 1X7HA 3V46A 3CWCA 1YE8A 4OGWA 4RK0A 4BBZA 2XWSA 2RK6A 4ZMRA 2AK3A 4FZVA 1NQAO 3H5VA 1NBOA 1WMDA 2L82A 3DR3A 1I9CA 4YUWA 3QBTA 1ZK3A 5TGZA 1HL7A 3LLCA 4DZRA 1T6NA 1R3UA 5HX7A 5JQGB 1OGYA 3H0EA 1WUHS 3OLQA 4WIAA 3G8DA 1RMTA 1UOQA 2YUTA 1KU0A 3I73A 3R3WA 5ESXA 1YQWA 4IKOA 2QAIA 2FAXA 4LS3A 2ZUBA 1E8NA 3S1AB 2YN2A 1OLSA 2P4HX 4Z4QA 2NG1A 2FCRA 3AUTA 2OGZA 3SYKA 1Z2EA 3B20A 2MSWA 3MLBA 1E5XA 3H42B 4QU9A 2GEUA 5GM1A 4MQEA 4EUEA 1E60A 5TVGA 2PY6A 1NBMD 3QSYA 4ZQEA 1GQOA 2YW9A 3KXLA 4P0TA 3R2JA 5F51A 1KQ3A 3Q5EA 5KKNB 2ZYGA 5TQ0A 1EK6A 3IVGA 2J48A 2QWXA 2FR8A 3N8IA 3VU3A 5AKYA 1EAYA 2WVHA 3E27A 4FFRA 1M8FA 1V5WA 4DWOA 4U2CA 2NMVA 3KVYA 3O84A 2Z2ZA 4UDOA 1PUJA 2XQVA 2QU8A 2SHKA 3PI6A 2RI6A 3NVAA 2PXHA 5GONF 2IW1A 4M1KA 1ZDMA 4OMFG 1UBTS 3EMDA 5EJFA 1MQ9A 2J3KA 4OCZA 5CLQA 3ZTTA 4URVR 4KPUB 3UT0A 4BBAA 3VOTA 1IVSA 4RIEA 2E4ZA 4ARSA 1SVLA 4UNPA 1JMKC 5AHRA 1DEAA 5ALTA 3U17A 2Y76A 3HI4A 3OJEA 5IF9A 2A9KA 1YSCA 4F45A 4F92B 1GZ7A 5CT9A 3BIFA 3FMVA 3GFBA 1PL0A 2CK3A 2G7ZA 4Y2VA 3TLAA 4NZZA 4C3ZA 4CL0A 5K8JB 3EN0A 4FC6A 1BE0A 1HZJA 5CPFA 3OWXA 2VDJA 1GR0A 5AVSA 2GJAA 3L8DA 3FLBA 2QAGB 5BSUA 4WXPA 4YDQA 1OXSC 3CEJA 3IVXA 4I5DA 2OOSA 3ESCA 1Q7BA 3GZNB 4RK5A 1UXOA 1YO6A 1UZNA 4FLEA 3I1YA 2VJNA 4KDRA 2C3PA 1TU3A 2O3QA 3Q3IA 3TXYA 3V55A 3BH0A 2FOXA 1BXGA 2GB4A 4OP2A 4PY2A 4IVQA 3SQOA 3FNIA 5BN5A 3IJEB 3KJZA 4GX1A 5EJ5A 1MHTA 3G2MA 4AS1A 5CLJA 2WF8A 3O90A 1QKJA 2WA2A 1FSGA 3I2IA 5DW0A 5AK6A 4A27A 5B3LA 5L53A 1IHPA 2FPKA 1V9SA 3B5JA 4F91B 4W5RA 2BGRA 2CB9A 2OECA 1DBRA 2NUTB 4CM9D 5BNZA 1KY5A 4H0FA 4FUTA 2WI8A 3PEFA 2OKCA 4CQMD 4WCFB 4K26A 5E6SB 2BUAA 4YMTA 5E3HA 4DYDA 1EWKA 3GT3A 4JJGA 2NVOA 2ERCA 2V7UA 3L40A 3WIVA 3BAFA 5AUNB 1C8KA 3N0WA 3UHOA 3P9YA 1SMKA 1C8LA 2O3JA 2JIDA 3B7WA 3HDGA 4FR0A 3AHFA 4ALMA 4B3CA 3NHUA 1Z2PX 2QN3A 3EODA 3KQWA 3UPDA 1AF7A 3PPXA 4AX4A 1WB4A 3DLCA 4R1UA 3O8BA 4IWXA 4QICA 1IU9A 3LQQA 5HCNA 5GVRA 4D4MA 3PXBA 1ZGHA 4JLJA 1WNTA 1EZ4A 2FZGA 3PC2A 4FW8A 1X8KA 4G4GA 4HEQA 5EPEA 4MS1A 3U61B 1ZHHA 2D00A 3K9BA 1RYNA 3M70A 2YWHA 4FBMA 5B6JA 1ESNA 3F2VA 3GN1A 4Y2HA 5IBRA 1S5PA 3IVRA 5K20A 2PIAA 4PG8A 2NV2B 1G0OA 1C29B 4QYXA 3BERA 5ILQA 1U8AA 1ZY2A 2OB2A 2O2JA 3WJ1A 1EUYA 2YJ6A 2B4TO 4G65A 4HTFA 3KEGA 5GWXA 3G5LA 4RTPA 4DA4A 3C5WP 4YT4A 1YQUA 3W78A 2WSYB 1NQXA 2AMVA 2DVMA 4RLQA 1Q17A 5AVUA 1PNTA 3HKCA 3TB4A 3CJRA 4EX6A 3EARA 2FEMA 3HYNA 3N0TA 3P2IA 4JJZA 3V8NA 4ESOA 3C1UA 3NWPA 3ZDXB 2H1HA 5IG2A 3EYWA 1VIDA 2R7KA 5EIHA 4OD0A 4ALIA 4JKIA 4FT2A 2IPAB 2XTZA 3PSHA 3UCFA 1ISMA 5JSQA 3U5ZB 1TJNA 3HMQA 3T1YB 3BEDA 3LT0A 3LYUA 3CZRA 1M2VB 2PZMA 2BOVA 5E7IA 4ZAWA 1DXOA 1CE8A 3I76A 4JMLA 4I5GA 4OQMA 4W9RA 4TMTA 5L7YA 4P81A 2V7EA 3MHTA 1Z83A 1TIKA 4CLHA 1NONA 2I2WA 3L7NA 2ZATA 5LYJB 1T9CA 3A1VA 4QWMA 1CQIA 2GF0A 2I2AA 4M55A 4F6LA 5ALZA 5F7OA 2WYIA 1PWXA 2DBZA 3G7UA 3D7NA 3F7NA 2R00C 1JAXA 3SJZA 4BGIA 2R65A 5IVKA 1BXRB 1A7AA 3W34A 2CFIA 2FP3A 1MEEA 2BFEB 4RVHA 4R54A 3WGTA 5JNRA 4NYJQ 1X80B 1S96A 1QQ6A 2ODAA 2X8BA 1K6XA 4YJ3F 4B8ZA 2DTXA 5SICE 3WLQA 5CXUA 2I3ZA 4G85A 1GVNB 1F60A 1AMNA 2D5AA 3WQQA 1T5HX 3KU1A 4MW5A 1RJ9B 3DWIA 4PBRA 1AIPA 3STWA 3E1KA 4MAMA 4BMVA 1OFTA 4G25A 2XVAA 2NZWA 3NIFB 3PE3A 1OROA 1F51E 2ZYRA 4W9NA 5KYGA 2NM0A 2WQ6A 3MAJA 2JBWA 2NYAA 4H35A 4GYJA 4P4UA 4B3XA 4FKMA 2AZXA 3GAAA 3HRHA 1VHTA 2O6LA 1WVGA 3WR5A 1QF7A 3CXRA 4JSRA 4DXAA 1HEUA 2BTQA 2WP0A 2HXYA 3GXOA 4P1ZA 2RK4A 5JSZB 3PJRA 3FH0A 3IULA 3HXKA 4CUKA 2NU6A 3KZXA 4UEWA 3D43A 5LYJF 4BFSA 4X65B 1AB6A 3DNPA 5B36A 4ZEOA 3D6HA 3R9XB 3LLMA 4D4IA 1JG1A 3DE0X 4ERXA 1XTVA 2VTKA 2P2YA 3I9NA 2QMQA 2B8JA 2ONYA 5IT4A 4AKHA 3H2IA 4R0VA 4N5IX 2P69A 1NQWA 1VLZA 1XD2B 2PUJA 2VQDA 2X8AA 3TOZA 4B3GA 5C4GB 2FWMX 1WDKA 3K6JA 2NUTA 2HLDD 1YUMA 2Q1UA 5A1TA 2FPIB 5IAKA 1GPUA 2NIPA 3W8EA 1JDPA 1U7DA 2V4MA 2VK8A 6ADHA 2HGZA 4ZKDA 1Q1GA 2O8VA 2VSXA 1II0A 1XE3A 1XRJA 3TWOA 1BW9A 2YXLA 1XFAA 2P30A 1LCIA 1YHNA 5A6SB 2QVGA 5A2QA 4KFTA 3H9EO 3HUTA 4L5AA 3LH5A 2DHDA 4M1EA 1HETA 2ECKA 2ZRKA 3H18A 3F5DA 2ZRNA 3G3EA 4HNAB 2XADA 5LWHA 3OLYA 3R20A 3HCEA 5MF6A 5MN4A 3FSGD 3PCRB 3WZLA 4AY2A 5D7BA 1DCFA 1TVCA 1GG5A 1NRXA 2UYYA 3MCVA 3RVOA 3S2GA 1Z8NA 3O8LA 5C2JB 2XCTB 1G7SA 1PRYA 3HCCA 1JJFA 4HEA1 4EAQA 5C7YA 5H9WA 9ATCA 2PH3A 3DFFA 1YC5A 2F1OA 2R8YA 5L9AA 1KMHA 5ELLA 4MOWA 2DTDA 1FXUA 5HILA 4BEWA 3NGLA 4AKIA 4NH4A 5IS2A 2VCHA 4KQMA 2DKFA 3DW1X 3BJIC 2AT1A 4V03A 2VATA 3CF4A 3JYHA 3AESB 4TL7A 1DKLA 2VAWA 5AK0A 4TS9A 4KPUA 1G2IA 2P35A 3JYNA 1Z4MA 4L57A 3PFIA 2ZM5A 3FXAA 4II3A 1ZUNB 4PG4A 2XXJA 2J33A 4E5UA 3DMHA 5AKZA 1U0LA 3LDGA 3C2QA 4LGVA 3GIWA 4B6JA 3DDHA 1WMFA 4FHZA 4G4IA 1CY6A 4UKDA 5IH7A 3GVIA 1WCIB 4HYQA 2XE4A 2OCDA 2QXYA 2YZ2A 4JJEA 3VZDA 2FDXA 1CZHA 1JZTA 3H2BA 1W4LA 2R4TA 2VH1A 2V0GA 3JQAB 2PYDA 1YZKA 3EIOA 2HDWA 3IEUA 4HZGA 4NDZA 2GM4A 1O5IA 1YL6A 2XR1A 2A5JA 3DEKA 1JHYA 3LPAA 1EFVB 5DN6A 3GT7A 5ALJA 3KT8A 5L3RA 3S40A 5IM4A 4LXQA 3MCZA 1G5PA 5CFQA 3K9CA 1NLZA 4UHKA 3V8RA 4F9FA 1WUKS 2X0JA 3AX6A 3W6OA 4BO3A 4EVSA 3DMRA 1SD5A 3FMPB 3IBSA 1HDEA 4HX5A 5A02A 2PXAA 3TSCA 2X41A 1KYZA 2FX2A 1KVTA 3EE6A 3ILVA 1VKNA 5HGXA 1P91A 1EDZA 2RAFA 2HA3A 4OG2A 1MQ8B 1AA9A 1FIUA 2GRAA 3OO1A 3I6MA 1KETA 3BKWA 2L0XA 3A26A 3SR4A 1IAQA 2ZETA 4IDNA 4L0QA 1HORA 1P2GA 4M76B 2C5EA 2NXEA 3O93A 3R3UA 3RFXA 1J06A 1JR3E 3LX5A 1Z15A 2PEZA 3MTGA 2FEXA 2LW7A 4P3NA 3HJHA 2X5OA 4KGDA 1DAPA 4DT1A 2NAFA 2A3RA 5I7SA 1FY2A 1BCRB 4OXQA 3O82A 3TPZA 4EUNA 1CX9B 4H0CA 1XCBA 4I9HA 4ZQGA 5EOVA 3KQLA 1W88A 2ATXA 2H2FA 3Q7TA 4I1UA 4D56A 5LLTA 1TMGE 1WDTA 2K5UA 1S2DA 4DRZA 2YWCA 4RTSA 3OCWA 1T0HB 3ABSB 1ENZA 4NC9A 5G3YA 7ABPA 4QXOA 3O2JA 1YHZA 2WMDA 1P4AA 4O4LF 3AG5A 4DLVA 4QULA 2J8ZA 1TIPA 4Y30A 1ECPA 1HMPA 4MO9A 1G5FA 4D9NA 3N75A 4BLRA 3PLNA 4B5KA 4X54A 3ADOA 4G4SO 2QTHA 3IUNA 4F21A 4Q4JB 4LPSA 3I28A 3P94A 3VO1A 1ZMBA 4QLOA 3O3OB 4A0GA 4TMWA 1RAEA 2RE8A 3CPEA 3MXTA 3MD9A 2IS6A 5EJMA 1PJAA 3IR7A 1L3IA 2HU2A 4JL8A 3KJFA 4AZTA 5JQGF 3IP3A 3CCCA 4HX9A 3S68A 4CR7A 4EFKA 2Z2YA 5J1SB 1JVBA 3MS4A 3RBAA 2H29A 3MRXA 4M60A 3ZHTA 2N75A 2X8JB 3FMOB 1VL2A 3R0IA 3SDZA 4MV9A 1JLKA 4K03A 2EX4A 2JFZA 5B1IA 2BMVA 4QJ3A 3LZDA 4QRDA 3IKJA 4NBNA 3UA4A 8LDHA 1QIEA 1Z5UA 5BV0A 4U00A 4WXHA 1KWGA 1M1ZA 3QWAA 4NYMQ 4NDAA 4DMCA 5BP7A 3EX7C 3SSNA 2UZ1A 1XZHA 3PL5A 2JGRA 5CX1B 2Y92A 5B5SA 1PO7A 2P0AA 1NDQA 4CZ2A 1V41E 1CNFA 2TSYB 4GRIA 4KGXA 4UCQA 4URFA 3G82C 2CL6X 3C1AA 2WK1A 3FNRA 1A5ZA 1E0DA 1FOEB 2GETA 5FLYA 3WDMA 4AI6A 2G77B 3Q4GA 3ND9A 2X5XA 3H9CA 2XMZA 1SBQA 2QY6A 3JQRA 3L07A 4LCEA 4N54A 3URMA 5HQ3B 4QJBA 4N8DA 5KBYA 2R8EA 3P9SA 3KHKA 4LK2A 3N86A 3W4KA 3KSBC 2QTAA 3KWFA 4JX8A 3KCQA 1GDDA 3F78A 1Y4ZA 3DM9B 3Q10A 3EEFA 3OZSA 1SC6A 3IQXA 3B5IA 4P7BA 3B36A 3HYCA 2GDJA 3L0BA 4UREA 3EEIA 3ZZUA 1H23A 1X8JA 2ZIFA 5EJEA 1SCJA 3SKVA 5K8LA 1H0RA 4AMBA 3O4GA 5LSAA 1AUVA 1A2QA 3DVRX 5KYUB 2RG7A 3QLUA 4OHFA 5EPUA 2WYHA 4UFPA 4I4IA 5TS2A 2XBMA 1ULUA 4KIGA 2JCGA 4L08A 1RXCA 5EXDA 5EGSA 2LDXA 3PR3A 4G1CA 5CDSA 2JJ8A 4MIKA 4DMFA 3IESA 1G9XA 4X6LA 2ZUSA 3FDXA 4HOYA 4TSFD 4B7CA 5CVTA 3RS3A 1GCOA 3KDPA 1JNXX 4PRYA 5DXAA 1M0TA 3BCRA 5CA1A 2AJ8A 5KOHB 1TCBA 2V7TA 4Y0AA 3V42A 5EJ8A 1V2GA 5AXBA 1Y8ZA 4JUDX 3FFXA 1WPQA 2PUWA 4K46A 2OAEA 2WJ6A 4OGGA 2NPOA 3JWPA 2ZXFA 3MCAA 4OGFA 4QLBA 3SEFA 4RJIA 3F49S 5EXXA 3KQTA 3WMRA 3IAAA 4L1KA 3KUKA 4Z4HA 4Q03A 4DNPA 3OJCA 1NXWA 3FPCA 4FE7A 1B74A 1MENA 3K15A 3K8OE 3LECA 1ZXXA 4R9NA 4ZA2A 3HP4A 3LYLA 5CB4B 8GPBA 2XE7A 3QYPA 4AXXA 1ONNA 5IW8A 2FF7A 3EXG1 3RBXA 5JCOC 1AH2A 2P4SA 2BMAA 3OM1A 2JRCA 4EGQA 3QVXA 3LHDA 3NUQA 4L4XA 2H0AA 5EIWA 3EQ9A 2CFOA 2JCXA 2F1HA 1A9PA 3DEAA 4GKVA 4TXHA 4NBSA 2B69A 4L3OA 4LRUA 5CCXA 2I6FA 1KAGA 4X71A 2Z58A 1TYEB 3QOWA 4R98A 4E6PA 4Z7JA 5L4LA 4D0LB 4D3DA 2O8EB 3P9KA 3BE8A 3RVKA 3MIIA 2PCJA 4J6EA 4EX7A 4X1KA 3KAJA 4ZXPA 3R7DA 3Q8KA 1ZQ9A 2IYOA 4RIIA 1OSNA 2OCLA 4IFEA 1QNFA 2NYRA 3PDHA 4G0WA 2Z4SA 3KAKA 5ALVA 2ZWVA 3UAVA 4EW2A 1OAAA 4FHFA 1CG6A 3ZZ0A 1YFLA 1F2VA 3S1LA 3A28A 4KO4S 2XXAA 2YR0A 1I4TD 4LOIA 4NK4A 3I61A 3OLWA 3B3GA 1A2BA 1NJSA 4GZ3A 1KDOA 3RV3A 5FUQA 1P0FA 1B0UA 2V0CA 2OR3A 4EYSA 3IIMA 4MLDA 4YWJA 4F4IA 1UK6A 1TPYA 1Z8FA 1XVAA 4UDYX 4WZBB 2CXNA 1XRNA 3FOAA 4BNTA 2PUTA 4ZT3A 3QHAA 3K7EA 3JYOA 1EQ2A 2ENWA 5DYWA 5KYXA 4ZEVA 3O74A 4FDLA 4S1NA 1TT5B 1F6WA 2QGFA 1A9RA 2JAPA 3G2PA 4KWEA 4L0DA 5EIAA 3D2AA 3HZRA 1DNPA 3D4BA 4L5YA 5M5BA 3WADA 4YJGA 3PUKA 1P7YA 5B4TA 5JAHA 2HB6A 1CY0A 4BWFB 1E5DA 4IJ6A 2C9MA 4Q48A 1DWUA 3ED1A 3QKTA 4CGYA 4PZDA 2Q4DA 3OA0A 4D8WA 1QCYA 2AXEA 2D2IA 2DQYA 3DKKA 3MGBA 3BHMA 1Z0JA 1PSWA 3WRXC 4RKQA 2FEWB 2DH6A 3ZDEA 3G6WA 4OQFA 2HPZA 3GLGE 3E9RA 1NYRA 4FFLA 4I66A 5IN4A 4TKUA 4R41A 3BMNA 3RQSA 1U6KA 1A8PA 1NMZA 1VB3A 2QM3A 1YB4A 4KYIB 5EZYF 4E7PA 1W36C 4FB5A 1ZGGA 3PJGA 1ZNXA 3AI1A 4CMKA 2NZJA 1YZGA 2QR5A 4NG4A 5HKLA 3R23A 3EJ6A 3PT5A 5BNWA 3CNHA 1JFSA 2VJCA 1J4AA 3AVPA 5IEJA 1RI2A 3EVCA 3JW8A 4B2YA 2REQB 5G41A 4CETA 1Z68A 3WJ7A 2I9PA 4JT4A 1ZNZA 4QYWA 2Q6VA 1ZK2A 3AHIA 5I9LA 1XU9A 1VYUA 4NCNA 3E5NA 2IUTA 4LXYA 3KZKA 1QH8A 1XC7A 2ZE6A 3ZJ5A 3GG9A 4B6QA 4KBYA 4ENVA 3QITA 2FK7A 2AZDA 2HH9A 5IDQA 2WUEA 1A0OA 3BCUA 3LXXA 1GPKA 4HQ0A 2R1VA 4K6OA 4J6FA 2VDKB 3ORRA 3ROGA 3QXGA 3PENA 3LD9A 1XT6A 4RF3A 3MWGA 4X63A 4TGLA 2JFNA 2YS6A 3HCFA 4BEBA 1SHZA 3DBRB 4LX0A 1RRMA 3DVAA 2J32A 4OEHA 2GPBA 4A9AA 4QFBA 1RRCA 4C4ZA 4DR6B 3GGCA 3EDRA 4PO1A 5ELMA 1XPUA 3OE4A 2HMTA 4NVRA 1LK0A 4LNUA 2B99A 1C8VB 2JGAA 1JLLA 2QGZA 1QIFA 3LW7A 4FNAA 3RUHA 3VZRA 3WIEA 3BK2A 4G5OA 5JCJD 1LBTA 4OQPA 3KEQA 3DOIA 1K89A 1T2EA 4YRPA 3I9LA 1MRZA 1I4DD 4UC0A 1KAMA 3OH8A 3RHSA 4H31A 5TNXA 2HWXA 4UW9A 5EMLA 1E7WA 1OYYA 1DKPA 1MABB 1JDNA 2Z3ZA 3BMNB 4OFZA 4UUAA 1JT2A 3UWKA 3SOPA 5HZHA 1G7CA 4KN6A 1GKKA 5TF4A 1TK2A 2XTAA 5IM4F 1CVLA 4AJOA 4EY5A 1K6IA 3AXTA 5CNIA 5B4UA 3WFJA 1CUCA 3NNDA 2HEIA 4ARIA 4F0JA 3ZWYA 4A8TA 3LPCA 3QVLA 5EINA 3O8NA 3W06A 4DQ0A 5F23A 4KMOA 1BHSA 1Z18A 2IXDA 4TS4A 3WSVA 1P4HA 2QLMA 1TO6A 4L3WA 3IUQA 5EFOA 5F1PA 5HZMA 2JLVA 3AHGA 2HN9A 4M1MA 5IN5A 2B1RA 3QUCA 2OZKA 1LS6A 4H59A 2XXAB 2IVFA 3O9ZA 4PS1A 2YN4A 2MSCB 2QX7A 4DA6A 3CLSC 5C37A 2WU4A 1NSYA 2FPOA 2J45A 1F0YA 3LX4A 3AEUB 3ICWA 4JJAA 1QO7A 1QS0A 3GUYA 3NOOA 4Q34A 5CXSA 4ESEA 2FRDA 1BSVA 3TQCA 5BR4A 2H0QA 2XB8A 5KDOA 1RJFA 2LKCA 3LZ6A 4MQEB 1NVVR 1V3TA 4EUFA 4YUXA 5ALHA 2CYAA 2NW6A 5DBFA 4MUBA 1XHLA 3TRKA 4TKZA 2H48A 4JLBA 3ZE7A 2I33A 1G98A 1NGSA 2H3EA 3PGVA 4YMUA 2IU6A 2GM5A 2QPTA 3IKVA 4UDNA 2QA5A 3BCSA 2ZJ4A 3H7IA 2QW1A 3O4IA 4YRNA 4OJMX 2Y1CA 3IBGA 4OJKA 1OXKB 1FDUA 1P4JA 3OF3A 4UD2A 4YJKA 3DEYX 2EZ9A 3O2SB 4RE6A 3WSTA 4OX9B 3NNSA 4JDUA 5EFZA 4BTVA 1A77A