1Z74A

Crystal structure of e.coli arna dehydrogenase (decarboxylase) domain, r619y mutant
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
342
structure length
326
Chain Sequence
b'RTRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVEHYKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein ArnA
publication title Structure and Mechanism of ArnA: Conformational Change Implies Ordered Dehydrogenase Mechanism in Key Enzyme for Polymyxin Resistance
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 326
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1z74A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1z74A02
5I7FA 1N7GA 1IULA 4PLPA 1HTBA 4M1QA 4CQMA 2NNLD 4XIJA 1T24A 3D4NA 4ZD6A 2ILTA 4KWHA 4BNWA 3CZRA 4L4RA 1QYVA 3ZHXA 4JROA 4PLWA 3BMQB 4P4GA 3CMCO 1KOLA 3BMCA 2BFPA 2OGUA 5BNIA 1NP3A 2AEJA 3NGLA 2HAEA 2Y0EA 3HZZA 4RF3A 3ULKA 4RORA 1J0XO 4OMUA 1BWSA 2Y1CA 2IEBA 1ARZA 3O26A 4A2CA 1TEHA 1ZBQA 3W8EA 4RJTA 1JQBA 1ZKMA 3GHYA 3L07A 5HM8A 4DL9A 4P22A 4RGBA 1T2DA 3JQGB 2X9NA 3KVOA 4PLVA 1DC3A 1D3AA 1FXSA 4EUFA 4PN3A 1GAEO 3Q3CA 5L53A 3PLRA 5ITWA 1WZEA 4OAQA 5JY6A 3DZKA 1XLTA 4AJEA 1I8TA 3U49A 3W8FA 2I3GA 1MLDA 1P1KA 2FMUA 4D44A 3DBLB 3OEWA 4RF4A 3L4BC 2WEKA 3GPIA 4AJ1A 3GEMA 4NU5A 2O3TA 2ZB7A 3VKUA 3B6ZA 3E8XA 2IZZA 3UF0A 5THQA 2NVUB 3BTOA 1B2LA 3GUCA 3WQQA 4W4TA 4R54A 1MC4A 1DLJA 3C24A 3DOCA 4BNFA 3V8BA 2CF6A 1EBFA 1MUUA 2YJZA 2YZ7A 1X15A 1Q2XA 1ONNA 3NT2A 4MIEA 4ALMA 4BHTA 4ZGWA 3D1LA 2W90A 4U0KA 1YE3A 4Z0TA 1KS9A 4BNGA 4EJ6A 5B1YA 2O3RA 5BR7A 4DTIA 1A27A 3RC9A 3ZCXA 5C5IA 4OSOA 2DBVO 1X13A 3UUWA 3ROQA 2CSUA 3E9NA 4O6VA 3FWZA 3H3FA 1DIBA 1DIAA 3C7CB 1EVJA 5LC1A 1N9GA 3NTQA 4YB8A 4HUJA 2Y1GA 4ALIA 4Z9FA 3UGKA 4RCVA 4BV9A 2O7SA 2Z95A 1BW9A 2NU8A 3GMSA 4MKXA 3K5PA 2A4KA 4M89A 1E5QA 3AM3A 3JTMA 2P9GA 4U0JA 1P74A 4IQ8A 1BDBA 2NTNA 4CQMB 4PG6A 5A05A 2YHUA 4MKRA 1LI4A 3MJ4A 2Q1WA 1PJ4A 4ID9A 1I3MA 2P9CA 4CMBA 3BMCB 4MP6A 3I6IA 4XDYA 3OQBA 5G4KB 5TT0A 3B70A 4U7WA 2PGDA 4FCCA 1BHSA 2FP4A 4QT0A 1ZJZA 2ZTUA 3GMDA 4GAEA 1ZNQO 4MVJF 1F14A 1CQJA 1NR7A 1N92A 5A04A 1FF9A 1RM0A 2RHRA 2W8ZA 3DOOA 3OEYA 2EP7A 3ENKA 3TNLA 4AJHA 2A35A 5DP2A 1T2CA 4CM9D 1ZCJA 4WNCA 1HDCA 4DYVA 2VZ8A 4ZHSA 1JWBB 3UXYA 3F46A 1DIHA 3LK7A 2J5RA 1P9LA 1H0KA 3HDQA 3ZI0A 2PZLA 3H7AA 3NTOA 4RVGA 1T2AA 1HDZA 1I5RA 4RF2A 5A5FA 5I9NA 4CL3A 1A7AA 1NM5A 2H6EA 4DPMA 1D1TA 3D7LA 5H83A 1R66A 1ADCA 3AY3A 5T57A 4B4UA 4XYLA 2PK3A 4CV1A 1MA0A 1MXHA 4TZTA 4B4OA 2IEDA 5FEUA 2DFVA 1H2BA 1BVUA 1XQ6A 2FRDA 3VPXA 2B36A 1NVTA 4Q3EA 4CQMD 5I9LA 3SC4A 4EUEA 1AGNA 4CLHA 1EQUA 4DIBA 1J5PA 3OMLA 1C1XA 2Q4BA 3LZ6A 4BO4A 4E2WA 5ICMA 2YYYA 1UUFA 2YW9A 1ENYA 3ZW9A 4CM6A 1VL0A 1QYDA 3GZNA 3RROA 3PHJA 4DWVA 2GN9A 3DAFA 1HZZA 4UUMA 1ZIDA 2EKLA 1OZAA 3WTBA 5AYVA 4BNKA 1GQYA 4W7IA 3ZZNA 3D4OA 1CIVA 1LTHR 3EK2A 3M1LA 2GZ1A 2A94A 2GNAA 3QVSA 3KYDA 4K1LA 3WSVA 3E5RA 3OJLA 1BW9B 1NVGA 1E77A 1PGJA 1YB4A 1E1MA 3LF2A 3OSUA 4LK3A 1YO6A 1WVGA 1SMKA 3QWIA 4WASA 2Y99A 2FOIA 4DQVA 5L95A 3ZV3A 5H82A 4I5DA 4TKLA 4KWIA 2DTEA 3ZV5A 5A06A 1ISIA 8LDHA 1QXSA 1H2HA 3BTVA 3GOHA 3H9JA 4IXTA 3WQRA 3SLGA 4ZICA 2Q3EA 3E48A 1NFRA 5CDTA 1I3LA 3WGOA 4E2XA 1HYGA 3GG2A 4YR9A 1WNTA 1LUAA 2X4GA 1R37A 3GPDG 3HB5X 4DGSA 3G79A 1DJQA 2GERA 1LRLA 4HXYA 4XRRA 2Y0CA 3RC7A 2VTEA 1EBUA 2O3UA 1PGNA 3P2OA 1F0YA 4E30A 1OAAA 1A9ZA 1ZJYA 4XYEA 3UVEA 1M2WA 1TLTA 1R15A 3AUUA 3DBVO 4GQAA 4MVJG 1QYXA 1LSOA 3WOHA 2A92A 1YONA 2EW8A 1I36A 5C37A 1LLQA 1B3RA 3QWFA 3TFQA 3F3SA 3PJEA 3SXPA 3H2ZA 3PYXA 1E3IA 3B20A 2VHZA 1Y9AA 2ZYAA 3TZQA 2P5YA 3ETDA 1Z45A 2EV9A 3A28A 2X0JA 1XELA 1DAPA 3NDRA 2NQ8A 2VYVD 2P4HX 2QYSA 2EW2A 3Q0EA 4CLXA 4E2YA 1MG5A 2YQ4A 5DN9A 4CMEA 3VPHA 1UR5A 4OXYA 3I6QA 2WE7A 5DCWA 1LBEA 4KOAA 2PD4A 5JC8A 3U4CA 3C1TA 3S2GA 1OC2A 5JCJA 4EDFA 2DUWA 3E82A 1C1XB 4CLRA 4YAIA 3ONEA 3ZU4A 3G3EA 4A27A 4BNIA 1YKFA 2ZJ0A 3WYBA 3G17A 3JQCA 3VTZA 3QY9A 1T1SA 1TVEA 1Y9EA 3EZYA 3GZNB 1O0SA 4OOEA 5ER9A 3INGA 1ZEJA 3RVDA 5U9CA 3Q9UA 4AJLA 3ZU3A 3G49A 2Q2QA 4CLOA 3PJGA 4NK4A 4OQZA 4EGFA 1WMAA 2NQTA 1QMGA 4D43A 3NYWA 1DLIA 4DA9A 4XIYA 2ZKLA 1UP6A 1KERA 4YT5A 3KYDB 3ABIA 3DBRB 4CV0A 3RUCA 2EGHA 1OOEA 1SAYA 3PHGA 1W8DA 3BYZA 4II2A 1DEHA 1JTVA 4NJMB 3FI9A 3BA1A 3H8VA 4RVFA 1VLLA 4N5MA 4ZN6A 1DHRA 2VQ3A 1GEGA 3DC2A 3SJ7A 1LSUA 1O94A 4E13A 4RLSA 2Y05A 3ASUA 3MJTA 4BNMA 3JQ9C 3BMNA 3GHHA 4OKIA 1A71A 1B8UA 1Q7CA 4IMRA 4G5HA 3DZFA 5BSHA 1UH5A 3DAGA 4WOKA 5HRUA 4L73A 4B4WA 3PYLA 4BO8A 4FOSA 1D4FA 4QECA 3DMTC 4ZQHA 2NU6A 4ND2A 1DFIA 3WICA 5GMOA 4PRKA 4UVIA 4TRNA 3N74A 3IUPA 4UUNA 3KRTA 1YL6A 3C3XA 1TXGA 1DC6A 5BSEA 2AQKA 2DFDA 4GLLA 3LYLA 3W4JA 1OFGA 2VT2A 3KHUA 1FJHA 4R01A 4PG5A 1N5DA 4Y8VA 3TL3A 4F45A 5DOVA 1O95A 4Q3BA 4PRLA 5CDGA 2Y1OA 2I99A 4L8VA 3FD8A 5TJ9A 1QYWA 2ZCVA 3RKRA 4WCFA 2YFHA 5IZCA 4MIOA 2AA3A 4AJKA 4DBZA 5A5EA 4RO0A 4BNTA 2HUNA 3V2UA 2EJVA 1E1LA 5IXYA 4ESOA 1BSVA 1PGOA 1PJTA 2J3HA 1PJ2A 2V6MA 2WYVA 4LRTB 2VOEA 1HE5A 1KY5A 2Y93A 1BRMA 5BNTA 3INRA 2AQ8A 5JO9A 4M54A 2QYTA 1WXDA 1F8FA 3VC7A 3RUHA 4FFLA 3PHHA 3EW7A 3HQ4O 3EMKA 2EF1A 2EG9A 1AN9A 4CLRB 2E48A 4A03A 3ASVA 4BKPA 3L6EA 2WDZA 5F1KA 4PG7A 3H65A 1SNYA 2UUOA 2C2YA 4PVCA 1KY4A 3QWHA 4HNHA 1ZW1A 5CHEA 3E9MA 4ZVVA 4I9UA 1GZ6A 1IE3A 1ENPA 3JYNA 4DRYA 1LU9A 2JFFA 4K6FA 3VZSA 5BSFA 4CLOB 1VI2A 5EMHA 3RI3A 2V6FA 2GN4A 4J43A 3TL2A 4J90A 4NBRA 1SBYA 5KJEA 4YRDA 3GY0A 4BL5A 4C7JA 4J4TA 3JQ8A 4JJFA 4R5MA 1U2DA 3PPIA 1HE4A 2BH9A 2RHCA 1SB8A 1SC6A 3FBTA 4MP8A 3V2GA 1UAGA 3VVCA 1P77A 1J6UA 4CUJA 1M67A 1QSGA 5F5NA 2H63A 3ZWXA 5AXDA 1A4IA 3ZWBA 3P19A 4BKQA 4GX2A 4CQLA 3LC7O 4OH1A 3HJAA 4L4XA 2VRBA 2VYND 4CMGA 5L4NA 5JMPA 1V3TA 4IJVA 5CPFA 5CAEA 1AE1A 4NFYA 2C54A 4UVEA 1A5ZA 5CDUA 2BGMA 3RAJA 1E3EA 1E3WA 2X5OA 2HDHA 1DRUA 4YJGA 1X14A 2A9FA 4EEZA 4RV9A 4R9RA 4IDCA 1DXYA 1H9BA 5JCJD 2EJWA 1L7DA 2I67A 1S7CA 4N54A 4U6SA 1DAOA 1R4NA 1E7RA 2CY0A 1E1NA 1KEUA 1Y5MA 4O59O 2O2SA 4AFNA 1ADFA 3CIFA 3IUSA 3MJCA 4BO3A 1GY8A 5G0VA 3VZPA 3HSKA 4IXWA 5KJ6A 4KZPA 5CDYA 4ONEA 3M2TA 5A1TA 1X1EA 3JQEA 4YRAA 3KV3O 3DR3A 4Z6KA 4XD2A 4MJLA 4YEDA 4OJNA 1AXEA 1LRKA 1PL7A 1BG6A 1Q0QA 1ZUD1 3L4BA 4R51A 4YPOA 4J16A 4ALNA 2NV6A 1EDOA 3EVTA 3ANMA 1C0IA 3O9ZA 4XX0A 2O3SA 5BNFA 3ZW8A 1UZMA 1OI7A 5G0TA 4P4LA 2G5CA 2JAPA 3OJEA 3WYCA 3GDFA 4UVHA 3U4IA 4OGWA 3PP8A 4TSKA 1Z7BA 2JCYA 3Q1LA 1U5CA 5B4VA 5A02A 4JLWA 1YJ8A 3VH1A 4FJ2A 4Z3DA 5DNAA 1EK6A 3ZGYA 5L4SA 3HDYA 3NEPX 1VL8A 4H7PA 2Q4EA 2IYPA 4BO5A 4IS3A 1SEVA 1IZ9A 1U3VA 2OBYA 5G2OA 3I9MA 4ZA2A 2UDPA 2ZB8A 3KXDA 3U4DA 5JS6A 2JD2A 1E7SA 3DL2A 5TT1A 4B7UA 5CPBA 3JQ8B 3GFGA 1I2BA 4N7RA 2J3IA 1FMCA 4W9NC 4BMNA 1U3UA 3KB6A 3DFUA 2F1KA 1J49A 3ZWOA 3B1KA 1FDWA 1Y1PA 2BF7A 1JU9A 1N7HA 3BMQA 3GRPA 1HRDA 4D79A 3WGGA 3CTMA 3FHLA 3FNEA 3I9JA 3L77A 4CQLB 3R0IA 1FDVA 5DBGA 3JYLA 2CZCA 1NQAO 2NM0A 3RSHA 3JSAA 1T25A 2R00C 2PA3A 2XF8A 3F5SA 3RU9A 3ZHYA 3WGIA 4CM8A 3PWSA 1E3WB 1T1RA 4NK5A 4UEJA 1NXQA 4YJGB 3RQSA 4F46A 4K6CA 4YBZA 4NFSA 3MJVA 3KTDA 4NMHA 2DAPA 3N7UA 2V6GA 4PLFA 4M86A 2DT5A 1R4NB 1YOVA 3PFFA 4E3ZA 5KTKA 1M6HA 2C7GA 2I6TA 3MOIA 3ZV4A 3VZQA 3WTCA 4F3YA 4BGEA 3V1TC 3FSRA 5DULA 1XKQA 2W4QA 4RPKA 1KIFA 1U7HA 2JAHA 4NZ9A 1YGYA 3UOGA 1YB5A 1P1IA 3K2EA 1AHIA 4ZQEA 4D45A 4UEKA 2WWRA 3OFSA 4YVFA 5ADHA 4GMGA 4J4HA 5ENVA 1GYQA 2OORA 2PKQP 5DZSA 3NKLA 1NHWA 5L45A 2I76A 2JD0A 1TI7A 3RUIA 3H2SA 3EUWA 4R3NA 3SVTA 4ZQFA 5JCXA 2HCTA 1XR3A 3JYQA 5JMWA 3OM9A 4Y6RA 1ISGA 2Y68A 4XJTA 4XR4A 2CUKA 3VAZA 2YUTA 3AI1A 3R6DA 3AI2A 1RYEA 4EYEA 1E6WA 3AW9A 3U0BA 3H5AA 2IZ0A 2NUAA 3CXRA 1YJQA 4E33A 2YV2A 1IUKA 5JAQA 2OOSA 5BT9A 2VZ0A 2HLPA 4HFMA 4J0FA 3HE3A 3KUXA 1RYDA 2GN6A 1GQ2A 3VZRA 3KSDO 2OXIA 1ZK2A 3WGQA 2Q46A 1YQXA 1WAMA 5TLSA 4E5YA 1YL5A 2X0RA 1Y7TA 4W6ZA 1UZLA 3VPGA 1JW9B 2AG5A 1NPTO 3HDJA 3SBOA 4ZJUA 3F9IA 4BB6A 3NJ8A 4FOOA 5JAIA 4FFRA 2BGKA 2RIRA 1Y8QB 4BNUA 3QA9A 3RJ5A 5EN4A 4XJSA 1KC3A 3WLEA 2XXBA 5KJCA 5G4KA 3LT1A 3CSDA 5TNXA 3IL2A 4WJZA 3I9KA 2RH4A 4DBVO 1LC3A 3ZNOA 4YT8A 1M6WA 3GDGA 2IRWA 2JKVA 1R4MA 2TMDA 2W2LA 4IGFA 3AWDA 2WE8A 3F4BA 4CM8B 3HDHA 2P68A 3HG7A 3IJRA 5L7YA 4EUHA 4IIUA 1DO8A 3NAQA 5GZ6A 3M1AA 2AG8A 5FI3A 4ZRMA 1YOVB 1OMOA 4AJNA 5DCYA 1R12A 4TRMA 4YJHA 2YHIA 4RL6A 4GX5A 1N1GA 2ZB3A 3TFOA 2QX7A 2VT3A 4BMVA 4WECA 3DEYX 4FN4A 2GLXA 4MINA 1JVBA 1NBOA 4XYGA 4WLEA 1H5QA 1GCOA 1L7EA 4BMSA 4OXNA 3QVTA 3D3WA 1MP0A 1V0JA 4DXHA 4EW6A 4Z0PA 2QQ5A 4QX6A 2I3AA 4IZHA 3FPCA 1ADGA 4LSWA 1PJ3A 3ZHZA 2FPIA 3OF2A 4GVLA 4IBOA 3QVWA 1PZGA 4WNIA 4GKVA 2OP1A 4PLHA 1EVIA 1ZXBA 2VHVA 3WGHA 3LLVA 4RPJA 4E0BA 1WW8A 3S2FA 1RPNA 5KVQA 1Q7GA 1O9BA 1MV8A 3IC5A 3BHMA 3DAPA 1QV6A 1LDYA 1IOLA 2X6TA 4YAJA 3D4PA 4YXFA 3F1KA 3S8MA 3V2HA 5MDHA 3ADPA 1WP4A 4JBGA 3PQFA 1PWXA 3UH1A 1KEWA 2C7VA 2OO5A 1EQ2A 4AVYA 3K31A 3MWEB 2VYVA 2I9PA 1IPEA 3C1OA 3AOEA 3RUDA 2WTBA 3EDMA 4TMFA 3HB4X 1UXJA 4U8GA 4DUPA 2IXBA 3RBZA 4DMMA 1HF3A 1WMBA 2POQX 5TSDA 1C0LA 1EZ4A 4Q3NA 2VHXA 2HO5A 4WGGA 4BNZA 2BELA 4BNLA 5I9MA 3FPLA 1ZXLA 4NIMA 5KIAA 3L9XA 3E9QA 3FCOA 1IB6A 1PX0A 3JQ9A 2BI8A 2IYOA 5IXSA 4PLZA 1YRLA 1E5LA 4OKNA 1R4MB 5JFOA 2QRJA 4J0EA 2Q1TA 2VUUA 1H6BA 5EESA 3OICA 1SCUA 4I9HA 2PTGA 3L0DA 1SOVA 4GBJA 3JQ6A 4RVUA 3PTZA 3UN1A 3RUFA 1O8CA 4UAGA 1L1FA 3WYEA 1S6YA 5B12A 4DIOA 1ADBA 1X0VA 4PZCA 1DB3A 3HADA 4YYZA 1YDWA 4GKBA 4YJHB 3JD3A 3S55A 5MGBA 2YHIB 1O89A 2JFGA 1E7WA 4L9RA 1DSSG 1CJCA 1I10A 3C85A 3GNQA 2C5EA 4ND1A 1HKUA 5J23A 4CR8A 2QHXA 2WD8A 2BFAA 5BQFA 2PZJA 2GGSA 4YWJA 3ROKA 1H9AA 3GN2A 1P31A 4IDDA 3K92A 3GZ4A 3D3WB 5F5LA 3ETGA 4L75A 5F3RA 3GFBA 3U9LA 3AM5A 3VH2A 3WXBA 4CLDA 1ISJA 1ONPA 3WNQA 1ZMTA 5HWSA 3JYPA 3I52A 3WLFA 1U28A 1P3DA 5JE8A 2OZPA 5THKA 1B3BA 3GVIA 4J7XA 3K30A 1Z73A 5DF1A 5TIIA 1ZZEA 1I3KA 1GPJA 3QWAA 1JA9A 2W2LD 2B69A 1ENOA 4JP2A 4B4VA 5JC1A 3PFWO 3R3JA 4HBGA 4M8SA 4RQUA 2O4CA 5JSFA 5TF4A 5F1PA 3KLMX 4WLUA 1F12A 4G65A 4NFHA 2GZ3A 2O2YA 2V7PA 1JKFA 3SEFA 4KUHA 3DBRA 4IQ0A 2OUIA 1K89A 2X5KO 3AY7A 2PH3A 4WK6A 2OHXA 4JX8A 4RPGA 4ND5A 1LDNA 4NJMA 3U5TA 2HMSA 1U4SA 1UXKA 1KC1A 1SO8A 1PS8A 2C5AA 4BO6A 1HT0A 2CVZA 1EUZA 2FR8A 4H16A 1C14A 1DFGA 4J3FA 2OFPA 2HK8A 4JIGA 5EL0A 1ZSVA 1NQOA 4N5LA 3BTSA 4Z3KA 2DUUA 3ZNQA 1QP8A 4DREA 3VHRA 4KUEA 4HX5A 1WDLA 1YBMA 3P5SA 3AOGA 1EFKA 4HP8A 3OIDA 2VHYA 4Q9NA 5L3ZA 3ST7A 1E1KA 1EE2A 1U2GA 1HLPA 2JL1A 5I7SA 4XQGA 4C4OA 4WLVA 3EC7A 4EZBA 4R4JA 3RKUA 2IODA 1GCUA 3ZWYA 2ZJ1A 4ITUA 1B14A 3A06A 4K26A 1VSUA 4TRRA 1BGVA 3ON5A 1MFPA 4I8XA 1ZH8A 2QRLA 4OL9A 4MKZA 2D4AA 4E21A 4RDHA 4E6PA 2C59A 4FGWA 3OJOA 4XA8A 4A7PA 1P1JA 2VYNA 2VOJA 1GFSA 2D5AA 4D0RA 3LF1A 4ZQGA 1KYQA 4W82A 3OA0A 5EJ2A 2TMGA 5DBFA 4B8WA 4LGVA 2Z1MA 1PQWA 4TZKA 2SCUA 2CDAA 3FNHA 5DCUA 2PLAA 2BMAA 5T5QA 1UJMA 4GGPA 4J1TA 2PD3A 3TJRA 2E6UX 3GA0A 1D8AA 4GI2A 1QV7A 3H9QA 1GU7A 4IZIA 1YH3A 3EHEA 3QE3A 1H6CA 5HS6A 4I08A 2AMFA 1ZO8A 3DB2A 1V3UA 4P38A 5K9ZA 3MJSA 4JBHA 5F21A 1U4OA 3JQBC 1IZ0A 3ZDFA 1KETA 4Y6PA 3CE6A 4FDAA 4CM7A 3TDKA 3JQAA 2IDZA 5CEJA 1PSDA 1E6UA 1ISFA 1NX6A 1WDMA 3PZBA 1B15A 3O03A 4BNJA 1LSJA 2GSDA 3ORFA 4JK3A 3WIDA 2GO1A 1LC0A 1PEDA 3MCVA 2Q99A 4XKJA 5KKAA 2HRBA 2GZ2A 2PZMA 3GGPA 4HKTA 1Y5RA 2Q2VA 2R2GA 1T2FA 4IDFA 5A4DA 4IJKA 4W9NA 5JW6A 3M2PA 5ICSA 3TZ6A 3FF4A 3FNFA 1PL8A 1HYEA 2QW8A 1B16A 1PQUA 1VL6A 3VVBA 2HMTA 3ANLA 5IF3A 3F6YA 2DTXA 3MTGA 4GWGA 1JAXA 2W98A 4NU6A 4PVDA 3FTPA 1CEQA 1FDSA 5JAMA 1GL3A 1KVQA 2R00A 3GGOA 4O63O 4TVBA 4MOWA 4QXMA 1XHLA 1NHGA 2VNSA 2OBNA 2WD7A 4LVUA 1ZFNA 4IGEA 1PZHA 1M66A 3WFIA 1O6ZA 4WE3A 1NR1A 5TRTA 3NTRA 4IDAA 3OETA 4BNHA 3C7AA 3UHAA 5F1OA 3JQFC 3H6KA 4YJFA 4J2HA 2HMUA 5JXWA 3ZNPA 1W73A 3D3EA 4J6FA 1I01A 3JD1A 2GF2A 2J6IA 3K2BA 2NSDA 5TC4A 1U9JA 5TGDA 3FRJA 2EGGA 2EXXA 3T4XA 3F4LA 3NT4A 4YRBA 1GEEA 3I3OA 4BQRA 7ADHA 4BO7A 1VE9A 3I9OA 2G1UA 1PJLA 4CJXA 1DRWA 4BO9A 4II3A 5C7OO 2NTJA 4BKOA 1HZJA 4DQXA 1M75A 1DHTA 2PWZA 3QSGA 4MVJM 5G0SA 1DDOA 4QFDA 1KVTA 3GUYA 1ZK4A 1KVRA 3IP1A 5A9RA 1K6JA 2EERA 4CM4A 1GR0A 2QZZA 2E49A 1K6IA 4CV2A 3OECA 1UXGA 2ZYDA 4XR9A 4ND3A 3EYWA 3KO8A 4UREA 1F06A 1D1SA 2O3QA 4O1MA 4OYRA 3TWOA 1B26A 1UDCA 4FJ0A 3WFJA 5KKCA 2PKQO 2UVDA 4LCEA 1QORA 3P7MA 2OMEA 4WEQA 2E82A 1XU9A 3JQAB 1V3VA 1J4AA 4B79A 1QRRA 1K3TA 4QTZA 7MDHA 3IOYA 3WBFA 4FBGA 4LISA 4PLTA 2NACA 2VUTA 1Z7EA 2RAFA 4KTVE 3G1UA 3FN4A 4UUPA 1ZK3A 3IMFA 1QLJA 3RD5A 2BGLA 4XDZA 4XGIA 1P0CA 1W0CA 1R0SA 1GUFA 4JNKA 4J1SA 3I9NA 4XZ3A 2ZATA 4N5NA 3DZGA 5T8KC 2VWGA 3QVXA 4L76A 4ALLA 1X0XA 1EEHA 3NGXA 4ALJA 1YBAA 3ROMA 1V35A 4J1QA 2BKAA 5IDXA 3K96A 4IS2A 5DOZA 4B7CA 1K5HA 4CMIA 4XEHA 1PS9A 3CINA 4J9VA 3ZHBA 2NU9A 3O38A 3Q11A 4KUGA 8ADHA 3W4IA 3R3SA 2WD7B 2J5KA 2D3TA 1H6AA 4OSPA 2V65A 4AICA 2WYUA 3AU8A 5IN4A 4NBTA 4LRSB 4YQZA 3GAFA 5FF9A 4AJ2A 3QRWA 2UAGA 3VH3A 4YJFB 1ID1A 3OP4A 4D3DA 5ILGA 3RUAA 2BLLA 1BXGA 3UCFA 1GYPA 3K8ZA 1VKOA 3JQAD 1GD1O 3K6JA 3ZWPA 5FFFA 3LVFO 2J8ZA 1UAYA 4IJWA 3S2EA 2UUPA 3PWKA 1F8GA 3WBBA 5EERA 2X58A 1NPYA 4YA6A 5KVVA 1PWZA 1EFLA 3CEAA 3KEOA 5TQVA 2NADA 2V6BA 3QP9A 3A9WA 4MVJA 4Y98A 3IS3A 1B0AA 4TROA 4CM3A 1E92A 4YAGA 2EIHA 4DLLA 3D64A 4UVGA 5T64A 2JFHA 2ZTVA 5L4LA 3HN2A 2R6JA 4H15A 4N18A 2X86A 2JD1A 4UULA 3WGZA 2Y1EA 2OL4A 3HUDA 4CM4B 5JDIC 1YB1A 4RDIA 4CMEC 4XQ9A 1MB4A 1N8KA 1P33A 5AQ1A 1G6KA 1EK5A 2YDXA 4JCOA 4TKMA 4BS9A 1BVRA 4Y6SA 4EITA 1ULSA 3INTA 1WDKA 2FHSA 1HDGO 2VRCA 1ZSYA 3GAZA 2CVOA 1ENZA 3ROPA 5KJFA 1NASA 3GDOA 4CR6A 3CUKA 4DVJA 4OM8A 5G0WA 2BFOA 4NG5A 1LDBA 3OHSX 3PDJA 3DQPA 4ILKA 4WLNA 4CMAA 4DPLA 1T4BA 1LLUA 1C3VA 4HNGA 4W7HA 4OHUA 4CV3A 1A7KA 1KVSA 1NVMB 1Y8QA 2G0TA 4GVXA 3VH4A 4CL8A 3H9EO 4YQYA 4D3SA 1E3SA 2B5WA 3KM0A 1BTOA 4DLAA 2O48X 3GNSA 3AFNA 2AW5A 4NJOA 2H9IA 3E5MA 4BB5A 1HEUA 3PHLA 1CERA 2DQ4A 3KZVA 1I0ZA 3RFVA 3VPFA 3B1JA 3P2YA 3AJRA 4CMIB 1MX3A 1VRWA 3IJPA 5JYDA 3U3XA 4AJIA 3JD2A 4BGIA 4BIIA 5CG1A 3I23A 1EE9A 1PJQA 3JV7A 3ZWMA 5FYDA 4W99A 3NDIA 2JJYA 1LJ8A 2DM6A 2ZIZA 3GN1A 5AOVA 5B4TA 2Q45A 2IZ1A 4DIFA 5KCZA 1BXGB 1H6DA 5JDCC 2EWMA 2Q1UA 4MVJI 5KOIA 4BNNA 3WWZA 2GYYA 2UYYA 3DZIA 1JAYA 3ZWNA 4AJPA 3DZHA 3LLSA 4PZDA 5T6BA 3AI3A 3VKVA 1EDZA 1R0LA 1HSZA 1G0OA 4WCFC 3JQDA 2BRUA 4Z9XA 5HA5A 4BNYA 4E31A 4D7AA 1XGKA 2HJSA 3OIGA 3AU9A 1DPGA 3B1FA 1MGOA 3ONDA 1BMDA 1HDRA 4WUVA 4L4SA 4BNXA 3LC1O 3RU7A 3ZU2A 3STHA 3GRKA 5CP8A 4FC6A 2GR9A 1P44A 1ZMOA 4IDEA 4LN1A 4O0LA 5KVSA 3LQFA 1E6EA 1AUPA 2PZKA 4DPKA 5DP1A 4R1TA 3TZKA 2G17A 4Q3DA 1PU2A 1YQGA 3M6IA 4GGOA 4BUCA 1ULUA 4FGSA 4Q3CA 5GZ3A 1DFHA 3HFGA 4J4BA 4KQWA 4RPHA 3NJ4A 5JPIA 2D1YA 1BDMA 1Z6ZA 2BD0A 2C0CA 1G0NA 1WLYA 3K73O 3OJ0A 4DLBA 1LDGA 1F17A 3ZWWA 1I2CA 4FSHA 2LDXA 1GV0A 3CMMA 1IL0A 5IZ4A 2XOXA 2XXJA 2AXQA 2XAAA 4FFMA 1W6UA 4K28A 4IQGA 2QZ9A 4XYBA 4FB5A 4LSMA 3H5RA 4XWYA 2GD1O 4MVJD 5IDQA 4BQPA 4YAKA 2JHFA 1WWKA 1EVZA 3BHIA 2B83A 2Y1FA 3WGYA 1HE3A 5L40A 3RBVA 4OIMA 4DYDA 4RQTA 5BSGA 4JQCA 4P4NA 2DBQA 2H5LA 2VZ9A 4D42A 2X7HA 2EHDA 2X9GA 4MDHA 4AJOA 1LLCA 2FPPA 3MOGA 2NWQA 3D5TA 5JO0A 3AK4A 1HETA 3DOJA 6ADHA 1V8BA 2AE1A 1LQUA 3KYCB 2RH8A 3PWZA 3T7CA 2CMDA 2C2XA 4FS3A 1PQPA 5TJHA 2FWMX 1N1EA 1U8FO 4IINA 1YS4A 1NQ5A 4NPCA 4EJ0A 2VRCD 3PDUA 2FN7A 3R1IA 5K6AC 1GTMA 2ZK7A 2DLDA 1E0DA 3GEDA 4G81A 2HSDA 1HDXA 3ICCA 4TWRA 4DC1A 1EVYA 4L74A 2RBEA 4D0SA 1AXGA 3C7DB 3GVXA 5JYEA 1SB9A 2Q2WA 1JLLA 3GR6A 2EKQA 1VPDA 4KP7A 1X7HA 3L9WA 2BHLA 5EIOA 3GNTA 4B8ZA 2VWPA 2ZB4A 2X22A 1VSVA 2D59A 1LNQA 5COBA 1ZK0A 1D7OA 3BTUA 4FD3A 1E7YA 4MPDA 3C1AA 2Z1NA 2C82A 3ZWVA 1PJCA 4BGVA 4PG4A 3Q6IA 5I7EA 4MVJE 1XA0A 2FSVA 2F00A 3ZNNA 2J3JA 4F6CA 4GSKA 3O8QB 1ZEMA 3JQBA 4ALKA 3GGGA 2OP0A 5TX7A 1ZVMA 2VWHA 3TOXA 1DC4A 1VC2A 5EQDA 5HTOA 4B7XA 2VNAA 1W4ZA 1O5IA 5DBIA 4J9UE 1OBFO 4WEOA 2B4QA 2JCVA 2YV1A 3ZU5A 4NNJA 3VPSA 3RASA 2D2IA 2DU8A 1C1DA 1LLDA 4A10A 1VJ0A 4CLEA 1UP7A 4PLYA 3ITKA 4O5OA 3KEQA 3WS7A 1DOHA 4ROSA 1I2ZA 2YDYA 1A72A 4BO1A 1PIWA 2X5JO 3NRCA 4B3HA 4PLCA 5KWEA 4NBUA 2DPGA 3PIIA 4M55A 5A9TA 4XRGA 3TOZA 1H94A 3DMTA 1DJNA 2E37A 2YQ5A 3HFSA 5A3VA 1QG6A 2HK7A 4CMHA 2J3KA 2E4AA 5U4QA 3WMWA 3WWYA 2AE2A 5IG2A 3H3JA 1GYRA 1PZFA 1KVUA 1P1RA 1DBVO 3JQFA 4R1UA 1YQDA 5EPOA 4JXKA 4KMSA 3PVZA 3ANNA 1VJTA 3F47A 1PR9A 2HKIA 3TF5A 1GQQA 3ITDA 4M87A 5KNLA 5AXAA 3FTNA 2YY7A 4YDRA 3E03A 5JBIA 3DONA 1IHYA 3PJFA 1HL3A 3JD4A 4IIVA 1RKXA 3DXFA 3GC6A 4GH5A 2VN8A 4H3VA 5CG2A 1RJWA 1BXZA 3BXXA 2XPCA 2P9EA 4UEOA 1P45A 3V5NA 3AFMA 1C0PA 2GASA 1E3LA 4B3JA 2DPHA 3IP3A 4YJDA 1VM6A 3E18A 3A1NA 1FDTA 2CFCA 3BZUA 2D5CA 4TQGA 3UICA 3AUAA 1IPFA 2Q50A 3DWFA 3IKTA 4GX1A 4BV8A 3PQDA 4KDEA 3FR7A 4G2NA 3ZV6A 4R68A 1QR6A 4WKGA 3OJFA 4XB1A 3H9UA 1IHXA 5IDYA 2DC1A 5JNLA 4XQEA 5A3JA 1JDJA 1B7GO 3DDNA 3I1JA 5B37A 4JGBA 1VKNA 3MZ0A 4PZEA 4YTEA 2Y67A 3LU1A 2Y0DA 2DBRA 5I7VA 2HJRA 3DZJA 1KBZA 1I30A 4QO8A 3U4HA 4DMLA 4IDBA 3WMXA 4RZIA 1LX6A 3QIVA 1EMDA 5H81A 1I3NA 2CDBA 4JJIA 3LDHA 1U7TA 1DIRA 3U62A 4JN6B 3IQDB 2HRZA 3QLJA 1C1DB 3W1VA 4GMFA 1N9GB 2FR1A 4ZQBA 3LT2A 3N58A 4R3WA 4FC7A 1GPDG 2WSBA 5T8KA 4WCDA 4CUZA 4FQ8A 3FNGA 1GUYA 4J1NA 1K2WA 1PS0A 3BIOA 1T26A 3VDQA 5HS4A 2O7QA 5IJZA 4GWKA 2AQHA 1CDOA 2X23A 3GVPA 3WB9A 5LDGA 1XDWA 4R9SA 4MP3A 2CD9A 2AQIA 2O50A 2VCYA 5T67A 3W8DA 2PFGA 5IN5A 5IFLA 4BOYA 1NPDA 3TZCA 4MIYA 4CR7A 5ITVA 4BKRA 3LSYA 1Q0HA 2B4RO 4IJUA 1NNUA 1MG0A 1QYCA 1UXIA 3EAGA 1NTOA 5LCXA 4CPDA 2IE0A 2P4QA 2I5PO 4CMJA 4RVSA 3V1YA 3JD0A 3PRJA 3A14A 1K0UA 5G4LA 1Q7BA 1QKIA 2X0NA 1HDYA 3RIHA 4DQUA 2WJPA 3NX4A 1X7GA 4RF5A 4EI2A 3K9QO 4M49A 2DTDA 2X9VA 2QG4A 3CKYA 3IDSA 3HHPA 4JJGA 4C7KA 3TPCA 1XYGA 4I5EA 1YVEI 2BI7A 4Y67A 1LXCA 3PLNA 3TRIA 4YT4A 2P2SA 1NFFA 1Y6JA 1RM5A 4AJ4A 3COSA 3I9LA 3WJ7A 3WX0A 1WZIA 1JVSA 4QFCA 5AVOA 3W4KA 4J7UA 3MWDB 5JDIA 1E3JA 4R41A 2W2KA 3RCBA 1I32A 3ENNA 1HE2A 2FY8A 4PGFA 3GVCA 3MTJA 2PH5A 3D0OA 3T4EA 2X0IA 3T7EA 4URFA 2G76A 1P1FA 3GVHA 4E5KA 1LDMA 4A26A 4EEXA 5HBRA 3O4RA 2X8LA 1EUDA 4IY1A 5EQFA 2PR2A 2DBZA 4MVJH 5ES3A 3CPSA 4YCAA 1CF2O 1CRWG 3CZMA 3UAGA 4QO7A 4JBIA 2Z5LA 4Y9DA 1RM3A 2QIOA 1RM4A 4OOFA 4CM1A 1A4UA 4YT2A 3Q2KA 3EZLA 1JWAB 3ONFA 1JKIA 1SEPA 1UP4A 3WGTA 3H4VA 3RJ9A 3LT0A 5CEFA 3AOEC 5GZ1A 3H9GA 4IUYA 1EUCA 3PQEA 4FJ1A 1SZJG 1ZK1A 1SOWA 2CDCA 3RBXA 4J91A 3X2EA 2B37A 3KOUA 4NH4A 1NAIA 1NFQA 2NU7A 1LRJA 1U5AA 3MEQA 3IIEA 2I66A 1MXFA 4ZRNA 2J5QA 5I8WA 1PR3A 2FR0A 3HNPA 3KSUA 1PTJA 1E7QA 4S1VA 4INAA 4J7CA 2PKRA 2AEMA 5CDSA 1X7DA 3NUGA 3QJ5A 3OH8A 3RC2A 1UDAA 4FFNA 2D8AA 1NYTA 3ADOA 3L4SO 3BAZA 2ZQYA 3FBGA 4OXKA 4P8RA 1N2SA 3H5NA 3DBHA 4OQYA 4HFNA 4RZHA 1HWYA 2PV7A 4CUKA 1JN0A 1AHHA 3OIFA 5A03A 2B0JA 5JDCA 3UKOA 5EINA 4PG8A 4LW8A 5ILOA 2EKPA 3UCEA 4QUKA 4GLOA 2B5VA 2C07A 4XGNA 1R6DA 3I4CA 2GRAA 3SC6A 2AEFA 1GZ4A 1UDBA 3JQ7A 3SX2A 5G0UA 5L9AA 2VUSA 4U6QA 2WYWA 4GSLA 4YAEA 4HY3A 5IAAA 2HK9A 1KEVA 2HQ1A 3E1KA 5A9SA 4IMPA 4NI5A 4JP3A 4NHEA 5L7WA 4U5QA 3WR5A 4A5OA 4YACA 2W2KB 3GEGA 3RUEA 1FDUA 3ETEA 1CYDA 3DMYA 3I5MA 4Z9YA 1DRVA 4D41A 4J49A 4LMRA 1ORRA 4Z0HO 3UCXA 1HXHA 2FZWA 5FWNA 1R16A 2D0IA 4RVDA 4LCJA 2JCXA 1TT5A 4HFJA 4LVCA 1I24A 1PL6A 3UFXA 3PHIA 3IKVA 4CMKA 3C8MA 4EJMA 4J2OA 2JHGA 1RWBA 4R1NA 4TRJA 2DKNA 4HADA 1MFZA 5JY1A 3Q9NA 1NWHA 3IAHA 3NT5A 1NAHA 4ND4A 4HWKA 2FZEA 2QRKA 3W6ZA 5LDHA 2PGLA 3FR8A 2DVMA 2IXAA 4FPXA 2FSSA 9LDTA 3G1TA 4CM5A 1V9LA 4FIZA 3WG9A 3WJAA 2O3JA 1U8XX 3EY4A 2Y1DA 2PGJA 2NLOA 3QV1A 1Y8RA 5CEEA 1JKJA 1XIVA 3KBOA 3VDRA 2BFMA 2HMWA 4E32A 1QLHA 4CMCA 1X1TA 3BMNB 2NTVA 1P0FA 3ZWCA 1GZ3A 2VWQA 5B4UA 3KYBA 3PEFA 2CNBA 4BVAA 1HYHA 2ZTMA 4E5PA 1PZEA 3OA2A 4X54A 5DT9A 4R5HA 3AY6A 4QEDA 1TB4A 1GADO 2WM3A 4I5FA 3DBHB 3BMOA 2Y66A 2P91A 4GPD1 5KJ1A 4PFJA 4HFRA 2VTDA 5K6AA 5KVCA 1HSOA 3HWRA 5C7LO 4WLOA 3VOSA 2EP5A 2LDBA 3QVOA 3DHNA 4E5MA 1GV1A 4GX0A 6LDHA 4Q39A 4WPGA 1MC5A 3UW3A 1WPQA 4BNVA 1CWUA 4AJJA 3WNVA 1ZSNA 3SJUA 4QQRA 1CETA 3JQ7B 5K0ZA 1PGPA 5GY7A 1NQTA 3I4FA 3OQ6A 4WCFB 1A9YA 3AM4A 1Q1NA 2PNFA 4F6LA 1YL7A 4XCVA 4AL4A 3GQVA 1DC5A 3Q2IA 3X2FA 5ER6A 3WQSB 4UUOA 5DDIP 1FK8A 5A9SB 2Q1SA 3ICPA 1PJBA 1C0KA 2EEZA 3GG9A 5AXBA 1U1IA 4ZU3A 2WMDA 3GT0A 4FFOA 2CF5A 1YWGO 3KLPX 4E4YA 3PK0A 1Q0LA 5FI5A 5L51A 1XWFA 2YV3A 5L7TA 4RVHA 3G0OA 1PGQA 1U3WA 3AUSA 1PJSA 3QW2A 1XG5A 4XYMA 4BGUA 3GH3A 4FR5A 4D46A 1XSEA 2YFQA 3JCZA 4A0SA 1P1HA 3FWNA 3LT4A 2NVBA 3L6DA 3OBBA 2AHRA 4R69A 1NWCA 3PZRA 9LDBA 3DTTA 4WLFA 5JLAA 2HU2A 3PJDA 4RLHA 1TT5B 3MJEA 2HMVA 4PIVA 3GF4A 2CVQA 5JAZA 4NDNE 1ONOA 3A4VA 1Y81A 2Q49A 5C3MA 5U1PA 1Z82A 2H1SA 3QHAA 2GUGA 1OC4A 3LC2O 1XU7A 3TN7A 3I83A 4I9NA 3QQPA 2B4TO 4Q3AA 3DHYA 1K6XA 2ZYGA 3DTYA 4IPTA 3W6UA 4BO0A 3AUTA 1T4DA 1LQTA 1UXHA 4S3MA 1G1AA 1Y8RB 3RFTA 3KYCA 1Z75A 1TT7A 4XB2A 3BHJA 4MVJP 4MO2A 4BO2A 1T2EA 4TVOA 3WIEA 1LDEA 4AG3A 4IM7A 2B35A 1U3TA 3S2IA 3RFXA 4B3IA 4NR0A 2X1HA 2I65A 3PXXA 4I1IA 4I5GA 5I8ZA 1SPXA 1B8VA 1LA2A 1R0KA 5COAA 3EGOA 4HV4A 4KDFA 3JQGA 3NV9A 3OQ1A 1XEAA 1H93A 3DO5A 4NBVA 2C20A 4EBFA 3BMOB 1ISHA 2P5UA 1LSSA 4A73A 3DHEA 1Z74A 2NVWA 1GUZA 1UZNA 3U09A 3SLKA 3S1LA 5CFZA 3DBLA 3F5QA 1GDHA 3RWBA 5IZCC 3PIDA 1HLDA 1BXKA 1I33A 2GDZA 3ZWAA 1IYZA 3DZBA 2PY6A 2NVUA 3ZN2A 1B8PA 3CH6A 4L0QA 4QSMA 1HDOA 4NBWA 3KSZO 4XGKA 3TZHA 1YXMA 2ZCUA 2ZQZA 4IDGA 4PCVA 3PI7A 4WOJA 5COQA 1KEPA 3ZH2A 3E6AA 3KETA 1XCBA 4KTTE 3L6OO 3TSCA 1M76A 5TS3A 1LEHA 5ENDA 1DIGA 4NQZA 3HN7A 4CODB 4PLGA 4R1SA 2FPGA 3O8QA 4D3FA 4DC0A 5IDWA 1TA4A 4XQCA 4E5NA 2PD6A 1V6AA 1ML3A 3DFZA 4E2ZA 2ZTLA 2GCGA 3EVNA 4OO3A 3RC1A 4BKUA 3GK3A 2GPTA 1CQIA 3D5QA 4CM9A 1IY8A 2C29D 3WSWA 4FFPA 3VTFA 4R16A 2O4UX 3QWBA 2UV8A 4FW8A 3V1UA 1ISMA 3PGJA 4UVDA 2O23A 3PYMA 5AXCA 4E12A 1YBVA 1E7MA 3NDJA 3TQHA 2G82A 3GLQA 3PGXA 4RPLA 3WDSA 3F1LA 1YDEA 4K9DA 1XQ1A 2RCYA 4GL4A 4KQXA 2ET6A 5C7IO 2GN8A 3JYOA 4LMPA 1VJ1A 2VHWA
chains in the Genus database with same CATH superfamily
1YQ9A 4OYLA 5D8DA 3TTUA 1N7GA 3P52A 4DY6A 4YMGA 1P0MA 3DXXA 4W5HA 3GOQA 4XIJA 4BNWA 2ILTA 3IIIA 3BRSA 3T0FA 4WJLA 1MAAA 4GOKA 5DIFA 2BMFA 2AEJA 2PYIA 3ULKA 2Y0EA 1V1MB 1ECLA 2ZAGA 3A6JA 4FSXA 4K9LA 4RORA 1PR5A 2G9UA 4O02B 4OMUA 1BWSA 2Y1CA 2IEBA 1ARZA 1R2QA 3I42A 1OGJA 3IPCA 2HWUA 4K9OA 4AECA 3THSA 1HORA 2QRVB 1ZBQA 1C9JA 2E7ZA 1GFIA 1KYVA 1W5FA 5HM8A 1VCMA 1FYEA 2BGTA 2C5SA 3OOEA 4K9PA 2P3QA 1CUFA 1X1RA 1Z33A 3P9KA 4EM6A 4PLVA 3O6VA 3K0CA 1A96A 2MSCB 5JCOC 3PLRA 1J33A 1GPLA 4XPIB 4L9SA 3FNRA 5ALHA 3A1UA 3WBJA 3GNLA 3WHLA 1P1KA 2H5JA 3E4CA 1OAKA 2Y4OA 4BGPA 1DAKA 2FKAA 4J16C 4YRZA 4RCZA 3WHIA 1Y33E 4TL7A 3ILSA 2ZSHA 3UF0A 3HBLA 4H1VA 5J63A 4ND8A 2NVUB 3ZS8A 3GUCA 5CVUA 2XJ4A 5FWAA 3PNSA 2NAFA 3QYJA 4ZT7A 2V7VA 1NVDA 2EC5A 2IHNA 1CS4C 1MC4A 1RTKA 3C24A 3O4VA 3OCWA 4LXHA 5FNVF 4AO8A 4BNFA 2A0FA 5BVGA 4LTDA 2HSJA 4LXIA 1R9NA 5BXQC 4EGAA 4EHBA 2PUFA 3D1LA 4GPZA 2GD0A 4U0KA 2AN4A 4Z0TA 1QTIA 2QPOA 3V2IA 2QW0X 5LA6A 2EBHX 4M0UA 1JT9A 2Z5GA 1BFKA 4XASA 3QVVA 1KFEB 3Q0IA 4FLEA 4HDCA 2PMCA 5C5IA 1CPYA 3S1AA 2FG5A 2DBVO 4EAQA 4PFSA 3ICOA 2VVTA 3E9NA 2P2YA 1UZUA 4O6VA 3OQNA 1J2UA 2ODBA 3BRWA 2HBZA 3H3FA 5KYXB 1DIAA 5LC1A 3RRXA 3NTQA 3TW8A 3U39A 3WLIA 4HUJA 4B43A 2Y1GA 3U3JA 3ZC3A 1THTA 1J1UA 3A6GA 1MJGM 3HBNA 3UGKA 4RCVA 4F2DA 1UQUA 3GGCA 2Z2KA 4TKVB 2Z95A 2ZM5A 1BW9A 2I55A 1L0BA 1CJUC 1QNLA 4K81B 1X80A 1YE8A 1E9VA 4M1OA 4HQKA 1U1FA 3KJNA 2A4KA 4HPWA 4BWYA 1ULAA 1QGAA 2QD2A 4HQ0A 2J6BA 3OZWA 1E5QA 3AM3A 2JGIA 1KF0A 4UE2A 3GRAA 4QJBA 2VDVE 1KZ6A 1BDBA 1RJDA 1U81A 5D7BA 4U3JB 4P3KA 4CQMB 1K06A 3JVIA 4NYJQ 5H3HA 2R0QC 5HKLA 3TQFA 4X97A 2X8JB 5EP4A 1XD2A 2YHUA 1T4MA 2DCUA 4IEEA 1IOWA 3VSCA 5HCUA 3EDYA 2P9CA 5LMUB 5KWSA 3BMCB 4MP6A 4PPGA 4MGHA 1L5MA 3D8UA 3KQOA 3J81A 5TT0A 3IQHX 2JVIA 2PGDA 4EG5A 4ENRA 4JKOA 4PZUA 1N4AA 4GOND 2FP4A 4JU8A 1F3LA 5DNWA 3V4ZA 4JBNA 1X9HA 1KZGB 4EL0A 3DF7A 2B1IA 1W4LA 2W2MA 3TAUA 2HSGA 2REBA 3OIYA 2XBUA 3BDIA 3IX7A 1FYVA 2C61A 2Q0QA 3N0RA 5EUBA 5EHQA 4ZXFA 3ZD9A 4TXHA 1RM0A 1R6XA 2W8ZA 3OEYA 2Q7OE 5CFPA 5AW2A 4R71A 2DWQA 4ZHSA 3QEBZ 1JWBB 2HPVA 5CLHA 3UXYA 3WMRA 1P6UA 3LK7A 1ATZA 4HS4A 4LRUA 5I4IA 2PZLA 5B6IA 1A5TA 2IIBA 1NJGA 4RVGA 2E4UA 2YICA 3BAFA 3NYIA 5CT9A 1OFUX 5DH9A 1B00A 4BRWA 3R75A 1I5RA 1U6JA 2FX5A 1WCYA 3QELB 3H1TA 5A5FA 1DCTA 2B61A 3PQ2A 4CL3A 2H6EA 1I4EB 1RWWA 1L5HB 1NNLA 5BOSA 1TPZA 3D7LA 5H83A 3T5BA 2B6NA 4B6QA 3QOWA 4TL8A 1MA0A 2BRUC 5K5EA 3WADA 2C1EA 1ZBDA 2AR0A 2DFVA 2X42A 1RXSA 1NVVR 3AKZA 3G0BA 1NVTA 3UB4A 2YXPX 4CQMD 1DV1A 5IK2A 3KQHA 3IERA 1WCV1 2UXCB 2I4NA 3C6KA 2O6HA 3OMLA 5TMEA 1C1XA 3UAVA 4V1CI 5L8VA 2PUAA 2XTJA 4O2BB 3P97A 4DNPA 1CDEA 1GAJA 4WBNF 1J97A 2YYYA 5KKNB 4XB6B 1BXRB 3SAJA 4F21A 3H3XA 1ENYA 4WFJA 4JJ4A 3ZW9A 2IDKA 1VL0A 3U3KA 3GZNA 3MMSA 4M1KA 1D6SA 2MYPA 4XWAA 4HZIA 4NAVA 1REQA 2ZS9A 3UJ9A 2W42A 3BIWA 3KTFA 4XUGB 1V26A 2EKLA 3KLOA 1WY7A 3MTDA 4OL0A 3CJQA 5AYVA 4MPTA 3VR6H 2WUWE 4INJA 1PR1A 1Q3TA 1GQYA 3A9CA 5A5VA 1S1MA 3A31A 2JLYA 3SQXA 2OY0A 4DVGA 3D4OA 3QLVA 3M1LA 4PSDA 2A94A 4EJ2A 3M4YA 2GNAA 2PFSA 2O52A 4KXVA 3SQLA 4RGYA 1NVGA 2NU8B 3NVDA 3DEIA 2ZYSA 3LF2A 1E1MA 4I1SA 4LPSA 4FHFA 5DTEA 3I58A 4C30A 1WVGA 2I22A 3ZPXA 2XWPA 3QWIA 3TO5A 5KNDD 2Y99A 4QICA 4NAUA 3B3AA 4QHTA 5L95A 1C3EA 3ZV3A 5H82A 5JH7A 4RHFA 1VXOA 1M72A 5A06A 3JTEA 5TY0A 5D5PA 1ISIA 5AKJA 4BLPA 3WL8A 1T1GA 2AK3A 2VSOA 1GNVA 2JGNA 2G7ZA 4A6PA 3JYHA 1AKVA 3SBXA 3ZHVA 1TF2A 2YN2A 4OQXA 3S3TA 3NW9A 5BPFA 1NXOA 5C52B 5IKEA 4N8EA 3C4JA 2G25A 4LS3A 1WNTA 2X4GA 4XOIA 3GPDG 3OP1A 2C77A 3G79A 1E9CA 1N5MA 2NXWA 4I50F 1B6RA 4R7GA 1LRLA 4HXYA 4RTQA 2Y0CA 4ND6A 2VAVA 2XCQA 3WKBA 1TNDA 1NNSA 2VTEA 2XRMA 5E38A 5JATA 5DXFA 1SXJC 1AS3A 3P2OA 1FOEB 4O4JB 3MHTA 1NSTA 3HMQA 1X1AA 1ZJYA 1A9ZA 4FMDF 1VA4A 3IP8A 3LRXA 1OQAA 4U9IS 2AR7A 2JNWA 5I3ZA 3NBQA 3UVEA 1M2WA 2EDCA 1TLTA 1QHFA 1R15A 2GFQA 1A9PA 2VBGA 2ZIWB 4O0MA 5TEVA 3UMYA 1ZGJA 2RHBA 4BPBA 1S2DA 2EW8A 3KT8A 1ZI8A 2R8YA 1K92A 3UGQA 3UAZA 1OR8A 2DPMA 4OGKA 1B3RA 2VP2A 3BWEA 4K6MA 4OFZA 5FPQA 3TFQA 3LX5A 3F3SA 1SBCA 4LHWA 1FX0A 1VG9B 2A1UA 3KB8A 2F8SA 2VCEA 1DADA 4NU8X 2P5YA 1X3SA 2EV9A 3MSXA 4RUKA 2NUTA 3G9XA 1XELA 3TMAA 3BQNB 3TQRA 4YRMA 2G4CA 3B3FA 1FVXA 2NQ8A 2VYVD 1VPEA 4RJ2A 1Z5PA 2B7LA 2EW2A 3RSFA 4CYMA 1MG5A 2XA1A 3HBAA 3ZHTA 5IKMA 1TE2A 3VPHA 3OQOA 3H11A 2NNWB 3A26A 1D5CA 3C87A 1UKZA 3KJXA 2VZEA 1QO0D 3PVCA 1I2DA 3LXUX 4EPXA 3SC3A 5JC8A 4RFSA 4WKPA 2C2GA 3G5UA 4XIFA 3QMWA 4IIFA 2RG7A 1M6VB 4TWZA 3GLUA 5IDVA 3E82A 4Y1RB 4NICA 4LF5B 4I1RA 4JSRA 4EJSB 1U8CB 5JWHA 2JCBA 2CBZA 4EA9A 3ONEA 3EXEA 4YAIA 5BV1A 3ZLUA 1YKFA 2ZJ0A 5EZYB 4CEHA 1MT3A 5IABA 3VTZA 2AFRA 1Y9EA 2BM0A 2HA6A 3Q40A 1IEXA 1QNFA 4B32A 5BRAA 3RVDA 4M0PA 4KO1S 3SBEA 3RTGA 2G36A 3DCNA 3G49A 1KOFA 3HKCB 4F1WA 3TM5A 1QVRA 5SY4A 3EVCA 3DV2A 3UJCA 5FYQA 4CLOA 3F0TA 1WMAA 5DTQA 3UA3A 3COPA 5DM1A 2QUIA 4MPJA 1W25A 2VP9A 1NBEA 3ZI4A 4D43A 4H1TA 4F96A 5E6SB 1U8ZA 3MCZA 4IKEA 4P3OA 1MIOA 1KERA 1ULZA 2V7EA 4XIYA 5E8RA 3TLAA 4E7OA 4L5BA 3AUKA 1SAYA 3GMTA 3PC6A 3PHGA 3V3KA 1TVCA 2QVXX 1R6TA 3KJFA 1JUDA 4KAXA 4X63A 4LKOA 1DEHA 5M29A 5EIEA 3BA1A 2HF9A 1D2RA 1AZTA 1FRQA 1VLLA 1T3SA 2P7IA 3H86A 4HS9A 3SZLA 3VKGA 1LK0A 5K8CA 1DV2A 5FPYA 3N8KA 2JK0A 1G16A 5C18A 4E13A 5DRTA 3AF6A 4ZVKA 1TA9A 1NRXA 3FLBA 1BS1A 2P9ZA 4OKIA 1ESDA 4V0KA 1A71A 1GNQA 1VL1A 2XD4A 3L0PA 3LQYA 5IMSA 5BSHA 4H1UA 3OY7A 1JHOA 2CEAA 3SF0A 2W58A 4RIEA 2PVPA 3RVOA 1W2WB 4FOSA 2ZVQX 1S02A 4QECA 1P1CA 3TQCA 4CCAA 1A50B 2DEUA 2BEJA 2QGFA 3ZUGA 1M0EA 1MAWA 1U0JA 3K5IA 4I3GA 4LJ6A 4TRNA 1C4WA 3N74A 3IUPA 3L1IA 5D00A 3C3XA 1TXGA 3DQZA 5C8DA 4EELA 2WG1A 1PN3A 3FPKA 2E0IA 1JR3D 1POWA 2ODEA 4R01A 3TL3A 4PG5A 4Y8VA 4BMZA 1DT5A 5DOVA 4E22A 2B78A 3ZLAA 2I99A 4UMFA 5SY6A 1KPIA 1QYWA 4JR0A 1RHUA 1EA5A 3RKRA 3TQIA 4KRGA 2P30A 2G09A 4RV5A 4BZZA 5IZCA 2Z6QA 4NZNA 1RP1A 4B9AA 1EESA 2CZQA 4P08A 4O33A 4GPAA 3A4NA 4DBZA 4OKSA 2QTBA 1ZMRA 1BNCA 2HUNA 3V2UA 3IAXA 3P2EA 1E1LA 4K3VA 1BSVA 3HYRA 2J3HA 2WYVA 1PJ2A 1ECGA 1MF7A 2V6MA 2PH7A 2VOEA 1G21E 3D2BA 4LRTB 3I0ZA 3ZJYA 5BNTA 1QF6A 2FWIA 3LUJA 2EZUA 5CTJA 3C7TA 3NONA 5BVHB 3PR1A 3VC7A 3CN9A 4FFLA 3PHHA 4YIHA 1JE0A 3R2JA 5CGZA 1Q6ZA 3JAWB 1AN9A 2H08A 2ZAYA 4JENA 3ZDQA 3KZKA 2O2GA 2ZSUA 2VHJA 3BGOS 3L6EA 1KI6B 2YXEA 4UC0A 4KLCA 4AZWA 2J3DA 5K7SA 2WB4A 1SQ6A 1J06A 2C2YA 3FPHA 1Z2NX 3CZ9A 4IIXA 1KY4A 2CGEA 3QWHA 4HQNA 4ZO6A 2MINA 2NXCA 3BK1A 4I9UA 4ZVVA 3IEIA 1IE3A 4IJ5A 3VHXB 5BSFA 4YY3B 2JFFA 4K6FA 3G8AA 5H0IA 1F6BA 2RK6A 3H13A 4GE0A 3RI3A 1JDPA 2JLSA 2CMHA 2O0JA 3RQIA 4NBRA 2XCSB 3EQ9A 1U2ZA 4WUTA 5K0FA 3GY0A 3TR5A 1W1WA 5BMVA 3TVDA 4R5MA 1GHTA 4OMFG 3V2GA 2VTBA 3V9AA 1UAGA 1P77A 3H0EA 3V97A 2VP4A 2WP8J 1QSGA 4JP5A 5FBZA 1QH0A 2CJWA 3W2EA 4AN1A 2NO4A 3DOUA 3H5VA 3HWX1 3NHAA 3WJ1A 3AR6A 5AXDA 3RS2A 3ZWBA 3VGJA 3D7RA 1Z12A 3F2VA 3F5FA 3LC7O 3VYWA 2GCOA 4K8OA 1XTBA 2VRBA 5ULLA 4HDNB 1VI6A 4IJVA 5JMPA 3SR3A 1VSQA 5CAEA 3GFTA 1AE1A 3PDIA 2C98A 3AFOA 4PXYA 2E5LB 4KFTA 2JA2A 1LX7A 2I6XA 2E55A 3TTXA 3QEKA 2VK8A 3U6KA 2XTMA 5GIOE 4QOGA 1E3EA 1E3WA 2Q6OA 2X5OA 5CBPB 3LGSA 1T5SA 4MV0A 4RV9A 2HF7A 4IDCA 4UU8A 4MR7B 4PPYA 4Y0NA 5JCJD 3GT4A 2IW1A 1U6KA 1G7TA 2JIZA 3G8CA 1AURA 3E3OA 3RH0A 4D9GA 1QR2A 3U3RA 1W93A 1E7RA 2CY0A 1R3UA 2OT3B 3I6YA 5BW8A 3KJHA 1E1NA 1KEUA 3TLXA 1SCQA 5F9HA 3IUSA 2BONA 1M2EA 3MJCA 5E7QA 4BO3A 3NHLA 4BFYA 3PE3A 2M6SA 2CVPA 2ZWAA 3K0BA 1MPXA 1U04A 2YKGA 1C4KA 5JCOA 4MW6A 3PHCA 1OPXA 5KU7A 1X1EA 4GYJA 1T0UA 4QWWA 4YRAA 4QAJA 4A91A 1PZNA 4KCGA 2HT6A 4OJNA 1OFVA 1Q0QA 2XUDA 3PCTA 5BSVA 2CV0A 2I7XA 2NG1A 2JLRA 2B3TA 1Y5LA 2QU7A 3IIKA 1WUTA 4I4TA 1EU1A 4CG1A 4DMKA 1S3SA 4J16A 5AUQA 5K8IA 3EVTA 1YZTA 2JGEA 5DTJA 2XB4A 2QD1A 5LL6P 4F4HA 4L5CA 4Q1DA 2YVKA 2CNWA 1OI7A 5TPZD 1U0BB 2C1XA 2ZXFA 3SMQA 5E95A 2PPLA 4P4LA 1JSXA 2G5CA 2GO7A 3GLVA 2OSBA 3OJEA 4IXMA 4MDYA 4MUAA 3WYCA 2VQDA 4ETIA 1XWWA 3ZCSA 3U4IA 1E1DA 1JEDA 4YRJA 2V4MA 1Y3DE 4X1OA 2QXUA 2VUIB 2WZCA 5EA2A 2IPMA 3DE3X 4JKIA 5BORA 7REQB 1D0IA 5KSWB 1SN7A 2VJPA 2ONZA 3SGLA 2NZVG 2VRWA 3R7NA 2V6IA 1O7JA 1YNOA 5G53C 4N40A 3ZGYA 1TIKA 1CY0A 1V41E 4NL4H 1TQ4A 1BE8A 4B6OA 2RJOA 3ABZA 2IZ6A 1GGNA 1SGWA 1K88A 2YYAA 2ZJZA 2Q62A 2PBRA 5FHRA 1GKYA 1IZ9A 4L2IA 2F1RA 2ZRLA 1TQHA 2GZDA 3OCXA 5HIMA 2A84A 3C4VA 2K2WA 2CXQA 4FYXA 1H4TA 1F2VA 2UDPA 2ZB8A 3B1VA 5CB0A 3AL0C 2JD2A 1RU3A 1N7IA 4GBED 3SDBA 5TT1A 5CPBA 3L6RA 2MHCA 4E1BA 2CE2X 2D3WA 3OM8A 3Q9LA 1FFXB 2I8AA 2H65A 3KOYA 1O87A 4J75A 4M1EA 5HIIA 5AVWA 1EE1A 1IPHA 1W49A 1JFFA 2P6PA 3AIOA 4H4EA 1SBTA 1EG7A 4OHCA 5CX1A 4X7RA 3B1KA 1H4SA 1Y1PA 2C78A 5JQGF 1JU9A 1YRAA 4ABTA 1Z38A 3RIMA 1QFXA 3C3WA 1Y6ZA 3FNEA 4FUTA 3L77A 3LQRA 3A4LA 2FMHA 2BMEA 1FDVA 2LV8A 1OHHD 5JANA 4DN6A 4NDAA 2JZNA 2OCDA 3TOCA 4UTNA 3RSHA 3TE7A 4FFWA 3JSAA 3ONNA 3HKBB 1T25A 1D6MA 3AHIA 3M9XA 4KSCA 3NHUA 3ZI7A 2A14A 1GZSA 4LBZA 1PDOA 4P36A 3M6MD 1LBIA 3CKLA 4AZ0A 1UJ6A 4V38A 1T1RA 3MG9A 2D06A 4Q1VA 1V1RA 2YN0A 2IPAB 4F46A 3OHPA 2WJJA 2BM9A 3B89A 3UMVA 4YBZA 5LMNB 4B6PA 3KTDA 1M2FA 2DAPA 3ZTWA 4K6KA 3ZJ4A 3E9ZA 3N7UA 3ZQKA 1Q12A 1R6BX 4DG9A 2IVZA 4C7XA 4TN1A 5EUMA 4CKBB 3IMKA 4E3ZA 4PX5A 2HD4A 2NPOA 4N7BA 5EQTA 3WTCA 4BGEA 2UYCA 3WNDA 1FXUA 1M2HA 5CNKA 1EHIA 1U7HA 2JAHA 4K9SA 4NZ9A 4L6CA 2WAAA 4YPFA 1YB5A 1YZQA 3EIOA 3K2EA 1OD6A 3RIEA 4QBHA 3UOGA 4A92A 4CKXA 1HQYE 2QM0A 4UEKA 1F7VA 3AF0A 3STWA 4QTTB 1DOZA 3E0XA 2XI4A 2PSHA 3WOVA 2GXUA 4LF7B 4JAVC 4LYJA 2Q3MA 3GCZA 1GYQA 2FEWB 2JLWA 5L45A 1NHWA 4JA2A 5IJ0B 4EX7A 3OC0A 1CCWA 2I76A 5BYJA 1A2QA 1P73A 3WDMA 2VPIA 3AXSA 1J9GA 3RS5A 3G82C 3EUWA 1IXSB 1E6MA 4HZUB 5JCXA 2HCTA 1F6DA 1FW8A 3JYQA 1KK1A 4HLNA 4CCSA 5C81A 3ND8A 5K0BA 3VR5A 3J7AC 1KO1A 4D4KA 2C99A 2H7YA 4HRYA 2ONYA 3JRWA 3ZKWB 3WO1A 1M1ZA 4XR4A 4OA5A 2O7VA 4FR0A 4K0RA 4C21A 2YIJA 1KK3A 1D2AA 3OE1A 3VVLA 4GOMD 5KTMA 3AI2A 3LX6A 1N3LA 2B1JA 4PPQA 1UAAA 3M9LA 3N7AA 2F3SA 2DHDA 2VT6A 3AW9A 5M2QA 2G4VA 2XCIA 4DIDA 3RYTC 2IZ0A 3TR6A 3CXRA 3P9NA 3K94A 4KIUA 2H0QA 1BX0A 4HH1A 1NW9B 5LD2B 4C2UA 5TPWB 1FVOA 3CLSC 4J0FA 4AYTA 3COJA 2RJ3A 1N0HA 3KUXA 1RYDA 3FOAA 1GQ2A 3MAJA 2JATA 2WABA 5CT6A 4MUEA 4EB0A 3WAGA 3Q4GA 4KO2S 1YQXA 4MMXB 4BZXA 5KSOA 4XCXA 4I6EA 4BFXA 1IAQA 4PHFA 4NONA 1SHLA 3GLGE 4AC9A 1TLLA 1UZLA 3RC3A 4BU1A 2YZKA 2WOJA 1JPUA 3RV3A 5AJVB 1VI5A 4BLOA 1V16A 4LDZA 5LZ9A 3U44A 3FNBA 2RJNA 3GLSA 2G6TA 3F9IA 3SBOA 3NJ8A 4DTCA 4ZJUA 3UGJA 5C51B 5F3DA 3PNYA 4L0MA 1ZISA 4BNUA 4CDGA 3IEXA 3IALA 1W5EA 2Z4RA 2ZJOA 5GPBA 3B85A 3BBPA 3GU3A 5KJCA 5G4KA 3IL2A 3ODPA 3CUSA 2CNNA 1W85A 2YL2A 2L2QA 2W6QA 4KKVA 2QUHA 3H75A 1LC3A 3WLSA 1RZRD 1KRWA 3GDGA 2IRWA 1T6XA 3CLHA 1I7SB 1DKUA 3LCVB 1F3OA 1FQWA 1TRHA 3AJ8A 4PXAA 1QDLB 4JJ8A 2WE8A 3F4BA 4KK3A 4PSAA 2Y76A 2I8LA 4PRYA 3HDHA 2JHAA 4FLMA 3UV7A 3NDBB 4A3SA 4GNRA 3CGWA 3EVAA 2OFWA 3HG7A 3BOSA 5L7YA 1IZ8A 1RCFA 1TEVA 4EUHA 4IMIB 1FP4B 4TTTS 1BYUA 2ZZNA 4FYHA 2OAQ1 4M37A 2WD9A 4ARUA 2RGDA 3M1AA 2WWHA 3U81A 1P91A 4TVKA 4HAUA 2O0MA 4L5JA 5FI3A 3ASYA 4ZRMA 3O95A 1OMOA 2Z09A 1R12A 5CA1B 1GNLA 1NJFA 1D2GA 3B12A 3ZX5A 1MA3A 2ZB3A 2XUKA 2R1UA 2E6KA 4ZAFA 4TUYF 2J0EA 2M6KA 1OZGA 4XYGA 1HEIA 1J7JA 3LT5A 4YV1A 5T7BA 2CUZA 2B9EA 1H3EA 4V3CA 1V7QA 4BMSA 4OXNA 1JRLA 3D3WA 4M36A 4P1ZA 4ZC8A 4DCTA 1MJ5A 1I4TD 3IESA 2D13A 1O3YA 4EW6A 4Z0PA 2I2BA 2GTPA 4HEA6 2VFAA 2V45A 4G2TA 5LOVF 3E05A 3QTTA 1DWQA 3V8RA 3OUUA 1CUJA 4GVLA 4EO9A 3T7KA 2QM7A 2ONKA 5K3BA 4GKVA 2W8BB 2OP1A 2B30A 1SCIA 1G55A 3WGHA 4RTKA 2NTYC 1HMPA 1UJNA 4XTCS 1UWLA 1EVKA 3SNHA 2QVCA 2BV3A 3I9V1 3JVVA 4NOMA 3S2FA 3AEKB 1PR6A 3LBAA 4FEAA 3BZWA 3RVLA 2XLCA 3DAPA 3DDCA 2GLTA 4GZ3A 4YAJA 2X6TA 2XUIA 2YV5A 1A4XA 4U2GA 3TD9A 2Z04A 3F1KA 3G7NA 3K8OE 3S8MA 4W8GA 1XZEA 3NR2A 3RS0A 4RKFA 1YJBA 4AO7A 2P2CA 1JHRA 2EFCB 1RYYA 5GJWC 4Y1EA 3V8EA 2R87A 4X6UA 3CY6A 3PUVA 4ES6A 3DMGA 2IOHA 4HRXA 2C7VA 4QDTA 2H7VA 4AVYA 1WXHA 2FN3A 4LDPA 2EGUA 3K31A 4P83A 5IMBA 1U5BA 3I0NA 3QJYA 4K9MA 3CCBA 3AF5A 1L5OA 3EXFB 4KL8S 4UD6A 5CCBA 4KBGA 2JJ2A 4RJJA 3T95A 3EDMA 1GGHA 3L8HA 4UHDA 4DUPA 2OMKA 4J0DA 2IXBA 3CB2A 4EF5A 3DFKA 3LGAA 1HF3A 1N5LA 1WMBA 2POQX 4FSDA 4JLDA 2ZRKA 1NOIA 4KQJA 4PNHA 2JGJA 1PG5A 4P5PA 1YS9A 5HSGA 1C0LA 1EZ4A 4I1YA 4NCXA 3ZGOA 1QWSA 1TO6A 3RYFB 1NX9A 2FUNB 2MWMA 5BSRA 1PT7A 5T4FA 1ZXLA 2PHZA 2RGRA 1NI4A 4U4AA 4QJIA 1JDBB 5AP9A 3DD1A 3ZZ1A 3R5JA 3R76A 4F91B 2BI8A 2IYOA 4LZAA 5IXSA 2C2MA 4JH0A 2WPDA 1R4MB 1FJXA 5HQ3A 5JFOA 2QRJA 4J0EA 4LYDA 2Q1TA 4UD2A 1SCKA 3T0IA 5IJ9A 3AZPA 2CWWA 2PUHA 2E85A 2OV1A 4KDCA 4TLEA 3RFFA 2HOQA 3OICA 1HDEA 3R41A 1SCUA 4OQNA 1P18A 4I9HA 1OVMA 2PTGA 3KKNA 1O9GA 3PRYA 4UNQA 1WP9A 4Y2UA 3HRHA 5CA0A 2AGVA 4ER7A 1VHDA 4UAGA 4DXDA 1F0KA 4MR9A 4Z9AA 3D2CA 1PNOA 2C5FA 4ZAWA 5HFNA 3VX3A 2PLRA 2A9VA 2N1MA 3UM9A 2VQ6A 1YDWA 4GKBA 5AM0A 4E15A 3S55A 1AUVA 3TTSA 2DERA 1E4EB 2DR3A 2ORYA 1CJCA 2XB9A 3PDCA 2C5EA 1SXHA 3ET4A 3FFXA 2GYVA 4R8VA 4MRSA 5BQFA 1JJBA 1S9HA 2CLFB 2IUFA 2PZJA 4Z99A 4YWJA 4AMZA 2XXAA 3ROKA 3NHSA 1H9AA 3GN2A 4B74A 3I2GA 3RGWS 4JLOA 2TECE 5TMBA 3R3XA 1L5NA 4CEJB 1VZ2A 1OVGA 2JFZA 3AM5A 3GFBA 5E1BA 1R64A 4JFRA 3WXBA 2BEUB 1PD1A 3FTQA 4CLDA 4QG3A 1TYDE 5JPDA 1V5EA 3F7OA 3H83A 5EEHA 3A6EA 4C4YA 3A1SA 3JYPA 3I52A 3QUCA 1NATA 2EZ8A 5FL3A 3WLFA 1OU0A 1T0JB 1P3DA 4U1RA 4ZI3A 5JE8A 1B3BA 3GVIA 4OMCA 4WZBB 1G2OA 2BEWB 3TAHA 1UT8A 4G1FA 2RC6A 3Q3GE 3M3DA 3THOA 1EIWA 1BD4A 1Z73A 1ZI6A 1ZZEA 3QLUC 1I3KA 1GPJA 1YGPA 3U4AA 4AKGA 4IFEA 4FFVA 4MV3A 2W2LD 1OXXK 3X1JA 2HJGA 4P4TA 1JVNA 2IT1A 1UFVA 4L0DA 3R3JA 4HBGA 4M8SA 3QEJA 4Y9SA 1H4QA 1Q7EA 5F1PA 1OWOA 2VSQA 5AW8A 2DFTA 3U7HB 1F12A 4NFHA 4L28A 3UIEA 2O2YA 2V7PA 3OF3A 4ZYTA 1TIBA 3TLGB 3ZOZA 4IQ0A 2MJLA 2ZSAA 2X5KO 3BF8A 1J1IA 1P9RA 4KNVA 4ZYVA 1N6LA 4BNDA 4JX8A 1KJNA 3IOCA 2LVBA 1KPHA 2FSPA 4NJMA 4UDOA 5AW0A 3HNOA 4IVNA 1UXKA 3PC8C 3QPWA 4KQGA 1Y8AA 5FLEX 2NXNA 2ZIXB 4BO6A 3S6JA 1HT0A 2CVZA 1EX6A 3HHEA 3VNSA 1NDUA 1C14A 1FE8A 4CTMA 2Q2OA 3D3QA 1RYBA 2B2NA 4J3FA 5ERGB 3AFIA 5AIAA 2ECOA 5EL0A 3R7SA 4YASA 3RC8A 1XEFA 4KJZA 1RHRA 9ABPA 4UAVA 3H84A 2IUYA 1JDTA 3IPAA 4RDCA 1QP8A 2EATA 2JHCA 4B3BA 5BWNA 1WUIS 1QRAA 2G06A 5CT5A 1LPPA 3ZDYB 4HX5A 1CNEA 1Y3CE 1XXHE 1C3XA 4HD8A 3SEZA 4MR8A 2XUGA 3WLNA 4CF5A 2VLIA 4Q9NA 2W2NA 1E1KA 1S2NA 2NX2A 5L3ZA 1EE2A 1RQLA 3PNVA 3ST7A 1H3NA 5BSWA 2JL1A 2M1ZA 2VI5A 5GM2A 4B34A 1FLDA 4R4JA 3RKUA 2IODA 5CYGA 4HJXA 2DFPA 3MXTA 2H2GA 4MYCA 2V55B 3ZWYA 2A58A 2Q0XA 3VDNB 4GP7A 1JPVA 3Q8WA 1KMIY 4K26A 4L95C 4TRRA 3AONB 3M9WA 4AULA 2WLSA 1AS2A 4I8XA 1Z6TA 1Q2UA 1ZH8A 2QRLA 1FYXA 3UK0A 3P0EA 3RGGA 1G60A 2YINC 4E6PA 3U80A 3OLCX 2R4UA 3W3AH 2O8BB 2BDUA 1KXZA 1PFVA 4XA8A 1F1JA 1P1JA 3WWPA 1GPNA 1ZESA 1IUPA 3LF1A 1ANKA 1UWVA 3P0HA 1QH1A 4ZQGA 4WA8A 5EIBD 3BXOA 3NNSA 3OA0A 1SXJE 3GEBA 2JGMA 1HRKA 2P2ZA 4GR4A 5DBFA 4B8WA 4YREA 3SHWA 2WJVA 2JIQA 2X19A 5F3WB 2BGRA 4PZPA 2N75A 3MRVA 3WYAA 4WKNA 4KPFC 1U7PA 5T5QA 3AMVA 4Q15A 4DCOA 4ENVA 3OQIA 1RFLA 1I7DA 2PD3A 2C8JA 1F8UA 4L5IA 1SCBA 3H9QA 4MTLA 1T6ZA 1JSZA 3WK8A 1WQ4A 2RGWA 4NV3A 2ID9A 2D4HA 4ATNA 1RAGA 1T9GS 3DB2A 1T35A 1V3UA 4DSUA 4XWOA 4XIGS 4R05A 5F21A 5K9ZA 5LSAA 4GU5A 4JV5B 3GV0A 4ZJZA 5B7NA 3JQBC 3H1AA 1TOAA 3QVUA 3GBVA 5AJXA 4D8WA 3CE6A 3VZBA 4JYMA 5DHTA 4OX9B 4CM7A 3R74A 1KQPA 4HDKA 1VJCA 2IDZA 2RKOA 1JJVA 1G66A 2WU4A 5H59A 1QRSA 3GBSA 1WCIB 5IFKA 3T4UA 1RPAA 5AKIA 1VL2A 1EFCA 4RNDB 3VKFA 1RRPA 5JTTA 1H1DA 2XJ9A 3PZBA 2G9ZA 5FBVB 3B36A 2WTAA 1NQWA 1QRDA 3N39C 1L4NA 3T38A 2GSDA 2FUCA 1QHSA 5IYZB 3CA8A 4Z4EA 3MCWA 3L92A 1RP7A 4JK3A 1LJLA 1RBYA 1MJNA 4TTRA 4WNAB 1Y9JA 3JVDA 5WRFA 2C8KA 3AR9A 2ZSEA 4XKJA 3JARB 1V4NA 3KKOA 4UXHA 5KKAA 3T7DA 4OUKX 3PQ7A 1STOA 2PZMA 3QUAA 1TC1A 1XZKA 1ZNWA 3C5CA 1SBNE 5JARA 2R2GA 5AKGA 2Y9PB 1I0IA 2FN8A 5J4HA 3MGAA 1Y5IA 3QKTA 2GAOA 4IJKA 3QE4A 4US1R 4CI0B 5BNWA 1N36B 3I2JA 1POXA 5C3UA 2R6CA 2F1OA 4P3YA 3KB2A 3P0IA 5ICSA 3PG5A 5JW6A 4R0MA 3QVKA 3QX3A 3HYLA 1PQUA 4IR7A 1KDYA 3VVBA 3NRJA 3F6YA 1CUHA 2C2WA 4IEFB 5EKTA 3PX2A 1YASA 4PVDA 2JJMA 1USGA 1AUQA 1YTUA 5JAMA 3ZXIA 1GL3A 5HK8A 3VC1A 5CBKA 3AG6A 1XTTA 3FYHA 4NX2A 1NHGA 2FXIA 2QTHA 3CE9A 4KQHA 4TSRA 4DW8A 4IGEA 3D2AA 3DM5A 3WFIA 3D3NA 5KDDA 3HCRA 5KNBH 1W87A 3C7AA 1THMA 1QU2A 3JQFC 3H6KA 3LLMA 4J2HA 2HMUA 2Y71A 3E5NA 4QTUB 3D3EA 4J6FA 3PGA1 1UM9B 5JS8A 3MQ2A 2P7HA 1Z37A 4EQ6A 1VGQA 3GA7A 2GF2A 1CLUA 1DXHA 2ISCA 4G5FA 1K4KA 3B9QA 3WIOA 3X3HA 5EJ7A 5AW6A 3I04A 2ZR7A 2EGGA 3IP7A 4ZCMA 3QOXA 4I1UA 2DKOA 2PS0A 3OLXA 4Q9LA 4YRBA 4IOLA 3LMKA 1GEEA 4EF6A 1D9ZA 1FSPA 4BO7A 4L3VA 3E35A 5GVRA 4I66A 1PT9A 4O2BF 3HZHA 3MMXA 4J29A 1J2JA 2PMFA 3FCEA 5EMKA 4BO9A 2FZ4A 4CKWB 4N0DA 2A1TS 5C7OO 3RVMA 3IJEB 4DQXA 4ICIA 1M75A 3LNCA 2YJGA 3S1SA 1P61B 4UTZA 1DDOA 3EODA 1KVTA 4IF4A 2QYHA 1QVVA 2B2CA 1CJKC 1K6JA 3KDPA 2NIPA 2JFYA 5A9RA 3R9XB 1JAIA 5ARCA 1NNEA 2R8EA 2VJNA 4BVBA 2HCFA 1K6IA 2QSZA 1E98A 1XJQA 3BE4A 4RS3A 3KQLA 2J87A 4R0NA 1O8BA 1NU6A 2OZLA 3EVDA 4DM4A 1DP4A 2QMZA 4QVIA 3RNLA 5JXHA 3B8HA 2V98A 3DTVA 3KO8A 1E2MA 1XEXB 2BE9A 4O1MA 4O25A 4OYRA 2BBSA 3TWOA 4RTJA 3N76A 3LPNA 1UDCA 4FJ0A 3LH5A 2PZFA 2PKQO 3LCRA 3V9PA 3ZQUA 2QSUA 2VF2A 3BJIC 3VTKA 3H2IA 1KL7A 1E8MA 1XU9A 5FNVA 4B79A 1ONBA 2GS9A 4MK4A 1OZHA 2H2AA 7MDHA 1BX3A 2DFKB 4LISA 1Z4OA 2XCUA 1IY2A 4PLTA 2IFTA 3T54A 5JXJA 2YNMD 4ZZ1A 3SFVA 1Z7EA 1XOIA 1IFXA 3QEMB 1EUYA 5KTSA 3FN4A 4UUPA 1ZYUA 3DC7A 4TXNA 5FLKA 4XDZA 4XGIA 2YOGA 2YJ5A 3EISA 4J1SA 3FKQA 1D4OA 4ETWA 2WJGA 4MUNA 4YAOA 4ALLA 3FWPA 1C80A 3LKBA 2D54A 1KMQA 5DTMA 4AMUA 1EEHA 3Q7PA 3AP2A 2QN1A 4HRAA 4Q82A 3ROMA 4QTXA 4AY4A 3I5YA 4HQRA 1V35A 4O4JF 3CJTA 1FNSA 1K2VN 4BFVA 5K8LA 2X5NA 3QKRB 4B7CA 1FZQA 4IS2A 5BN4A 4CMIA 1EUCB 3QYAA 4EY3A 4I1VA 3WL3A 4BLWA 3JALA 3CINA 1KI3A 3HCBA 3THYA 1V11B 4J9VA 5JFTA 3O38A 1FRZA 3NVKI 4NBKA 3K16A 4F5ZA 2GETA 2IY8A 4AP9A 4C7OA 2X1VA 1I0LA 1GSHA 3A2NA 2EZ4A 3OJCA 5IF3A 4B35A 1VKRA 2HF2A 4OSPA 3S29A 3UB3A 2WYUA 1SRQA 3X43A 1J42A 5BSMA 3C39A 3EDOA 1W4RA 2NPFA 4YRPA 4DE5A 3ED1A 5MN6A 4I3HA 4UJ3A 1L4EA 1BOOA 2GN2A 4YJFB 4D3DA 2ZBPA 2AZTA 1K8RA 3EZ2A 1XQ9A 5ILGA 1GP2A 2BLLA 4Q48A 1BXGA 2GVNA 4WD3A 3UCFA 4BFZA 2D0PB 3TECE 1GD1O 3HGTA 1ESZA 1VE6A 2BFFA 3K6JA 5FRDA 3A36A 2J8ZA 4QGBA 3IV7A 4IJWA 4NS4A 5HKAA 3R3YA 4HWPA 3PWKA 3B6EA 1OXMA 2EQAA 2JGDB 3A1CA 2H2FA 1NPYA 2PIDA 1TECE 3SSNA 1IUOA 4YA6A 4RA6B 5BNZA 3KEOA 5KVVA 4RHUA 2GK6A 2DY0A 5ALXA 2V6BA 1FVHA 3COWA 3A9WA 3A1EA 5ELLA 3D3JA 1SA0A 1U0GA 1NBIA 4K46A 1E92A 1QHYA 4YRQA 5ED4A 5EZYF 2EIHA 3U56A 1QFYA 3QMPA 3D64A 3D6FA 1KH3A 1ZN9A 3HGMA 2PBLA 5HM6A 1DTWB 1E99A 3HN2A 2JJ1A 5H1YA 4N18A 5ALWA 2RHOA 4UULA 4RSRA 2R6DA 3HUDA 3RAEC 5ICEA 3TVYA 1HEYA 3EEIA 4CMEC 1HH4A 1GKIA 5FL7A 1D8TA 2ZZMA 1C9YA 2H4ZA 4X1IB 1N8KA 3T5CA 4B82A 4XWWA 3MGBA 2E89A 1JZTA 1L5RA 2J7PA 3FPBA 2YY5A 3B1WA 4JCOA 4QPJC 4TKMA 3UO8B 4Y6SA 4EITA 1KZ9A 1C9DB 2ZUFA 4I99A 3K9GA 2FHSA 2FQWA 3DV0A 4LOHA 1DKPA 1WKVA 4OJTA 1WXGA 4CR6A 3M4JA 4EKYA 3BE6A 1SIUA 1IQPA 3ZWQA 4R2XA 1EXMA 1ORVA 2BFOA 4NG5A 2ZTSA 3G7SA 2ZUTA 4F7DA 2XA9A 2YZNA 1U3GA 3PFIA 4LJRA 2MSDB 1T4BA 4EMTA 4WBNA 3DAYA 2PKXA 3LX4A 2V58A 1VJGA 1PNTA 1RJ9B 1FSGA 1GRVA 1KVSA 1XZMA 4GOLD 4GVXA 3ZDRA 4CT5A 2OPHA 3A9UA 2CLCX 2G8NA 1UKEA 1VG0B 2OKCA 1E3SA 2HBYA 1QLWA 3BWVA 3GPBA 4IYRA 2EHJA 4D99A 4N8DA 3AFNA 5T4BA 1BCSB 3CVJA 5CUQA 4WY2A 3E5MA 1QX4A 4BB5A 3FDFA 4ESVA 4XCQA 1EB8A 1HEUA 2QW1A 4HO1X 1CERA 3KSAC 1X1CA 1NA5A 1JIJA 2YOHA 5KQPA 4COKA 4KB5A 1LVHA 1PLKA