1Z6XA

Structure of human adp-ribosylation factor 4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
175
Chain Sequence
TISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 4
publication title Structure Of Human ADP-Ribosylation Factor 4
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 54
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z6xA00
3U3RA 1Z2AA 2VH5R 2JLQA 1XPRA 3CUEF 2O8BB 2IEYA 2ZYTX 5CDFE 3TUJC 4M4SA 3T06B 3BIFA 3GJ5A 1S1MA 3MWJA 4Z54A 4IFBA 3AF1A 2AKAB 4Q18A 4L9SA 1OXXK 3AVOA 1NSFA 4HB0A 2FA9A 1UDXA 3ECCA 2V1XA 2ZSAA 4KO8A 4M1TA 5KSYA 2IUSA 3VKGA 3EPKA 1XD2B 3L0IB 1BH2A 4KAXA 2ZIAA 4IDPA 4B3CA 1E2MA 4DDTA 4MKIA 1JI0A 1QHIA 4Z1MD 4F91B 4RD6A 4X8OA 1TUIA 3GJ0A 1NJFA 4DJTA 2YKGA 2JJ2A 2R9VA 1JR3E 2JLXA 3SJAA 3EX7C 1R8QA 4B48A 1N6LA 2OESA 2DR3A 3ZD6A 5FL7A 3IIMA 3RS0A 3SS8A 5HCNA 2ZRAA 3SEAA 4YXWD 4LHWA 5TV2A 4P4SA 4JL6A 2QL6A 1MRNA 4YMUA 5J4VA 3TUZC 3D8BA 1OYWA 2P65A 1OH5A 4IVQA 1U81A 1HA3A 4AYTA 2DFLA 4JZKA 1NN3A 1YZNA 3X1XA 4MRVA 2GJSA 2ORWA 4WXPA 5CYPA 1W4AA 2FPMA 3CX8A 4NYJR 3K0AA 2L0XA 2IXFA 4HUQB 4P4TA 1N6RA 2P67A 1F2TB 1EFRD 4BE7B 4G5RA 2IS1A 1XMJA 1ZD8A 2R6FA 4YXWA 1E9DA 5SZHB 1I4TD 4ZI3A 2REXB 2SHKA 3BJIC 3CH4B 2TMKA 3H86A 4RD4A 3WNBA 4LK2A 2VP6A 2O52A 2GXUA 3BB1A 3PUWA 2IHBA 3SDZA 4UNRA 3KQNA 2W0SA 4QOSA 4TYWA 5IDVA 3EZ9A 2HYDA 5E95A 4LJ8A 4AG5A 4PZYA 3U60B 4Q7LA 4A2QA 1QVRA 4IHQA 4LWZA 5H70A 5KO2A 2FDCA 5FTNA 5JJLA 2ZUCA 1JQLB 3GP8A 3ICEA 3AKCA 4C0HA 4P3YA 2PLFA 4X8LA 3A4NA 4EUNA 4ZDIA 3TMKA 2C9YA 5HZHA 2WWFA 3THWA 1JAHA 4II7A 4LUCA 3W6OA 2YINC 4NE2A 1KAOA 3AVYA 4P0TA 1L8QA 2F6RA 4DXAA 1VYUA 1NY5A 4DLTA 3OEHD 2ANCA 1E99A 1NJGA 3RWOA 4JLPA 3X2SA 1NMZA 1EESA 1HQCA 2AK3A 2AWNA 1WBDA 1CBUA 1SVSA 2NPFA 4LC0A 2D4HA 2OFXA 2X8AA 2ZAMA 1YZTA 4US0R 4ZCMA 2RCNA 1ZUIA 3TSZA 421PA 1UDWA 4L8GA 4LBYA 5DO9A 2QQEA 2GEDA 2G9NA 4ACBA 1GTVA 5AWFC 3VKHA 2JLRA 4AKIA 4C0LA 2C9CA 4Q7JB 1KI7A 1Q21A 3QPVA 3PG5A 1Z2CA 1WB9A 1A82A 1BS1A 4LJ7A 1OT3A 4LYJA 3I4LA 1N6HA 5KDLA 1G5RA 4DHEA 3H1TA 1ZNXA 1U9IA 3HPQA 2NO1A 4BLSA 5EE3A 4HDOB 4US1R 1P75A 521PA 3ZVRA 4CGZA 4AKGA 4MUBA 4CF7A 2F1JA 1N5LA 4TL9A 4DEYA 1M6NA 3EG5A 3IQWA 5FPSA 2ZRPA 3NEJA 4O25A 4UQOA 4BZXA 1Z08A 3PUVA 3NVAA 5JWOA 1HV8A 2FG5A 3CWQA 1VMAA 2H1LA 1LTQA 1P73A 3BB3A 4HAUA 4PPGA 4RKFA 3UMSA 1TU4A 2A5DA 1KI6A 2GF9A 1FNNA 3P4YA 1DAHA 4ZCLA 3RAPR 4E07A 4C2TA 4LYFA 1NLZA 5EUQB 1LB1B 1KO5A 1N3BA 3L0PA 2E9SA 3RSOA 2QGZA 1YRBA 3EIQA 2QMHA 2FWRA 1IN6A 4Q1FA 2CHGA 1G17A 1R5OA 1Z47A 3G5UA 3W6PA 1XRJA 3LDAA 1G3IA 4TMTA 2GDJA 1W44A 1G3MA 2I4IA 3PXGA 4QG7A 2O8EA 2ZTSA 1YR8A 4JKIA 4G01B 1ZIOA 3CRVA 3A58B 3FKQA 4UKDA 2OT3B 1Q3HA 5DHFA 1UBFA 1A4RA 1IJEA 2ZXUA 4YMVA 3GEIA 2UKDA 3QBTA 4MKGA 3THOA 2FF7A 3ZIAA 4E22A 1GL7A 3QKUA 3KJEA 4EPTA 1SULA 2R6CA 5A4JA 1OH6A 3SBDA 4Q4JA 3C8UA 2D3WA 4NP6A 2VTKA 4M9ZA 1KO4A 4ZV4A 2GAOA 5LB2A 5P21A 5LPNA 1KNQA 3X1YA 3LBHA 2J7PD 2OM2A 1OYYA 1G7CA 1P9WA 1NL3A 1Z0FA 4KYIB 3THWB 1GFIA 4Z8XA 3KUCA 4RFVA 3LVQE 3SHWA 1NLYA 5JI2E 4WOPA 4JYCA 4AK9A 1CJUC 1DTSA 2F7SA 2RGNA 5FUWA 1E0SA 4A1FA 4OK5A 2GILA 4LV8B 4DDWA 2C03A 2KSQA 1LS1A 1T9HA 3L43A 3UK6A 5CB6A 4LCBA 4D4KA 1W7AA 2NG1A 3GLIA 2ODWA 3B85A 1WE2A 1N5KA 2ZSBA 2FFQA 1ZW6A 4CZ2A 2YWFA 5FUVA 3B60A 2QP9X 1VECA 1ZM7A 2BCGY 4KXFB 3T35A 4HEJA 4A2WA 1G5TA 1NBMD 1DOAA 3OIWA 2BEKA 3CRMA 3EIHA 1S4QA 5JEDA 2IL1A 4JIMA 2JIZD 4XD7D 1KDTA 1F60A 3DL0A 3OF5A 4C30A 721PA 1E2HA 1IOZA 2QTHA 5IRCD 3CIOA 4GP7A 4FMCB 2EFEB 5E7MA 3PCRB 4JJZA 1MV5A 3LW7A 4OI2A 2IYTA 4BPBA 4W5JA 2JLWA 2A5FA 2CLSA 2ZPTX 4EPYA 5E7IA 4NCNA 1LS6A 3GPLA 4UXIA 2E1RA 2BBTA 2QN6A 1K8RA 2PT7A 2WHXA 1NBMA 4HYYA 2YWEA 3GEEA 2JATA 4BFUA 2QMOA 2HF8A 3RANA 3ZD7A 3ND9A 1A2KC 2VHJA 3GLHA 2CJWB 3DM5A 4XD7A 3U7GA 2GZAA 3VR3A 3K09A 2PLRA 4N3NA 2CK3D 2UZ3A 4KFSA 4TMWA 5FOTA 3GJ6A 4C2UA 1NIJA 3SYKA 3R8FA 4PHFA 1AZTA 1DAEA 1ZAKA 4PX9A 1JNYA 1IXSB 3IO3A 3GLFB 3QXHA 3K70C 1UJ2A 3EPHA 2PZGA 2HEIA 1R2QA 1GITA 2FN4A 4LJ5A 4M53A 1ZYUA 2R6AA 4PAMA 2G1KA 3AP1A 5HE8A 4OI1A 1J8MF 2BVNA 2WKRA 3LFUA 2EU8A 1AS2A 1KI4A 1HYQA 2EFCB 1AS0A 4NU0A 3WHKA 2CK3A 1MKYA 3BFXA 3CR7A 4BASA 1COWD 4M1YA 2OCPA 3FHCB 3GQBA 3TBKA 4DLYA 4IDQA 1EFTA 4JLJA 3C4JA 1S8FA 1TQ2A 3KKQA 4HLQB 1XBTA 2ZE7A 5A0FA 5KDOA 4KITB 3REGA 4TZ6A 1KNXA 4DLUA 4BFVA 1H8ED 2OE2A 2PMKA 1OIXA 2A3RA 2BKEA 3MD0A 3AKDA 4DCTA 3O47A 3EZ7A 4B71A 2FV8A 2NPIA 3HDTA 5CM8B 3A4MA 2FGKA 1ZM4A 2QT1A 5TDHA 1UADA 4C4PA 4QC2A 2ZETA 4YMSA 2GJ9A 3SQWA 1GZSA 3W90A 1D6JA 2FFAA 4WZ6A 1OH8A 1P6XA 3K1JA 4S35A 3CB4A 4IXMA 4CT4B 3RLFA 4LJ4A 3MSXA 2FPLA 3QE0A 4MRNA 3RRZA 1WXQA 2Q9BA 3B1ZA 4C0AC 1OHHD 1WCV1 3OIYA 4BLQA 1GIAA 4JLNA 2GCPA 3T1OA 4BZPA 4M2LA 1SXJD 2ZSEA 3G82C 2QSZA 2QP3A 1TTTA 1FQJA 1V5WA 2FNAA 2GA8A 2P5SA 2QGNA 3GLGE 4OHXA 1FPMA 4LDJA 4PC2A 3BAFA 2XB4A 1IN5A 2KWIA 4KSBA 1QHHB 1PUIA 3TAHA 4WW0A 5FPHA 3K0SA 2OO7A 5C1BA 1G18A 221PA 2QI9C 3EARA 1P61B 3THXA 1EFUA 5FBLB 4YC7A 2ZR7A 1U0HC 1VYVA 5G3ZA 1SXJA 4A0GA 4HAWA 4JLBA 1YKSA 1T91A 3UPUA 4KHZA 1G16A 4GBMA 2EVWX 1L4YA 3RDPA 6Q21A 4KFRA 4XVUA 2RMKA 1E94E 3CWZA 4LJYA 1XCMA 4BLRA 3DO6A 1LNZA 4EPWA 2BHRA 1P60A 3J81k 5GADl 1GKIA 3T34A 3I62A 1XB2A 1NSTA 2PCJA 3KQKA 1SZPA 2O8FB 1M7BA 1YVDA 2B8WA 4JJKA 1J90A 1GNPA 1ZINA 1PVOA 3RVBA 4OI4A 4GI7A 1HT2E 2QMEA 3B2EA 3U61B 1UKYA 1DAKA 2Q21A 2O8DB 2BOVA 4PO1A 5HPYB 5J4HA 4X8HA 3NC1C 1E9SA 2HLDD 4IDHA 3GEHA 4NHOA 4CEHA 4N1AA 2R2AA 4IW3B 4PC1A 2H16A 4BLTA 2Z6VA 3U2QA 1QVAA 4DSTA 2PZEA 1G4AE 4HZUB 2CNWD 2P6RA 3IUYA 3VAAA 4FW9A 1KI3A 3OIVA 2BBOA 2QAGA 3EPJA 4CIDA 1KJYA 2ZRKA 1YZGA 4ILEA 3I5XA 4AY2A 3UMRA 2UVQA 4E09A 4UNPA 3WXMA 1T5IA 1XPOA 4JMPA 5JRJA 1D5CA 4A9AA 4HB3A 4RY2A 1GNQA 1XEWY 4HB2A 4ZIRB 4DCVA 1E98A 3PUXA 1G3RA 2W6IA 3BOSA 5AJXA 2HJGA 3KL4A 4LPKA 4D0NA 1PJRA 2OBLA 3TSOA 5KPDA 3AP2A 2QM8A 1HY3A 4FI3C 2C04A 4TYNA 4KFUA 5IHPA 4B74A 2W6JA 4DLZA 1E1QA 4QBIA 4ZPXA 3EWSA 4B3DA 3K09C 2OUKA 1NN5A 1VCMA 1NMYA 4TZ0A 2V9PA 3T1QA 4POAA 3RS3A 3TVDA 3QPUA 2JEOA 2KE5A 1XCPA 3ONWA 1D2NA 4BEJA 5E7JA 4ASUD 1RRGA 3U4QA 4A8JB 3BC1A 4B43A 3X1ZA 4KSCA 1NP6A 2FGJA 4O2RA 2CXXA 2XJ9A 2EFHB 1U99A 2Z43A 2B7CA 3RHFA 4ACAA 4D4MA 2ZITA 1IY0A 2LWIA 1G20E 2JDID 4L4UA 1EK0A 3B8HA 3SFZA 1UBGA 2W83A 1CKEA 1GILA 3CRRA 4MUAA 4QGGA 2ZR9A 4Z8YA 1KSJA 2O8BA 3MMPA 4PANA 3AM1A 1K5GA 3GJ4A 3IIJA 4ASUA 2ZRHA 2OHFA 4Q9IA 4KVAA 5FTMA 1GOTA 1UFQA 4A2PA 1OB2A 2AD5A 2G1JA 1EWRA 1CR1A 1Z6AA 3QF4B 1Z0KA 1DO0A 4C0JA 3EA0A 1IONA 4RD0A 5BN5A 2V8OA 4ARZB 2VPPA 1UKVY 1W0JA 3L2OB 1VG0B 1J99A 1XD2A 1ZC3A 3ZVLA 5JWRA 1FMJA 2WMOB 5K8TA 1EGAA 2GBLC 4LYHA 1N5JA 4B6FA 4RZXA 2AK2A 3EWAA 1RKBA 1KMQA 1JR3D 1W0KA 1ONBA 2QU8A 5FPTA 5JHHB 3RS5A 1XD8A 4XTRA 4TYPA 2DFNA 3QXCA 2B6HA 1GRRA 2P5TB 1MOZA 1GVNB 2FH5B 2KI5A 3QNUA 1FZQA 2GZDA 2IYZA 4V0LA 3KFVA 1ZM2A 2V7QD 3TH5A 4I81A 1IQPA 3AQ4A 4A8JC 2OEPA 2ONKA 1AK2A 5C46F 3HJNA 4OQMA 1LV7A 2XTMA 3ETLA 3IPYA 1GL6A 3LRPA 3PIRA 4TQUS 4JVMA 4TTRA 3C14C 3NBFA 2ZRGA 5AK0A 3FPAA 3CLVA 4XWAA 3IHWA 2ZVQX 2VBCA 2Y8EA 4RKEA 2Q9AA 3LWNA 4NZYA 4FN5A 2OFWA 2QAGB 3KZ1E 1F2TA 1AA9A 4IOLA 2AD1A 3CZQA 4KI0A 3THYB 2V7QA 1QZXA 4HLCA 4UJ5A 3T5GA 1D2EA 3BH6A 3VR5A 5J4LA 1SXJC 4MGIR 1MO6A 3LQQA 4UNNA 1QHNA 5K8LA 2J3EA 1N6PA 1G19A 2MMCA 1E6CA 3W34A 3LV8A 2HF9A 3REFA 1G41A 2NO0A 3FHTA 1OLOA 4XJXA 4O3MA 3WNDA 4EFLA 4G5SA 3K9HA 4A15A 4DUGD 3U3KA 3V00A 1IBRA 4ABYA 1AN0A 4OI0A 2IYVA 3WBKA 3Q7QA 2CVHA 2XSZD 4QBFA 1FP6A 3E5HA 4IFEA 1W48A 3TQFA 1R0XA 1VCIA 2IYSA 4C7OB 4DIDA 4TLEA 2IX3A 1EWQA 4F4CA 4RCZA 2BJWA 3LVRE 3WYGA 4BZQA 4O0MA 5HE9A 3TLXA 1YRAA 2BMFA 2DFTA 2P6UA 3BH7A 3FVQA 1TADA 3BWDD 1XPUA 2XEXA 3TGPA 1E2DA 2AL7A 1VG1A 1XXHB 3B1YA 4YDSA 3ASYA 2ZRNA 3AVXA 1ELOA 1KZ7B 2D7CA 3AVTA 3M0EA 1G3QA 3KX2A 1XX6A 3P1JA 2FFHA 4OK3A 2HV8A 3P20A 3I92A 4ESHA 3I1FA 1WBBA 2ZI5A 2D62A 2IK8A 1C9KA 1H8HD 2ZRMA 4TWZA 2CE7A 3NDBB 1KK1A 2QAGC 1NN1A 4C3ZA 2VHCA 4V02A 4W9MC 3LW8A 5LD2C 1ESMA 4TTPA 1XEXB 4B35A 1P4SA 1FTNA 5HCIA 4EAQA 4V0KA 2WJVA 3LAWA 5F9FA 2DWPA 1FUUA 4QGFA 2A78A 4AKHA 4AI6A 4HI0E 3RNLA 1Q22A 3V4FA 3DZ8A 1TEVA 2BV3A 2Z0MA 3U3JA 5L8VA 4EPVA 1H8HA 3SE0A 1AM4D 3SOPA 1QHGA 1MH1A 1XTRA 3LO5A 4R9UC 4XIGS 2V6IA 5IF9A 1Z3IX 4UJ3A 1N0UA 5BW8A 1NG9A 5C18A 2CCKA 2HJVA 4KVGA 1QBKC 3VHXA 2VL7A 1Q44A 2AXNA 1ZNWA 3AGQA 3P26A 4Q1AA 2D7DA 5H68A 1D8TA 1ZP6A 3TE6A 2ZRFA 3O8RA 3HWSA 3AEZA 5EP4A 4Z1MA 4LYAA 4DDUA 3CH5A 2F1HA 2QENA 4PQRA 4US2R 4M0LA 1TQ4A 5FR2A 4TL6A 1YR7A 1EFHA 3UWOA 3MWLA 4Q19A 1O3YA 3HYRA 2JGNA 4DDVA 5JJKA 1CJMA 2B8TA 3UWKA 1NNEA 1MABB 2YHSA 3T12A 4XSGA 1NG1A 1CTQA 4RJLA 1SQ5A 4XVQA 5B64A 2IEZA 3F3YA 1XTIA 1ZBDA 4LV6A 4CT5A 1NKSA 3ZZUA 3HR8A 3IEVA 1IHUA 1I4DD 4EPXA 2ZJ8A 4L9WA 1Q1ZA 4MGZR 1Q1QA 2A5JA 4D6PA 3SQXA 1TUEA 2DPXA 4NCJA 4MYHA 3QEOA 2IF2A 4IOJA 2ZR0A 3KXKA 3PFIA 2PEYA 4IVRA 3BXZA 3KB2A 1EFRA 5L3RA 1M1YE 4OK6A 1BOFA 5KU1A 2EW1A 3RC8A 2BIFA 1MT0A 1YZLA 4NYIQ 5JMTA 4Y0VA 1XD9A 1OXTA 4Q7KA 4V0NA 1TL7C 1NVVQ 3MGCA 1VDZA 2VHUA 4LOAA 3VR1A 1BYUA 3SFVA 4URUR 4E5UA 3QG5A 3C15C 2XZPA 3X1DA 4DSUA 5CIWA 2W2TA 1OF1A 2F3RA 4PHGA 4Q1BA 1U2RA 2CHVA 1VCNA 2Q3FA 5E3HA 2ZAOA 2A9KA 1N2CE 2HDNB 5TVKA 3LH5A 1UBCA 3LQRA 2IF0A 1I4LD 2CCGA 3BORA 3EXAA 3OEHA 4U5XA 3VKWA 1KO8A 2WKQA 3SYLA 4JLMA 4PO8A 5KSZA 2EYQA 1DG1G 2VRWA 1CR4A 2J0VA 3BFVA 3PENA 3I32A 4TT3D 1DE0A 5EJEA 4OQFA 2ZS9A 1P9RA 4Q1DA 5TMPA 4LPSA 4V0MA 5DI3B 2ZU0C 2W2VA 1QRAA 1RZ3A 2FSIA 2JA1A 3CF0A 4DT1B 1DAGA 1ZMXA 2AR7A 1JECA 3BS4A 2CJWA 3D31A 4MKFA 1BKDR 1II0A 2I1VB 1CXZA 5F9HA 1Z0IA 3NBXX 1LY1A 1HT1E 2FMXA 2N42A 3CF6R 2DWQA 2GXQA 3FYHA 4PZZA 5CK4A 4KBGA 3QXXA 2PCLA 1R0YA 1SGWA 2VP4A 3GLFA 1Q20A 4G1UC 4L5BA 4TT3A 4PSAA 5D3MA 1KK2A 2WOOA 5HZKA 3K8YA 1P2SA 4LBZA 3RWMB 1KMHB 4M1OA 3SJBA 2WWGA 1X8JA 4Q4HB 4ERNA 3PVSA 3DKPA 4GPTA 4OHVA 4P33A 3U7EB 1DADA 2G0NA 1NF3A 1NVWQ 4M22A 2CL7X 2GJKA 2ZQ5A 1G7TA 1Q12A 5KSPA 3PJRA 2HCBA 1UAAA 2H18A 4BFZA 2XZLA 1FOEB 2WPDD 1I2DA 4Q02A 3GFTA 3HYTA 1T3LA 2CL6X 2YC2C 3PEWA 2V55B 5DGXA 3Q85A 1HUQA 5FBWB 4MKHA 2O0JA 3U3MA 1IN4A 4GP6A 1V43A 4F38A 2WIBA 3EASA 5KHOC 1CULC 5FBRB 2WBLC 3ASZA 1SVOA 2ZYUX 1QHXA 1M2OB 5TXGA 1N6KA 5FOVA 3SN6A 4B34A 4IVPA 4QJ3A 4W5HA 2XZOA 2WICA 2Q6TA 3U5ZB 3P4XA 4P32A 4FWIB 3TR5A 2K5UA 3TIFA 1AS3A 3CPEA 3ZZTA 4JLAA 3TVTA 3NXSA 1RVDA 3V9PA 2REOA 1JJ7A 4RZ3A 1AGPA 3MJRA 4Q9LA 5AR1A 5F3WB 1D2MA 2OCBA 1KSHA 1US8B 5SZKB 2ANBA 4D80A 3A1WA 4AWXA 3DOEA 2IS4A 5EXTA 3VTKA 4DB2A 2ZJBA 3EC2A 3E2IA 3RRNA 1QHHA 1UKEA 1A5TA 3I61A 4GMXA 2J46A 5GJVC 2XNDD 4G5OA 2GAAA 2J7PA 1WDTA 5EE5B 1N25A 1SVMA 2JJ8A 2V6JA 5FH9A 1S9DA 4HLUA 2C8VA 4QGAA 2FSGA 1R4AA 1VKJA 2J0UB 3AVVA 2PEZA 2JLYA 2QBYB 2B92A 4LGMA 3TW8B 2NTYC 2GCNA 4B32A 2RHDA 1E96A 2JLUA 1YR9A 1KJZA 2OLJA 2ZE5A 4I1SA 1GUAA 1U8AA 2BM0A 3QVVA 3CKLA 3VX3A 3MUFA 2XNDA 4GZMA 2BM1A 3IDQA 4BRWA 5KNBA 1U0LA 1W47A 1ZU4A 3CRW1 3ZQ6A 4PTLA 4FCVA 1KHTA 2JIZA 2WM9B 1RW4A 1X86B 2VSXA 1KDPA 4RCYA 2RGXA 5GVRA 5EE1A 4RSGA 4B2PA 3BFKA 2G77B 2O8FA 4HZIA 2OG2A 1M7HA 4QKQA 3NHBA 4XWOA 5JJIA 3G0HA 4YMWA 1CJTC 4QFMA 1X8LA 1YZUA 2NOAA 2NO6A 2UZIR 1F3OA 3FOZA 1TPZA 2FEMA 2P0EA 2O8DA 4RD1A 3NHAA 5D3MB 2D2EA 3IILA 1R7RA 3L0OA 3MLEA 4JLDA 2F9MA 4CVNA 4N0EA 4DCSA 4PC7A 4ITRC 3QVUA 4GT1A 2ZREA 3NEYA 1Z6GA 5FOSA 5KDDA 2FZLA 3O8BA 2C78A 2J9RA 4HZUA 3E1SA 4HAVA 4CDGA 3DMNA 4BEBA 5CYOA 4NYIR 2IC5A 1OE0A 1IM2A 3KXIA 1NVVR 2EFGA 3R8CA 1U8YA 4HUTA 3VU9B 2YWGA 1VIYA 1E9EA 1ZD1A 2NO7A 3NKVA 3BGWA 1CP2A 4IDOA 3GCGA 3FWYA 2IHYA 5FI0B 4ZDWA 3S1AA 1Z6YA 2VP2A 1JQJC 1DS6A 2CL0X 4B76A 5G3YA 1N6IA 2RKOA 5GJWC 1E2KA 4ZIRA 1M7GA 2C98A 2WSMA 5J47A 2ATVA 3GJ7A 1KI2A 2C77A 1COWA 3TKLA 1Q0UA 4L16A 1EX7A 2GBLA 2EQBA 2JJ1D 3AP3A 3CW2A 4JS0A 5DH9A 1FTSA 1U94A 4XSHA 4C9BA 5J4YA 1PLJA 2V1UA 4JLVA 3O8DA 3LXRA 1GNRA 3WMEA 4BFXA 2OAQ1 1C4OA 1OJLA 1G8GA 4TYYA 1J70A 1ANKA 3K0EA 1H8EA 1R8SA 2AHOA 3C5HA 4QRHA 4D82A 3PEYA 1XDBA 4MDFA 1RPZA 1W36D 3DDCA 5TY0A 2ZVPX 5EZ6B 4BGDA 4A8JA 4URVR 3FKSD 2IYWA 2WJHA 5JEEA 1VG9B 5JCPA 1GRQA 1GP2A 2BMDA 3AUXA 3BD9A 2JJ1A 3Q5DA 4FMDF 4KFTA 4QGHA 1HE1C 1RFLA 4I99A 4QHYA 1X8KA 3CF2A 3GLIE 3N70A 1N6OA 1DEKA 3U3OA 1J7KA 5DISB 4BUJA 4FINA 2A7QA 2FSHA 4NCHA 1RRPA 4CW7A 5HKKD 2NQ2C 1P7CA 4IXNA 3UG7A 4DKXA 1HTWA 1CEEA 1OHHA 1D9XA 3LNCA 4Q9HA 1JEEA 4WXRA 5UKDA 2ZI7A 2IYUA 1KY2A 2A5YB 1PV4A 1RRFA 3QXSA 5FOWA 5FUYA 3GLGB 5DLQC 1E0AA 2WWWA 3QF4A 4V03A 5FBQB 4BRUA 3R9XA 1WP9A 1OIWA 1KDOA 1Q3TA 3R7WA 3QY0A 4GOXA 1CJVC 3MG9A 4D81A 4ARZA 1KKLA 1NBME 2OFOA 2CDNA 2MSEB 1S3GA 3FDIA 4ESVA 4JBYA 1R10A 4HDCA 1TF5A 3QENA 4I4LA 1S3SA 2IW3A 3LA6A 3MRSA 4F7WA 3GLHE 2YJTD 4QNMA 2EFDB 3NC0C 2IBMA 4D26A 1NVXQ 1OPXA 2RHMA 1NMXA 2ZE6A 3CBQA 3WHLA 4EKDA 5BYJA 4LI0A 3D7MA 2JLZA 3L0SA 3E70C 5FPYA 5BYKA 2CLDX 2Z83A 1S1CA 3ZZ0A 5FBVB 4Q1EA 5FTLA 4Q01A 2FPKA 3FMOB 4YQFA 2ZUDA 1JPNA 1KI8A 4BFWA 3EIEA 2N46A 3TUIC 4PSKA 1JBKA 4AURA 4EPRA 2F55A 1TF2A 1XMIA 3IPXA 1OH7A 4LHVA 4F4IA 3AB3A 3WRXC 1G3UA 1ZNZA 1A2BA 2ASEA 1U8ZA 2ORIA 2ZRBA 2O5VA 2C5LA 3CPHA 1W1WA 2V4ZA 3RRYA 2AKYA 4NDZA 1SKYE 1S2MA 2OLKA 3QEJA 4A4DA 1K6MA 1KTVA 1ZIPA 5G41A 2JLSA 4HLUC 4DC9A 5JHGB 3THYA 2RGBA 1XTJA 3MWYW 3CRQA 4R2IA 3Q8XB 3S1AB 4LSGA 2AFHE 3WRYC 1E2EA 1DAIA 1KI1A 1TU3A 2PMDA 2QTFA 2HLDA 1G6HA 3EC1A 4TQ9A 5L3VA 4ON9A 2VP5A 3MWKA 1VHLA 1KOFA 2CNWA 4OQXA 5EXXA 2IYXA 2XAUA 1LVGA 5EP2A 1BMFD 1II8B 1SHKA 1TMKA 1G8FA 3KJGA 1X3SA 1MR3F 4OJQA 3RYTC 2GEUA 3OAAD 4PXAA 4AD8A 2X19A 3ICQB 4C7OA 3RC3A 4EFNA 5L3SB 5JLJA 1PZNA 2IWRA 3PUYA 1W4BA 5DNYB 4QHTA 5ANRB 5FR1A 3SJZA 1KZGB 5FPKA 2ODBA 1G8HA 4JVNA 1LW7A 4JSTA 4LJAA 4MRPA 1XXHA 5KYKA 5KNCA 2XGJA 3B82A 2Q9CA 1YZKA 4K8OA 5FOUA 3F5FA 4NCKA 1KI9A 2OZEA 1M34E 2ONJA 1JALA 3OAAA 1UEIA 5CLLA 2E87A 1YJ5A 4R7ZA 5CB8A 1W36B 3K0FB 4EJSB 1RYFA 4LHXA 1SXJE 3ZS8A 4DLXA 3I73A 1KYIA 5KOYA 2EWWA 1IAQA 3IEUA 2QUZA 3EA5A 4R98A 1CRPA 3EZ6A 1XEXA 2AWOA 1CR0A 3R7WB 4PAQA 4PSVA 4LHYA 4WAUA 3VQTA 3IHLA 3VX4A 4MRRA 5DI9A 3U44A 1XTQA 5F2EA 4TMVA 2ATXA 2ODEA 2JDIA 2LKCA 5BXQC 2R8RA 4LV5B 3AH8A 1G21E 3Q3JB 2FEOA 3HU3A 1TEXA 3KJIA 3ZQJA 2QE7D 1E79D 1SVWA 4WBSA 5D3QA 1R0ZA 5H8WA 1GWNA 2WSSD 5CDFA 2OBMA 2RAPA 4WVFA 3ZH9B 5DHAA 3K9NA 1R0WA 2QT0A 4G5QA 4K46A 2FFBA 3NIBA 3JZMA 2Z5FA 2OCYC 1NRJB 1IXZA 1NLFA 2OV2A 2PZFA 4WZBE 3GD7A 4KLNA 4A0HA 2WOJA 5ELXA 1NI3A 1Q57A 4B47A 2ZRLA 1FMLA 4DB4A 2GTPA 4NL4H 3VNUA 4CEJB 1L2TA 2J0SA 4PR0A 3ZLJA 1GL9B 3QBVA 5DSZA 5KPJA 1JR3A 5JS8A 4QNRA 2GWHA 3M4YA 3W5IA 3OZXA 2G3YA 1EXMA 5HR5A 5AUOB 4LBWA 2O8CB 5LDDC 3FHOA 1MABA 1W36C 1DAFA 2ZI9A 3QKRB 1CS4C 4EJSC 3BE4A 3KB1A 4A82A 4UXJA 2XOKD 4IKEA 5DIFA 3H4MA 1P62B 3M6AA 5AJWA 4ZKDA 3TR0A 2QQ0A 3NDPA 4HDQB 1HURA 2C99A 2FZ4A 1E4YA 2YVUA 2YZ2A 3PEVA 4HB4A 1AGRA 621PA 5F98A 4D0LB 3BRWD 3N2EA 1FP7A 4HAYA 3LD9A 3LLMA 4C0SA 1E9AA 1Z0JA 2VF8A 3QF7A 3B7GA 1WRBA 4A0FA 3IKJA 2ZROA 5J5CA 3W3ZB 1Z22A 1Z07A 3QSYA 4OKSA 2QP4A 5JSZA 3UG6A 4TLAA 1E9FA 3KUDA 5KSOA 4JL5A 5A5GA 4P31A 2PX3A 3AF3A 4FD2A 3X1WA 3EZ2A 2XTZA 1E2PA 4DCUA 2P3SA 4B75A 4AYXA 3B13B 1KK3A 2YNMA 1P5ZB 4Q7MB 3EZFA 5CJPA 2WVJA 4DUGA 4TSFD 4Q9KA 3RS4A 3U6KA 4D25A 3SNHA 1G4UR 1W5TA 4NBSA 1RYHA 2VLIA 1G8YA 2XSZA 3QKTA 1E0JA 4Q47A 4XH9B 2VSOA 2OSBA 4Q4AA 5G40A 4DZZA 3AKYA 4JYBA 1WQ1R 3F0TA 3V4RA 3A8TA 5DN6D 3MAAC 2C96A 3AF2A 1W2GA 2HT6A 2HXYA 4M9QA 1H65A 3I3SR 3PEUA 2GK7A 1VG8A 2DBYA 1TQ6A 1TNDA 1PLLA 1N0VC 4M9XA 5JCZA 5IK2D 5DI3A 4FCWA 4URXR 2JLVA 3AVUA 4DT1A 3U44B 3KDSE 1KIMA 4B33A 4UNSA 1ZC4A 2CCJA 5BN3A 2DFKB 4JKYA 1TF7A 2IA5A 3B1XA 3C5CA 3GJ3A 3JVUA 2RH5A 3CNNA 5B2ZA 1E2QA 2VEDA 4O2LA 5DN6A 1RJ9B 2QRZA 2JJ2D 4Q21A 2PL3A 2O0HA 1VPLA 4UNQA 3D3QA 1WF3A 1E2IA 2MSDB 2XXAB 1X1SA 4M8NE 4Q9JA 3ADBA 5IK2A 5FL7D 3W3AA 1QDEA 2IT1A 2Q3MA 2BC9A 2PJRA 2H92A 3OEED 1BIFA 5EXPA 1Z5ZA 3EW9A 2CVFA 3FMPB 3R9WA 4GL2A 1KMHA 4HSEA 1DELA 2IS6A 2N1BA 2H57A 3FMIA 1EG7A 4Q4HA 2GETA 3PV0A 1FX0A 2AXPA 1QHYA 2GNOA 2WWYA 5GVSA 5JRZA 2HUPA 4PO9A 1E69A 2ZS7A 2GXAA 1Y63A 3GFPA 3W8NA 5L3QB 3TAUA 4LRWA 3DZDA 3HR7A 4FIDA 1UPTA 821PA 5JI3E 2BDTA 4KLZA 1RRCA 1GG2A 5LB4A 3I72A 3OEEA 2VYFA 1LFDB 2VSFA 1Z63A 1OFTA 1GDDA 4D2IA 1G1MA 2WV9A 4F92B 1Z6TA 5EP1A 4WZAE 2DB3A 4OBEA 2R62A 2I3BA 4V0OA 3T15A 4B2LA 4CEIB 3KTAB 3BB4A 4JT4A 4FXPA 3TSWA 2ECKA 2WJIA 2MSCB 3W8RA 3LX8A 1A7JA 3C16C 1G64A 2OILA 2NZJA 1PLKA 1J8YF 1KGDA 4QJ4A 4EIWA 4NKRA 3WP1B 4KCGA 5K8IA 1MO5A 3NTUA 3MJHA 3K70D 2V3CC 3U6BA 3KFXA 4PAOA 2ZJZA 3SJCA 2C2HA 2ZRJA 5FL3A 1XZQA 3T1VA 4I1UA 2R44A 1F48A 4A0RA 2HT1A 5JSZB 5BWMA 3WNCA 1B23P 5B57C 1S96A 4JT2A 4BECA 3EPLA 2F9LA 1US8A 4TL7A 5EZ5A 4GZLA 1GKYA 3OESA 3DM9B 4UXHA 3SHFA 1VCOA 3B9PA 3NG1A 1ZUHA 4H1UA 4RD2A 1CIPA 4JLOA 4Q5IA 3K9GA 1E2GA 5KNDA 1R5NA 4YLGA 2H5EA 3CO5A 4MGKR 3A36A 4GRAA 1I2MA 2A2ZA 3QPWA 1VIAA 4JBXA 1GRNA 3VHLB 1G5PA 2XITA 2GK6A 2J0UA 4Q4AB 2XX3A 3VFDA 3Q9LA 5DYIA 4CRWB 2QBYA 1E0KA 2ZS8A 2GEVA 4LY6A 1XWIA 4AYWA 5K8UA 2ORVA 2ZJ2A 1XMVA 4DLVA 3OE7D 4ZDJA 1OW3B 4A6XA 5C2JB 2BBWA 3QKSB 4K81B 2QM7A 4URZR 3DOFA 5KUTA 2BWJA 4NPHA 3CM0A 2O0KA 4HAZA 1T3SA 4PC6A 1JB1A 3UIEA 1ZU5A 1Q1BA 3A1SA 4MITA 1FNMA 1Q1EA 3R20A 3IQXA 3Q72A 4XTCS 1ZM9A 5FFMA 1SHZA 3SZRA 1CRQA 1N6NA 2ZSFA 5B30A 4QM6A 3OE7A 1IY2A 4GMDA 1KO1A 2RGGA 2P6NA 4JBWA 3FFBA 1SVLA 1OKKD 4TTQA 3RSLA 4A6PA 1U0JA 1Z0AA 1ZNYA 2EWVA 1CR2A 3FMFA 1FX0B 1F5NA 2X2EA 1IN7A 3BBPA 2W2XA 3WP0A 3QIAA 2ZSDA 3H2YA 2ZI4A 1WA5A 1GSIA 2WIAA 4Q66C 4TLDA 2IXGA 3FE2A 4G5GA 5EE9A 4AG6A 1D9ZA 1E9CA 2CE2X 3IO5A 3VU9A 2H8KA 3KXLA 4KODA 1MRSA 4M1SA 4M1WA 3SC3A 2CLCX 2PX0A 3ZIAD 1OKKA 1Z6XA 4P4SB 4KYUA 4NYMQ 3P32A 1L4UA 1FFHA 5FOXA 1EFCA 2IYYA 1YE8A 2YOFA 5AJZA 4B6EA 4BLOA 1UKZA 1ESNA 2ODNA 3VNVA 1E3MA 3B1WA 2QORA 2ZYVX 3A6PC 1HEIA 1W4CA 1OXUA 1YHNA 3N5CA 4IOKA 2JASA 2FU5C 2WPDA 3K0AB 4DSOA 4RFSA 4M1KA 1T0JB 4TYQA 2VIIA 1XTSA 3ND8A 5JZVA 4U00A 1YU9A 2ZJYA 4C0BA 1G8PA 1VYTA 1JAIA 5AUPB 3WY9A 1X1RA 5BN4A 4CYMA 3B9QA 3T5DA 3QOFA 3RS7A 2GVZC 1XMSA 5JBQA 2OCAA 2J59A 2YYZA 1UM8A 3KKMA 3UATA 2QZ4A 1KAGA 3IGFA 3FB4A 5B58C 2FOLA 2QAJA 4Q4LA 2CBZA 4MYCA 5AJVB 3K70B 1W4RA 3HU2A 2NGRA 3DHWC 4PQYA 1IJFA 1BO6A 4NMMA 1XP8A 5EP3A 3JZAA 4HLDA 4IDNA 4DLRA 4FMDB 1HQYE 2X2FA 2BMEA 2PJZA 2RGAA 1CLUA 4LJ9A 3TQCA 3GLGA 1OIVA 1AJEA 2A5GA 4BWYA 3PR1A 2NZ8A 3ZGXA 4TLCA 4QHSA 1TAGA 2NO9A 3BK7A 4I1VA 4V0ME 1ZUNB 1JJVA 1DO2A 3H0KA 2YOHA 5EE0A 1S0UA 4NCIA 3KQLA 1OFHA 2XB2A 3RRMA 2ZJOA 4ZCIA 1T0HB 4MDEA 1UBEA 2PT5A 4JVLA 1ZD9A 3TNFA 1P2UA 3KJHA 4PC3A 1A1VA 1AIPA 2BBSA 4B2IA 2YV5A 3RS2A 3F8TA 2KBFA 4LBVA 5FTJA 3IBYA 4M1MA 3GLFE 2GKSA 3B1VA 1JXOA 4XVRA 1NIPA 1OFIA 2R65A 1PUJA 4IJMA 4YDHB 2QROA 1W46A 1F2UA 2WWXA 5FI1B 2KB0A 1ZCBA 2WAXA 3AF4A 1JEDA 3T1TA 2WWIA 5CJ2A 3AVPA 2LKDA 2PH1A 4E03A 5CIQA 2QPTA 2GESA 5H1YA 4NONA 2G83A 4OQLA 4KJZA 3ZVMA 2QNRA 3FGNA 4GDFA 2HXSA 4M21A 3I5YA 2J45A 4QBGB 2G0TA 4A36A 4G3XA 2FE4A 4QJ5A 1KI6B 3W9YA 3UANA 1HE8B 1M8PA 3TJZA 4IOMA 4FMBB 4D0GA 1ZVQA 5FTKA 2ZE8A 4FWTA 2BEJA 2DYKA 2J7KA 3KKPA 2RGDA 3U7HB 2NMVA 1GM5A 2O8EB 1U98A 4FCTA 2ZU6A 3SI7A 4DVGA 3NWJA 1XJ0A 1W5SA 4C0KA 4JLKA 2IYLD 1II8A 1K5DA 1TX4B 2J5XA 2VA8A 4ZDKA 2BJVA 3VR6A 4RFSB 3AGPA 3NBZC 4MYTA 5DE3A 3P27A 4RZ2A 4AIIA 5L3SA 3DVLA 2GJ8A 3QQ5A 4GNKA 4OHYA 3Q5EA 3R9IA 2F1RA 2QPAA 4N0DA 2QG6A 1CF4A 1DBSA 4Q4JB 2G6BA 4IEEA 1U9IC 1J2JA 4ZKEA 1R6BX 1E9RA 3IBGA 3M1IA 2D2FA 1KY3A 2F1IA 4OHZA 3GFOA 1Z83A 4HATA 4MQBA 4I1OA 2VHTA 3TK1A 1T5LA 4DCNA 4TMZA 1T8TA 2GF0A 3NH9A 5FUXA 2QA5A 3AUYA 1OFUX 1OXVA 4MYUA 4B3BA 4OHWA 3ZYCA 2WTUA 4EDHA 1E4VA 3CNLA 1T4GA 3K0FA 4EJSA 3NBYC 3GMTA 3SR0A 1KK0A 4IRUB 3FKSA 1UF9A 4Z51A 1IY1A 1G7RA 4PPNA 4FMCF 5HTKA 5SZIA 1XJCA 5KTYA 3GLIB 2P2LA 1HH4A 1O87A 2F3TA 2JCSA 1CU1A 1DAMA 4G0NA 4DWJA 4XOIA 4RZUA 1E9BA 1LF5A 4QL3A 5HKKA 5TARA 3I8SA 1GKUB 2FX3A 4GFDA 4PPFA 5EXSA 5CLQA 4OQNA 4NYMR 4WIAA 2NIPA 3WMGA 5JWHA 2GHIA 3K0CA 4S2EA 3CX7A 2D06A 121PA 2DHRA 2LCFA 1AKYA 2KJQA 2AN9A 4JVSB 2EYUA 4Q03A 3C41J 4OJKA 4U7DA 1DPFA 1RE0A 2RB4A 3HPRA 3LY5A 3GJ8A 1C1YA 1G6OA 1DVRA 2B21A 3A1UA 2ZANA 2BCJQ 2YOGA 4J0QA 5G53C 3SU8A 1S9HA 3HP1A 4URYR 2J87A 2DWOA 3PQCA 4KU4A 4Q48A 1F2UB 2VF7A 3AF0A 1L7VC 3H84A 2VO1A 5TB5A 2H17A 4GOKA 2ZJAA 3ZDQA 2ZM5A 1G7SA 4CEJA 2MMGA 3GLHB 2AX4A 4B3GA 5JS7A 2RGCA 3SYNA 4DLSA 1XCGB 4TQAA 1XF9A 4PPQA 1XTKA 3ZJYA 1AKEA 3B5JA 4U02A 1KJWA 5IT5A 1T8UA 4DSNA 1N5IA 5CITA 3AKEA 4BLPA 2O8CA 2BKUA 4EQ6A 1SVIA 2X1VA 3QKRA 1XNJA 3CZPA 3CNOA 1P9NA 3C7KA 2X77A 4BFTA 2RGNC 1P2VA 3LLUA 4LC1A 2WJGA 4Y0AA 1XJQA 3QXJA 3MFYA 1ZRHA 2KBEA 3L8ZA 4DEXA 1E2JA 2DCUA 2W6ID 2WZQA 2AFIE 1Z0DA 4R71A 3LX5A 3L8YA 2QRNA 1KKMA 3B78A 4QM7A 2GJAA 2C9OA 4YONB 1AQYA 2OAP1 3OIUA 1UEJA 2BMJA 1SKYB 2GVDC 3ZVNA 1TQDA 2W6JD 3KQUA 1E1QD 1E32A 2H7VA 3GJXC 2F43A 2D74A 4AC9A 3VMFA 2IUTA 1P72A 1ZM3A 5M04A 3IIKA 4YMTA 2Z4SA 2B7BA 4ZI2A 1JPJA 3HU1A 3LBIA 4DIEA 2QSYA 2REBA 3KKOA 2ZRIA 4NH0A 4B73A 2ERYA 2CEAA 4W5WA 2ZYWX 4Q00A 2WKPA 3OHMA 1Z8FA 2DY1A 5BQ5A 5C4MA 4DLWA 2VP9A 1EX6A 1N0WA 4Q1CA 1W49A 5SZJA 3ADKA 5J40A 3U7FB 2WMNB 4GOJA 3Q7PA 4C0QC 1BMFA 4TN1A 3RABA 1SKQA 2WAYA 2W00A 3QUSA 2R6DA 4TMKA 1AZSC 1FUKA 1B0UA 2JAQA 1G291 2ZRDA 2ERXA 1FL9A 5C4GB 2XTNA 2GCOA 1R5BA 1QHSA 4RVCA 4F4JA 4W7SA 3CX6A 4P4UA 4QBHA 1KDRA 3TW4A 4NYJQ 4DBLC 1LF0A 4LHZA 4PHHA 4OYHA 2IXEA 3T61A 2RGEA 3KKNA 1SVKA 1E2FA 3NH6A 1RIFA 1MO3A 5JFGA 2QTVB 4AKEA 2W0MA 3FTQA 1FW6A 3ADDA 1VTKA 1DG3A 1W0JD 4H1VA 4TMXA 3SBEA 2FSFA 3QI2A 2V54A 3QG1A 3I8XA 1E1RD 3W6NA 2QY9A 1VHTA 2IYQA 4MH0R 3THXB 4ZO4A 2W58A 2ZI3A 4OL0A 4JSYA 1RJ9A 1W0KD 2OXRA 4MA4A 2OBNA 1SXJB 3LXXA 4TL8A 4X8MA 1P2TA 3VR4A 3TRFA 1KSFX 4DRZA 4LJ6A 5CK5A 4LX0A 2IUUA 8OHMA 3KQHA 3PITA 3OFND 2XXAA 2HCJB 1ETUA 2PBRA 4BFYA 4TLBA 1OB5A 2YC4C 1G9XA 1M74A 1Z28A 2VHQA 4PHTA 5AUQA 3EAQA 4HAXA 1E2NA 2QPOA 1U90A 3A1TA 2J1LA 4QXAA 5CM9C 1T3HA 3QJYA 3JVVA 1E1RA 1YZQA 1Z29A 2A30A 2Q3HA 2YWHA 1JR6A 3DMDA 1KO7A 2XJ4A 4GSYA 2QE7A 1E79A 4D4JA 1ZCAA 5L3QA 1AQUA 2WSSA 3ADCA 4B3XA 2WWHA 3OFNA 4B3FX 1OXSC 1CJKC 2VQSA 2ZJ5A 4NTZA 5AUNB 1ODFA 1IN8A 4M9SA 4EQ6B 2VP0A 3UXMA 2OXCA 2IS2A 3N2IA 1XZPA 1MO4A 5GJCA 3WYFA 3DKVA 1QG2A 1OV4A 5DYGA 4BQSA 2ZRCA 3CONA 1NY6A 4PQFA 3A4LA 3UMFA 4CEHB 4CEIA 1IXRC 3KTAA 2GZHA 3AVQA 3MCAA 3WBJA 3VR2A 3W5JA 2CMKA 1ZJ6A 1NKTA 3D6TB 1YR6A 3ZS9A 1XEFA 4PZLA 5AJYA 4B44A 1P3JA 4HUQA 4BFSA 1WMSA 1II9A 3BH0A 1T6NA 1XEWX 1NN0A 4EFMA 1JXMA 1F6BA 2F43B 5LD2B 2ZUBA 1GAJA 3K0CC 1QF9A 2IYRA 1E2LA 2I1QA 4XWKA 2XOKA 2CHQA 2R6GA 1XFAA 2G88A 4D4LA 1KSGA 2HYIC 2J0QA 5J4KA 4IEIA 3CR8A 4JL8A 5E4FA 3PUZA 3A37A 2WJJA 3A1VA 2Q0HA 1OSNA 4R2HA 2ZI6A 5LBIA 3LBNA 4PFSA 1XXHE 1W2HA 3AVWA 3AV0B 5EUMA 2QMUA 3B6EA 4MGYR 3DEFA 4WA7A 4URWR 1RC8A 1YQTA 1BYIA 4LZZA 4F93B 3K53A 3DPUA 1X6VA 2XNSA 5JECA 2GCOB 1Y3AA 1QG4A 3BERA 3L82B 2Z4RA 3U4QB 4H9GA 3UKDA 1DARA 2WJYA 2FJUA 4L15A 2IWHA 3QKSA 2ZEJA 3CPJB 3WYAA 4TSFA 3O8CA 2QEQA 1NVUQ 4MRSA 2C95A 2GRJA 4KBFA 4KV9A 5EQTA 1FQKA 5GJBA 3WMFA 4RD3A 3FFAA 4A92A 1Z06A 2J41A 2GXSA 1XU4A 3K9LA
chains in the Genus database with same CATH superfamily
3U3RA 1PJTA 1ULHA 1XPRA 1MP0A 2BFCA 3MVEA 5SY9A 1HNNA 2IEYA 1TDJA 1YWGO 1L7QA 2DHDA 2CLHB 2ZYTX 3ZOKA 2IEDA 2ZBQA 5G02A 3DAGA 1LVUA 4FE7A 1M1NB 4IFBA 1KFKB 5PNTA 2WHRA 2AKAB 1PQUA 5BN5B 5REQB 3WQRA 1KARA 1R8YA 1TXGA 2ZSAA 4RPJA 1VSQA 3AM4A 1E1CB 3WTBA 4TV8A 3L0IB 1BCRA 1LBSA 3NHPA 3TB4A 3FF4A 1O94A 2I54A 1E2MA 1UK9A 1VRVA 2PX4A 3OZUA 3W7VA 4BZZA 4FK8A 3CUWA 2RBEA 1ISHA 1UPUA 2XMDA 3N59A 2R9VA 2AF3C 3ZXUB 2GPWA 2IXBA 3R6LA 3S2SA 3L1JA 4H1TA 4I46A 2OESA 4WK6A 3CT6A 1UPAA 1VBNA 3P0EA 4HRVA 4RGBA 3USCS 1YKFA 3WDLA 3QU5A 2R8OA 1R9GA 2FMKA 5TMBA 3JXEA 5LWHA 1Z38A 5C8ZA 5LFAA 2QL6A 2WIGA 4WFJA 3PHBE 4NC9A 3L04A 5JAUA 1HT3A 4NVRA 5J58A 4IVQA 4PG6A 1HM5A 4L3WA 3X1XA 4WXPA 5ER6A 1W4AA 1YGPA 3V3KA 3CX8A 4C0WA 1P17A 3CZMA 5LNK1 3RAPR 1IZYA 1YS7A 1N6RA 4KLCA 3T3OA 1P6QA 1B6SA 4BE7B 1FLDA 4FHCA 2CFOA 2R6FA 3IP9A 2CZCA 1O95D 3NPAA 4YXWA 5HF5A 5SZHB 4BCBA 3JTEA 2TRSB 3BJIC 4Y18A 5GGXA 4M38A 1QRDA 4MUNA 1MC8A 3OWXA 4I4IA 4QFBA 3WNBA 2VJMA 3SGLA 2RGWA 4LXQA 4UNRA 5I4BA 3KQNA 1YI1A 1A8HA 4EGQA 5JNTA 1AH2A 1V8FA 4L5AA 7AT1A 2JFYA 2VVTA 4LJ8A 4AG5A 2WU4A 3EAGA 4Q7LA 4A2QA 4IHQA 2C2WA 5FNVA 1P0IA 4MJXA 3SX2A 5ADUS 1JQLB 5KO2A 3GA0A 1Y81A 4RHTA 1QP4A 4EARA 1OWNA 2E37A 5FBKA 4ZDIA 2I4RA 3UF0A 1RACA 3PFBA 4LUCA 4OHCA 4KRFA 4LXXA 2XUZA 3MGBA 4TUYA 4P0TA 2OPBA 2R6ZA 3AVYA 3PZBA 4ND3A 1VKRA 1VYUA 2IOQA 4BV3A 1GZ3A 1NRXA 2J4CA 4L8LA 5FOQA 1OZAA 1NJGA 2ANCA 5DNDA 3D6MA 5AVKA 1W88A 3LHIA 1DTWB 2RH4A 2RGRA 1XXLA 1MZPA 3OTHA 4JXXA 1EESA 3ABSB 1HQCA 2AWNA 3ROPA 1V8BA 1SVSA 3SLRA 4DE5A 5EMKA 2IW1A 1PJBA 5IJWA 1XQVA 3MHPA 4DUPA 5D7NA 5K0JA 3LG2A 2ZAMA 1ISFA 2O4UX 1RWOA 5T5QA 3L9WA 4US0R 5JAMA 2VQEB 3FNBA 4P22A 4KO1S 5TT0A 3NT5A 2MWMA 1VLJA 2QMQA 2HHLA 4LS3A 2Z04A 4RADA 4UM9D 4DLLA 2GEDA 1Q0QA 4ACBA 1M5RA 1GTVA 5AWFC 4E2FA 4JODA 13PKA 3L1HA 2EGUA 4YQYA 4EEZA 1KMIY 3PTAA 3IXLA 3MJEA 1KQOA 1PSDA 3IAXA 2C9CA 1ZWLA 2HRRA 2JH9A 2PGDA 4YIHA 1Q21A 4J0KA 3S70A 5L95A 1IWOA 1Z2CA 5DFAA 1WB9A 4DAEA 3V1UA 1ZGAA 3I4LA 1N6HA 5KDLA 1G5RA 4MQUA 2YICA 3F74A 3N2KB 1U9IA 3G0OA 3ZWDA 4H35A 3T95A 2PX5A 2BFFA 1ZBQA 1FF9A 2O50A 4IQGA 4TV9F 4WEOA 2ZK7A 2NO5A 4LYGA 3WB1A 4BV2A 4H2DA 4RYLA 5IWAB 1Z4NA 4OXNA 4QJBA 1N5LA 1TFUA 2AMJA 2X1HA 1KF0A 5JDIA 4ZYTA 2POQX 3P5BA 2O48X 5LQAA 1E89A 4K1XA 4DEYA 1LDNA 4QAJA 4FFPA 4KXUA 4LGYA 3LUDA 5IX8A 1T9GS 4FFLA 4BBPA 4MS1B 4QYTA 3VPSA 3RASA 1Y9DA 1Z5NA 5JWOA 4TTTS 1SHTX 5E6SB 2F00A 1XJ5A 1SBNE 1PWYE 1VMAA 3CWQA 1DC4A 1A5ZA 2SNIE 5KJFA 4R68A 2B94A 4C20A 3TTUA 4RPGA 2GF9A 5HX7A 2BI4A 4YWHA 4KX5A 4LDPA 1BKSB 4BATA 4C2TA 4C3UA 4GX0A 4LYFA 1LTHR 4IGEA 1BFUA 1KO5A 1N3BA 2E5WA 2E9SA 2NAPA 3KD2A 2JHCA 3RSOA 5YASA 3I6MA 4Q37A 1GA4A 3N8GA 3RSHA 3GUYA 2CHGA 2VA9A 3NAGA 4HGZA 3G5UA 4M60A 4UTXA 3ZHBA 2FTKE 4RV5A 3LDAA 1PTJA 3C98A 1G3MA 3PXGA 4QG7A 2O8EA 2WF8A 2D1SA 4INJA 3U1VA 3S99A 6YASA 4G01B 1HE2A 2IY7A 2RBGA 4KWIA 3W79A 3BRSA 2C5FA 1FDTA 2OAEA 3F96A 1NVBA 4TTAA 2VDOB 3OTWA 3A11A 3L0YA 5C9ZA 4O59O 3T3MB 4ER0A 4N54A 4PCLA 2OT3B 2GD6A 2QKYA 3FBGA 4KDFA 2OVFA 3M7IA 3G8YA 4P36A 4YMVA 3GVIA 2PPLA 2UKDA 4MKGA 3K8ZA 3THOA 4K8RB 4E22A 1N78A 4LQCA 4I6EA 3I1YA 2UYHA 3HCWA 1P0PA 5ILGA 2JBAB 1OWPA 3W05A 4EH1A 4GQIA 5A4JA 4GBED 3REQB 5AYVA 1OH6A 2UUAB 1T4BA 2PAFA 3DKIA 5FFNA 4HX5A 1PJ2A 4ZV4A 5A4IS 4PVDA 2FLWA 5CLHA 4V1CA 5LPNA 1XRMA 4IMIB 1SHLA 2OP1A 3FPGA 3EVTA 1CY8A 2JAOA 2JL1A 4D1YA 1LQ2A 1UFRA 4LFBB 3HV2A 3DQQA 3LS2A 3UBMA 1N2BA 3TIGA 2X9LA 5C1IA 1KEZA 3X2FA 1M67A 1Z0FA 1IYZA 1WXEA 3W5UA 1DRUA 1EA5A 3EEBA 1GFIA 4ZO7A 3VDXA 4C08A 1ZCZA 1LK0A 5JD4A 3LVQE 2RHHA 4JQSA 5JI2E 4E4TA 4JYCA 4I19A 3K8QA 4E08A 1W87A 1O9GA 2FEPA 3I9JA 4CQMD 1C0LA 4UEJA 1E0SA 4G07A 5HKBA 2PKEA 2XA2A 3C3BA 4YRPA 1IL0A 2KSQA 3R0JA 5U4XA 4D4KA 3JAWB 5B7NA 2CGEA 3AEKA 1WE2A 1YULA 2ECPA 2ZSBA 5B4UA 1FDRA 1ZW6A 2P9YA 4PLZA 4H7HA 2HZ7A 3T35A 1VGRA 1G5TA 3OJ0A 1DOAA 2Y1EA 2A58A 2BEKA 3N6RA 4LXHA 1S4QA 4MWTA 4MWEA 4LQ4A 1DBPA 3HHPA 2DHQA 1FX1A 4DILA 5IU6A 3L77A 1X9IA 1QORA 2CLMB 4CKBB 3WGZA 4RVSA 4C30A 721PA 1E2HA 2QTHA 1YJ8A 4GHWA 4HNAA 5JAHA 4ZXPA 2W2KA 2WV7A 3E9MA 4FMCB 6NULA 3WSVA 1OLUB 1Z36A 1JLHA 2FZVA 2IYTA 2RKWA 3I3OA 4LVNA 3ELBA 4YAEA 4DR3B 3EVGA 4D3ZA 1LFAA 1PE0A 1UDBA 4EF4A 2P5YA 3K6SA 1K8RA 2PT7A 4ATNA 1TM5E 4HYYA 3GEEA 4IUDS 4U2CA 4BFUA 1BX0A 5AW7A 3O6VA 4P82A 3TGWA 4YR7A 4IS3A 2FR0A 2O2HA 2QTMA 2CJWB 3AETB 4MMXB 4XD7A 4AZ0A 2OFFA 3LQ2A 4JJ4A 2C9MA 4PYNA 4YP6A 4K0KB 4KFSA 3EEQA 2AH5A 2YQZA 4QTZA 1X7XB 2NSLA 2XUIA 2Z9CA 1ZOOA 4XCVA 1ECJA 1QX4A 1NIJA 1A0OA 1MN6A 3T4PA 4YRQA 2I80A 2AN1A 1AZTA 4WKCA 4AMBA 2A14A 4FM9A 4PX9A 3DNPA 1JNYA 1Y9ZA 5AM1A 3QVKA 4EFKA 1FPQA 3UY4A 2ARKA 3K92A 4XWWA 1CUYA 2UZ1B 5CDSA 3HUFA 3W6UA 4DA9A 1GITA 3DVAB 3TL6A 3VGJA 3DBLA 1XOIA 4OI1A 3W7BA 1J8MF 3LFUA 1VJTA 1HYQA 3OVMA 1CRPA 3A4TA 4QEDA 5JYCA 3WHKA 1COWD 4M1YA 2O3RA 5KOJB 4PRYA 3GQBA 4MB6A 5MN6A 1LDMA 2OCIA 4BEVA 1QH0A 4JLJA 3CW8X 4UU0A 4YRAA 1E64A 1S8FA 4D79A 4WOCA 4J2TA 2IZ5A 2UXBB 4HWKA 1KAEA 2IYEA 4YREA 3QM1A 4BTEA 4WXMA 3UMVA 4TZ6A 1KNXA 1U2TA 4DLUA 1XHLA 4M0CA 4LSMA 2E85A 3QYFA 3UOGA 4AMGA 5LOVA 4IGFA 3K1TA 1V16A 2WHPA 3ETJA 3G13A 3AKDA 2NXWA 2O5CA 3O47A 2HF7A 3ZJUA 4P34A 2B4AA 3HNPA 3I45A 4HOYA 3DLPX 5C7LO 3C1TA 3I37X 3HDTA 5CFRA 2JFWA 3HYSA 3Q7SA 3QYJA 2QT1A 1PX0A 2FHSA 3A3YA 4TN5A 2EP8A 3SQWA 3ZV6A 1E6LA 3DFMA 1LU9A 3M3HA 1P6XA 3RGGA 3G7UA 1U7UA 3K1JA 1EJ0A 1B8VA 1SMKA 1A9OA 3CB4A 3P9YA 4YJ2A 1F12A 1LWOA 1QGZA 3KZKA 2G8LA 3MSXA 4MRNA 4OXYA 1N2HA 3L46A 1WXQA 3I6BA 4NV0A 4CTNA 4C0AC 1HNXB 5F7ZA 1OHHD 1XTVA 4QOIA 3JAMA 2GH1A 3U4AA 5K0ZA 1VJ1A 4TWBA 3T1OA 3P9NA 4BZPA 3K72B 1JQ5A 4F5ZA 1U7WA 4M2LA 3G82C 3EVNA 3E8MA 2GCGA 2XMBA 2I7XA 1BN7A 5EA2A 3RTCA 2GA8A 1RI1A 4QVGA 2YR0A 3U81A 1L1EA 3GLGE 1XZJA 4EUHA 3NHUA 4C03A 3TNLA 1GZUA 3RVOA 3ADPA 1A96A 7ADHA 4DBZA 2EG9A 5IKPA 1NZJA 2OO7A 1EZ4A 4UHCA 1UBOS 1G18A 4HFRA 4JUAA 4U6NA 5DP1A 4CLRB 4XQEA 2I6XA 4AQDA 4OCZA 1NWCA 1ZRMA 4LDZA 4L28A 4YCMA 1CQIA 2VTBB 1EFUA 3GLRA 1PT9A 3B3FA 1VYVA 4JI1B 5G3ZA 1WUKS 3ZWPA 1ZSVA 2X7XA 5EY5B 1EP3B 2R8EA 4AF6A 4EMTA 4RACA 3VVLA 1YKSA 4QJIA 3UPUA 3VNBA 1VXRA 4KHZA 4P3XA 4XFKA 1EFVA 1PHPA 2XOEA 1PJ8A 2EVWX 1CNMA 3BUSA 3ZWKA 3MUNA 1YB4A 4DEVA 3MHTA 5DKFA 1RMQA 4CM1A 5A4DA 3G6KA 1H6DA 1UZLA 3NATA 3TLEA 3W1WA 3ZCVA 1GKKA 4QUIA 2P2NA 5ALXA 3ZHTA 1RD4A 2Q5CA 1V35A 3CLSC 4U2BA 2L42A 2BHRA 3EUAA 3J81k 5JNSA 1QQBA 2PZJA 1XB2A 3ABRB 5AVSA 4IJ6A 1L7AA 3VVMA 2YH2A 2O8FB 1M7BA 5EVCA 4NBLA 3GRFA 4YCNA 2B8WA 2OQ2A 4E11A 5M5BA 1XKQA 1QGED 2VDKB 4UDOA 2XB9A 2O5RA 1IVNA 4O4JA 3HB1A 4OI4A 1FJ2A 1Q50A 3K16A 1G2IA 1JIJA 3FDJA 1SCKA 1X1EA 3A3NA 3PA8A 2Q21A 2QNIA 2OL4A 2BOVA 1QZZA 2IU3A 3HMKA 3OY7A 3C5WP 2JLBA 4HWSA 3H2JA 1M2NA 3MSCA 4FFRA 4PO1A 1K97A 1SOVA 4P93A 1MGOA 2REQB 3LUBA 4QXMA 3NC1C 1PJAA 4PG4A 3AYXB 2Q5EA 1O5IA 3GEHA 2NU9A 1RXSA 4IW3B 5BV8A 3AK4A 1IH8A 3HFSA 3ITKA 3U2QA 3IA2A 1G4AE 1E77A 2CNWD 2P6RA 5K0NA 2YWBA 2Y0PA 2V0NA 4X6XA 3VAAA 4AQ7A 3G8CA 2OMKA 1TC1A 1V4NA 1KJYA 3BKWA 3NGMA 3UJ8A 2D5LA 2CNLA 1XTTA 2OXFA 3HCAA 3A6LA 4DG8A 3UMRA 3F6YA 4AU1A 5HXAA 4AJLA 5CCXA 3QVSA 3HA5A 4JMPA 4QODA 1PT6A 5AW8A 4WCVA 2XTAA 2JFNA 3LY9A 5EMNA 2NUTA 3VJLA 4A9AA 4ZMRA 2VS1A 5DJ5A 1XEWY 2Q4DA 4O4IA 4MR9B 3G5TA 4ZIRB 4DCVA 3KHKA 3PUXA 5ALHA 3LPCA 2PD3A 3KL4A 1UMCA 4CG0A 1TUGA 2W6MA 3B9BA 2OBLA 3TSOA 1LX6A 5JQGB 2QM8A 3T9CA 3H16A 3OO1A 1T4DA 1W2WB 1Y6RA 5DV9A 2XCTB 2H1OA 5IHPA 3E15A 3CEAA 4BNLA 4HO1X 4B74A 4LVCA 1RM4A 1E1QA 3BXXA 4QBIA 1R9NA 3EWSA 1T2EA 2BE7A 3K09C 2OUKA 1NN5A 2EKQA 1WMFA 4FLFA 5DP2A 5G0SA 4POAA 4JMLA 4LRTB 4MO9A 4N49A 2AFVA 2YVKA 1B6RA 2TYSB 1L4NA 1XCPA 2KE5A 3F5DA 1SCDA 3ONWA 5JH7F 1GPJA 3HJUA 5LZ8A 4QYSA 2AQKA 2H9IA 2YFHA 2HU8A 3CGGA 3JD2A 1EB8A 4GGOA 1RRGA 4L7QA 2BP7B 4G8BA 3BX1A 1CY0A 3Q7IA 2EX0A 4ZVTA 2GYUA 2AC2A 2JJMA 3RTBA 4MI9A 5EJGA 1U99A 2I2BA 2B7CA 5TQVA 4HH4A 4JLSA 3GZJA 3U9LA 3VNQA 1QIMA 3MJCA 5KX5F 1G20E 2ID4A 1YJQA 3ANNA 2I4LA 3PQ8A 3KYDB 4TS9A 1NBEA 2VZEA 4WASA 1AZWA 4XB6B 4YCJA 1GJRA 3UENA 1JGTA 2W83A 1JH9A 4CQNA 3LZ6A 1C9NA 2COEA 2CBXA 1NFRA 2NP6A 1GZ4A 2YV4A 2F9FA 2Q6VA 2E89A 4ID3A 2VJCA 3DGFC 5F3RA 3W8FA 2O8BA 1THGA 3BTSA 1K5GA 3M33A 2SKEA 4F12A 1ZDMA 2YN0A 2OHFA 4IIGA 1Z73A 4IIXA 4UU7A 5FTMA 1W85B 2A9OA 2AD5A 1FA9A 2G1JA 4TWIA 1Z0KA 2NVWA 1DO0A 4QQFA 4NCBA 4J0HA 1QX3A 5TS3A 4RD0A 3CVVA 3S27A 3WLFA 2WJ6A 1ECLA 4HDKA 1L5HA 1JLLA 3FVRA 3H9GA 2QSJA 1UKVY 1W0JA 1HSZA 2I9PA 1MJFA 4M36A 5JD5A 1ZC3A 1FMJA 2XR1A 2J5KA 1EGAA 3AEQA 4LYHA 1N5JA 4R3UC 3ONNA 1KS2A 4RJIA 3TRDA 4ARUA 3GJYA 1ZJJA 2QU8A 1ONBA 2NO4A 3D3NA 4MUEA 1RQPA 3AR2A 3DPIA 2X14A 2B6HA 3CCFA 5ERYA 3IEPA 4C22A 1RZRD 3LUCA 3WZMA 4FGWA 3AHGA 2IY8A 4YO8A 1FZQA 1K0FA 1IM8A 1MORA 1T2CA 2W6PA 3C3AA 2AMYA 1GQQA 1NULA 4LE0A 4V0LA 4EPYA 4CHGA 3AUAA 3D81A 2V7QD 4RBNA 3VKUA 3TH5A 5HSGA 3IESA 1PR1A 3OT4A 4HS9A 3NHZA 4CCYB 4KRGA 2OEPA 2ONKA 1YQQA 2GT1A 2OZLA 3C3JA 3ICVA 5DBOA 4HRYA 5EINA 4KEAA 3RT7A 2OWDA 2E5LB 1NUQA 1LV7A 3ETLA 2CNDA 5JANA 1YVPA 3G88A 3OZSA 4TQUS 2BLNA 3QLTA 2QX7A 3NBFA 2H4JA 2ZRGA 4P54A 5AK0A 1QNLA 2QN8A 3MB5A 16PKA 1NM5A 1R6AA 2D0OB 2HTEA 4J1QA 4F46A 2NYVA 2HMUA 2VHVA 2Y8EA 5DCLA 5IJ0A 2Q9AA 3K2EA 4EBFA 2IELA 1P2GA 5GZ3A 3TRHA 2FWJA 4RIIA 1KEUA 1P7PA 2XLCA 3R09A 1FW8A 4KI0A 5KU1A 1REQA 5J4LA 1H2RS 1SXJC 3BHIA 3H9QA 2EATA 5IABA 5K8LA 2XCQA 1N6PA 1G19A 3K5WA 4WZAA 1KY5A 2Y1OA 3GZNA 4RHCA 1E6CA 3LV8A 3MLBA 3RTAA 4U7TB 1U8CB 1ISIA 2QL7A 1G41A 2M2IA 2NO0A 5JJBA 3L07A 2BKAA 5C5DA 1M3SA 1ZX1A 2X9VA 4E1AA 2COKA 5IG2A 3K9HA 3NT4A 1GADO 1C2TA 3MEQA 1LCIA 3E9EA 3RS8A 2PUVA 2DSTA 3NNNA 3U3KA 4DA8A 3V00A 4EHBA 4ABYA 1W52X 2VDNB 4OI0A 1WM1A 1GPLA 4QBFA 3RC9A 1FP6A 1RABA 3E5HA 3C2QA 3FHLA 2D1FA 4IFEA 2YZMA 2IYSA 5I5GA 2VPQA 2M1XA 1LUAA 4C7OB 1B2LA 3FWZA 4CM8A 1EWQA 2IX3A 2WTMA 4F4CA 4YV1A 1ORHA 1QYVA 3ZDEA 4HTFA 2BJWA 3B6KA 2CDAA 4L5JA 3WYGA 3DFUA 3TLXA 4QXRA 1KP9A 1YRAA 3USZA 1AQ6A 1DUSA 4CUJA 2DEUA 3BE6A 1MB4A 3CEPB 4TLLB 1XRRA 3TGPA 3PT9A 4MLCA 3O94A 2Q9UA 3O92A 4GS5A 5DHSA 4RETA 1AHNA 3MIZA 1PBNA 4PVCA 2C82A 1ELOA 1UDRA 3HBAA 1G3QA 4B7AA 1XX6A 3P1JA 3R0IA 2FFHA 4YLEA 2D2IA 2I2FA 4ZCQA 3I1FA 4TWAA 4K3UA 2ZI5A 1UJMA 4D74A 1YRQA 3NDBB 3L4EA 2CE7A 1IMOA 3Q6IA 1NN1A 5CFZA 3MJTA 4PG5A 5AKLA 2MT9A 3NR2A 4V02A 3W1EA 4JFAA 4CKCB 4TTPA 1C9DB 5DGDA 3TXXA 1XEXB 2DJ5A 1Y9JA 2GWRA 3U9SA 3WIEA 3U48A 1BXGB 1P4SA 2ZZMA 1VQ1A 1BGWA 2M1ZA 4V0KA 3IOMA 1T9CA 5FQOA 3PT5A 4MVXA 3FOCA 4QGFA 9GPBA 3NV9A 4TRJA 5TIIA 3LUKA 4UE2A 3PQ5A 5EIAA 3LYHA 4UMVA 1PSWA 3GLTA 4PZPA 4R69A 3NP7A 1XK6A 4BNDA 1ZAYA 1H0KA 2ZCJA 4LF4B 4N48A 1IB6A 2Z0MA 3GBVA 2NZUG 4O08A 2VWQA 5HQ3A 1E3EA 4I5EA 1JDVA 1VHDA 1WKVA 4FR5A 5ALDA 1BE8A 3KOYA 1UWCA 4XGKA 1T2NA 5IKOA 2P7HA 3SOPA 4BMXA 1N1GA 4R9UC 3QLUA 3L6DA 3EE6A 4J7UA 1YSCA 3EXFA 2GB4A 3V1LA 2NU7A 2FW1A 3ZTYA 4DMMA 1DLJA 2WILA 1LBHA 1OAAA 2J5QA 3OJWA 1UBHS 1FYFA 4KN6A 4ZQFA 2BGGA 1KERA 3G2QA 2FMHA 4I5FA 4FZJA 3AGQA 2OHHA 2AZTA 2P4EA 4O4HA 4UCQA 3ETGA 3TL2A 2D7DA 3EFOB 1IN1A 1ZP6A 2FHPA 3TE6A 1MCZA 5DHPA 1J33A 4UBIA 4FFOA 1C7FA 1C9EA 3AEZA 2FZEA 3AXSA 4PLWA 3GAFA 1B6GA 5EP4A 4Z1MA 5HZGA 3VPBA 2ZBGA 4D0RA 5CXSA 3FIUA 3AR9A 5FR2A 3LC7O 3UWOA 3MWLA 4IFIA 4Q19A 4D8UA 3HP4A 1OT5A 1C8BA 1MAAA 2QF7A 5TC4A 4BLVA 1T9GR 2B8TA 4N7MA 5HJ5A 1KQFA 4KK4A 4WINA 1BDBA 1D6MA 1SU8A 1SQ5A 3HNRA 4XVQA 2IEZA 4IO1A 4B6GA 4LV6A 1UOOA 3F1LA 1B7GO 2CUKA 1MQAA 3ZZUA 4F1JA 4BNXA 1IHUA 1P4HA 1L7RA 3IV7A 3TEJA 4EPXA 3F6SA 3RFXA 1WHTA 3IDSA 1I0IA 1N3IA 2WM2A 2J0EA 1YKGA 4O2BB 1NBIA 3EC7A 2BFEA 3PFIA 2PEYA 3NC4A 3TXYA 1IZ9A 3BXZA 4HRXA 5A7FA 2IU0A 2B4RO 1YVRA 3EXEB 1LC0A 3KB2A 1EJBA 1JHOA 1M1YE 2GM3A 3OPYA 1VC2A 3VA7A 3MYRA 3EOZA 4PNHA 2C0PA 3P9PA 1Y5IA 4FILA 2QVCA 1JHQA 4OJMX 1G8AA 2Y77A 4QE3A 2WUVA 4AX8A 1XIVA 1JMYA 1EP9A 4MK4A 5EESA 4EBBA 1BQ4A 1EFAA 4Y0VA 2LV8A 4E7OA 1ML4A 3SSOA 3E23A 4IGAA 3OBBA 5DU2A 5SY4A 2ZRQA 1FU4A 3MJVA 3OJCA 2JRLA 2YWDA 1V3QE 3C15C 4X1OA 1KU0A 3X1DA 8AT1A 1OF1A 4Q1BA 1AKVA 4RDIA 1P4AA 5E3HA 3F6BX 4G81A 1RPJA 2A9KA 1DU4A 1DLIA 1L8OA 4MV4A 1NPYA 3R5JA 5CA1F 5I5EA 4U5XA 2DXIA 3OEHA 4D9BA 4MR7A 2VYND 1KVUA 5JYEA 3GRZA 3NIDB 1DG1G 2VRWA 1CR4A 2TMYA 4TT3D 4BO2A 1MG0A 1E62A 2WJ4A 4DWVA 2ZS9A 1P9RA 4Q1DA 4RAOA 1XCLA 3FFXA 1I32A 1TA9A 1CY6A 2WUGA 4JOQA 1RZ3A 2ZB2A 5AVUA 3QFTA 1UDCA 4JIGA 1H4SA 1IWPB 3H1EA 1IAVA 4MWCA 1OVGA 1JEYA 3WFZA 5PGMA 2FWNA 1II0A 2NXCA 5U9CA 3G9ZA 3I9NA 4GI3A 3CTMA 5F9HA 3NBXX 3O9MA 4DQKA 3D6AA 5A5GA 3LZCA 4MUFA 1Z4IA 3FYHA 5L6LB 2RG7A 2X5XA 3NUQA 4Y2VA 1QCYA 2PD6A 4C2AA 4EI8A 4O2AA 2NZVG 3INTA 2PCLA 3AR4A 3QXXA 3TLBA 2I2XB 4XJVA 1W8DA 5SYMA 1SQ6A 3UWDA 2R8ZA 5AO9A 4F1KA 3JQGA 1L5SA 3Q0TA 4G1UC 4L5BA 4F56A 5HKAA 3RVNA 3MCUA 4AJHA 4EDFA 3AOEA 5C80A 4R2XA 4DGSA 4E3ZA 4G4SO 1GVHA 1K4YA 4D9JA 5HZKA 2PANA 3ZV5A 3WJAA 1P2SA 1Z8HA 3A6JA 3RWMB 5CD1A 1HDIA 3DLTA 4YK7A 5H81A 2HWXA 3UYKA 3VZRA 1TKRA 4CU5A 4ZI7F 3PVSA 1GTG1 4I8XA 1QP8A 4NDNE 4KN5A 2GFIA 3NWBA 2G0NA 2G17A 1YCFA 2XIJA 3PJEA 4HQNA 4M22A 2GX6A 2W37A 1G7TA 5KSPA 2BGLA 2HCBA 4BQSA 2NADA 3GC6A 1B26A 1YH3A 1AQIA 3OCUA 3PJRA 3ESDA 3QFHA 4BFZA 1BA3A 1FOEB 4FN4A 4Q02A 3HYTA 3N0RA 4GYWA 2CL6X 3PEWA 1SOWA 4H7IA 2C5AA 3DDUA 3E35A 1V5FA 4MKHA 5BWOA 1Q0SA 1JG4A 3I58A 1V43A 3SDBA 1Y9AA 3WL7A 2R0QC 4F38A 1L5MA 2PKWA 4YJFB 4MZXA 5BW4A 4BFCA 1BXKA 1WWKA 2NUPA 2LZ0A 3PI6A 3O2NA 2VDUE 3QWIA 1E60A 3AEUB 1RWPA 3BWBA 3KEQA 2ZYUX 5TXGA 1M2OB 2DUJA 2JI9A 1M5TA 2WD9A 1DJNA 3AMVA 3ELUA 1IRIA 3H5WA 4ZVSA 3SN6A 4B34A 2Q4EA 4XIJA 3RVPA 1OWOA 3G23A 5JXGA 2J09A 2Q6TA 2X86A 4D9CA 2VPWA 2OCLA 1PZEA 1TJYA 1WKBA 1I1HA 5K03A 3TIFA 1IEWA 1T4MA 3EVBA 4PXSA 4DR7B 2RAFA 1HLPA 3I83A 2R68A 3HLKA 4GXRA 3QV1A 2R25B 5IEJA 4IWYA 1X1BA 4UVGA 1JQBA 2ZJ1A 1TQ8A 3MJRA 1XRPA 4RF3A 5F3WB 1J5XA 1M2EA 3Q0IA 1D2MA 5DLDA 2X0FA 3JQAD 4BGVA 2GHRA 1FS4A 5SZKB 4D80A 3ILVA 1FLAA 1QV9A 5I7WA 3DOEA 1IZ8A 1K0UA 5DWVA 1EE2A 4NOKA 3VTKA 2CHUA 3K0HA 3EC2A 5GONB 4RH1A 3A1NA 1UKEA 3RRNA 3N2LA 3P0IA 5CTAA 2X13A 3EXHB 3FSJX 3I04A 4YNBA 2GAAA 2BH2A 3OMLA 3STUA 2P6MA 1XDZA 3CE9A 4XLZA 1CUIA 1S9DA 3I39X 4HLUA 1U0EA 4I8IA 2CKMA 2DBVO 5BR4A 3AVVA 1SIWA 3FUWA 1ZL2A 5BSMA 3W9SA 4DNQA 3IMFA 2J6CA 5GY7A 3IVGA 3ILXA 2NTYC 4OUDA 3DW1X 3MGAA 3JWEA 4RL6A 1DKPA 3MS7A 1YR9A 5D6OA 1C9YA 2OCGA 2OLJA 3LDFA 1PR9A 5ADWA 3RTEA 1NXSA 4NICA 3V5NA 4PLHA 1C14A 1Z5VA 3VX3A 1T2VA 4MIEA 1EX1A 2BM1A 2XQKA 3B1KA 1UMBB 1P8AA 3GFVA 1J1ZA 4HFJA 3ZQ6A 1QPZA 4N3AA 1DFGA 3ZHZA 2JIZA 1ZCJA 4MV5A 2BT4A 1Z4MA 2RGXA 4HXFB 5BORA 2HGZA 4LRQA 4RSGA 5CFNA 3BFKA 2QVLA 1W4ZA 1O2DA 2HBRA 3A1DA 1B00A 4YH1A 5AW9A 3FCUB 4UHKA 4Z0TA 3ZY3A 4UHHA 4XWOA 5IN5A 1NJ8A 4JB8A 4P7KA 1ZWKA 3FOZA 1XZ8A 3TYXA 4BC0A 2OK8A 1CPYA 2I7VA 5D3MB 3N39C 3RFFA 1PNRA 3IILA 3GNLA 1Q7TA 1VE9A 4JLDA 2F9MA 1YI8A 1Z3CA 1A9XB 3QVUA 2ZREA 3IAM6 4QPZA 1JHRA 1EM8B 1XAGA 2OQVA 3WBBA 5KDDA 5FWYB 1ZD5A 4FYXA 2ZJ3A 4KXYA 3QLVC 3ES9A 4NECA 4HZUA 4HAVA 5FA8A 4CDGA 2XECA 3Q4GA 3EXHC 4C29A 2XDQB 5AOAA 4HXEB 1E8DA 1OE0A 1NVVR 2BISA 2D8AA 1U8YA 2VG8A 5FWAA 5HEKA 4II3A 2HWWA 2YWGA 1B41A 1MQ9A 1E9EA 1ZD1A 2YJ6A 3DEYX 3EBPA 3KHSA 4K26A 2HIAA 5FI0B 1ENPA 1PQPA 4M0PA 1UR5A 1PFYA 3A4VA 2H1IA 5E9WA 5GJWC 1QM5A 2RKOA 4B76A 4TKVA 3FNEA 3T6KA 3LIIA 1KBQA 1RQXA 1KI2A 1EEHA 1USKA 2YYSA 3ZU3A 5IPFA 2EQBA 4Z1OA 3T3GA 4ARCA 2AOTB 1WD7A 2NZWA 2GN1A 2V1UA 2QXYA 3M5WA 3E84A 3O8DA 3Q7RA 3LXRA 1U7ZA 4FZVA 2LIVA 4Y2TA 5DASA 3WMEA 4BFXA 3AF6A 5ESXA 2OAQ1 4TROA 3K20A 1OJLA 2FKNA 3G3EA 4YJGB 2GM5A 1J70A 2A9QA 3K0EA 3LLCA 1DBWA 3PXUA 4JB0A 1H8EA 3CLTD 3WL4A 1AHHA 2AHOA 2QTLA 2PWBA 3C5HA 1JXAA 1XDBA 1SCNE 2IOYA 3K2BA 4XWYA 4CM6A 7ABPA 3DDCA 4FIZA 3DDOA 1CS0A 4LSZA 5FHQA 2EQAA 3INRA 4KWHA 1X42A 5HMMA 4BGDA 3OMWA 3I9V1 4JC4A 4XAQA 2WJHA 4MPDA 3FVWA 5JEEA 4V3BA 5BSRA 2BMDA 3AUXA 3MMNA 3Q5DA 4FMDF 1PAUA 4E5KA 4QGHA 1HE1C 4ZEMA 4KO2S 1RFLA 4I99A 4QHYA 3SZUA 2PD4A 4JP8A 1JG2A 1SB9A 1N6OA 1T8WA 3ODPA 3U3OA 1N2SA 3H9CA 4OFBA 5HDQA 1EPUA 2IZ1A 1I7LA 4ER3A 2EL9A 5JSUA 5K99A 3THSA 1E61A 2GERA 5DM2A 2C7PA 3HB9A 1GA6A 3CLUD 1WL8A 1OI3A 4FQ7A 4OXQA 4Q9HA 1JEEA 3WHPA 2INGX 3G2PA 1QIIA 1K8QA 2XMQA 1KY2A 2JFQA 2Y1KA 1EB9A 3CS3A 2EJUA 2TECE 2FZWA 3QXSA 2AW5A 2QU7A 5DLQC 3OTOB 3GLGB 2EKPA 5JVDB 1ZQ9A 2V74B 3B1FA 1WP9A 1YB7A 3TZEA 1OIWA 1KDOA 3H5NA 3R7WA 1XQYA 3VI3B 4D02A 3GDHA 1N9GB 1T1IA 2H9YA 4GOOD 5KMGB 4ZOEA 2OV1A 1KKLA 5F21A 2IQIA 1ZMBA 3MCWA 3QLEA 3VPGA 2MSEB 4QT4A 1RRMA 4HDCA 4K87A 1HEUA 4A0HA 1IBKB 2HMAA 1S3SA 2ZT6A 1NFFA 4F7WA 1KYXA 1P45A 4QNMA 4MVCA 2WWRA 4ZD6A 4F97A 3HUDA 1NVXQ 2Q5OA 1H4VB 1NMXA 2Q5HA 2RHMA 1WY5A 4P5EA 4G37A 4WGGA 5BYJA 3RVQA 4NEGA 1R16A 1DFHA 2ZTUA 3L0SA 4IDGA 5FPYA 4OXKA 5J9FA 4F0JA 5IVKA 2Z83A 4Q1EA 1Y7IA 3NLLA 3WA6A 5KWIA 2W8ZA 5DRTA 1JPNA 4ZCRA 1FVXA 1M6VA 3LY8A 4W8HA 3KZXA 1OQAA 2CLOB 3TUIC 2A92A 4LDAA 4F9FA 1ENOA 1EWVA 1TF2A 5DX8A 2Q6LA 4N4AA 4E5SA 2B5WA 1ARZA 1NNLA 4F4IA 1C4KA 3DF7A 2W93A 2LW7A 4YUWA 4LSWA 1G3UA 2OD2A 3TWOA 2J30A 1LLDA 1MVLA 1Z39A 2GRUA 4R83A 1QO0A 3QU9A 1RJDA 3PJDA 1QE3A 3G8BA 2QI9F 3K6RA 4J0EA 4A6DA 4WNAA 1QH1A 3GMSA 2R7MA 1PNTA 5JHGB 1SQGA 3L8DA 2FN8A 3THYA 4MNTA 2C9BA 3PC3A 4QO7A 4PGMA 4R2IA 1SBTA 3M8KA 4KE9A 4DV0B 3ZH2A 3FRIA 5F33A 4LMBA 3PD1A 4S3MA 1TU3A 4W8OA 3ZXXA 2QTFA 1O0BA 1G6HA 3E6AA 4JEMA 1K06A 1ODKA 4U3JB 1AXGA 5EWMB 1VRWA 1KE2A 5L3VA 1ZL0A 4ON9A 3H11A 5H59A 4XGRA 3EULA 3JWIA 4X1IB 4OQXA 1E2UA 1K66A 4M1ZA 4YRFA 1LRLA 2OMEA 1CFZA 3EOAI 5EP2A 5LBUA 4TQGA 3ZBPA 1G8FA 1LNQA 3X0DA 2C7QA 3L6EA 4DYDA 3LF2A 1NGSA 3UMCA 2DU8A 3HDYA 3RYTC 3TLKA 3RSCA 1Y8ZA 3OAAD 4AD8A 1CEYA 3BEDA 4NOJA 3RC3A 5HFJA 3KL2A 1T1JA 4EFNA 4FYWA 2Z98A 5D85A 1W4BA 5DNYB 1EFKA 2EX1A 2YVLA 3NHYA 3OLZA 5FR1A 2L82A 3SJZA 5KQMA 2LDBA 2ODBA 4Z6KA 5TQ0A 3IJ5A 4COKA 4K6HA 4RWZA 4XPIB 1LJ8A 1JIIA 4JP3A 5ALNA 4Q82A 4R81A 4E30A 5TGZA 3AHCA 3FSRA 1H9AA 4FFNA 2D7JA 4MRPA 4C7MA 3K70D 5IKXA 4AULA 5HS6A 2X2PA 2RHOA 1HF3A 1YT5A 3O7WA 3ZV4A 4C76A 5C5CA 5FOUA 3F5FA 1RHUA 3ECAA 1H4QA 3DZKA 1KI9A 1LJLA 3ACCA 5DGTA 2FI1A 2ONJA <