1Z6XA

Structure of human adp-ribosylation factor 4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
175
Chain Sequence
b'TISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 4
publication title Structure Of Human ADP-Ribosylation Factor 4
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 54
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1z6xA00
4JVLA 4JSTA 4EIWA 4A2QA 1U0HC 2P6UA 4W7SA 4Q9LA 4RD3A 3HDTA 3R9IA 4C3ZA 4LV8B 1Q21A 1DELA 3AP3A 3MJHA 4GP6A 2ZRPA 1KTVA 5EE9A 1W36B 4HUQA 3VQTA 3QVVA 4BEBA 2GVZC 3P26A 4C0HA 2O8FA 5GADl 2J0VA 4DCNA 2B21A 4MUBA 2SHKA 3UWOA 3JZMA 3IUYA 3B9PA 5FTNA 3F3YA 2CL7X 1Z8FA 2X2EA 3PXGA 2V6JA 4LYHA 1R8QA 1N6PA 3ZGXA 1TX4B 2O8EB 2EW1A 1E94E 2GWHA 1A7JA 2VA8A 5EXTA 2O0HA 3QIAA 4FIDA 4Q4JB 3ZVLA 4TMTA 5EZ5A 4FMCF 1S4QA 3L43A 4KSBA 721PA 2BBOA 4BFYA 4YC7A 3TSOA 2PEZA 4KFRA 2FV8A 2HF8A 4ASUA 2OCBA 1X3SA 4EJSB 1XMJA 2F3RA 4HUTA 2AXNA 3QEOA 2XX3A 5HCNA 5JLJA 3TAUA 2IYYA 1SVSA 3ZYCA 2W83A 1U0LA 2A78A 1OXUA 3PQCA 2YOFA 4GT1A 4OQMA 4R98A 1SHZA 2XOKA 4Q01A 1G8FA 1T9HA 2NG1A 3QNUA 1F6BA 2AD1A 1CU1A 3CM0A 4KBGA 2ZRLA 2ZJ2A 1KK1A 2YKGA 4FWIB 4OI1A 1WA5A 4IEIA 1TL7C 4M1KA 2W2XA 2QMEA 3QKTA 4BFUA 2O8CA 3EZ9A 3UATA 4N1AA 5FUXA 4PAOA 2LKDA 1GSIA 2P0EA 1OFUX 3AKDA 4NYJR 1OFIA 3JVVA 1OYWA 3MUFA 3RRYA 4MQBA 1CR2A 3W6PA 3ZQJA 4TYQA 1RJ9A 4IRUB 1YR8A 2P6RA 5TARA 1IJFA 4RD2A 5L3QB 1COWA 2AX4A 4HUQB 1FUKA 4E5UA 2O8FB 2ZJ8A 4KYIB 4URVR 1JPJA 2VP5A 1U0JA 2A9KA 4GNKA 4UJ3A 2XSZA 4DLRA 2XXAA 1GWNA 2Z4RA 1JEDA 2G77B 4IVPA 3UMSA 5CITA 1BO6A 2EFGA 4LBVA 2BWJA 4N3NA 2V9PA 4RCYA 2ATVA 2WSSA 3AH8A 4UXJA 3W34A 3BGWA 4XVQA 1DADA 4G0NA 1PV4A 2W0MA 1AGRA 2CVFA 2ZE8A 2Z4SA 2TMKA 1XD2A 1GRRA 3RSOA 2J7PA 2OILA 4DCSA 4MGIR 2WAXA 4MGKR 4PR0A 3O8RA 4M4SA 1UKYA 2ZU6A 4PSVA 3B1ZA 3TSWA 2CK3A 1ESNA 221PA 2WIBA 4QHTA 5BYJA 3ZS9A 1TUEA 1RE0A 4B76A 5BN4A 4F7WA 1XCMA 5AJXA 3QE0A 1TQ2A 3W8NA 1XXHE 5LBIA 2BV3A 3CF0A 1JQJC 1KYIA 2ASEA 3WNCA 3P1JA 3LQRA 4ZDJA 1E4YA 2GRJA 2IX3A 4OI0A 3CO5A 4LJAA 2O8CB 1L8QA 4W5WA 3P4YA 1GKUB 1GVNB 1ZM9A 4XD7A 1TF7A 5AK0A 1U8AA 3CR7A 4LHWA 1HE1C 1YRAA 3B78A 1E2QA 3RS3A 4B3BA 1MH1A 2IS6A 1KOFA 1Z6YA 3K9GA 2D2EA 1ZM7A 1WCV1 1RJ9B 3SS8A 1E2IA 1MO6A 4NHOA 1VYVA 2QRZA 4G5GA 4OQFA 4QJ5A 4LJ6A 2ZJAA 5CIWA 3NBXX 3EWSA 3FTQA 3EAQA 1GITA 5BN3A 4R2HA 5E7IA 3T35A 2QU8A 3C5HA 2AWOA 1QRAA 1U98A 5KDOA 1JQLB 2H8KA 4CW7A 2XXAB 2VBCA 4KHZA 2QY9A 5TDHA 1IY0A 2Y8EA 1P62B 4PC1A 4DUGA 1HE8B 2I1QA 3V4FA 3FYHA 4YXWA 2CHVA 4RZ3A 1CR0A 1XEXA 1UPTA 2YNMA 2OO7A 4OKSA 1LVGA 2EFEB 2G88A 2GA8A 3ZIAD 2FFHA 3SC3A 3NDBB 2FG5A 2FMXA 2X77A 4AC9A 3W8RA 2CE2X 4NU0A 1JNYA 4PTLA 1XD2B 3RRMA 4BRUA 3QEJA 1E1QD 2YHSA 4XVRA 1NRJB 1WXQA 4LJ9A 1IXRC 1QHGA 4R2IA 1XTSA 2WJYA 1E2PA 1OW3B 3DDCA 3UWKA 4LRWA 4P33A 5JJLA 1T5LA 2ZR0A 4UXHA 3QSYA 3CR8A 5FOUA 5FOVA 4YDHB 4V0ME 2ZJOA 1A4RA 1RKBA 1XCGB 1KSGA 1CLUA 4KITB 1KSFX 5J4HA 5JBQA 4AY2A 1OH8A 1G7SA 4JLOA 1Z6AA 4W5JA 4MRSA 4L9WA 3C5CA 3NEYA 3LW8A 5AJYA 4TTQA 1XJ0A 3TGPA 1E2NA 3TBKA 4B3XA 2YZ2A 4OL0A 3ICQB 4PO8A 1Z06A 4V0OA 5KHOC 1F48A 4BWYA 2OLJA 1A5TA 3JZAA 4ZCIA 4L5BA 1KJWA 4J0QA 2V7QA 1ZU5A 5SZKB 3PUYA 5C2JB 3PEUA 2FWRA 3PENA 2QGNA 4UNPA 1E96A 4DSTA 3N5CA 4AI6A 2NIPA 1F5NA 1F2UA 4ABYA 1FFHA 4DDVA 4C2UA 2ORVA 3LQQA 4RVCA 3EX7C 2KB0A 4KLNA 2Q3HA 4FCVA 1OPXA 1E1RA 1GKYA 1XEWX 2ZAMA 1KZ7B 5EE5B 1J70A 2QN6A 4Q9IA 5LB2A 4M2LA 2WMNB 1PLJA 5TMPA 3NEJA 4D4LA 1ZUIA 3VR3A 1GRQA 1KSJA 2RGXA 3B2EA 3OHMA 3EPHA 3VX4A 1W4CA 5A4JA 4MDEA 5FTJA 5KSPA 5JJIA 4NH0A 2ZUDA 4HDCA 3VNVA 4Q7KA 1Z29A 2ZE5A 3MCAA 6Q21A 3NXSA 2FOLA 1UAAA 3OE7A 3ZS8A 2A30A 4AYTA 4KVGA 1F3OA 5EE1A 1T8TA 5H8WA 4HSEA 4DJTA 4QNRA 1SVIA 3BE4A 1H8EA 4ZO4A 1UEJA 2PMKA 3CF2A 3DKVA 4HATA 3IPXA 3CNNA 3BH0A 4MRRA 1LNZA 3SDZA 4Y0VA 2JGNA 4MYHA 3VR4A 2Q3MA 3BFKA 1OLOA 1M1YE 4ZDKA 1DTSA 2OE2A 2VF7A 3B1XA 4FINA 1KK0A 4EPWA 1YE8A 2NO9A 1M34E 2OZEA 4C0BA 1U90A 2IF0A 5KO2A 1T3LA 2ZSDA 2IS4A 5F9FA 1Q12A 4DEYA 1VG0B 2FE4A 1Z0KA 3U3KA 1YR7A 3LNCA 3U7EB 3HPQA 1E9SA 3O8CA 1F2UB 5BYKA 3I92A 1IBRA 2DFKB 4RSGA 2FDCA 3AVPA 4C0SA 1I2MA 2QZ4A 3PUXA 4KFUA 4NTZA 4DSUA 2QROA 1NL3A 1U8ZA 4RD4A 4AKHA 3LXXA 4M0LA 3LV8A 1G18A 4D4KA 3QXJA 4LSGA 1S9DA 2PBRA 5K8IA 4HLUA 5AWFC 3LWNA 2WICA 4C0LA 4NYJQ 4Z1MA 2EFCB 1Q20A 1OIXA 2HCJB 2OXCA 4NYMR 1G3QA 4OHVA 4Q4AA 4ZCLA 4D0GA 3U3RA 1UADA 2OFXA 3M4YA 4ACAA 3WP0A 1SVOA 3RS2A 3VMFA 1L2TA 1AS0A 1KI7A 3TVTA 2G1JA 2IYUA 1G64A 5CIQA 1NBME 2QPTA 2FSHA 3VHXA 3IKJA 1OV4A 3KQNA 2H57A 1F2TA 4H1UA 3PUWA 5LD2C 3CH5A 4Q4HA 5J4LA 4DLTA 3KKMA 3MFYA 1E2FA 1FZQA 1RRFA 2OBNA 2QSYA 3U3JA 1CR1A 4QM6A 2UZIR 5E4FA 2J41A 1AIPA 2VHUA 1SVLA 4V03A 3DOFA 1W46A 4RZXA 4DBLC 4QRHA 4DDWA 1CF4A 1E6CA 2WVJA 4M9SA 4EFMA 1AKYA 4DEXA 4V0KA 3E5HA 3GP8A 5AUQA 2WWWA 2C96A 2G0NA 4RKFA 5E7JA 5EZ6B 2R9VA 5D3MA 2XZPA 1YZNA 1JI0A 1DG1G 2WBLC 3B1VA 2YV5A 1HA3A 2A2ZA 2Q6TA 3SNHA 4WXPA 3EPLA 3I4LA 2R2AA 5HZKA 4LYJA 4D82A 1UBGA 2JLRA 1ONBA 4E03A 4P0TA 4YMVA 5FBQB 2FNAA 3SJBA 2JLSA 3O47A 1BMFA 3OIWA 5F98A 1TQ6A 4M21A 3C8UA 2BJVA 5JRJA 1DAMA 5C1BA 1SKYE 4FCWA 3TMKA 3FFAA 2B7CA 3AVQA 4M53A 1E9AA 3ADBA 1E9RA 1MO5A 5DO9A 2JLYA 2ZS9A 4Q4AB 1NIPA 2UKDA 4IVRA 1R5BA 2O8BA 2ZREA 1Z47A 1N0WA 3GEIA 4D2IA 2P65A 3KTAA 4L4UA 3ZIAA 4HB3A 5HTKA 1G19A 1VKJA 1G7TA 3X1YA 4BASA 1HV8A 3HR8A 2CVHA 4WZBE 2IT1A 1F2TB 2WZQA 1Z08A 2VEDA 3U7FB 1AK2A 1UJ2A 1YR9A 4Q4HB 1TUIA 3AF3A 3CH4B 2QNRA 1E9FA 5SZHB 4A2PA 1KKMA 1Q0UA 4LBYA 5JWRA 3WYFA 2H1LA 3RYTC 2VH5R 621PA 3W9YA 5FR2A 1JR3E 3QI2A 3CRVA 1BYIA 2AK3A 5LDDC 3L0PA 3R8FA 2PZFA 5G3YA 3BFXA 4B6FA 1I4LD 5AJVB 2ZJZA 5EXSA 2C99A 3AVOA 3HP1A 4EJSC 5FI1B 2XOKD 2RGNC 4TQ9A 4FWTA 5K8UA 4DB2A 2LKCA 1X1SA 2IYSA 4EPVA 2ZYTX 1N6HA 1W4BA 3AF1A 3BD9A 5D3MB 2ZYWX 3KB2A 4DLXA 1KMQA 4FXPA 3TUZC 2REOA 4DCTA 4C4PA 1DAGA 4KYUA 4I1SA 1WE2A 1Q44A 4AG6A 4JLBA 3UIEA 1AQYA 3SHFA 1T0HB 2HXYA 2PMDA 1MABA 4TL9A 5KYKA 3EW9A 2XJ9A 4QBFA 4B71A 3VR5A 1LS1A 4QOSA 4GOXA 3W6NA 3MRSA 2ODEA 1COWD 3IGFA 2YC4C 3FOZA 2D62A 3AVVA 1H8HD 4GMDA 1WBDA 4JLPA 1NBMD 1OT3A 2XNDD 2JLWA 2VP9A 5J47A 2XTMA 2XSZD 5BXQC 2C2HA 3RS4A 3OIUA 4B3CA 4GBMA 2JA1A 1EFHA 1LB1B 2ZRFA 2O8BB 2QT0A 2NZ8A 4JVNA 3ZH9B 3PEWA 2PL3A 3KTAB 3W3AA 2HF9A 3TQCA 1D9ZA 4B47A 4V02A 1ZINA 2ZI3A 1PLLA 2GXUA 4A6XA 2JCSA 4OQXA 2WSSD 5FOWA 3SOPA 1N25A 1XD9A 3F5FA 3ZD7A 1XXHA 1E99A 1NJGA 4A9AA 4MYUA 2ZRMA 4OK6A 1A82A 2V8OA 4PANA 1K8RA 3HYRA 3K0FA 3QVUA 2FFAA 2PJZA 3VX3A 3I72A 3MWLA 1G20E 5TY0A 4IDPA 2C98A 5DGXA 2R8RA 4U7DA 3WYGA 3KJIA 4Q47A 2K5UA 4KCGA 4KJZA 1KK2A 3WY9A 1OXTA 4BZPA 3GPLA 3FHTA 3QG5A 1HUQA 1D5CA 1EX6A 2CL0X 1EWQA 2XNSA 3QG1A 2FSIA 2JDID 2QA5A 2H17A 4D26A 2CXXA 4N0EA 1XFAA 5BW8A 1GIAA 5E7MA 3PJRA 1NF3A 3IBYA 3WMEA 4BLSA 4S2EA 3LXRA 2GXSA 3SJAA 1JXMA 3B8HA 1YU9A 1QHIA 5H68A 4JZKA 3THWA 3VKHA 3NG1A 2O8DA 1ZIOA 3VAAA 4ILEA 3CONA 1U94A 1MABB 3DEFA 3NH9A 2NPFA 3KKPA 3D7MA 4BFTA 2ONJA 1JAHA 1Q1ZA 3UANA 3BH7A 3E1SA 3TE6A 3GCGA 4QXAA 1AZSC 4WIAA 2PLFA 3EZ2A 3J81k 3AUYA 1S3GA 3B82A 3HWSA 4PFSA 1G3IA 4PSAA 1ZIPA 4NYIR 5DYGA 3TLXA 1XD8A 4AKGA 1ANKA 1KJZA 3MG9A 1FPMA 5FTLA 3U7GA 2XGJA 2AL7A 1W7AA 2JATA 1VG1A 3AKEA 1EG7A 1ELOA 1G8GA 4EFNA 1G3RA 1HT2E 1HYQA 1Z22A 1ZYUA 2FF7A 4OHXA 3FMIA 2R6AA 4LJ4A 4DUGD 5B57C 3NH6A 2Q9CA 4YXWD 3WBJA 1ZRHA 1JR3D 4CEIA 3EXAA 3L8ZA 3BRWD 1RRCA 5J40A 1HEIA 2GTPA 4V0MA 2DBYA 3VU9A 5KNDA 1XXHB 3RWOA 1U8YA 2ZSAA 1OIWA 3K0FB 1R6BX 5KPDA 1NMZA 5LD2B 3KQUA 2QQEA 4QM7A 4LDJA 1LF5A 4L8GA 5JSZA 3DOEA 4QC2A 3NVAA 4IOMA 1JEEA 1H65A 3CX7A 4JLMA 4R9UC 1GTVA 5JRZA 1LY1A 3PV0A 1W47A 1VECA 4NYMQ 1DARA 1KMHA 2BM0A 3SHWA 4D81A 3NWJA 4F4CA 2REXB 5CYOA 5FBLB 1XPRA 3K9NA 2CCKA 1Z07A 3DM5A 4Q48A 1DOAA 3JVUA 4XTRA 3ND8A 3LRPA 2IWRA 2BHRA 1G6OA 4JLDA 1NLYA 3MD0A 1ZM3A 3THWB 2O8DB 3TR0A 2BBWA 4EDHA 2WPDA 3T5DA 2ZUCA 4PHHA 4TQUS 4Q4LA 4C0KA 3BC1A 1CJMA 1SVMA 5EP2A 1MOZA 3VKGA 2MSEB 1AQUA 2ZE7A 3U44A 2BEJA 2GKSA 1OHHA 1IHUA 4US0R 2IHYA 1XP8A 2IC5A 4FMDF 2V7QD 3FKQA 2ZI7A 1B23P 4C2TA 1JJ7A 1XMVA 2F7SA 4GSYA 5JHHB 3BORA 3DVLA 2QM8A 5IK2D 2ZI9A 1ODFA 4L16A 2BMFA 2F1RA 4KVAA 1E1RD 3DL0A 2DFTA 2IS1A 2GZAA 3VU9B 3B7GA 3KL4A 1CBUA 1NN1A 1CKEA 2A5JA 1N5KA 3AVTA 1IM2A 1DAEA 1FP7A 1YR6A 2GF9A 4M9QA 3TVDA 3GJXC 1VCMA 2ATXA 1E3MA 3GJ5A 1OYYA 2J87A 1NI3A 5JSZB 5JWHA 4BZQA 1R0YA 1Z0FA 2GEUA 2VHTA 1OB5A 3TNFA 1MRNA 4BECA 1Q22A 3T15A 1ZBDA 2VL7A 5CK4A 1KMHB 5CLLA 4EKDA 1KO5A 3U4QA 2VYFA 3CF6R 3OE7D 1QVRA 4IOKA 3K09C 4RFSA 3HPRA 3B6EA 3Q85A 4MDFA 1ETUA 1GL9B 1E2KA 2PH1A 4HLDA 2DB3A 1JB1A 1H8ED 2VSOA 4XTCS 2ODNA 3CPJB 3EIHA 2KBEA 3AVWA 4LWZA 3R9WA 2IYXA 4XWKA 4ZIRA 2EVWX 1E2DA 2QPAA 2HJGA 5IRCD 4Q66C 3U44B 4JVMA 1WB9A 2HEIA 2EWWA 3CUEF 4OQLA 5L3VA 5A5GA 1OFTA 4NCNA 1XEFA 4IKEA 2Z0MA 3RRNA 2NZJA 4MGYR 3K70D 2ZRAA 3D3QA 1CRPA 3EA5A 1NVUQ 3NDPA 3PCRB 4PPNA 3DO6A 5CYPA 4JL8A 3K0SA 4CGZA 5TB5A 1H8HA 1NBMA 2D2FA 2XNDA 2QMUA 1JXOA 2ZI5A 1S1CA 4RFVA 1VTKA 2JJ1A 3GJ3A 4PC7A 4OI4A 3PR1A 2BOVA 4X8LA 4UNSA 4AYXA 4Z1MD 4CIDA 4D4JA 4WW0A 1MV5A 4NE2A 1ZNWA 3R7WA 1FUUA 2B6HA 3HR7A 1XTQA 2VLIA 4QGFA 3QXCA 4B34A 3M0EA 1TU4A 3WBKA 2C78A 4GOKA 1C4OA 2ZJ5A 1VCIA 2VP4A 4PZZA 2WWYA 3RRZA 3NC0C 1OKKD 4HAWA 1VIYA 2E9SA 3U4QB 3TRFA 4HLCA 1FW6A 5KNBA 4O3MA 3I62A 2C9OA 4GFDA 1G6HA 4RFSB 1OJLA 2IYLD 1UFQA 1EWRA 2ZI6A 2PJRA 1QHHA 5KTYA 1BIFA 2OUKA 4EPRA 1VCOA 2AWNA 3UMRA 4MITA 2D06A 3GJ8A 4LUCA 2JDIA 4A2WA 4X8MA 1CS4C 1Y63A 2IUTA 1YZQA 4TTRA 3WRYC 1O3YA 3QPUA 2FEOA 4ZIRB 1IN6A 4O0MA 3IILA 1E0KA 1K5DA 2H18A 2WWXA 2WWFA 4CRWB 5HR5A 5DI3A 2C9CA 5GVSA 4RJLA 2BDTA 3NBYC 4LOAA 1OSNA 1NP6A 2BCJQ 3KX2A 2ODWA 3P20A 3K70C 1Z3IX 3FGNA 3BH6A 1GNPA 3KXKA 1U81A 2CEAA 4HZIA 3K8YA 1BMFD 1G3MA 5L3RA 3AVXA 4GZMA 2VHJA 4JMPA 5HPYB 2E87A 4Q1CA 1EFTA 2JJ8A 1LF0A 2EYUA 1N5IA 4D25A 3BOSA 4A0RA 4KI0A 2YYZA 4L15A 3R7WB 3ZVNA 4HLUC 3I3SR 1JR3A 1YZLA 1ZJ6A 4XWAA 1NMYA 3CNOA 1VG9B 2BCGY 4KFTA 3WNDA 1HURA 4Z54A 2ZRCA 4JBXA 4LYAA 2W00A 3IDQA 4NYIQ 5IDVA 5TV2A 2IXEA 2WKPA 3RVBA 4KLZA 4IOJA 4OYHA 3TJZA 4DT1A 5B2ZA 1TEXA 2ZTSA 1DO2A 1TPZA 1IQPA 1ZM4A 3FMOB 1Q1BA 2ODBA 4PC2A 1YZKA 4IHQA 2D3WA 4A82A 2D4HA 4Q1BA 3VR6A 1QHHB 2AXPA 3A36A 5DHAA 4BLPA 2IUSA 2WSMA 4MUAA 4TMZA 3MGCA 3K09A 4NPHA 4GL2A 1UBCA 4B2LA 2FEMA 2CE7A 3GFOA 1KNQA 2GILA 4AD8A 3KQLA 3AQ4A 1GL7A 4XIGS 4CF7A 2QT1A 2VIIA 1NN5A 1NN3A 1SKYB 3EG5A 4DLUA 2RKOA 4Q00A 1P2UA 3FHCB 5DI3B 1EFUA 4UKDA 5DIFA 3OAAA 3MWKA 4JJKA 2I3BA 3T1VA 5JMTA 3WXMA 521PA 4LGMA 1DS6A 1X6VA 2P67A 1L4YA 1IXSB 1ZD1A 3X1WA 2PX0A 4UNNA 1R2QA 1CP2A 1R4AA 1E0JA 2F1HA 3N2EA 1G8PA 1GP2A 1FQJA 4MKHA 4POAA 3HU2A 3SE0A 5FPKA 1XTIA 2BMJA 5IK2A 5EJEA 2GJAA 3TUJC 5ANRB 2NMVA 2QENA 2AHOA 2VHCA 4OHZA 1XEXB 4B2PA 2ZRDA 4XSHA 4LHZA 4IDQA 2UZ3A 5HE8A 5CJ2A 1RZ3A 1QVAA 1YZUA 5FPYA 4ZCMA 2ZI4A 4ON9A 1DBSA 2RCNA 3AUXA 4NCKA 1E2LA 4JLVA 5FFMA 3FFBA 3X1DA 4DT1B 1E2MA 1EFCA 5JEEA 1E0AA 2GF0A 4Q1DA 4TLBA 1TEVA 2OLKA 4M22A 5J5CA 4LJ8A 1IY1A 4LHYA 2FPMA 1NN0A 1DAHA 1Q1EA 3KQKA 421PA 1KO1A 1R0XA 4Q19A 1FQKA 1ZC4A 4BRWA 1BOFA 1PJRA 1W4AA 1YJ5A 2CCGA 1G8YA 3VTKA 3I5YA 3QBTA 2A5DA 2G3YA 4B6EA 3KKQA 3Q8XB 4TT3D 3Q9LA 1UKEA 2R6CA 2ZU0C 1E2HA 3U3MA 1I2DA 1KDTA 1QBKC 2ZRBA 5FBRB 3U60B 3BK7A 2CJWA 1TU3A 2NO7A 5EQTA 5CK5A 5A0FA 1VCNA 2B8TA 3M6AA 4G5RA 1TAGA 3OEEA 1OXXK 4IDNA 5AR1A 3LA6A 2ZANA 1OH5A 2F1IA 3PEYA 2GESA 2QTHA 3RHFA 3L82B 2IK8A 4DLYA 4MYTA 1KSHA 3GJ7A 4C7OA 4XSGA 1KI2A 3R20A 3VR2A 1ZD9A 2RGGA 2QAJA 3UXMA 3KXIA 4JLAA 3GJ6A 4JKIA 2R6FA 3O8BA 1W0JD 4QBGB 1CJUC 1E0SA 1OF1A 4TMWA 5FOTA 1DVRA 2WIAA 2QTVB 2FJUA 2DR3A 2F1JA 4HLQB 1XBTA 1Z2AA 1P73A 4DB4A 4Q1AA 2IL1A 4WAUA 3KKNA 3RAPR 4ESVA 4V0NA 1D2NA 3DMDA 1Z0AA 2WJHA 3X1ZA 1XTJA 1CEEA 2KE5A 2WV9A 3U3OA 2BIFA 3GFPA 4LK2A 4YMSA 5IT5A 5K8TA 4BFSA 4IFBA 3KKOA 2OV2A 1XB2A 2ZITA 3LBIA 3MJRA 3IEUA 4IXMA 2J9RA 1MO4A 3KUCA 4WZ6A 5KU1A 1YZGA 3ICEA 1LFDB 5HKKA 2P5SA 4TN1A 3OEHA 4BLRA 5CDFA 4EPYA 5D3QA 3I5XA 4M1WA 3AV0B 1HQYE 3LO5A 3IBGA 2WJVA 4TYNA 1OKKA 1KZGB 2IEYA 5FBVB 3REFA 1G8HA 2G83A 4DKXA 2PT5A 3K1JA 3ONWA 3U6KA 1OH7A 4LV5B 4CDGA 1IN7A 4NL4H 1J99A 3QY0A 4KXFB 4P31A 4TTPA 3OESA 1XU4A 1KO7A 5E95A 2UVQA 2W0SA 4ERNA 1EK0A 3KUDA 3EZ6A 1HH4A 1MT0A 3L0IB 1WBBA 2CJWB 4LYFA 2IW3A 2GNOA 5FPSA 1NVVR 2EFDB 2RGEA 1XX6A 4B44A 3SJCA 4A0GA 1GOTA 1GAJA 3GEHA 4KFSA 1RW4A 3QKRA 4HYYA 2WPDD 3A1TA 3W5IA 2IF2A 1V43A 4C7OB 4DLVA 4Q7JB 2OAQ1 3RNLA 4RZ2A 3W3ZB 2GZHA 4GI7A 4TLEA 5DH9A 1G16A 3K70B 3KFVA 2D7CA 1OHHD 4Q21A 4PAMA 4B48A 1VHLA 3LVRE 3ZVMA 3QKSA 4HAUA 2MMCA 4DIEA 4EPTA 2ZRNA 2NPIA 3IIKA 4I4LA 3R9XA 3BB4A 3K53A 1NSTA 1WRBA 2IHBA 4XH9B 4F4JA 3UKDA 2ZIAA 2BMEA 1HTWA 1NLZA 2XAUA 3MMPA 2AD5A 1G4UR 2BBSA 2NQ2C 3OZXA 5FOXA 2FGKA 3VHLB 1N2CE 2FFBA 2RB4A 5JI3E 4NDZA 2IUUA 4UQOA 3I8SA 3FE2A 1L4UA 1S2MA 3L0SA 4GP7A 4LHVA 4PSKA 2N46A 4DSOA 2MSCB 5DN6D 5KUTA 4U5XA 1Z2CA 2DYKA 1IONA 5EP1A 4AG5A 1W2HA 4PHGA 1E2JA 5EUMA 4G01B 1XRJA 2J7KA 1W4RA 1RC8A 1ZM2A 4DWJA 2VP2A 3ASYA 4DIDA 1M8PA 3AP2A 1G5TA 4IVQA 4II7A 3G5UA 2G9NA 2J0QA 2YOGA 4PPGA 4DDUA 2JLZA 4FN5A 3F0TA 4H9GA 4O25A 2IYZA 2Z83A 3ECCA 4K8OA 3EA0A 1IXZA 3FKSA 3A4NA 1P9NA 3PITA 1Z63A 5SZIA 3CLVA 5B30A 3A6PC 1T4GA 4CT5A 3E70C 1R0ZA 4BPBA 2R65A 2BC9A 4A92A 5JECA 2W6ID 4Q5IA 5JEDA 4LC0A 5AJZA 3I73A 3U5ZB 1DPFA 1G3UA 3QKRB 1KDRA 4PQFA 4QBIA 1FTNA 3ZDQA 3CX8A 2CNWD 4IEEA 2FGJA 2BBTA 4FMDB 5JS8A 1T3HA 3OF5A 3KQHA 1AGPA 3AGPA 1E2EA 3W6OA 3A1VA 4EAQA 2Q21A 5AUNB 2PZEA 3WRXC 4C30A 2L0XA 3H86A 2ZVPX 3OIYA 4PHFA 4S35A 4X8HA 2F9MA 3TIFA 1A2KC 2DHRA 4HZUA 1I4DD 2FN4A 5HCIA 1GILA 1E2GA 2PCJA 1FNNA 1CTQA 1TQ4A 5FTKA 4CZ2A 4Q1EA 4DRZA 2ZEJA 5FOSA 2R6DA 2BVNA 2JJ1D 2CHQA 4PX9A 1XCPA 3FMFA 4NCHA 4B74A 1IN8A 1W0KD 2GCPA 3IIMA 3IQWA 2FZ4A 4KV9A 1NKTA 4B32A 4EQ6A 5JWOA 2FPKA 4B2IA 3T5GA 4B33A 1GRNA 3SFZA 1XNJA 1HT1E 1BS1A 1ZW6A 4LI0A 3RABA 1T8UA 3T34A 5FH9A 3B1WA 4PO9A 3FHOA 3N2IA 1N6RA 4LPKA 4F4IA 4NONA 5L3SA 3Q3JB 1ZMXA 2PZGA 3LX5A 5F3WB 3SBDA 2NO1A 1XF9A 4JL6A 3CWQA 3S1AA 1G17A 2WTUA 3EASA 3LFUA 3SYKA 4B3GA 4LPSA 1AS2A 2C5LA 4TT3A 1P2SA 4GRAA 2HYDA 1ZNXA 1J7KA 5DE3A 2FZLA 2ZSEA 2JLXA 4GPTA 4IW3B 4JKYA 2XB2A 4ZDWA 1ZU4A 3ZD6A 1PUIA 4LJ5A 2PCLA 3L2OB 2RGDA 4JVSB 4NCJA 1Q1QA 2Z43A 2B7BA 4R71A 3MWJA 1W5SA 3QBVA 4RCZA 1T0JB 1VMAA 2XB4A 3UK6A 4LCBA 1Y3AA 2YWEA 3U2QA 4B75A 2J46A 2V54A 2FX3A 2V1XA 4HZUB 1SQ5A 1ZCBA 4TLCA 1OB2A 2IYWA 4KAXA 3KJGA 4QGGA 3SQWA 2ZSFA 5DISB 4CVNA 1YHNA 2D74A 1W0JA 3L8YA 4AKIA 1XJCA 2QSZA 4LBWA 3DHWC 2ZRKA 1Z6XA 3I1FA 2P5TB 2JJ2D 2QM7A 5J4KA 2QMOA 4Q9JA 2IA5A 1JPNA 1W44A 4EQ6B 3P32A 2A5GA 1XZQA 1UM8A 5JI2E 2KWIA 2C8VA 1XPUA 3QXXA 4IDOA 1G9XA 2PLRA 3DM9B 3LLUA 4PQRA 3SU8A 2QMHA 3BWDD 2WMOB 3BERA 4URWR 1KJYA 2DY1A 1R0WA 2VPPA 5L3SB 3T1QA 1TTTA 4BE7B 3CPEA 4XWOA 3GLGE 4HAVA 2P3SA 3ZQ6A 3S1AB 3KXLA 3A4MA 4BZXA 2ZROA 1AZTA 2OCYC 5BWMA 2ECKA 4A0FA 2DWQA 3CZQA 2I1VB 1QF9A 2WWHA 3DZDA 4AK9A 1XJQA 3SEAA 3GD7A 3GQBA 4AIIA 3GFTA 3N70A 3RS5A 4TMXA 4KSCA 3SZRA 1U9IC 4BLOA 2EQBA 3PVSA 1KO8A 1R7RA 2C03A 5CDFE 2QP3A 5GJBA 2KBFA 2ZPTX 5HZHA 2XITA 5FR1A 1J8YF 1II9A 1RFLA 1KI6A 3K0CC 2W6JA 4NCIA 4JIMA 2FSGA 4G5OA 4RD0A 5H70A 1N6LA 1WF3A 2DWPA 2OFOA 2ZJYA 1O87A 1EGAA 3LBNA 1WP9A 2BKUA 3OAAD 3RS0A 4BFZA 3ADCA 1KY2A 2VSXA 3NBZC 4UXIA 4PZYA 4DLSA 3SJZA 4O2RA 3H84A 2QL6A 5DNYB 2DWOA 2JIZA 1W48A 2ERXA 3C41J 1YQTA 3AGQA 3RDPA 1X8JA 3EC2A 5CB8A 1M7HA 4JBYA 1NVVQ 2HJVA 1G4AE 1RRGA 4TMVA 4O2LA 3SR0A 5F2EA 2C77A 2FPLA 2OCAA 1Q57A 3CZPA 4OBEA 4CEIB 2D7DA 3SFVA 3PUZA 3H2YA 2EYQA 3V4RA 3D8BA 1NIJA 4HB4A 3TR5A 4RZUA 5E3HA 2ZE6A 5DN6A 3C7KA 4UNQA 5CJPA 4N0DA 2O0JA 4QJ3A 2QI9C 3FPAA 3GJ4A 4LX0A 3R8CA 4QFMA 4MA4A 5AUOB 5L3QA 3SBEA 1NG9A 1KGDA 3RANA 4TYWA 4E09A 4EUNA 1AN0A 2CBZA 1IJEA 3TW8B 4WVFA 3IO5A 1D6JA 5ELXA 4MKFA 2NOAA 5C4GB 1UBFA 2WJIA 4QNMA 1CULC 2W2VA 1X86B 2YC2C 4BQSA 1WDTA 2FA9A 4AYWA 5P21A 3ZZ0A 1N6IA 3ZZTA 2QQ0A 2PX3A 3K9LA 4GMXA 2O5VA 4A1FA 1KI6B 4NKRA 2W6IA 1P72A 4Q18A 4D80A 4BEJA 4YMUA 2JLVA 2ZRHA 3KJHA 4ZV4A 1JR6A 3TQFA 2DFNA 4FW9A 2CNWA 3OEED 4GDFA 1FP6A 1QZXA 1KDOA 3M1IA 3P4XA 1NY5A 2OBMA 1KO4A 4Q1FA 4TSFA 1OXSC 4LBZA 1QHSA 1OE0A 2VSFA 2G1KA 1FOEB 2X2FA 1S9HA 3AVYA 1CIPA 1QHYA 3D6TB 2J59A 3A8TA 3CRRA 3IQXA 1DE0A 2ORWA 3WP1B 1RVDA 4Y0AA 5M04A 2YJTD 2FH5B 2OCPA 4XVUA 4ZKDA 3GLHE 1VIAA 3IHLA 2ORIA 4M1SA 2RMKA 4Z8YA 4TYYA 4C9BA 4P3YA 1AM4D 3DZ8A 2GJ9A 1E79D 3H1TA 2QGZA 4MRVA 5KSOA 1M74A 4X8OA 1LV7A 3W5JA 3B85A 2RGCA 3G82C 3H0KA 1W0KA 3LVQE 4FD2A 4A6PA 4A36A 4NP6A 2JLQA 1TNDA 3AVUA 4WA7A 1YRBA 3TH5A 1CXZA 3TK1A 3QQ5A 3QKUA 1ZUHA 4F92B 3E2IA 2VHQA 1N6OA 3CB4A 3GEEA 1OXVA 4BFVA 2JEOA 5HKKD 3A58B 2J45A 3OEHD 1PVOA 2GBLA 2HDNB 5TXGA 3MAAC 1T6NA 1AA9A 1E9CA 2CMKA 2GHIA 4F38A 3RWMB 3V9PA 2CHGA 4M1TA 1Z5ZA 2OT3B 2YOHA 3EIEA 5EE0A 1FMLA 1KI1A 3QJYA 3TW4A 1U9IA 1SXJE 3IEVA 3VNUA 2ZYVX 3WYAA 1GL6A 1QG2A 3I32A 4Q7MB 2BJWA 3T1TA 4JT2A 2RHMA 1DAIA 5CB6A 4DZZA 3K0CA 5GJWC 4NBSA 5J4VA 4MKIA 1TMKA 2VF8A 4QKQA 5GJVC 3GMTA 1MKYA 1GDDA 2CCJA 4CT4B 1FNMA 4A8JC 3AF0A 5FUWA 3KDSE 5EXXA 1JECA 1UKVY 1G7RA 4WOPA 3PEVA 2QP9X 3HU3A 5EXPA 4DSNA 2HLDD 4URZR 3C14C 2AR7A 4ZKEA 2GXAA 1KAOA 1GNRA 4PO1A 2AKYA 1G7CA 4OQNA 1PZNA 2F3TA 2J5XA 4AURA 1C9KA 1DAFA 1NJFA 3QENA 1J90A 2ZM5A 2Q9BA 3FMPB 5HE9A 1NVWQ 2JJ2A 3OFNA 1E32A 1GM5A 1II8A 3WMFA 5G41A 1CR4A 1RIFA 1E9BA 2F6RA 4FMBB 1C1YA 3T12A 5K8LA 2O0KA 2VP0A 4M1YA 5CLQA 5J4YA 3KB1A 3AP1A 3X1XA 3LLMA 3QPVA 4D0LB 5DYIA 1P4SA 2LCFA 5C4MA 2OBLA 3ADKA 1G41A 4JYBA 1VG8A 1XMIA 2X19A 2NGRA 3GLFE 3SN6A 2V3CC 5UKDA 3VR1A 4TLAA 3CRW1 1KI4A 3EC1A 1XZPA 3PUVA 3RSLA 1D2EA 3FKSD 4TMKA 3T1OA 3GLIE 2MMGA 3AKCA 5FUYA 3LH5A 4U00A 1XEWY 2CLCX 1I4TD 4DCUA 3DPUA 2I4IA 2QG6A 2O52A 5DI9A 1N6NA 2F9LA 4E07A 2A3RA 2ZSBA 4LZZA 5FL3A 2XZOA 1NY6A 3C16C 4I81A 4B43A 4KU4A 3LAWA 4M9ZA 3CWZA 3REGA 1U2RA 4DXAA 3B60A 3FVQA 2QAGC 4YLGA 1P3JA 4HAYA 4G1UC 4M1OA 2B92A 4DDTA 2ZS7A 1KKLA 1Z28A 2JAQA 1II0A 2ZVQX 4TWZA 2YVUA 3CRQA 3EZ7A 4I99A 1SGWA 2J0UA 4KO8A 1JALA 4MRNA 4Z51A 2GAAA 2OM2A 1QDEA 4K46A 1II8B 3SYLA 2HT1A 3NTUA 2ZETA 1ZP6A 4TZ6A 1P75A 1TQDA 3NHAA 2HXSA 2LWIA 1UKZA 3CPHA 4E22A 2DPXA 2WKRA 4G5QA 1FX0A 3A4LA 3EZFA 1N0VC 4WXRA 3T61A 3B13B 4U02A 3Q5DA 2HYIC 1VYUA 1Q3HA 1SULA 2GCOA 4XJXA 2KI5A 4R7ZA 4JL5A 1SXJD 1IN4A 1ESMA 1VPLA 4OJKA 3I61A 4GOJA 4C0QC 2A7QA 2EU8A 3I8XA 5DHFA 2B8WA 2MSDB 1EXMA 1S0UA 3HJNA 4YQFA 3EARA 1KI8A 2WAYA 1IY2A 1G21E 2QE7D 4LC1A 3VFDA 4PQYA 1UEIA 4EPXA 4TYPA 2WJJA 1ZUNB 4QGHA 5BQ5A 2HUPA 1N6KA 5KSZA 2QTFA 3CX6A 3PFIA 1EFRD 3AB3A 4M1MA 3EIQA 1ZNYA 2OESA 4L9SA 4QGAA 5LB4A 2H5EA 1ZD8A 1E4VA 1IN5A 2ERYA 4JT4A 3U7HB 1JAIA 4RD1A 2G0TA 1MRSA 5FI0B 5B64A 5FPTA 4CYMA 3CW2A 1G5RA 3CNLA 4BGDA 1RPZA 3ZLJA 3WNBA 5KOYA 4A8JA 3BFVA 1T3SA 2IYRA 3LDAA 4B35A 3PG5A 4M8NE 2BMDA 4IXNA 4JLJA 2ZR7A 3FDIA 3G0HA 3DKPA 1NSFA 1MO3A 3CIOA 1EESA 2OHFA 3BS4A 1TF5A 1CRQA 2Q3FA 4YDSA 1KI9A 2G6BA 1Z83A 3V00A 2J0UB 4HB0A 1P2VA 1CJTC 2DCUA 3UPUA 4MKGA 1VYTA 2JLUA 1YVDA 3PIRA 3A1UA 4BFWA 1Z6TA 3TAHA 3UG6A 1F60A 1ZVQA 3K0AA 1E79A 1E69A 4YONB 5G53C 3ZVRA 3AF4A 1FX0B 4HDQB 3GLGA 4DC9A 2OG2A 4P4UA 3QXHA 3B1YA 2GCOB 3KZ1E 5FL7D 3X2SA 2ZXUA 2J3EA 3UG7A 1RRPA 1R8SA 5GVRA 4DVGA 3C4JA 3BB1A 4Q02A 1SXJC 2HCBA 4LHXA 3LY5A 5JHGB 1TADA 1XTRA 3BJIC 4AWXA 1NG1A 4K81B 2V55B 1P61B 3U6BA 1W36D 2YWHA 1P2TA 3THOA 4QHSA 1Z0JA 1U99A 1G1MA 4Q9HA 4IOLA 1S96A 3QPWA 4V0LA 4C0AC 2GK6A 2AFIE 1UBEA 5L8VA 4JS0A 2VO1A 4JJZA 2V1UA 1Z6GA 4ITRC 3ETLA 2QUZA 3AM1A 1SVKA 3EPKA 3ASZA 4MH0R 4PZLA 1AS3A 4MRPA 4RD6A 3FB4A 4OHYA 1TF2A 2GCNA 1E98A 2OEPA 2W6JD 4A8JB 1KK3A 4ACBA 2HT6A 2XZLA 2F43A 1R5NA 4H1VA 5H1YA 4TL8A 1OIVA 5EE3A 1SZPA 1N3BA 2W58A 4EFLA 3A37A 2ZUBA 5EUQB 1KIMA 2HLDA 2QAGA 2ZRIA 1SVWA 2RGAA 1W2GA 4A0HA 3QF7A 4CEJA 2IS2A 2IYTA 1UF9A 2IWHA 1JJVA 2JIZD 2AK2A 3B9QA 4RY2A 1PUJA 1N0UA 1R10A 2ANBA 2VQSA 5DLQC 2A5YB 2YWFA 1BYUA 3K0AB 1AJEA 1IOZA 1KNXA 3MLEA 2V6IA 4W5HA 8OHMA 4BFXA 1XMSA 4BUJA 3GLGB 4QJ4A 2PT7A 4JLKA 2OSBA 2Q0HA 4IFEA 3AKYA 4UJ5A 4ZPXA 5CM8B 2XJ4A 1W49A 3NBFA 1K5GA 2GDJA 4JBWA 4JSYA 3MWYW 2C95A 3Q5EA 4JLNA 2WKQA 3IIJA 1QG4A 1XTKA 4Q03A 5KSYA 1G5PA 3BB3A 3UMFA 4W9MC 2ANCA 1CJVC 3P27A 1XPOA 3THYA 3HU1A 4XOIA 2ONKA 4HDOB 1KI3A 4RKEA 4NMMA 2C04A 4PC6A 4URXR 2QRNA 1W36C 121PA 1NMXA 1PLKA 3K0EA 3MSXA 3THXA 1K6MA 4P4SA 1W5TA 4US2R 3IHWA 2BKEA 4LJ7A 1RYFA 4B73A 4D6PA 4I1UA 2R62A 2IXFA 2BEKA 5FUVA 1P7CA 2JASA 1US8A 5BN5A 4F93B 3RC3A 3O8DA 4US1R 1JBKA 4IJMA 1KY3A 2F43B 1E1QA 1QHXA 2NO0A 2P6NA 5TVKA 3QXSA 3LBHA 1IAQA 2IXGA 2IYVA 1GKIA 2VP6A 3FWYA 1LS6A 3GLHA 2GVDC 4TZ0A 2FU5C 3EWAA 1QHNA 3CBQA 4D4MA 3T06B 4TSFD 1D8TA 2QAGB 2WOJA 1T91A 5KDLA 4ASUD 5F9HA 3SYNA 1OFHA 2R6GA 4HAXA 4TQAA 4DCVA 4CEJB 1P60A 1XDBA 4PC3A 4ZI2A 2WWGA 4A4DA 3BXZA 4D0NA 4OHWA 2AFHE 1P9WA 4ZDIA 3QKSB 5G3ZA 2KJQA 3ZZUA 3AEZA 3KJEA 2E1RA 4ZI3A 1P5ZB 3C15C 1X8KA 4AKEA 5JCPA 1R5OA 1KAGA 2FFQA 2IEZA 2XEXA 1Z0DA 2ZS8A 3F8TA 1SKQA 4OK3A 3VKWA 1YZTA 1M2OB 4HEJA 2H92A 4NZYA 2Q9AA 1KDPA 3SI7A 4KODA 3TSZA 4ARZA 5JJKA 1X8LA 5IF9A 2QPOA 3HYTA 1GFIA 2CLDX 3THYB 1SXJA 2GK7A 2QORA 4MGZR 2F55A 4Q7LA 2ZYUX 4UNRA 4F91B 4YMWA 2HV8A 4LJYA 1WMSA 1B0UA 4OI2A 3ND9A 4BLTA 1LTQA 4C0JA 2A5FA 5IHPA 4G5SA 1A1VA 2N42A 3THXB 2PEYA 4P4SB 2QE7A 1HY3A 4PPFA 3TKLA 2RGBA 2X1VA 4ESHA 2C9YA 2GXQA 3LW7A 5EP4A 4QG7A 3ADDA 1EFRA 1GG2A 1US8B 3KFXA 1M7BA 4FMCB 4B3DA 3NHBA 2WHXA 4CEHA 4OJQA 4TL7A 1VHTA 5KPJA 1L7VC 2N1BA 3BBPA 4FI3C 4I1VA 3TUIC 2ZJBA 2R44A 2IBMA 3GLHB 2AN9A 2ZRGA 1V5WA 2RAPA 2AKAB 2H16A 1GUAA 3ZJYA 1M7GA 1E9EA 1T5IA 2J7PD 3H4MA 4HB2A 1DO0A 1G291 1N5JA 3U61B 5JCZA 3OIVA 4PPQA 4G3XA 4OK5A 5G40A 1P6XA 3LD9A 4DLZA 2EWVA 2CDNA 2XTNA 1HQCA 2KSQA 2VRWA 1D2MA 1FL9A 1WQ1R 5AUPB 2CK3D 1UDWA 2P2LA 3B5JA 3QUSA 2QP4A 5JZVA 3Q7PA 5JFGA 1Q3TA 2GAOA 4FCTA 2ZAOA 4GZLA 3QF4A 4TL6A 5DSZA 5JS7A 3RLFA 3Q72A 4HI0E 2WJGA 4P4TA 2RH5A 4URUR 3SQXA 4XD7D 1J8MF 1CJKC 1W1WA 3IO3A 3OFND 2J1LA 1N5LA 5C18A 2QBYA 4WZAE 4ARZB 4P32A 3LX8A 3GLFA 4KBFA 5B58C 2YWGA 3BIFA 5FL7A 3EPJA 1SXJB 1BH2A 1AKEA 3GLIA 1ZC3A 1ZNZA 4Z8XA 2GZDA 1GNQA 2WWIA 3CRMA 1SHKA 5FPHA 1DEKA 3NC1C 1NNEA 1X1RA 4TLDA 2GBLC 2NTYC 3QOFA 1S8FA 4M9XA 2NO6A 2OAP1 2V4ZA 2ZRJA 4WBSA 4A15A 1KHTA 1DAKA 3CKLA 5SZJA 1A2BA 1VDZA 5KDDA 2CL6X 2WOOA 2DFLA 3A1SA 2GEVA 4QHYA 4YMTA 1BKDR 3RC8A 4HAZA 2GEDA 1MR3F 4BLQA 4CEHB 1FMJA 1M6NA 5CM9C 3A1WA 3L0OA 4QL3A 2XTZA 1P9RA 5GJCA 1E9DA 4JYCA 2O8EA 2GJKA 2VTKA 4QBHA 1OH6A 4PAQA 3NIBA 4URYR 3DMNA 3K9HA 5EP3A 4LY6A 5FBWB 2FSFA 2GJ8A 1DG3A 1FTSA 4Q4JA 2W2TA 1RYHA 1D9XA 2H7VA 1NVXQ 2ZR9A 4PHTA 1GZSA 2IYQA 2REBA 2J0SA 1Z0IA 3AF2A 4Q9KA 3BAFA 2OXRA 2X8AA 2ZQ5A 3QF4B 4EJSA 2Z5FA 3RS7A 1ZAKA 3Q7QA 3WHLA 1ZCAA 2RGNA 2CLSA 2BM1A 4MYCA 1S3SA 2Z6VA 2EFHB 1NLFA 5FTMA 4B3FX 3NKVA 5C46F 1XWIA 1J2JA 5LPNA 1EX7A 3WHKA 4LV6A 1LW7A 2WM9B 4DHEA 821PA 2QBYB 2YINC 3GJ0A 3WMGA 3W90A 5AJWA 3GLFB 2GETA 1NKSA 2GJSA 1S1MA 2OFWA 1UDXA 4DLWA 3GLIB 1YKSA 4IDHA 2QEQA 3D31A 5KNCA 3IPYA 4I1OA 2RHDA 4PXAA
chains in the Genus database with same CATH superfamily
5LXTA 1U0HC 2HSZA 1GG8A 3KSMA 3RUDA 3C8ZA 3JYOA 3SZLA 4CF4A 1T24A 3HDTA 1SUSA 4N5LA 4LV8B 4KMRA 4PGHA 1DELA 1M8JA 3KJXA 4M38A 4EW3A 3ER9A 4UATA 2X40A 4RW0A 4C0HA 4KUGA 2O8FA 5AM4A 1F1BA 5EWLB 3DL4A 4AXXA 5GADl 4EG8A 2B4TO 1NJ2A 3BWYA 3PCTA 4MUBA 1LBSA 3CTMA 2ADOA 5F9MA 4ZVOA 1MB2A 3B9PA 2Y0DA 4OATA 4E7PA 3QVSA 5F33A 1LI5A 2CL7X 1Z9BA 2FPGA 4TWIA 4LYHA 1FFDA 4MV9A 3ZGXA 4YJKA 4LDAA 4D8UA 1UZMA 1IZYA 4OMDA 1CHDA 3EGWA 5GONB 5I3CA 1A7JA 3WX0A 1VKNA 1INLA 3M5PA 2R1VA 1W87A 1YQQA 3ACBA 3HVHA 5CVTA 4AJEA 2HK8A 3ZLVA 1NNI1 3L7CA 3TX6A 3UTDA 3UTCA 3TMYA 2JGJA 4ZEWA 1LDMA 5JJBA 4AJLA 2Z2IA 4KSBA 4EVRA 4R1LA 3D9QX 3G89A 3Q98A 4MS1A 3OBBA 3OKCA 2FV8A 4RHYA 1X3SA 4UM9B 3AFIA 1PD0A 2NSYA 1NSYA 2HK9A 1C9NA 4HUTA 1MTZA 3GRKA 1TLTA 1KWKA 2C7QA 1XQXA 2BKVA 2LPMA 3NIFB 4HQKA 3V1TC 4GG1A 4GT1A 1AHHA 4L0QA 4R98A 1O94A 1LZKA 4KIUA 4Q01A 1G0OA 3SJ7A 1CZNA 2AD1A 4KBGA 3CM0A 2JPDA 1EBBA 5LZ5A 3R44A 1FRFS 3KVRA 5F7ZA 5L3VA 1RCFA 1MD9A 1JW9B 2PFGA 3DR3A 4S1OA 3HM9A 2YKGA 1WA5A 3Q3CA 4X6LA 5FA5A 4YT4A 3PT5A 2UUPA 3DUWA 4X41A 2R96A 2AN1A 7YASA 2NYAA 2R4QA 1XROA 3R3WA 4F04A 4BFUA 3KR0A 4PAOA 4PR3A 4UU8A 2CLHB 4W1PA 2LKDA 4CIWA 1OFUX 1USIA 2RG1A 4E4RA 4KR2A 1HFEL 4LISA 3OLZA 3MUFA 2B36A 1H2HA 1OYWA 2IOYA 2YDXA 2IHZA 2ZAYA 3CLUC 3JVVA 3RRYA 4TYQA 2CJXA 1VM6A 5I4BA 2HREA 1YDHA 1R37A 2AX4A 4HUQB 1H3FA 3F49S 1P44A 3HXLA 4R1TA 4BVKA 3BBLA 3O4FA 2ZJ8A 4KYIB 1E9VA 1FFYA 4AQ7A 4A3SA 4GNKA 5CT9A 1PZGA 1OU4A 3U37A 1K97A 3ABSB 2VHEA 3T9AA 2J9YB 5LMCA 4LDQA 2Z2YA 1UJMA 3BJZA 4HPWA 2C84A 3WSVA 2E0IA 2G77B 1T26A 3MD9A 5CVUA 1T34A 2P9QA 3S27A 3UMSA 5B36A 2XA2A 5LIRA 3N8IA 3B7PA 2R0QC 3OCJA 4K6MA 5LL6P 2CLIB 4WN3A 5JCOA 4LBVA 2BWJA 1OMOA 3EUEA 3JZFA 4BB5A 5JVDA 4I46A 2V9PA 3AL0C 1P1KA 4BNIA 1I1HA 4UXJA 5L51A 3BGWA 3CG4A 4G0NA 1YVPA 3RU3A 4REOA 1MHPA 4FHFA 1I7DA 2V4UA 3KYCA 3GCDA 1AGRA 3E1KA 3KVNA 2CVFA 4ZQIA 2PM8A 2ZE8A 3BKWA 4HN9A 3R7DA 5IHXA 1XD2A 3R6GA 5F4BA 1P7YA 4HWRA 4C2AA 1NUPA 2I76A 1NDHA 2W8ZA 2AKEA 4DCSA 4HDSA 4LRTB 2FPPB 4I08A 4AJOA 4G4JA 3C7DB 5KCZA 3QM1A 1EWTA 2ZT6A 3KDPA 3MWEB 1TUEA 2J3DA 2TECE 1XCMA 2WMYA 3W0LB 1EE1A 1XXHE 2M2IA 2DPYA 3Q3EA 1KYIA 4U7PB 4PYJA 3LQRA 3ZLTA 3IR7A 4OGFA 4HDNB 2GRJA 5AMXA 2VJOA 2PV7A 4W5WA 2O14A 5AIAA 2BI7A 1QO0A 2OOKA 1TF7A 5AK0A 3SS9X 5ILOA 2VTBA 1IEWA 1R1DA 1MV8A 1YRAA 3BXHA 4F6LA 3MMZA 5D7BA 1MH1A 2PWZA 2IS6A 3ZCQA 3SKXA 3OM9A 3PWZA 3QA3E 2D5LA 4Z4HA 3K9GA 1PEKE 1ULBA 3RJTA 1CUUA 1ZM7A 1RJ9B 2NU7A 1Y7PA 1IWPB 2VNIA 3SGLA 4OYLA 4OQFA 1PKXA 1V8FA 2ZJAA 2VTDA 2YY5A 2JRLA 2PDAA 2P6MA 3AEQB 1QR6A 1VBNA 5BN3A 1CLEA 1WSWA 4R2HA 3T35A 4DLBA 3TPFA 3R09A 2VDRB 3FM9A 4Z0HO 3ZDZB 1W5EA 1N92A 1QPGA 4J7XA 2A92A 3D5EA 3HO8A 3LQ2A 1W85B 4BEVA 2Q4BA 5TDHA 4KC0A 2Y8EA 2FDXA 3N2ZB 2G9ZA 2IV3A 4DUGA 5B1EA 2CMFA 3FYHA 4YXWA 3T9BA 4N48A 3OTOB 1VL6A 2FRVA 2IUFA 2YNMA 3CISA 1NR1A 5EHGA 2FZ5A 4CKBB 4JQSA 1XAIA 2GFIA 3O7MA 3GA7A 3KR1A 2G88A 2GA8A 1R88A 4ONEA 5A9TA 3JQ7B 4QRIA 3LWBA 1EAMA 2X77A 4FGSA 1OI4A 4IV0A 3WLNA 2YCBA 4Z3KA 3PHIA 5IUNC 4CUJA 4PTLA 4BRUA 1HFJA 2GI4A 4E1BA 4A6EA 1SKMA 5TX7A 1N2ZA 3D6NB 3GRYA 1I2BA 4MJ7A 2CT8A 4K6KA 4X63A 2WJYA 4BV2A 2AOWA 4H3SA 3DDCA 4LRWA 2AC4A 4LF9B 2ZR0A 4UXHA 2PRSA 3QSYA 1TEHA 3CR8A 3KR9A 4TM8A 5LWHA 3HLTA 3AR8A 4ROTA 4Y2JA 4YDHB 2NUAB 1RAAA 4V0ME 4KITB 1E8MA 4AY2A 2YHIA 1J49A 4E15A 2VYQA 1VLQA 2GPNA 3GAAA 1OH8A 3ITDA 4C5CA 1OLUB 4L6CA 4MRSA 4R6WA 2KQUA 3IL2A 1GQOA 4K8RB 3LW8A 2A0KA 1LH0A 4EG3A 5IAGA 4R68A 4YYZA 1XJ0A 2HGSA 1RJFA 1M0SA 2PSSA 3M9WA 4H1HA 2QGFA 3G0DA 2FG6C 3JAKB 4X7PA 1TK9A 1B7GO 2Q27A 1G98A 1CJSA 2QRUA 2XDQA 2LD4A 2PBLA 2BF4A 4PO8A 4RQBA 2Y6VA 5T6BA 5AKZA 4QO7A 3KL2A 3QMPA 4XWGA 1YONA 3UNXA 2YV2A 1YBVA 2HX1A 1FFCA 4FOLA 4L5BA 1IH8A 1A50B 4J0QA 5CT4A 1KMMA 4CQMA 3JQFC 2GYWA 2H9AA 5BWCA 1HG1A 4KXVA 5HOQA 5FP0A 1CUZA 4P7FA 5AKEA 3MJCA 2PBFA 2VCYA 5FKJA 5SZKB 2PSJA 4JCCA 3PEUA 4X3PA 3S2EA 4IQGA 4YLYA 1M2EA 3AX6A 3WB0A 1RJEA 1PQ4A 4TRMA 1E96A 2O3UA 2HA3A 5FWAA 4AI6A 2NIPA 3H87A 4P38A 1F5NA 2G8NA 3ENQA 3BVPA 4YCAA 3NHPA 4G97A 2EZTA 1KQPA 1SCQA 4LWOA 4Y2PA 4F8EA 4CIXA 2Q3HA 1TA4A 4FCVA 2GZRA 3VH4A 1J70A 5LB2A 5NULA 4M2LA 1QIMA 1PLJA 1SWWA 2AFHB 2NXWA 5CP8A 4KOAA 3A7EA 1UUFA 1ZUIA 2J9FA 2ZCVA 4YT5A 2AJLI 5ALNA 5K0ZA 2RGXA 3RUAA 2VDJA 2A8YA 1W581 3BJRA 1DRUA 4LCEA 3EPHA 5EMLA 2F4NA 4Q12A 4B8ZA 2XY4A 3MUNA 1ZJJA 2VT2A 3C3CA 3LRTA 5EJ6A 2IPNA 4KQ1A 5JJIA 4C0XA 1XDWA 3K0HA 3VJKA 2E5WA 4JJIA 4RULA 1NBHA 2ZE5A 4KH1A 5F78A 4UTPA 1AKWA 2H07A 2J6BA 1Q0RA 3MCAA 5HGXA 3F4LA 4ZOAA 3MINB 3NXSA 1OBFO 1PFUA 1JQ3A 1I10A 1YMUA 3W5AA 4WZAA 3CEJA 4XB1A 3SBXA 2DLCX 3SZOA 5K45A 4QNRA 3SP1A 2NUPA 2QRQA 1SVIA 3MTJA 1BQEA 3BTOA 3DYVA 1YZHA 3WRYA 4KPEC 3DKVA 4RIFA 4HATA 4MR9A 1G8AA 2QE6A 1M0TA 3CNNA 4RY9A 3K1TA 2WYVA 3WGLA 2B5VA 1Q15A 1U8TA 2PO7A 2WTMA 3PRJA 4D98A 3T3HA 4OLFA 4JP3A 1M1YE 1AKUA 1KE2A 3EGEA 1KK0A 1AOXA 1YE8A 2VVTA 4GXQA 5EKUA 4NFYA 3HBMA 5LP6A 2ZSDA 4Q6WA 3H3XA 1ESZA 1OFUA 4DMGA 5F7XA 1PHRA 4HFMA 4FFBA 1Z0KA 1Z2EA 3ZZ1A 2ZDHA 3B1JA 3EVAA 5CCXA 1NQAO 3WHIA 2X3FA 3KWFA 1XZMA 3ORYA 3LKZA 5BYKA 3I92A 4JWKA 4RSGA 2I67A 4DREA 5DEIA 4C0SA 3QWBA 1GR0A 1RTTA 3K5IA 2RHJA 3E5RA 2JVJA 3Q12A 4GF5A 4WT7A 5HFAA 3E22A 4EB3A 3KWJA 4RD4A 4EYOA 4M0LA 2ECPA 2HPVA 2IY9A 3U9TA 2QZPA 1S9DA 1GT6A 4OJNA 5K8IA 4HLUA 3TLZA 1J00A 2WICA 3LWNA 3E9NA 4C0LA 5I7OA 2EFCB 2FWIA 2QJWA 1I7PA 2HCJB 4NYMR 4Q4AA 4ZCLA 1H2WA 4EMUA 5HRCA 3VA7A 2PXAA 3JQDA 3RF6A 2FYTA 4ZT3A 1KI7A 5COAA 3WYDA 5CFMA 2RI6A 2G1JA 2I29A 5EIAA 4IIVA 1CSEE 3ZI7A 1E1CB 2OM6A 2IEAA 2FSHA 2QPTA 4HDRB 4E2FA 2LNDA 3IKJA 4GBGA 4O33A 4IIJF 5HIAA 3KQNA 2AJBA 2H57A 2W37A 2XUAA 2YBEA 3PUWA 2QLTA 4Z3DA 3O26A 5J4LA 3D8NA 2HLNA 4DLTA 1EUDB 3EXEA 5FI5A 3MFYA 5L3ZA 4MZXA 3O74A 1RRFA 4JP8A 2IPMA 1D4ZA 2Z3ZA 4OLHA 4KIWA 1CR1A 4QM6A 2QLLA 1CFJA 5EWJA 1MJ5A 2VHUA 4I55A 5BRNA 2OTCA 4AP5A 5KTNA 1SVLA 1QQ6A 2HA6A 3TSCA 1N9GA 3FZEA 1N8KA 4RZXA 4DBLC 4QRHA 2WU8A 5AI9A 1L5QA 2EKPA 3A04A 1DC8A 2ZUVA 3Q3VA 4MW5A 3L4BA 5BOVA 5TVGA 5KQMA 1U2DC 1A9SA 1G1AA 4K6GA 4M89A 4NBWA 2J3JA 5AUQA 1PFKA 2WWWA 3G02A 1XZGA 4UUQA 5D3MA 1RYZA 1LK7A 2GK3A 1F9EA 4LNUA 2YV5A 1HA3A 4ZYVA 2GPTA 6YASA 2FCRA 1FX1A 2NXNA 1HI9A 1SO8A 3VISA 2VYVA 3ZWPA 4LYJA 3LL7A 3M6XA 3KLPX 1RXUA 2EHDA 5FA8A 2PQ0A 2MU1A 1PT8A 5G02A 2XQGA 2RH4A 3NNDA 3OX3A 3PD1A 3N2YA 1C14A 1BMFA 3I0ZA 5K2MA 3V2IA 2XNHA 5F98A 4G1FA 1H2ZA 7ABPA 1WWKA 2HM7A 3O8OA 5HF6A 4MQ5A 6LDHA 4LG1A 3T8YA 2BJVA 2J3MA 5IMBA 3UCFA 1DAMA 1P0IA 3UB2A 5AIBA 5C1BA 3TQSA 3TMKA 2YRWA 3FFAA 2B7CA 3C1TA 4JT9A 3ELUA 3LVFO 4M53A 3HJGA 4MKRA 4WK6A 5DO9A 3ADBA 3DJYA 2ZS9A 3WQQA 4IVRA 4Y98A 1J0EA 1GTZA 1LPOA 3OJFA 4BQIA 1PE0A 3KTAA 1J20A 1GUYA 4HB3A 3P9SA 5HTKA 1XJWA 2HU8A 2O3RA 3UFXB 1BRMA 1VKJA 2IZOA 2OPBA 3JWGA 3WGYA 4KR7A 1LSJA 4BASA 5IBPA 2C2MA 4EHNA 2H29A 2CVHA 1EXVA 3H2ZA 3PP8A 1F2TB 1TAUA 4P36A 2BR5A 1UMBB 1AK2A 4ZARA 3W6ZA 2PR2A 1RZUA 5DM60 1SD5A 2QNRA 4H3KB 3LT4A 2V7WA 5SZHB 3OZGA 1IULA 1KKMA 1Q0UA 1V3QE 2XMRA 3EEIA 1I3MA 4I19A 2W6ZA 4IF4A 4LAFA 5DWDA 1PGNA 2NV0A 3ADPA 3RYTC 621PA 5FR2A 1D8AA 4KDFA 3RJZA 3CRVA 3Q88A 1QG6A 2GN9A 1HNXB 1Q95A 4F4UA 3TVYA 1Y1RA 1DC3A 2E4ZA 3K32A 5DTQA 1I4LD 1F7UA 1BG6A 3BMQA 4N9WA 4QUHA 4LEIA 1C2TA 5EXSA 3RYCA 3AVOA 5IAJA 4EJSC 5FA6A 4ARUA 1MF7A 3DUFA 3GVIA 3E0QA 3K9WA 4QKQA 4FWTA 5K8UA 1GZ6A 4PLYA 4FM9A 4FJ0A 1A8SA 2ILVA 2ZYTX 2HU5A 1N6HA 3I5AA 1WSAA 3KAKA 4WCFC 4O2AB 3KB2A 4CR6A 1SUIA 1O89A 2GYUA 3HA7A 3PA8A 3MS4A 4JBLA 4BBPA 2NW6A 4TV9F 1UPFA 4B79A 4P93A 4AZ0B 1DAGA 4LRYA 1YFLA 4AG6A 2FMTA 2E48A 4CNBA 2GAIA 2G9VA 3NGMA 3EMDA 1MABA 4S0ZA 3WGIA 3ZJTA 3ZBTA 3VZSA 4JGIA 1T3TA 3Q3HA 3LVBA 4Q9AA 2GQ0A 2VOEA 1J9EA 4QOSA 1WSDA 3GXBA 5BY2A 5BUZA 4QU9A 1DP4A 2P9CA 1C3LA 3FDFA 3LF1A 3RSFA 4GMDA 2JLWA 5I7UA 1YH3A 4YI3A 5J47A 2AMJA 2XTMA 2XSZD 4MWZA 2QT0A 3E8XA 3NFRA 2ACWA 1EDEA 2YRFA 3N86A 3QUQA 5AH0A 4EG7A 3W3AA 4JB8A 2HF9A 2BMWA 2HLHA 1XNHA 4OA5A 5DDIP 4ZVMA 1C80A 2I0FA 2GK4A 3EIWA 1TCVA 2QL7A 3ZX4A 4V2IA 5T6MA 2JCSA 2GSWA 5FOWA 1XD9A 1XG5A 3F5FA 4OUKX 3ZD7A 3BGIA 3OQ1A 1E99A 3M3DA 4I8XA 2FRDC 4L8WB 1K7SN 1UDAA 3JWIA 2GN2A 4G84A 3K0FA 3GB9A 2FFAA 4KWIA 3VX3A 4GU5A 1W9MA 1SB9A 1SAYA 1RU3A 4X1IA 2C98A 3DDNA 2R8RA 3TTWA 4U7DA 3IVMA 1RD4A 3WYGA 3KJIA 4JI6B 4C7VA 1B15A 5BVHA 1OWNA 4KJZA 3FJYA 2PN1A 4WESB 3NTXA 3GPLA 2R7MA 5HGJA 2XNSA 5LC1A 3UW3A 3FLAA 3QG1A 3WB9A 2FSIA 5JFTA 2B4QA 2HIAA 4DLAA 2O5CA 1WZ2A 5E7MA 1RM5A 3BMNA 3IBYA 4AMBA 5KX5F 3LXRA 1KYZA 3B8HA 3R3VA 1J1ZA 4WLFA 1N2EA 3AHJA 1MH9A 4WKGA 1U1FA 4JNCA 3L49A 1C3JA 1KAEA 1QFZA 2QUBA 5SY9A 3LG2A 5DIZA 1VBFA 1JAHA 1MENA 2R6R1 3M49A 2OHJA 1Q1ZA 4YJHA 1N4AA 3GAFA 1Z3CA 3E1SA 1K6XA 1SK8A 3GMIA 1JLSA 3H2BA 3IV7A 3L0ZA 3TE6A 1Z26A 1AZSC 1D7OA 2F3SA 4WIAA 5ISMA 2HNKA 5E3IA 1S3GA 3TRKA 1BCRB 4NYIR 5A71A 7REQB 1DUSA 1WXWA 1GG5A 4Q6BA 1KJZA 2XGJA 3U7GA 3HR4A 1DIHA 2QVBA 4XGQA 1ZGCA 1WXEA 1W7AA 2Q8QA 4IICA 3AKEA 3LYLA 1EG7A 3SLRA 1DIOB 3C6KA 1G3RA 4IJ5A 1Z22A 1GHTA 1OZAA 2B37A 4IWXA 4EFNA 3FMIA 1D03A 3NYRA 3C6ZA 1RHMA 1T43A 5BOSB 4LNAA 2YRXA 5JBNA 3IMFA 4RJTA 5D00A 1VB5A 1JR3D 4DRXB 2WKWA 4RVHA 1PN3A 4OCZA 1OZGA 2GTPA 2IZ5A 5J40A 3P9NA 3W5VA 4V1CA 2JIDA 2VTEA 1JIIA 3LC2O 4O4HA 3VU9A 2QNIA 4H6WA 3ZEIA 5KNDA 5KWSA 1VJGA 4Y67A 3CVOA 2J8ZA 2WJ6A 3ULKA 4DR5B 1GPDG 1OIWA 3FTCA 2OHGA 1N57A 2P2DA 4GYWA 5BSGA 5KPDA 1Y6GA 2QQEA 1E5TA 4R7GA 2GKGA 1LF5A 2LUOA 3BJEA 3DL7A 4CQNA 4MI9A 5K8JB 4CLXA 1NC3A 4QC2A 3G9UA 1H65A 1XK6A 4L6IA 3U13A 4BO1A 1IY8A 4JLMA 3G5AA 1T8SA 5AKLA 1EVLA 4FXOA 3PV0A 3BG5A 4DAOA 1ZHFA 1E1LA 5GWXA 4NYMQ 3SHWA 1KMHA 1Y6ZA 3VJMA 4B81A 4C7XA 3JQGA 2GPJA 1BH6A 1WULS 1ZESA 4MQFA 3EMKA 5FBLB 3K9NA 1KFCB 3CS3A 3RYIB 3C48A 4C3UA 4ZHSA 3FZQA 3ABIA 5EZSA 2NVBA 4ZZ0A 5AQEA 3ZK9A 3BGOS 4O59O 3A1EA 3F71A 1NUSA 3TQOA 2VDQB 4KXYA 5DCLA 3WGZA 5BUSA 2OWDA 4ND8A 1JNXX 3LPCA 4EDHA 2WPDA 4PO3X 4EA8A 1XGKA 4QDKA 2ZUCA 4PHHA 5LQNA 3K9FC 2O4CA 2ZTLA 3AONB 3L9WA 3MB5A 1W52X 3OMXA 3U81A 1OFVA 4ITUA 4RF2A 3WRXA 4CLRB 1QJ4A 1X7WA 1V47A 2ZE7A 3AR7A 4JASB 5ALRA 5LQAA 1XKLA 2H1VA 1V41E 3FOFC 3FUXA 1IHUA 2JFYA 1SUCA 4US0R 1TK3A 3X43A 5AKHA 2VG8A 4D97A 1UK6A 1VLLA 1B23P 1DXQA 2O2GA 5A5VA 4PGMA 3DPIA 4KBYA 4KMOA 4GSYA 5JHHB 2IU4A 5DGHA 3IAEA 3TM4A 3VBCA 2A67A 4NPAA 1C7RA 4HMOA 3VI4B 3ZWQA 4CR8A 2RKBA 4G2TA 4C89A 3R4VA 4F56A 3K1AA 3B70A 4JHXA 2F1RA 1S7GA 1FDUA 1WO8A 4G07A 1SOWA 3DL0A 3I53A 2HD4A 3UWMA 3VO2A 2QX9A 4C6HA 1Y8RB 4WDQA 1DO8A 3DCJA 3I76A 4DE5A 5AK5A 1NN1A 4W1RA 4IY1A 3OQMA 1N5KA 3EDRA 1ZN9A 3GLTA 1FP7A 1YR6A 5HRUA 3TVDA 3JSAA 3GJXC 4DHWA 2AUNA 4D9JA 5BSUA 5H81A 5IP5A 4M7OA 3V5NA 4DIBA 1NI3A 4QVKA 1JQEA 5AHXA 1KZHA 3UXYA 3X2FA 1CEYA 1V1RA 4XASA 1Z0FA 2Z09A 4M46A 4DYHA 1OB5A 3I9JA 1UK9A 3TNFA 1YTUA 3OD1A 4DRYA 3T15A 2D1SA 3JWHA 16PKA 2FPRA 2Q5EA 2VL7A 5CK4A 4BATA 2Y3IA 1PKEA 2OB1A 2FFRA 1KO5A 2B69A 4F5WA 3OE7D 2HF7A 2QVGA 3RVJA 4RFSA 1FP2A 2HFJA 3G2MA 3BL8A 2HSWA 1OYVA 2XVYA 3OA2A 4NQZA 1J8VA 3KS9A 1ETUA 4RNDB 4EP1A 4HLDA 4H4CA 4PYNA 1BSVA 2WZDA 4XTCS 1Y3DE 3I6QA 2I4RA 4LE1A 4F2GA 2B9VA 3AVWA 1O2DA 2BGUA 3SC4A 1NQTA 1QVVA 4A73A 1T1IA 1N3YA 2IDKA 4MYRA 1LV8A 5A7HA 1AD2A 3U44B 4RZIA 3IUSA 3PGA1 4JVMA 1XLWA 2QDKA 1UT5A 3RBAA 4D1YA 5K9ZA 4LC9A 2K2QB 1QYRA 1XEFA 3PXBA 2Z0MA 3RFFA 1U7UA 1EU1A 3DFKA 4OKNA 3NGLA 4L07A 4H1WA 4KE9A 4ZMRA 4JVOA 3S5JA 2V96A 4YROA 5T67A 3DO6A 5CYPA 1VLMA 1VKOA 2CNDA 2Q07A 2JCYA 1V16B 3FNRA 2AIRA 5H9VA 1H8HA 5KQSA 4CGZA 1NBMA 2D2FA 1NYLA 2CYBA 3GUHA 4RE6A 3DNMA 5ICFA 4NXNB 3AUUA 3OURA 2JJ1A 3GJ3A 1Q17A 3TIGA 5KYWB 4M0UA 2MHCA 5IT0A 3D59A 3C3YA 4AYXA 4DMRA 5JYDA 1T6XA 4GKBA 4CIDA 1YL5A 1MV5A 2Q3CA 3AESA 3MJ4A 4WW0A 1U7DA 4RSMA 1E4EA 5K0JA 1J33A 4ZXPA 1MB4A 3HR7A 2VLIA 4IIJA 3QVXA 2PMCA 1B41A 4K26A 4ZREA 5CXSA 4IF6A 1C4OA 4K7JA 4AU1A 4BX0A 4I3HA 1ZSYA 4R2WA 4YJGB 1WXFA 2WU1A 2WWYA 5G1NA 3A28A 4LFBB 1JA1A 2WV7A 2QM3A 3U4QB 3LSTA 3LKVA 3RU2A 1CY7A 1IBMB 1B8NA 3I62A 2YWDA 1G6HA 4GFDA 3GUCA 1E3LA 5G0WA 4DMHA 2ZBRA 4KTTE 2B7LA 3EJWA 2PJRA 2L69A 4EPRA 1VCOA 1H4QA 2CB9A 5B53A 2R1TA 4QFCA 2D06A 1BXKA 1NVKA 1FSSA 2JDIA 3GJ8A 3MWDA 4NC9A 4X8MA 2M6KA 4MCIA 3HA2A 5LFAA 4LVUA 1YZQA 2I03A 4TTRA 3P97A 1XMOB 2JFFA 1O3YA 3ZI4A 1QYVA 5J2TA 3AFOA 2FEOA 4C05A 1E5QA 1OGYA 3DLTA 1XHLA 5J1SB 1J2UA 1ETHA 3D1VA 1E0KA 1K5DA 4JJEA 4LWQA 2WWXA 1IBKB 2WWFA 4UPEA 2Y0CA 5G1OA 3E5MA 3HJCA 4GR5A 2C9CA 2B5WA 4Z9XA 5GVSA 3F46A 4RJLA 2VJNA 1YFKA 3G7NA 1LKZA 4YBRA 3P20A 4N7BA 1JDBC 1L5VA 1Z3IX 1GNPA 3BH6A 3KXKA 3MWGA 1F06A 4KXNA 1XYGA 3VC2A 3K8YA 4KEAA 5CTJA 4D3SA 5L3RA 2WUGA 2JHGA 1RNLA 1KJJA 1TIKA 4GZMA 3FA2A 5I8PA 5EMHA 2EP7A 5D8DA 3R6LA 5DMHA 5J2UA 2IEBA 4JMPA 2BJHA 2R79A 1YDFA 4WZBA 2A9FA 4FNGA 1LF0A 2EYUA 4HT3B 2DBZA 1HZJA 4YRAA 2RK3A 2I66A 3AL3A 4R9RA 2F8SA 2Y0EA 4NFLA 3F4BA 4O8ZA 2YYZA 4EKNB 1R4MB 3FRHA 1YIAA 1FBTA 4ZV7A 3PNOA 1QV6A 2UYGA 1QGDA 2B2CA 1SC9A 1RHKA 4TWRA 2NSJA 3JQEA 1TB4A 2PV0A 1HURA 1RI2A 1HPLA 4EKEA 4NYIQ 3IMGA 5CMLA 2UZ1A 2IXEA 3V34A 4MS4B 4WINA 3E9ZA 5LMZA 3AIIA 4L4SA 1PSDA 2XIQA 4OYHA 3VMMA 3ROQA 1SXGA 3THSA 1T2NA 5K3FB 1JFLA 2DUWA 2ZTSA 2VAVA 3NIDB 4H6PA 3V55A 3UPTA 4DV1B 2DGDA 1HK7A 3AK4A 5A1TA 1Q1BA 3MPOA 3ZWDA 1YZKA 4HCJA 2FZGA 1X7DA 2GX6A 1QR2A 1D7AA 4Q1BA 2DM6A 3EQ6A 1QHHB 2Q5CA 3A36A 4H7KA 5DHAA 4A6DA 1BFUA 1QAQA 3UWSA 3L0BA 4YRJA 4E94A 4BCCA 2WSMA 1JSCA 4MUAA 4TMZA 3MGCA 3RYFA 5LR6A 1E18A 3K09A 4L73A 4NPHA 4F6CA 3VPDA 1A7AA 2SCUB 2FEMA 1ECLA 1THMA 3MXOA 3OT5A 1C7FA 2A1UA 3UV6A 2X41A 3AUJB 1SNYA 4G4SP 1R5JA 2XKAA 3PI6A 3KLNA 4PYQA 5CCBA 5CGZA 1RDFA 1ADYA 2CNLA 1GCUA 2FK8A 5D5HA 4UVEA 1PYGA 4DIFA 5KNCH 3F98A 1Z39A 3E9YA 3Q15C 1NN5A 2Q2WA 3BRQA 4BX2A 2DFPA 1ODIA 2C8KA 3EG5A 4MXDA 4DLUA 1ODLA 4NX2A 1P2UA 1GPNA 4EO7A 1KH3A 3SZUA 1NBOA 2NVWA 1JLHA 2ZSJA 1SA0B 3PHGA 3T1VA 1AUOA 1QGZA 3ANSA 1M2VA 2QXYA 5AVVA 1XVTA 2EDAA 5T4HA 1VMIA 3LA8A 5FNVB 1QRUA 2GKOA 2KLHA 2P67A 2DKFA 3V1KA 5JDIC 3X1WA 5JC1A 3UH0A 1ZWLA 3OEWA 1CP2A 1QANA 1E0JA 5LZ9A 1XVVA 1WCIA 3GGSA 3ZY2A 1QGED 3A6ZA 4S24A 4AO8A 1P1CA 1DL5A 1E66A 1PYDA 3KUKA 3N2NA 4IIUA 4POAA 4TZTA 4WE3A 3TLBA 1Y34E 2V0CA 4BNMA 5BN1A 2Y93A 1PJBA 1L5RA 3WADA 4HH1A 5ANRB 3TUJC 4HQLA 3MOGA 4F2WA 2QENA 2I6QA 1X1AA 1I7SB 1SUBA 2KS6A 2ZRDA 3D6VA 1G20A 4H16A 1DGQA 3PC8C 4IDQA 2QD5A 5DTIA 5CJ2A 5HE8A 2WM3A 4OYYA 4B0PA 5EC8A 4BGIA 1HE4A 4HWGA 1YA8A 3Q7EA 3IVXA 4POOA 4EG0A 2GB4A 4NCKA 5MN5A 1DB3A 2AI1A 5FFMA 3U48A 4ALJA 3SHVA 3ZHXA 1E0AA 2UVPA 3S2IA 2GF0A 4Q1DA 1X2BA 1TEVA 3LYUA 2A0WA 2IVZA 1H5NA 4DUPA 2HK7A 2PVPA 5CVDA 4YUWA 3IQZA 4LJ8A 1IY1A 2NTJA 4ZCSA 4LHYA 3RW9A 2FPMA 1LBIA 1NN0A 2PXXA 1U7XA 5C1IA 4ZVKA 1Q1EA 3O4HA 3L1IA 1KO1A 3PD0A 3Q11A 4NU6A 1W4AA 1IYZA 2CCGA 1G8YA 3O8QA 3T41A 3I5YA 1C8BA 4V38A 2A5DA 1U0GA 2JKZA 3CEAA 3ETEA 1DKQA 3KKQA 3Q8XB 4CFSA 1VE5A 2QB5A 3UPDA 1ZFNA 5EKDA 3HO1A 5KX5A 1K9SA 3AYZB 2QM0A 3BJMA 2R6CA 3OQPA 1E2HA 3RSQA 3U3MA 4EABA 1AQNA 1RYYA 4WOCA 5KEIA 1RXVA 2ZRBA 3G8DA 5FBRB 3AKZA 2ES4A 3BK7A 3I52A 3CCBA 4UHHA 1VCNA 2B8TA 3M6AA 1JWBB 2W2PA 3VPAA 4NJMB 3OEEA 3LFHA 3HXQA 3LA6A 1MW8X 5KVSA 5L4SA 3BIOA 2X9QA 1FVXA 4QQFA 4ZOLB 3ER6A 3RHFA 3WOHA 2FR0A 3CO0S 4MYTA 4DLYA 2QVLA 4FSDA 4OA8A 4G1EB 2H2HA 4Y9SA 3IX7A 4XSGA 3BHIA 3VR2A 4PZCA 3UJ7A 4BDTA 2PX5A 3I42A 3KDAA 5IDXA 1CHNA 2EEZA 3GJ6A 3RIYA 4AZVA 5AVZA 2FDRA 4PTYA 5DTMA 2R6FA 5E6RA 3MGKA 2H54A 4RA6A 1JF8A 1OF1A 4F45A 1DVRA 2QRVB 2QTVB 5EIEA 2DR3A 4O4JB 2OWEA 4UMFA 1MAWA 1IM8A 1O8CA 3MW8A 1Z2AA 3G9QA 1B43A 1T25A 4Q1AA 3RS9A 3KKNA 5CB4F 4ESVA 4PE5B 3E48A 4V0NA 2Q7XA 4QASA 3LHSA 4YMLA 3I1JA 1CEEA 2KE5A 3QU4A 4QGBA 1UC4B 4LK2A 3A1CA 5CW2A 2IW1A 1A2QA 3KKOA 1G2OA 4HK4A 1MOQA 3MJRA 3RU9A 5A9SB 3LUKA 3LX6A 3EG9B 5LA6F 2IH2A 3PJFA 4IXMA 3KUCA 3ENKA 3AZQA 4WZ6A 3T1YB 2R7LA 1YZGA 3ICEA 5HKKA 4PYOA 3WA6A 4BLRA 4OKIA 3I5XA 3VTFA 3HXKA 1HQYE 3IBGA 3FDXA 5HQ3A 1V7PC 2WJVA 1HM5A 1Z4MA 4M9UA 2IEYA 3REFA 1KVQA 3RHTA 3ONWA 3LF2A 3D7LA 2FP4A 2VQ3A 3PNKA 4CDGA 3PXAA 4XYLA 2QPLA 5TQ2A 1BN7A 1T8RA 3CZ9A 4YRBA 1NQXA 3AETA 3CF4G 4QTTB 3IDOA 3DVAA 2PUHA 2WWTA 3PPXA 5A4MS 1MEEA 1N1MA 2H3HA 1WBBA 4AJPA 1Y37A 3A2MA 3DO8A 3EGXA 5CPFA 4OH7A 2G9UA 3GCXA 1IWBB 1NVVR 3VYWA 2X9NA 2ATCA 3RK1A 1MG5A 3F7TA 3ML1A 1E6EA 1GOTA 2X9GA 1L1RA 4KFSA 1DWPA 3ZWCA 3B7WA 4EGSA 1Z5OA 1V43A 1Y89A 1FSZA 4DLVA 3DC7A 3AI2A 2OAQ1 3G5TA 3GUYA 2AUTA 5THKA 3BPSA 3RNLA 3USCS 3W3ZB 1Y7IA 4OB6A 1GA1A 1JDBB 3KFVA 2B8JA 3KC2A 2PVSA 1WXGA 1W59A 3A4YA 3ECSA 1WM1A 4MIOA 3LVRE 1FK8A 3VZCA 1AK1A 2HA0A 1NVDA 2MMCA 3GA0A 3G9TA 3AW8A 3UJCA 2W7TA 4I4LA 3K53A 4NMLA 4CMCA 4E7OA 2IHBA 2WYHA 4GLOA 2BMEA 4H77A 2XAUA 5E9QA 5A0VA 3MMPA 3HVUA 2AD5A 1JILA 2DF8A 1CG6A 1R74A 2R3SA 2W6OA 4EY3A 4D8TA 1N2CE 2OD7A 5A2GA 1UJNA 4YNBA 2A1TR 4LYDA 2Q49A 4GP7A 4UHJA 1L4UA 1EK2A 1YCHA 1X42A 3Q7SA 4LHVA 1C9DB 5AHRA 2YJNA 5FO1A 3CLKA 1DRKA 4D3DA 4AG5A 3TCKA 3V8QA 1W2HA 4PHGA 4XJSA 2R8YA 5I9SA 3TDKA 3BGSA 2Y2VA 3GDOA 3ADDA 1W4RA 1ZM2A 3M6FA 4DWJA 5A3SA 5JSQA 1V71A 3ASYA 2DR0A 2B4KA 1M8PA 3OTHA 1G5TA 1D2HA 2R87A 4FYIA 3SLGA 1G59A 4OX9B 3G5UA 1JDSA 3OE5A 2HMVA 3VZRA 2JLZA 2HBYA 3T5PA 4N5HX 2PLNA 2VPQA 5I8WA 3S55A 2Z83A 3W5DA 4EY5A 3BXFA 4KQHA 2NP7A 4JNKA 3JU3A 2WR8A 5C8DA 1QPBA 5SZIA 3R3YA 1GGEA 3WGTA 3ZDYB 4DA9A 4S1WA 2FZWA 3A6PC 3KEGA 2EZ4A 1T4GA 4TN5A 2JBWA 1R0ZA 3TNLA 1YQUA 3TX2A 4ITVA 3U1BA 1XA4A 4MVCA 1SJ9A 5J43A 3HHEA 1TVEA 5JEDA 4CKEA 2WILA 3U5ZB 1G3UA 3FX2A 1TJ5A 1VJRA 4FFDA 2HADA 4LVNA 5D3KA 1HKUA 3WLIA 5IBCA 4M3NA 3USES 1UQTA 3GVHA 1DX9A 3K2BA 5JS8A 1SXIA 2HOQA 3KQHA 2FEAA 3ZTWA 1VSBA 1E2EA 3UT5B 4ALMA 1CNEA 1KEPA 2PNFA 4EAQA 2PZEA 4UTXA 3L7LA 2ZJ3A 4L8LA 2L0XA 4QXOA 1OX6A 4CR7A 4ERXA 4MVXA 2WU4A 4DUYB 5I01A 2ZVPX 2GBFA 3AB8A 4X8HA 4LTNA 2BSQA 2X23A 1XPJA 3H6KA 4YCBA 4HZUA 5G0SA 1N1DA 5HCIA 3LY7A 5LLTA 3R9XB 2OCGA 4CTNA 1DHRA 3MGAA 3T1NA 1CTQA 4U7HA 5DBFA 4BNGA 3COZA 1QVZA 3I6MA 4DRZA 3JYLA 1CT9A 2PPLA 4CMGA 3S1SA 4LXQA 3N1UA 4M98A 3UCEA 1FNDA 2EGUA 1XCPA 4NCHA 1ONPA 4MUFA 4QAQA 1AQLA 4Y2TA 1L3IA 1XDDA 1HDIA 4B33A 3LK7A