1Z74A

Crystal structure of e.coli arna dehydrogenase (decarboxylase) domain, r619y mutant
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
342
structure length
326
Chain Sequence
b'RTRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVEHYKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein ArnA
publication title Structure and Mechanism of ArnA: Conformational Change Implies Ordered Dehydrogenase Mechanism in Key Enzyme for Polymyxin Resistance
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 326
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1z74A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1z74A02
5EPOA 2CDAA 3V1TC 3T4XA 3WGIA 4CM3A 1LDEA 2CDCA 4NBWA 4U6SA 9LDBA 4PZEA 1TA4A 3FN4A 5B4VA 1V9LA 4UVIA 3SEFA 2QIOA 5AOVA 1IZ9A 1IPEA 1SMKA 1EFKA 3QVWA 1VPDA 4JBIA 2HMSA 1I2BA 3LSYA 3BMOA 3H3FA 4OAQA 3JYNA 4W9NA 5JO0A 1SEVA 3H5AA 1BWSA 1HETA 2GGSA 3AUTA 3KZVA 3PJGA 1IB6A 4XRRA 4Y6SA 4NR0A 5EESA 3Q11A 4W4TA 4G2NA 3MTJA 1GPJA 3GRPA 3EY4A 3KYBA 5BNIA 1VM6A 3CMCO 4IJKA 4TSKA 3V2GA 2X0RA 4DYVA 5THQA 1G6KA 3H65A 1WDMA 1BRMA 2OHXA 3E1KA 3H3JA 1HDCA 2ZQZA 5BSFA 4LGVA 7MDHA 1B8VA 1PZEA 4IMPA 4PGFA 1MXFA 3GVPA 3PJFA 4YAIA 1P1KA 1RM0A 3PXXA 3W8DA 2AE2A 4K1LA 4J1SA 4OO3A 3ZZNA 4R51A 1EEHA 4UUPA 3SBOA 2YHUA 3T7CA 2JFGA 4GLOA 2EHDA 4OHUA 5FI3A 3BTVA 3RQSA 1U7TA 1HLPA 1SPXA 2GO1A 2Y1EA 1ID1A 2HK7A 2Y1DA 4HKTA 4B8WA 3A4VA 3CKYA 4RQTA 3AM4A 4PLFA 5KIAA 2NV6A 1XU7A 4AICA 5EQFA 4O6VA 4XWYA 3G1UA 3L6DA 4R1SA 4DC0A 2R00A 5TT0A 1LXCA 4PIVA 4E4YA 2B35A 5DDIP 2X0IA 3EZLA 2OBNA 1K5HA 3TJRA 4CQMD 3HWRA 4QO7A 3KSUA 3E5MA 3NTOA 4KQWA 4NBRA 4WCDA 4DPKA 5DULA 1BVUA 3UN1A 2O7SA 2FPGA 1DC3A 1A27A 3GVXA 4MVJG 4BQPA 3U62A 2VT3A 3Q9NA 3RBXA 2Y05A 3TZCA 4I5EA 4IJVA 4BNMA 4PFJA 1PWZA 1DAOA 3RIHA 3I4CA 3MJTA 1B15A 3ROQA 3A06A 4C7KA 2WSBA 2Y99A 3E8XA 2Q2WA 4OXKA 2O48X 3CSDA 2Q1WA 4DRYA 4PLVA 3U9LA 4GX2A 3MJEA 5AXAA 4NH4A 4CR6A 4HUJA 4YAKA 5ADHA 3B1FA 3DOJA 3JD0A 1WPQA 4U0KA 4YQZA 4J4BA 4IIVA 2HK9A 4FIZA 1ISJA 2X0JA 4WEQA 4WOKA 1CEQA 2NM0A 5G0VA 3WYCA 5BSEA 5L53A 1WW8A 5CDTA 1LSUA 2Z1MA 4NZ9A 4XYMA 3W1VA 2W2LD 5DF1A 5FF9A 4DREA 4IBOA 3DMYA 3E48A 4D0SA 4RDHA 4XB1A 3OIGA 1DAPA 4E31A 4GSLA 1PS8A 3JD1A 3ZWYA 3DO5A 3CXRA 3LQFA 2G1UA 3VZRA 5BSGA 1LJ8A 5JCXA 4CMHA 2YHIB 3GK3A 1LLDA 4CV1A 3ST7A 5G4KA 2EKLA 2D1YA 5ENVA 4UAGA 1E7RA 3GVCA 3IQDB 5DCWA 3INRA 4ZRMA 1GR0A 4F3YA 5ITVA 2PNFA 3BMCB 1ZMOA 2ZYAA 3NRCA 2P5YA 4NPCA 3TSCA 4CL8A 3T7EA 2PH3A 4PLGA 4WLFA 4FFLA 3EUWA 2X6TA 3WGTA 1PGPA 3L77A 1U9JA 2SCUA 5A3VA 4BKPA 3EVTA 1UDBA 3RSHA 2DPHA 3QSGA 5MDHA 5IDYA 4LVUA 1ULUA 4D3FA 2WYUA 3ZWMA 5JAZA 3OICA 4AJJA 3TDKA 3H7AA 3GG2A 1IULA 1E6UA 1E7YA 2D8AA 3U0BA 1JVSA 4OKNA 1CQJA 4LCJA 2JJYA 3UHAA 3NDIA 1YBMA 2HCTA 2P91A 3FNFA 4W82A 4B7UA 5JDIC 1U3VA 1XHLA 4RZIA 4Y98A 1M6HA 4NI5A 5C7OO 1ZSYA 3DC2A 1DIAA 1XSEA 3CMMA 4WLVA 4EDFA 1O5IA 4KMSA 3HDYA 3WSVA 1ENYA 3WYBA 4YRDA 5CG2A 4RPHA 4PN3A 2X4GA 1X0XA 2NU9A 3PHIA 2TMGA 1YONA 3BMQB 4RF4A 4OOEA 1YVEI 2DTDA 4CMEA 3IC5A 1YOVA 4YEDA 4I1IA 2DAPA 3PYLA 4ND2A 1IL0A 2EF1A 1PJ4A 5AXBA 1UUFA 1KVTA 3HUDA 1XKQA 3EMKA 4J0EA 4BOYA 3NJ4A 5ICSA 1ML3A 3AWDA 3WICA 3BTOA 4J91A 2QHXA 4P4NA 3WGOA 4B3JA 4XKJA 4XGKA 1O0SA 2P9EA 2CY0A 5AXDA 1R0LA 5B4TA 2ZJ0A 4O5OA 2B5VA 2Q4EA 4XX0A 3OEYA 3TNLA 2B0JA 5I7FA 4BNJA 3JQGA 1T2AA 1ZFNA 3VPHA 4F6LA 3DOOA 4CLRB 5KWEA 2DT5A 5A5FA 3D7LA 4M89A 2NACA 4Q3EA 4E5NA 3LT4A 3HQ4O 2EKPA 3CE6A 1S6YA 4M1QA 5F5NA 4YT4A 3FSRA 1GUYA 2HU2A 1LQTA 2W2LA 2NSDA 3AOEA 4NNJA 2VN8A 4N5NA 4IINA 2VHXA 3H9JA 2VYND 4QECA 3LK7A 3I6IA 5H83A 5CDYA 1DFHA 4ZQGA 4EITA 1SO8A 3HB5X 2HUNA 5L7WA 2IRWA 1CF2O 3NYWA 2UAGA 3IUSA 1WNTA 3B70A 4DC1A 1HZJA 1WMBA 2FR8A 4ZA2A 1QLHA 3KLMX 3NTRA 1YWGO 5EN4A 2X1HA 3MWDB 4YA6A 5A03A 1D8AA 1UP4A 5L40A 4HFNA 2A4KA 1JN0A 3HB4X 4AJHA 4BGVA 3F4BA 2Q49A 3P19A 1R16A 3H5NA 3KM0A 3LC2O 3WIEA 2GN4A 1WXDA 3JYLA 3KUXA 4AJNA 1FJHA 1KIFA 2R00C 3VOSA 4HWKA 3U4HA 1BW9A 1YL6A 1I01A 4WEOA 5K6AC 4WPGA 4BO9A 1GADO 1P1RA 4NG5A 3LU1A 4Y67A 5L4SA 5DCUA 1KVUA 1P1FA 2VNAA 4OXNA 3TZ6A 4ALMA 1UDAA 4J2HA 4PLTA 2O3UA 3QVOA 1QV6A 4J7UA 4TRNA 4MP6A 3UICA 4JXKA 3NX4A 4W7IA 5T6BA 3MWEB 4HFRA 5LDGA 1J49A 4DPMA 3I52A 3DAFA 4CLEA 1HTBA 3KEQA 1E0DA 2Q1UA 4JX8A 1JTVA 3ZV3A 4BNZA 1NQ5A 4ND5A 1Z75A 2B4RO 4GLLA 1ZK1A 3NDRA 4OQYA 4RVSA 3I1JA 4YAEA 3DTTA 4EJ0A 2GZ3A 5EINA 4XR9A 1C0PA 3OF2A 3UF0A 4NK4A 1CRWG 1UAGA 2CNBA 3H8VA 4FFPA 3RC9A 2ZQYA 4BMNA 2X23A 2AEMA 4WLUA 4CM6A 4BNLA 1TLTA 3RUDA 2DKNA 4ZQFA 5C7LO 3BA1A 1U2GA 4MVJM 2C59A 4D79A 4CLDA 3VVBA 3PEFA 3UOGA 2P68A 1EZ4A 1YQGA 2O4CA 5CP8A 1X1EA 1SCUA 1ZIDA 3SJ7A 1CWUA 3GPIA 1SZJG 1N7GA 2ZIZA 1UZLA 3H5RA 1DXYA 1I24A 1JA9A 2E49A 4I9UA 2QYSA 3ZWCA 2BD0A 3E18A 4DMLA 3WGGA 1VL8A 1YO6A 1KY4A 1N2SA 5JW6A 3KXDA 4R41A 3LF2A 3KBOA 3V8BA 2R2GA 3N7UA 2J3KA 2J3HA 3ZNQA 3P2OA 4YXFA 4Y9DA 2WTBA 4M87A 1HZZA 3ICCA 1B0AA 5HBRA 2NU8A 3ZWVA 4S3MA 4BV8A 4XYLA 2VYNA 3AUAA 3IKVA 1HSOA 3JCZA 3HN7A 1HEUA 1G1AA 1WMAA 2PY6A 1LSOA 3T4EA 2UDPA 2Y0CA 3V2HA 3JD3A 1MC5A 1M76A 1NPYA 2JD1A 1JVBA 4KUEA 2YHIA 2BELA 3AFMA 2JCXA 5G0SA 1NQOA 4MKXA 4TRJA 2X86A 4OJNA 5GMOA 4Z9YA 3GNTA 1JKIA 1BDBA 4OSOA 3RU9A 3OA2A 1E92A 3ENKA 4KTTE 4CMEC 3EW7A 3K2BA 1MG0A 1PGNA 2YFHA 3QV1A 3AY6A 3IMFA 1N92A 4BO2A 1OFGA 4II2A 3DEYX 1O94A 4FBGA 1PEDA 2EW2A 3GFGA 1DIGA 3EVNA 3F46A 1H6BA 3MOIA 1N8KA 4U5QA 3PLNA 4M49A 5GY7A 1B3BA 3KLPX 4AJ2A 3U5TA 5AYVA 3ROKA 1GYRA 2PR2A 3GRKA 4IXTA 4QXMA 3QJ5A 4UULA 2PK3A 2NWQA 2DBQA 2PD6A 3M1LA 2YZ7A 1QMGA 3M1AA 2Q2VA 4YT2A 3HFGA 4JCOA 4GBJA 5FI5A 1DJNA 3NT5A 3MJ4A 5JO9A 4AJIA 3KVOA 5GZ6A 1Z73A 5TJHA 5HTOA 4CM4B 3PHLA 3ZGYA 1Z6ZA 5IFLA 4C4OA 3PHGA 4WE3A 4AJ1A 1P44A 2HLPA 4DWVA 3BMQA 3ZH2A 2DUUA 5TLSA 5A04A 2EGHA 2GNAA 1ULSA 3AOEC 1ZSNA 3RWBA 2UVDA 4JK3A 1DIBA 5CDSA 4CV0A 3PIDA 4L4RA 1E3LA 1SBYA 2ZYGA 2DFVA 3OECA 3VAZA 2ZB7A 1B8PA 2B4TO 4DBZA 4CM8B 3VZPA 2ET6A 1FDWA 2WD8A 3JQ8B 4PLCA 3ZWNA 4PLPA 1MA0A 3PGXA 1Y5MA 3WQSB 3BZUA 3I9NA 4TKLA 3UCXA 1KETA 2XPCA 4R9SA 2C5AA 3I3OA 2QW8A 5ER6A 3P7MA 5DZSA 4E2YA 1PZGA 2FSSA 2Q4BA 3ROMA 3ZWWA 3NUGA 5I7SA 3IAHA 4YTEA 3QP9A 1I10A 1QKIA 1N1EA 3JQFA 5JCJD 2DM6A 5AXCA 1B7GO 1VSVA 3WG9A 1X0VA 3BHMA 1C0LA 5KVSA 1FF9A 3GUYA 3RUIA 4OM8A 1YJ8A 1XQ6A 2C7GA 1AUPA 1B26A 3DBVO 1YDEA 1EFLA 4GX5A 3DBRA 1VJ0A 2GF2A 4BO4A 3E9QA 5IXYA 2CZCA 1XWFA 3GLQA 2AQ8A 3RD5A 4FFRA 2Y0EA 5TRTA 1BGVA 1HE4A 2NTVA 1HE2A 3C1TA 1DO8A 1E1KA 1LC0A 1I3MA 3DDNA 1U2DA 4EUHA 1E7MA 4RVHA 1I36A 4JGBA 1VI2A 3BHJA 4UUOA 4TMFA 4UVGA 2HMUA 5JS6A 2ZTLA 4UEOA 3LT0A 2Q99A 1XDWA 2XOXA 4XCVA 4WCFB 5I8ZA 3AOGA 1ZK4A 1YL7A 2O3SA 4BO0A 4YPOA 3GG9A 4J4HA 5KKCA 4B3HA 4BNVA 5JC8A 1Q2XA 1F14A 1UP6A 3X2FA 3E03A 5IXSA 4ALNA 4D43A 2UYYA 4IMRA 3E82A 4R5MA 3A1NA 3AI2A 4ZJUA 4BNHA 3R3SA 3VTZA 3KB6A 4TKMA 2J8ZA 4B4VA 1Y8RB 1DBVO 4N5LA 4R68A 3QWBA 4AJPA 1RWBA 4ZQEA 4LK3A 3R1IA 3CH6A 1HDZA 3H6KA 3STHA 3JYOA 1IZ0A 4CUZA 2IODA 2X9NA 2GYYA 4KDFA 4RVFA 4I9NA 5JAQA 3RCBA 1P0CA 3RKUA 2E48A 2ZJ1A 4PLZA 4OKIA 2G82A 1P9LA 3L9XA 5EQDA 1EMDA 4IQ0A 2YFQA 4DIOA 1R15A 3QE3A 3PP8A 2ZATA 3GQVA 1IOLA 5JDIA 3VH2A 4FB5A 4DBVO 1XELA 3CUKA 2HMWA 3UXYA 4PLYA 2PZMA 4Z3KA 1LDYA 1R66A 3GHHA 1WVGA 1ADFA 4RLSA 3C3XA 4C7JA 3ZWXA 2ZTMA 3BIOA 3MJCA 3DMTC 4J49A 3WQQA 2QZ9A 3QW2A 5HS4A 1Y1PA 5ER9A 4DUPA 4XIJA 5L95A 3F5QA 1M75A 3JTMA 3LZ6A 4L76A 4INAA 1QYXA 3N74A 4MVJH 2BFOA 4XGIA 3TFQA 4ND4A 3I23A 3U49A 4A26A 1PJCA 4YQYA 1PTJA 1MFZA 2O2SA 3L07A 2Q46A 5JCJA 3DL2A 5L7TA 4JJFA 4F6CA 5KTKA 4XEHA 1U3TA 2O4UX 1G0NA 1QSGA 3ORFA 1A7KA 4NU6A 2BLLA 3C24A 3DOCA 1BMDA 4CQLB 2CUKA 2BKAA 3GZNB 3GF4A 1H94A 3IJRA 1OOEA 3NTQA 2VHWA 4TVOA 5I9NA 4BKUA 1NPDA 2IXBA 3PYXA 1CYDA 4EUEA 3WDSA 1LNQA 4GVXA 1MX3A 3JQ7A 1Q1NA 2WYWA 4KDEA 1T2CA 4R1UA 4AJLA 3RI3A 4OQZA 2AQHA 4MPDA 3OJFA 2JHGA 4MIEA 3WLEA 1NFQA 3WOHA 5A9SA 1VKOA 3G79A 1R4MB 3CZMA 1AXGA 5DOZA 8LDHA 4LISA 4J9UE 2VZ9A 3VTFA 1U1IA 3BMNB 3WGQA 1C1XB 1GUZA 3B6ZA 1XR3A 1R37A 3ZU5A 1BXZA 4CODB 3NDJA 3JQAB 4DMMA 4PVCA 2IDZA 1T26A 2VYVD 4E5PA 1ADGA 2OORA 1OBFO 4O0LA 2C2XA 3MJVA 3BTUA 3D0OA 1JWBB 2FHSA 3TN7A 3ONFA 5IG2A 4E0BA 3B1KA 5MGBA 2P4HX 3WFIA 1ZJZA 3S1LA 3FWNA 3WBFA 4UREA 5JMPA 2PFGA 4EGFA 2PWZA 3WJAA 1PR3A 1PSDA 3HJAA 2NTJA 2B4QA 3M6IA 1DB3A 5TSDA 1AN9A 4PG4A 1DIHA 1HRDA 4ZN6A 5K6AA 1GQQA 3AUUA 3JQFC 4E30A 5GZ1A 3ONEA 1Z82A 3S8MA 3UCEA 1LLUA 3K96A 4CM4A 4DIBA 2EGGA 3D5TA 4I08A 5T8KC 1J6UA 5ES3A 4JP3A 2V6MA 4B7XA 1ZXLA 1P31A 5B12A 1A71A 1E3JA 1LC3A 3K8ZA 5JAIA 4JQCA 5FEUA 3HZZA 4LCEA 4GPD1 1LDBA 4JNKA 3R0IA 3QVSA 1B16A 5JDCA 7ADHA 1K6XA 1VE9A 4TZTA 4LMRA 1AE1A 4G65A 2Q1SA 1O95A 2JKVA 1X1TA 4BNYA 5F1OA 2I76A 4IGEA 4IXWA 5LDHA 4CMGA 1IE3A 1UH5A 2NVBA 5TIIA 3PJDA 4K6CA 4BGIA 4XRGA 4YRBA 6LDHA 4DA9A 4P4GA 1H9AA 1B3RA 3AK4A 4DQXA 1AHIA 2BGLA 5DOVA 3BXXA 4E5KA 5DBFA 4FJ1A 4D0RA 2RH4A 1LRKA 1BHSA 3WX0A 2WE7A 3FD8A 1YS4A 1T25A 1V0JA 3L4SO 1WDKA 4ZICA 3W4IA 4YJFB 3O26A 2DFDA 2XXBA 2D5AA 2FY8A 2R6JA 4A7PA 1V3UA 3LT1A 4CV3A 4J0FA 5CPFA 1NXQA 1J0XO 3QY9A 4JBGA 2Z95A 2NVUB 1PJQA 1EVIA 1JW9B 3UUWA 4G5HA 3TWOA 1H0KA 4FSHA 4LMPA 4Z6KA 1I3KA 5KVCA 4PVDA 2DC1A 1R6DA 1TB4A 2X8LA 4WCFA 4RJTA 4YJDA 1NWHA 4W6ZA 3CTMA 3GMDA 3PVZA 2WEKA 5T67A 2X7HA 3VKVA 4WLEA 1A4UA 2PA3A 4WNIA 4MVJF 1PGJA 4NU5A 1R4NB 5G0UA 4J43A 1KVRA 2CF6A 3I9MA 3ON5A 4B4UA 4NDNE 3GDFA 4W99A 4R01A 1GV1A 4FFNA 3WS7A 4O59O 4MVJI 2VTEA 1PX0A 3U4CA 1H6DA 4BO6A 1BSVA 1NTOA 3TF5A 3ZWBA 3WMXA 3ZNNA 2YV2A 1JDJA 1NPTO 4GI2A 1UXGA 1QLJA 1XA0A 3DFZA 4QX6A 5HS6A 3X2EA 3B1JA 4CQMA 4IQGA 2YDXA 5EERA 1HE5A 5A3JA 1N1GA 4DTIA 1W73A 1O6ZA 4QQRA 1D1SA 2A35A 2H1SA 9LDTA 1ENPA 4DLAA 3N58A 1F8FA 4RQUA 1LDMA 3GOHA 1YDWA 4ND1A 4ZGWA 3DZGA 2GLXA 2H5LA 4GAEA 4YJGB 4ZU3A 5KKAA 1Z7BA 1A9YA 1F17A 3FTPA 1Q0LA 4WUVA 4DL9A 3GVHA 5CEFA 3F3SA 5A06A 2Y1GA 2HMTA 1N7HA 5FFFA 4N18A 1WLYA 1FMCA 1Y9EA 4A10A 1P45A 4JJIA 4U6QA 4BO8A 1B14A 3Q0EA 2OBYA 2FSVA 5ICMA 2JL1A 3QLJA 3GY0A 4FJ0A 2FOIA 3OP4A 4AJ4A 3NJ8A 1PGQA 4OH1A 1GPDG 4IDGA 2IXAA 5JNLA 4GKBA 2G17A 4GGOA 2EKQA 3IIEA 2CVZA 1K2WA 3O4RA 3GFBA 4B79A 4KZPA 1C1DA 5C5IA 4YJHB 1LDGA 4M86A 1H5QA 4RO0A 5HA5A 5BR7A 2BMAA 1SB8A 3GPDG 1TT5B 1RYEA 1HT0A 3WFJA 1XGKA 1UXIA 1DC4A 2W2KB 4IIUA 4P8RA 4CQLA 2ZYDA 3GZNA 1YXMA 2CDBA 4B3IA 1N9GB 1ZNQO 4YDRA 5JC1A 2WD7B 5CAEA 4XA8A 2J3JA 1Y6JA 4E21A 3TL2A 2J5QA 3WGZA 2DLDA 4CR7A 3AI1A 4E3ZA 4J7CA 1H9BA 3K9QO 2D2IA 4GQAA 4F46A 1LX6A 1P1JA 3KOUA 4NJMB 1VJTA 3FI9A 3O9ZA 1EBUA 4WKGA 4IQ8A 3BMNA 3PYMA 4FGWA 2GUGA 4RVDA 1C1XA 1LLQA 1NVMB 2C29D 4YB8A 3DXFA 1EQ2A 3CEAA 3DB2A 3R6DA 5C3MA 4DQUA 4R69A 5DBGA 1X7HA 4QFCA 1AXEA 2VUUA 1QR6A 2C54A 1QV7A 1UXKA 2OOSA 2DPGA 4P22A 5HWSA 1U5CA 2O3RA 1FDTA 5JDCC 4CM7A 2QRJA 2QG4A 2PV7A 1GEEA 1LRJA 1OC4A 2X9GA 4J6FA 4KP7A 2C20A 4B4WA 1H2BA 3H9GA 3RC7A 4E5YA 4EEXA 2PGLA 5CEEA 2ZTUA 4J1TA 4YBZA 2I99A 1D7OA 4LRTB 2B83A 4GWGA 1T2FA 4G81A 1SEPA 3KYDB 3NKLA 1E1LA 1L7EA 3G0OA 2EP7A 4J7XA 1H6AA 4R5HA 3UH1A 1Q7GA 2ZB3A 5A5EA 1UJMA 2LDXA 4D7AA 2DBRA 4JJGA 1XYGA 3W8EA 2XXJA 1GZ3A 3PRJA 3W4JA 2WE8A 2AG5A 3GN2A 5I9MA 1E3WB 1F06A 1AGNA 3DTYA 3OA0A 4OIMA 3JSAA 4Q9NA 2FRDA 1E6EA 5DT9A 4BNWA 4BNFA 1RYDA 4IJWA 3TZQA 4I5GA 3OIDA 3D4PA 1U8FO 4BNXA 4QUKA 2VWGA 3KTDA 1QYVA 5U1PA 2VQ3A 3ANLA 1I0ZA 1BTOA 3GC6A 3F1KA 4K28A 1QRRA 4DLLA 1PJ3A 4CV2A 4XB2A 5I7EA 3FF4A 1LU9A 1J5PA 1EDZA 2PKQO 1NBOA 2A92A 3QWHA 3W4KA 1ZJYA 1YB5A 3VH3A 1PJTA 2GERA 2PZLA 3Q6IA 2H63A 4ZHSA 1ZUD1 3LC1O 2NUAA 2PD4A 3M2TA 1Y8QB 4A2CA 4XIYA 4BMVA 1ZBQA 2Q3EA 4E33A 1D1TA 5F1PA 3OEWA 3RC2A 1RJWA 4WCFC 4BL5A 3OBBA 1RM5A 3NGLA 2YV3A 3I83A 1I8TA 2OO5A 3WMWA 4LN1A 4RORA 3PDJA 1GZ4A 1HWYA 2Y1OA 4O1MA 2QYTA 4YVFA 2IYOA 2YYYA 2O3QA 4IM7A 3DMTA 1M2WA 4CLXA 2OL4A 2D0IA 4CPDA 4GGPA 5I8WA 3BMOB 5ILGA 5BSHA 4RPJA 1DLIA 1I33A 4YJFA 3TQHA 3BMCA 3GNQA 4FW8A 3RFXA 4CMJA 1HDYA 3D3EA 3DAGA 1A9ZA 4GWKA 3ZDFA 3OH8A 3ANNA 4L75A 2VRBA 2NVUA 1LLCA 4ESOA 3PPIA 4WNCA 1KBZA 2HMVA 2J6IA 2P9CA 2YQ4A 4ONEA 3WB9A 4KOAA 4NFYA 4RPGA 5KVQA 3VHRA 4IY1A 1I30A 3IS3A 3LLSA 3Q1LA 4AJOA 1Y81A 1NWCA 2POQX 1P77A 1FDSA 3GAZA 3ANMA 4BS9A 1U3WA 4PZCA 3RAJA 1FXSA 5AQ1A 3VPXA 2FP4A 1DOHA 1R4NA 3AUSA 3DHEA 3DWFA 1EUDA 2C07A 1CIVA 4AJEA 2QRKA 5FYDA 5BNFA 3HDJA 3PJEA 1C3VA 3OJOA 3HG7A 2JFFA 4MKRA 3V1YA 3A28A 2YQ5A 3HDHA 2LDBA 3PDUA 1RM3A 1EQUA 4MP3A 4Z0TA 3AJRA 3RUAA 2RCYA 1ADCA 3FRJA 4KQXA 3TL3A 1MFPA 5CDUA 5A9RA 4CJXA 4QTZA 1OC2A 5KNLA 1ZW1A 4FPXA 3ZCXA 4NFHA 1BVRA 4FGSA 1GQYA 4WJZA 4FD3A 1NFRA 2DU8A 1OAAA 4M54A 5H82A 4YJGA 4CR8A 2O3JA 2PGDA 5IJZA 1XU9A 4NJOA 2FMUA 5DCYA 1ONNA 3RJ5A 3ENNA 4CMKA 2FN7A 3OJEA 4A0SA 1BXGB 3DR3A 3QVTA 1QG6A 3ZV6A 3B20A 2ZCUA 4TROA 3ZW8A 3IOYA 3LF1A 2ZB8A 1YE3A 1YBAA 2I9PA 1E5LA 1YB1A 2X5OA 2CD9A 2IZ1A 4FJ2A 3U4IA 3F6YA 4CLRA 1P3DA 4Q3DA 3FPCA 3PIIA 1L1FA 1SNYA 3A9WA 3ZU4A 2CF5A 5T8KA 3QWFA 4K9DA 1V6AA 2G5CA 3SLKA 4YJHA 1A7AA 4DVJA 1T4BA 1DDOA 1HLDA 1PIWA 4YAJA 2NU6A 4BNIA 1Y7TA 4BQRA 2V65A 1TT5A 3C8MA 3FBTA 5B37A 4IS3A 1Z45A 4NBUA 3ZNPA 1ZEMA 2W2KA 3R3JA 1VLLA 4BUCA 1P74A 2E6UX 2XF8A 5JBIA 3C7AA 4L74A 4XQEA 1QORA 3SC6A 1N9GA 2EXXA 4AVYA 1MGOA 1BG6A 4LW8A 1NX6A 1Y5RA 1VRWA 1VL6A 4CM5A 5L45A 3KYCB 1PL7A 5IDXA 3ZHZA 3FBGA 5G4KB 3OQ1A 4EBFA 2IYPA 2NVWA 3DBHB 3P5SA 4OL9A 1F0YA 4KWIA 4YRAA 5JYEA 1B2LA 2P4QA 4FOOA 2IZ0A 4PZDA 1E1NA 2AXQA 4TRRA 1LRLA 2QZZA 1NR7A 3JQCA 4NJMA 1GTMA 4XZ3A 3UVEA 1H93A 4B7CA 1LSJA 1DFIA 4ALIA 2JFHA 3O8QB 2JCVA 3RUCA 5JYDA 2Q2QA 3F1LA 2DVMA 3VZQA 2VZ8A 1HYEA 1DRWA 1E1MA 1A72A 4CLHA 1EDOA 3OSUA 4GMFA 2VT2A 2WM3A 5LCXA 5IZ4A 2GSDA 3G17A 1WWKA 4Q3AA 3RBZA 2VOEA 3DFUA 2H9IA 4NIMA 1I3NA 3O38A 5CPBA 5T64A 2HQ1A 1ZO8A 1IUKA 4DPLA 3EDMA 2WMDA 5TC4A 2RIRA 1Q0QA 3HSKA 3JQ6A 1IHYA 1U4OA 5KJCA 4UEKA 1BXKA 2OFPA 4PG8A 2P5UA 3LC7O 1FK8A 4BV9A 2X5KO 2VZ0A 4N7RA 2CFCA 3SJUA 3EHEA 1MB4A 2AQIA 3ADPA 3KYDA 3IJPA 3WTCA 1QYDA 4ID9A 5CFZA 3DZFA 3W6ZA 1DIRA 2I6TA 5C37A 4MKZA 2ZK7A 4PLWA 3L6EA 4YCAA 1GL3A 1LUAA 2OGUA 3S2IA 1P1HA 1MP0A 2AW5A 3F5SA 1KEWA 1YOVB 2DBVO 1IHXA 1T1RA 4XGNA 5HM8A 5JE8A 4UVDA 1K3TA 4UVHA 2PD3A 4E12A 5JFOA 5J23A 1RM4A 5DP1A 3K92A 3RKRA 4TVBA 4BKOA 1QYCA 2V6BA 2V7PA 1W8DA 2EIHA 3DZKA 2EEZA 3IUPA 1U4SA 4B8ZA 2HRBA 2X0NA 3RBVA 1PQPA 2X9VA 3I4FA 5KCZA 1HXHA 4BO5A 3C1OA 1G0OA 4FQ8A 4R1TA 3EGOA 3IKTA 4OOFA 2DQ4A 3D5QA 1KC3A 1A5ZA 4MDHA 1CDOA 3D4NA 3QQPA 3JQGB 1SC6A 4EI2A 3K73O 1GAEO 1Z7EA 2O50A 2G0TA 3RUEA 4IPTA 3KV3O 2GASA 1O9BA 2AQKA 5IAAA 3HNPA 3Q9UA 4YT5A 3VPFA 5IN5A 4NQZA 4BGEA 3D1LA 4BO7A 3ABIA 2I3GA 2ZKLA 2I66A 3KEOA 1W6UA 4EUFA 4R4JA 3FHLA 3OJ0A 1JU9A 4FFMA 1UDCA 1L7DA 4J4TA 3UAGA 3MEQA 3ETEA 4YR9A 1YKFA 1Q7CA 1ZVMA 5TQVA 3WYEA 3NEPX 4GL4A 5ITWA 3GEDA 1NASA 1YH3A 4AG3A 1FDVA 1YGYA 3GT0A 4YAGA 1KERA 4L8VA 3D4OA 2BF7A 4ALLA 5DP2A 4UUMA 1NNUA 2NNLD 3WXBA 4FCCA 1KVSA 5L9AA 3JQDA 3V5NA 3WNVA 3JQBA 4KTVE 4BGUA 2VWQA 4H16A 4L4XA 1HSZA 4NBVA 1BW9B 5A9TA 4E13A 2QQ5A 4CLOB 1HL3A 1JQBA 1XLTA 3OIFA 2Y67A 1Q0HA 1EE2A 4PG7A 3BYZA 3PWKA 2PZKA 4WLNA 2FZWA 3OM9A 4IDDA 1FDUA 4E2WA 1GCOA 2YUTA 2OP0A 3VVCA 5L4LA 1JWAB 4GX1A 5ENDA 4DXHA 3AU9A 1ONOA 1EK5A 3LVFO 2Q50A 3RU7A 4WLOA 2NQTA 5COAA 5HRUA 1PJLA 2EW8A 4CUJA 3MOGA 3MTGA 1X14A 2VHVA 3KSDO 2YW9A 4CMBA 2RHCA 3NT2A 5EJ2A 3VZSA 5L7YA 2BGKA 3WSWA 3ROPA 4J16A 4EZBA 5L3ZA 3DHNA 1N5DA 3PZRA 1NVTA 2C2YA 3TOZA 4RL6A 2Y68A 2VWHA 3FTNA 2PZJA 4WK6A 1T1SA 3F4LA 4MOWA 4BO3A 2OP1A 4I5DA 1ZSVA 1RKXA 3GUCA 2WWRA 5EMHA 2GR9A 3AFNA 3K6JA 2VUSA 1KC1A 5TX7A 1D4FA 5JMWA 4ZD6A 4CM8A 1XEAA 1W4ZA 3JQ8A 1EUZA 2I3AA 2RHRA 1I2CA 1BXGA 1GD1O 2F00A 3IP3A 4HV4A 4O63O 4PLHA 3JD2A 4D46A 2JAHA 4BIIA 4XQGA 4RV9A 3I9JA 4EEZA 2GD1O 3G3EA 1MV8A 3NV9A 3P2YA 2Y1FA 4CMAA 1WP4A 4K6FA 4ZVVA 3C7CB 4H3VA 4FS3A 4PCVA 1PS0A 1YJQA 2V6GA 3I6QA 3PHJA 2XAAA 4NBTA 4Q3BA 2VNSA 5AVOA 3KHUA 4AFNA 1MXHA 2JCYA 3QA9A 4RCVA 5CHEA 3WJ7A 1HDOA 2Q45A 1HKUA 1DPGA 1PQWA 3WWZA 3HFSA 4RDIA 2GPTA 3C1AA 3K30A 4LSWA 1ZZEA 1EVZA 1PZHA 3L4BA 5A4DA 1GV0A 1I5RA 1RPNA 1YB4A 3ADOA 3VKUA 2GDZA 3ONDA 3KETA 1Y9AA 1U8XX 1C0IA 1ZXBA 2BFAA 3ZU3A 1PU2A 2VOJA 3ZU2A 3OETA 3WNQA 3ETGA 3ICPA 4MO2A 4CMCA 3EYWA 3IL2A 2ILTA 4XR4A 1K89A 2JAPA 1K6JA 1NAHA 3KYCA 3OHSX 3ZV4A 3PQDA 2VYVA 2OXIA 3DBHA 1ARZA 4FDAA 3HDQA 5KJ6A 1DRUA 2I67A 2WYVA 2H6EA 2NTNA 2D4AA 3AM5A 4ND3A 1ISGA 1UZNA 3H9EO 3QIVA 4IDAA 1E7WA 1P0FA 3JQAD 1E7SA 1E7QA 2C82A 3E9MA 3L9WA 1LQUA 1HYGA 3INTA 1UXJA 4D42A 2EJVA 3GZ4A 1LA2A 3O8QA 3U4DA 5CEJA 2HSDA 2RAFA 2DUWA 3K5PA 3QHAA 4HX5A 1KYQA 1DRVA 1GZ6A 3DZIA 3A14A 4Z3DA 3TZHA 4PG6A 2Y1CA 1Q7BA 3LDHA 4RF5A 3ZI0A 4EJMA 4Q3NA 1EUCA 2BI8A 2O7QA 1Y8RA 2ZTVA 5F1KA 1CETA 3H9QA 1GU7A 4BVAA 2W98A 1JKFA 2VUTA 3OQ6A 2B37A 2VTDA 5G4LA 3VDRA 1DC6A 1JKJA 3MCVA 1ZMTA 2P2SA 3SLGA 1VSUA 2PKQP 3HHPA 1MC4A 4X54A 4YACA 1I3LA 1OMOA 2BRUA 1NR1A 2OZPA 2C5EA 3PWZA 3ZWOA 5FWNA 4FOSA 3WQRA 4L9RA 3NT4A 4LSMA 1V3TA 4IDCA 2QRLA 5EL0A 1R0KA 2YV1A 3INGA 2F1KA 3FNGA 1WZEA 1ENOA 3RUHA 1UR5A 2D5CA 3I9LA 3DBLB 4R3WA 4A5OA 4Y6PA 3KRTA 1NAIA 3QRWA 5CDGA 4W7HA 4XYBA 3SX2A 3GH3A 1DC5A 1KVQA 1MUUA 4IDEA 1KOLA 3HN2A 1R0SA 4R1NA 3EK2A 4FR5A 4W9NC 1GDHA 1B8UA 2AEFA 4GKVA 4IZIA 1PR9A 1TT7A 4BNGA 4E6PA 3L6OO 3TOXA 4KWHA 4PG5A 3F9IA 3ETDA 1YQDA 5JLAA 1JLLA 1T24A 3H2SA 3JQBC 1SOVA 4DQVA 5TGDA 4FC6A 3I9OA 3U09A 1DFGA 3CPSA 1LEHA 4MINA 4RGBA 5K9ZA 1KEUA 3F47A 1GQ2A 1XQ1A 2AE1A 1JAXA 2CSUA 3DBRB 4DLBA 4FN4A 4BO1A 3GA0A 2HKIA 3U3XA 4RF3A 1U7HA 1T2EA 3D3WB 3H9UA 3GGPA 5THKA 1V35A 4OYRA 4Y8VA 3VC7A 3E6AA 3KO8A 1R4MA 3FCOA 4II3A 4N54A 4D45A 3LYLA 2Y0DA 4YT8A 3WR5A 4M55A 1KS9A 3FWZA 1ZH8A 2VCYA 2O23A 3WGYA 3Q3CA 3WWYA 5JY6A 2W8ZA 5F21A 3SVTA 3DZHA 3RFVA 3JQAA 4D3DA 1NP3A 1U5AA 2EWMA 2QX7A 4Y6RA 1XCBA 2B5WA 1NM5A 4CM9D 3M2PA 1HDRA 3FR7A 4MVJP 1NVGA 1BDMA 3CIFA 2PLAA 3HE3A 3RC1A 5B4UA 1C0KA 5DN9A 2ZCVA 3VPGA 3GDGA 5U4QA 4WOJA 4BNTA 5LC1A 3OMLA 1NFFA 1UP7A 4CLOA 5T5QA 3AY3A 2OMEA 4IDBA 1ZEJA 3GGGA 4ITUA 2W90A 4BB5A 3JQ9A 2C0CA 3C7DB 1IYZA 3IDSA 4UVEA 4HADA 4OGWA 1MLDA 1GYQA 1S7CA 3ITDA 4B4OA 4XDYA 4QSMA 4E2XA 5IZCA 3JYQA 3PZBA 4OXYA 1HDGO 5KVVA 1UXHA 1DLJA 1NHGA 2GN8A 3DONA 4R16A 5C7IO 2RH8A 3RROA 3IP1A 4XYGA 2BFPA 5H81A 1E3EA 4RF2A 2B36A 1SOWA 2CMDA 3MZ0A 3G49A 3OQBA 3CZRA 2E37A 4JP2A 4MVJE 5TS3A 1H6CA 1PZFA 4WASA 5I7VA 1OI7A 3L4BC 1NQAO 1HF3A 4BKQA 1E6WA 2X58A 5KJEA 4GH5A 4JLWA 3S2FA 4L73A 4BNKA 3KSZO 3ZHBA 4NK5A 2NQ8A 2VHYA 3PI7A 1PGOA 1DHRA 4J1QA 4MVJD 1WAMA 1KY5A 2Q1TA 4EJ6A 4YYZA 4JROA 4ROSA 1QP8A 1D3AA 4D44A 2BH9A 4ILKA 3TRIA 3QVXA 2EV9A 3ZN2A 2PGJA 4LVCA 3UGKA 3VPSA 1ISIA 2V6FA 4MIYA 1M66A 1VL0A 4XDZA 4P38A 4XYEA 2HK8A 3AW9A 3D64A 3PLRA 3NAQA 3PK0A 5G2OA 2GZ2A 1E5QA 1E3SA 4CMIB 1PS9A 5JXWA 1PJSA 1O89A 4E2ZA 3GDOA 4BB6A 4I8XA 2WJPA 3GMSA 4QT0A 2DTXA 3H2ZA 2E4AA 4NFSA 4IZHA 1XIVA 4TZKA 2HAEA 1K0UA 1WZIA 2UUOA 1EBFA 3WTBA 4HNGA 4D41A 1V3VA 2RBEA 2AHRA 2D59A 4XQCA 4CM1A 3ASUA 3UFXA 3RFTA 5DNAA 2Y66A 2Z1NA 3O03A 1P33A 3W6UA 1F12A 3CINA 4JN6B 1U3UA 4UUNA 3BHIA 1ZCJA 4NHEA 1CJCA 2I5PO 3JQ7B 5ILOA 4J9VA 4PRLA 4JIGA 4IGFA 1ZKMA 4R54A 3GNSA 5TT1A 1E3IA 2CVOA 1PL8A 5A9SB 1TEHA 5IN4A 4IUYA 4CM9A 3JQEA 1YQXA 3PFFA 4KUGA 3GR6A 1ISFA 4KUHA 3ZV5A 4EW6A 3AI3A 3DZJA 4XJTA 5BNTA 4U0JA 2I65A 1ZK0A 1PWXA 2NU7A 4R3NA 4URFA 2AA3A 5KJFA 5L4NA 4K26A 5A1TA 4DYDA 1KEVA 1LSSA 4CUKA 5K0ZA 3RVDA 1GCUA 4FC7A 4A73A 1VKNA 2OUIA 2GRAA 3NGXA 5G0TA 4XJSA 4ALKA 1XG5A 5T57A 5TNXA 4TQGA 3FNHA 3RASA 1ZK2A 3E9NA 3BAZA 5F5LA 2FPIA 1MG5A 1NHWA 1Z74A 3LLVA 4L0QA 3RUFA 5KOIA 1ONPA 4HY3A 2VRCD 3FPLA 4HFMA 2DBZA 4J2OA 1CQIA 4GSKA 1IY8A 2GZ1A 3VH1A 3UKOA 3ULKA 1PL6A 4J90A 4R9RA 2TMDA 4IDFA 3WBBA 2JD2A 1X15A 5L51A 3I5MA 4EYEA 1EK6A 2FPPA 3ITKA 4Z9FA 4ALJA 5DBIA 1TVEA 3FR8A 4RVUA 4D3SA 3AM3A 1UAYA 2C7VA 1SAYA 2Y93A 4MVJA 4U7WA 1DJQA 3WGHA 4NMHA 4YWJA 4A03A 4TWRA 2IE0A 2NLOA 3DBLA 4N5MA 4BNNA 2FR1A 4I5FA 4HXYA 4CL3A 2WDZA 4F45A 3JV7A 2GN9A 3PHHA 1QYWA 1AHHA 2PTGA 5G0WA 3UW3A 4AL4A 1M67A 3TPCA 1HE3A 3DQPA 4GMGA 4Z9XA 4TRMA 3FNEA 5U9CA 1WDLA 4H15A 2FWMX 3OJLA 5GZ3A 4HBGA 4RLHA 1X13A 4Q3CA 4QEDA 2BGMA 3ZHYA 1ORRA 1OZAA 4PRKA 3S2EA 3WLFA 3RJ9A 3VH4A 3GHYA 4Q39A 1R12A 3Q2IA 3I9KA 4OMUA 4UEJA 1C14A 1TXGA 4J1NA 2AEJA 5COBA 3VDQA 2BHLA 4BKRA 4M8SA 2GN6A 5A02A 3E5RA 1U28A 2JHFA 1F8GA 2PKRA 5KJ1A 4WECA 1A4IA 4RPLA 4GVLA 2GCGA 2WD7A 4IS2A 3V1UA 1PJ2A 4JBHA 3JQ9C 3TFOA 3PWSA 2AMFA 4BHTA 4J3FA 1DSSG 2X5JO 3PQFA 4Z0PA 4BNUA 2W4QA 5JSFA 3D3WA 4HFJA 2EP5A 3EAGA 4IJUA 2X22A 2VHZA 4RPKA 3HADA 2G76A 2HRZA 3PTZA 4Z0HO 1EVJA 2E82A 1P1IA 3Q2KA 4H7PA 2J5RA 5IDWA 5IZCC 3WIDA 2IZZA 1LDNA 2J3IA 2AG8A 3GN1A 4MJLA 4FFOA 2HJRA 3H4VA 5COQA 4A27A 4LRSB 1I2ZA 4AJKA 1JAYA 5TJ9A 2HO5A 3DHYA 1DEHA 3GVIA 1VJ1A 3EZYA 3ZW9A 2A9FA 1GYPA 1O8CA 3K31A 3PFWO 5F3RA 1H2HA 2UUPA 3L0DA 2IEBA 4E5MA 3AY7A 5I9LA 1LBEA 3ZNOA 1YL5A 2FR0A 3JD4A 1GFSA 4S1VA 1KEPA 3G1TA 5IF3A 1IPFA 1GY8A 2VRCA 2JD0A 3TZKA 1I32A 1HDXA 1YBVA 4MIOA 1GUFA 2D3TA 3COSA 2HJSA 4RVGA 3LT2A 4ZRNA 3ASVA 1LTHR 2BI7A 1PJBA 3UCFA 1PQUA 1LI4A 2UV8A 4HP8A 4ZQBA 3PQEA 4CQMB 2BFMA 2O3TA 2VWPA 2YJZA 1HYHA 8ADHA 4DIFA 1EVYA 5A05A 1UZMA 3ZWAA 5IDQA 2O2YA 1E3WA 4RZHA 2J5KA 5JAMA 1TI7A 2HDHA 4E32A 2PH5A 2CVQA 1ADBA 1M6WA 1ISHA 3S55A 3MJSA 1T2DA 3SC4A 3PGJA 4I9HA 5TF4A 4U8GA 1NYTA 2EERA 2P9GA 3GEGA 4QFDA 1ISMA 1X7DA 1V8BA 1GEGA 2IEDA 3EC7A 5CG1A 3C85A 5JY1A 4XD2A 3AU8A 3GEMA 3BTSA 3QWIA 2Z5LA 4WGGA 1QXSA 3QWAA 5JPIA 4DGSA 4OSPA 2EG9A 1CERA 1J4AA 4HNHA 4XQ9A 1YRLA 1ZK3A 3ZHXA 3S2GA 3GGOA 3W8FA 1W0CA 3ZWPA 4GX0A 5B1YA 4ZQHA 4BMSA 1E77A 4QO8A 1VC2A 2NADA 5BQFA 1ENZA 1Y8QA 2A94A 2DTEA 3DZBA 3GAFA 3JYPA 4MP8A 4P4LA 5BT9A 3SXPA 3V2UA 1DHTA 1X7GA 2EJWA 3OFSA 1T4DA 2ZB4A 4L4SA 2YDYA 2FZEA 2B69A 1NQTA 1C1DB 3K2EA 5EIOA 2YY7A 1EE9A 3DAPA 6ADHA 1SB9A 4CMIA 1K6IA
chains in the Genus database with same CATH superfamily
3MA0A 2IY8A 2CDAA 3LZCA 3BKWA 4TS1A 5EPOA 3V1TC 3T4XA 3EHDA 5LYJA 1J5XA 1JE0A 4CM3A 4U6SA 1SUWA 9LDBA 4PZEA 1HT3A 1HLFA 4FZ3A 4UVIA 4D3YA 1GIAA 2H0QA 5CFRA 5HZKA 2WVHA 1IZ9A 1JKMA 5AOVA 3KAKA 2COKA 2HMSA 1I2BA 3LV8A 2XD9A 3I39X 2VDWB 5FJIA 4OAQA 2OPHA 1PL0A 4W9NA 3RSFA 1SEVA 1S8OA 3RS0A 5EESA 3L7MA 4RTPA 3LO8A 2FP3A 4DQ0A 4Y6SA 4FU0A 4WESB 2FMHA 5L3SA 3MAAC 1R0CA 4QUHA 4PTYA 3MTJA 3D2AA 4YCLA 1GPJA 4PPNA 3LUFA 3M7IA 5B57C 1VM6A 1PZXA 4TSKA 3A0UA 3CUWA 5FA6A 4A4DA 3BWVA 5BN3B 1G6KA 3DKRA 1N9KA 1J9ZA 2Q5HA 3A9CA 3AR3A 4RGQA 3E1KA 1IQPA 1HDCA 3ESQA 3ESRA 3H3JA 2ZQZA 2Q0HA 4LGVA 3PC7A 2VQDA 4KG7A 1B8VA 1O3YA 4TSFA 2UXDB 4IMPA 4QWWA 3TYXA 2R4QA 1RWVA 2IPMA 2QRQA 4K40A 1MB3A 1E64A 3W8DA 1GA1A 1G8FA 2F62A 3L0CA 3T8YA 3U40A 3G02A 3THWB 4BXOB 4UUPA 4ENWA 3SBOA 3P96A 3KUCA 2ZBGA 5FL7D 3T7CA 2HWKA 4LJRA 4GLOA 3BIJA 4KMMA 4KFUA 4CT0A 3BTVA 1W30A 2ZWOA 1CUJA 2GO1A 1OAOC 1V4NA 3PUYA 1G7TA 3UMSA 2FFBA 3QPBA 1SQ6A 3EQ2A 1G17A 2C8VA 3ZI7A 3AVYA 2IU6A 3WB1A 3A4VA 5DNUA 4B31A 3HHEA 3OTWA 4M8NE 4MPPA 3OPVA 5CX1B 4B6OA 1SZPA 3ZJUA 3WLKX 5KIAA 4KQIA 5ALOA 1XU7A 5FJJA 4AICA 4DRXB 1M8GA 5EQFA 4O6VA 2IHVA 4XWYA 3K1AB 3KC2A 1ZC4A 2R00A 3D0QA 1GSIA 4U2FA 1G64A 1LXCA 1M7HA 2CXXA 5HRCA 3GJ4A 5IT4A 2QVCA 4RY0A 4Z99A 3OY2A 4FR2A 2MDTA 4QDXA 3TJRA 2YHSA 4CQMD 2CUTA 3M0EA 4C14A 5EGNA 2QXYA 3KSUA 4DPKA 2CXQA 2YWFA 4LF8B 1XROA 4V0LA 3RARA 2XNSA 1E2GA 3ED1A 5DV9A 1T10A 2YXEA 1XL0A 3T99A 1CJKC 2VUIB 1NXSA 3TZCA 2WJ4A 2Y05A 3M3PA 4BRSA 4FBLA 3LXRA 4IJVA 1FS5A 4NZPA 4BFUA 3NW9A 3MJTA 1OYOA 3OM1A 3QENA 4QD3A 4IH1A 1E6LA 3I34X 5AK4A 4AYXA 4B2IA 2J3EA 5LQJA 4D4GA 4C7KA 4EJ2A 2WSBA 1XO1A 4RZQA 4OXKA 3CSDA 1VLVA 4DRYA 4PLVA 4LAFA 4L7VA 2ID9A 3DVSX 4Y2HA 3EFBA 4DFDA 1YVRA 3C7TA 3PNOA 1T4MA 5ADHA 1U2DC 3G13A 3I32A 3EAQA 1W48A 1WPQA 4U3JB 3N75A 3UA4A 2D5IA 2PKWA 3A3OA 3DC7A 4ZYWA 5FUQA 2XIJA 1AHPA 1LI5A 4H1WA 2GPWA 3UXMA 4CETA 5LR6A 1Y3IA 3VU1A 1SRQA 4WEQA 5IABA 1KF0A 3CNEA 1E0AA 3AYZB 4OUKX 4WOKA 1YFKA 3WYCA 2QAGB 4OYYA 1M3SA 3IUYA 4BAZA 1DQPA 3NIGB 1I6KA 4NZ9A 4BJ3A 2NNWB 5FF9A 1UWKA 3TLGA 1P62B 3D4IA 4ZO7A 3GROA 2WSLA 4GC9A 4Q9IA 4K0KB 3HDVA 4XB1A 1DAPA 1N6PA 3O8BA 4GSLA 4YRMA 3JD1A 1JR3D 3DO5A 3LQFA 4L4YA 2G1UA 1GGNA 4CV1A 1S1MA 3ST7A 2X76A 1DZIA 4YFYA 2EKLA 2D1YA 1ZN9A 4D4KA 3VO1A 3IQDB 5ITVA 3INRA 3EXFA 3CW8X 3QEBZ 2IGBA 2ZT7A 2QX6A 1UDWA 4PHTA 4CL8A 2AXNA 3BXEA 3MK31 4IRMA 1W93A 4IUCS 4UHBA 4PLGA 1OYVA 4E5UA 2C2HA 4FFLA 3EUWA 3GRVA 4YJ2F 3WGTA 1AKVA 4D8VA 5BN5A 4F1JA 1VL2A 1PUIA 1Z0AA 2DBYA 1H2EA 3WLTA 1UDBA 3OHPA 2N46A 4U2GA 4WNYA 3ETLA 5MDHA 3FVWA 3ZVMA 1ULUA 3C7KA 2IUSA 1Q91A 3A4YA 3QLVA 3NM6B 2X3FA 3ZGNA 3KZCA 4JC4A 4AJJA 1E96A 2D8AA 3DTVB 2V9ZA 3UHAA 2IOFA 2I71A 5AM5A 3QG5A 2HCTA 2FN4A 2JIOA 1V5FA 2Q6OA 2W93A 2XUJA 3FNFA 4W82A 2ZFUA 5JDIC 4QWMA 1JSXA 5DVZA 2PMEA 3OT5A 2PVPA 2Z8ZA 2ZRIA 3DC2A 3KLOA 5AW5A 3VR2D 2C8LA 2IP2A 4IZOA 3CMMA 4MV7A 4WLVA 4EDFA 4YRNA 4URZR 3BB4A 3QXHA 1O9GA 1X87A 2KM1A 4UTXA 1EFRD 4YRDA 3IQHX 1KMMA 3R3WA 3F67A 2HRDA 1CUVA 3B13B 1SURA 5DE3A 2MSEB 3E9EA 1LLFA 3VRHA 5CLFA 4IKPA 3LRPA 4EI8A 1K7YA 1EX7A 1QVZA 2YMQA 5HMMA 4OOEA 1YR6A 1RT9A 2HRCA 2TECE 4I1IA 4CMEA 5FWXB 2PUDA 3AR5A 4RYLA 3OCZA 2P9ZA 1KZYC 1G8AA 3D8BA 4WD3A 5E4YA 5AXBA 2WUWE 5LVAA 1J2JA 1SU4A 3LCUA 4IKEA 1OCEA 3EMKA 3KZMA 2FWNA 2VA8A 3BF7A 1R6XA 4MZDA 1A77A 1VSQA 4PY2A 4X93A 1MHTA 5ICSA 3L4KA 5K8CA 4LWOA 3SR3A 4YO8A 1KL7A 3AGPA 4D9FA 4WJLA 4DCCA 1THGA 3JAWB 4FFBA 4MUAA 4EATA 3DLBA 5AXDA 3GFQA 1V5EA 3FUCA 2HSJA 2EDAA 1ELOA 1T0IA 2VSQA 5P21A 1CW2B 4FHEA 4XX0A 3S5JA 5KNDA 3OJXA 3M6XA 2IX9A 2XLBA 3AG5A 3QU7A 3TNLA 1IEWA 1ODIA 5I7FA 2ZOSA 4BNJA 3LBAA 3JQGA 2V3VA 5BWNA 1JXQA 3ZHTA 4KAXA 3DOOA 5GAJA 5GV7A 2MYTA 3DGFC 1RLIA 2FEWB 4IRUB 4Q3EA 2OPBA 3LT4A 1Q3HA 3N8NA 1EAMA 1PT7A 4I4IA 1TIKA 3RAEC 3CE6A 1FNBA 1T29A 4M1QA 5D7BA 1GUYA 2HU2A 1GCGA 3BFKA 3MTAA 5D5QA 3RBAA 3IVAA 4EB6A 1KQGA 2NSDA 4NNJA 3U3OA 4MQMA 4IINA 4DOMA 1JYFA 3V80A 1KO7A 4DMUB 3H9JA 1D6SA 3SF0A 2VYND 3U1BA 3NVDA 1Z4IA 3I6IA 4R8RA 4MRRA 4WBXC 5H83A 1LQ2A 1A5BB 5LZ8A 2DKOA 4IFBA 2PT5A 3QUBA 4QASA 1NQXA 1SO8A 2B82A 4XOUA 4PNEA 1YTUA 1IN8A 3WNDA 2OAEA 1WR8A 2IRWA 2UAGA 1BX3A 3RC3A 1WNTA 5EIFA 2J08A 2HD4A 1PR5A 1WMSA 5EN4A 3BWMA 5ECDA 4A2QA 5KWIA 2FDXA 2X1HA 4B43A 2VBIA 3RODA 1T2UA 3WWOA 2CW5A 2IYVA 1UP4A 1IQRA 1Y5NA 1JN0A 2IF2A 4RTJA 1R16A 1BFUA 3LC2O 2XI4A 1A8UA 3QUQA 4PGGA 1WXDA 2WICA 5ALJA 1UPUA 3KUXA 2HA2A 1FJHA 3FMOB 2GKGA 4CKEB 3U4HA 1G7RA 1U0BB 2I1WA 3ZE6A 4W5QA 1G60A 1XOIA 2PQMA 1HBJA 2RB4A 3IV6A 4RDCA 4WPGA 1A04A 4W5TA 4M0EA 1J2TA 1J97A 1KAQA 3RGGA 1OFHA 2H2WA 4AG5A 2VNAA 1I6MA 2YRXA 2HA3A 3HWSA 5LP6F 3KD2A 3VDMA 2WHEA 3QVOA 2FG7C 1AMUA 3AMVA 4J7UA 5AKEA 4P3PA 3FTQA 2AJTA 4TV9F 3TAHA 3V7NA 3ZYCA 3NX4A 3D4BA 3OE7D 1EYZA 4W7IA 2V54A 1J49A 4DJDC 3DAFA 1EB8A 1EEXB 1G291 3K4PA 1E0DA 2Q1UA 1JIIA 3ADDA 5HEKA 3GLIB 4BNZA 3AXSA 5IULC 3KS9A 2I2XB 4G37A 4J0JA 1TPYA 4DY4A 1L0BA 4RPIA 4OYLA 4N12A 2QN1A 2R4UA 1NUQA 1IBLB 3GYBA 5I4BA 1JR2A 3MGAA 3AHCA 4M7PA 2CD7A 4PQRA 4Q4LA 3RK1A 2AC7A 3GFPA 2NZUG 1PT6A 3CLRC 1KPIA 3U7RA 4JLDA 3EA0A 1F2TB 2RK6A 3O8OB 3P0JA 2BM8A 4FFPA 5EKTA 4J3NA 4DCTA 4X62B 2Q9UA 2BKUA 3A9VA 3D7KA 2Q3FA 3LQ1A 3QFHA 4PNHA 2D06A 1XMIA 2X23A 3GH1A 5TPZA 3VOAA 2Q5FA 3OOYA 1BKSB 4Q9KA 2HV8A 2VHJA 2ZRMA 3VI4B 4BNLA 3OKAA 1TLTA 1IBRA 1KJWA 3RUDA 3TUJC 1V11A 1EIWA 1U2GA 2ZSHA 3NEJA 3IIMA 3WC4A 2R6AA 3PEFA 2B61A 2P68A 3CWCA 3E3NA 4JLVA 4P4SA 1F51E 5JSYA 3P0RA 4W1QA 3EPHA 1T9BA 4G5YA 2I1LA 1X1EA 3EJWA 4LUCA 5CP8A 2IV7A 1Y6RA 3WGVA 2NMVA 4N7JA 5HCNA 4ER0A 2X8WA 3EOBI 4UZFA 3LYAA 5ER9A 2ZIZA 1UZLA 4F9GA 1JA9A 2R1TA 1JB9A 2AX3A 2QP3A 3MMXA 1SOAA 4DMFA 2ZJ8A 3V9AA 1E0KA 1VL8A 1YO6A 3D6FA 3WGGA 2MMGA 2MHCA 3V8BA 3KBOA 2AOTB 1OU0A 1CUCA 2R2GA 2WWHA 3N7UA 4LJ5A 2ACKA 3N6XA 4DJAA 3ZNQA 1AM4D 2OGSA 4QBKA 4AUKA 1C80A 2FF5A 5FOUA 5FV7A 1V1RA 3D0RA 3AY0A 1BQ3A 2EX0A 4LQ4A 4M87A 4P53A 2ISCA 2Y27A 2DR2A 4PZ9A 4YJ3F 5LMZA 1C3LA 4EG4A 5HBRA 3QBVA 3DDCA 3JCZA 4ACAA 4EFMA 3SMQA 3SZOA 2ANCA 1OAKA 4K9SA 4BFLA 1JR6A 1QC5B 1WMAA 4M7WA 3T7TA 4KXQA 4C5CA 5BVGA 1IM2A 5EE9A 3ACDA 2C3UA 2V8BA 3AHFA 4IEEA 2HXSA 4HQRA 4KE8A 5DWDA 5GONB 4LE1A 4LDNA 1M76A 2JD1A 3B3AA 4LJ6A 3U4DA 1PFQA 2YJ4A 1OR8A 3I2HA 2XMDA 3H2HA 1YC2A 1G2PA 4ZT6A 4DMKA 4P5EA 1CZRA 4UDNA 3ZTYA 2KB0A 1KA9H 4O4HA 1L7PA 1GUDA 3A1SA 4OJNA 3DM5A 1G3MA 2OG1A 2G83A 3QPUA 1QUFA 4Y1GA 5AM3A 2HXGA 3IBGA 4FFVA 3OA2A 1EDBA 1LV8A 3VC2A 4WBNB 3ZWDA 3OQIB 3EW7A 1WSWA 4HL6A 3EZFA 1OTHA 2E4WA 3DLPX 1G20E 2XSZA 3LGAA 4FNMA 1N92A 2BZ1A 3H8WA 5K5EA 3HZOA 4II2A 2DF8A 2R1VA 2WWGA 3DEYX 4XPZA 4A0RA 4AKEA 1MW9X 2A7XA 3GFGA 4Q6WA 1DIGA 2IBMA 1QVWA 3EVNA 1FRQA 3WGNA 4TXNA 4GE0A 1MW8X 1FS4A 3AEYA 4M49A 1B3BA 3LCJA 2TS1A 5F3WB 3U4QB 4PAWA 4L9WA 3W2GA 2PR2A 2I7DA 2R6R1 1T5LA 2YWXA 3JQPA 4Q9JA 2ZSUA 4OA8A 2R5NA 1Q14A 3M1LA 2NAFA 4L5AA 2ESRA 1QKKA 2Q2VA 1W5BA 2XUZA 1UWLA 4IDUA 2VR1A 1Y1QA 1RJFA 2A14A 3M33A 2M1XA 4F6RB 2I29A 1K8QA 3LWNA 3I09A 4NU8X 4QG3A 1L7BA 1AHNA 1RQ7A 2YCLA 3NH9A 4AJIA 4AMBA 5J4YA 3U56A 1VGRA 5TJHA 4LTNA 5IFLA 2HGSA 3PHLA 2O8FB 4REQA 3H11A 4S2UA 2BGGA 1GKLA 5BN4A 4DWVA 5LU8A 3C6MA 2P4EA 3ZH2A 3ZVLA 5AVXA 3OD5A 4R7TA 4BFWA 3SE0A 3BF8A 3ZZUA 5A04A 2EGHA 2OD2A 4H9GA 1ULSA 5IYZA 4OJYA 2IA5A 2EKBA 4JZKA 4R2LA 5CDFE 1DIBA 3JWHA 1XKLA 1V7ZA 3A4NA 1QWSA 1NY6A 1CUUA 2VTBA 3VU0A 3KLBA 2I2WA 1OAOA 2ZB7A 4RD3A 1XVLA 4M99A 4DBZA 4ZCIA 2NVOA 3R3XA 4JKIA 3WYAA 1EK0A 2FSPA 4CM8B 3IDQA 4QHYA 3A1DA 5KZMB 3E7WA 1H23A 1B93A 3NVMB 1VIDA 4PLCA 1MA0A 4PLPA 3I0NA 4ECAA 4I4CA 5CVUA 1I1OA 5CM8B 1BEUB 3GT7A 4UUQA 5DX1A 5GPBA 1S8FA 4C01A 1XEFA 4P4TA 1X1QA 2C5AA 2NO0A 3I3OA 4WK2B 1RTKA 3IDAA 4TXMA 5DZSA 3N0VA 5DHSA 2JI9A 4UFPA 4LJ9A 4L50A 1DP4A 3GGCA 1L5VA 3EFOA 1L4FA 4C6HA 1QYRA 1I10A 3GCXA 3R7AA 4EHAA 1ZN2A 3MJHA 2DM6A 2MSCB 2WIGA 5IM5A 1IBKB 4B34A 1GCIA 4C6TB 4ANFA 4R81A 1K63A 5DRYA 1Z4QA 3RF7A 1Z0KA 4EUSA 1SCKA 2FK7A 5FP0A 4LOHA 1VJ0A 2GF2A 3ZBUA 3WV4A 4KITB 5IXYA 2C2ZA 1V26A 4E11A 3BERA 1N6IA 1HTTA 3E05A 4TYQA 3HWX1 1K2VN 2WU8A 3JTEA 4IJSA 3EG5A 3DZCA 1D2AA 3NTUA 3VNRA 1M7GA 1CSEE 4NV1A 2I6QA 3I9V6 4B45A 5DO9A 1I3MA 4W5OA 1RBQA 4Q1DA 1U2DA 5DHQA 4EUHA 1WZUA 3AL2A 2A5GA 2B5OA 1WXGA 4RHTA 1ILWA 4RVHA 1ABBA 1NKSA 1P6XA 1ORHA 2ZJ3A 4J1TC 3B3QA 4EY5A 3L92A 4CBVA 5JS6A 4UEOA 4WZBE 1FFCA 4KO2S 1Y4AE 2Q99A 3LT0A 1KEKA 3CZAA 2XOXA 3VDQA 2CE7A 2QAJA 4TTTS 4NBLA 1ZM7A 1ZK4A 4ER7A 1WCXA 2G0AA 1S5PA 4YPOA 3GG9A 3UB2A 3WMGA 4J4HA 5B58C 1RKUA 5JC8A 1IOWA 4N1AA 1A8SA 3WWPA 1H8HD 4KE6A 1JQEA 1YZQA 2JLYA 5IXSA 5LMCA 10MHA 4X3PA 3G2JA 4I6EA 3E82A 1A9XA 1Q3TA 3AI2A 5KQRA 3PC2A 2GAFA 2NV0A 4N4AA 5EEGA 2WWVD 1VGQA 2EIXA 2YUIA 5JQGA 2ZSKA 4B4VA 1EHCA 2WBLC 4ZFNA 1PEAA 4HH3C 3L7KA 2OD7A 1RMTA 4MR8B 2DB3A 1P8AA 4CTNA 1KRXA 3CH6A 5KC9A 3HA5A 3E9YA 1IHOA 3KR0A 1W1WA 2A1UB 1JFSA 4ESVA 2WJZB 1IZ0A 1G3RA 2UZ3A 5GM1A 2C7RA 3THRA 4MYTA 4L27A 1YZFA 4RK0A 2W22A 1JQDA 3LSTA 1Q1BA 2P9HA 2WJAA 3BIWA 4KW7A 4S1PA 4W8GA 1AT1A 4L5YA 2X2PA 3SX4A 2QL7A 2P9BA 3H6HA 5JAQA 4NNPA 4NZMA 3RKUA 5T3YA 4F2GA 1YFJA 4PLZA 4KIUA 4OKIA 2G82A 4P3YA 2YOGA 3L9XA 1QP7A 5EQDA 2ADOA 4WK4B 4IQ0A 5I51A 3H19A 2UZ1B 3H6GA 1Z8HA 1BOOA 1VJCA 4KFRA 1ML4A 2V7VA 2IHUA 3QE3A 1Z83A 3PP8A 1RZ3A 1SUAA 1PI3A 5JDIA 4TL9A 1VI6A 4DB2A 1ZH0A 1F2VA 4V24A 1VXOA 1O6GA 4LNAA 1QGYA 3CUKA 2FQQA 3WXMA 3UXYA 4KZKA 3FOAA 5JSZA 3LGSA 4C7JA 2WV7A 1WVGA 4RLSA 2FN3A 3C3XA 4TS4A 4RD6A 1NJ6A 2BFNA 3H3XA 3MJCA 5KX5A 3WQQA 4AD8A 3KFVA 2QZ9A 1FZQA 4TV9A 2R6ZA 3AJEA 1Y1PA 5CB0A 2NZYA 5L95A 2DPYA 1M75A 3TGPA 1N2CE 2QORA 2N0SA 4XGIA 4IVQA 3KSMA 3AF2A 1EZZA 1T0UA 4ND4A 1Z06A 4A26A 3RE1A 4WL0A 4U63A 1Z4LA 4GR9A 4MH0R 1GPMA 3TQQA 5C8XA 1JU3A 2RG1A 2GBFA 1IY0A 2FWPA 3DE2X 5F78A 1TQ2A 3VZDA 3PFIA 3AF1A 4JT9A 5KYUB 3CB2A 4CIYA 1QSGA 5IF9A 5IC5A 4E07A 2BLLA 5CA1A 4CG3A 5HIKA 4G1VA 4UNPA 4CQLB 2CUKA 1Q1ZA 2FWJA 3B2EA 3C48A 4X92A 1S7GA 4XSVA 3LWDA 1TA9A 3CEMA 2GJSA 2PCLA 3NVAA 3PNSA 3TTVA 4F8JA 1RMQA 4HAWA 3IBTA 4QGSA 2D0PB 1NPDA 4UU7A 4Y18A 4B6PA 4JT2A 1FFAA 2UYCA 3HMQA 3GL9A 5TGTA 2A5LA 1Z88A 1H2AS 3WDSA 4D1YA 3AR9A 3L79A 1MX3A 3WGMA 1CJSA 2X5XA 4OQZA 2AQHA 2YVAA 4MPDA 1EAYA 1KKUA 3OJFA 4MIEA 5DMXA 5IX8A 3WLEA 1NFQA 3NANA 5AMXA 3KJFA 2YC2C 1R4MB 2BEKA 4TS3A 1QOZA 2C2GA 4KXMA 4ZHQB 5GGYA 5J2UF 1AXGA 1KSGA 1G2OA 2RK4A 1ZUIA 4F8YA 2RKOA 3UAOA 3WGQA 1RC0A 3OLXA 4ZXFA 1G3UA 2CB0A 1XTKA 2JAXA 5J1TB 3OFNA 3V7YA 1BXZA 4AMVA 3JQAB 2I4RA 4ID3A 4TKUA 5AKIA 4B09A 3EXEB 4DA8A 4IXMA 4AIIA 1LF0A 2OORA 4WT7A 5SV2A 2WIBA 4GMHA 4O0LA 3T1NA 1XDZA 3MJVA 3W78A 2WZBA 1SBZA 4HDCA 1HUQA 5AVTA 4QFMA 2AN3A 1G5HA 1WOYA 2FHSA 1MH1A 1RKQA 4YJ3A 5T6MA 4HDSB 5EMMA 4TMZA 1X7ZB 2IZ5A 2QI9F 1E2DA 2A0XA 1JHZA 3F6SA 1QF7A 3H8JA 1H1TA 3KVRA 3TD9A 1M0SA 1ZJZA 3S1LA 5AJUA 1BXRA 3FWNA 4UREA 4NLLA 4QVKA 3D5EA 1OZFA 1ZRSA 2B0CA 1NLUA 2POCA 3WJAA 3HJAA 3MUEA 3NAGA 1AKQA 3ICVA 1MRZA 5GWXA 2IXEA 2VPTA 4R8MA 1DB3A 1MT0A 2YJ5A 5TMDA 1AN9A 1L1EA 1K6EA 3QMMA 4S1TA 2B2NA 3OUUA 4GE3A 4ZN6A 1AN0A 1WB6A 2YFYA 4HYEA 2PQ2A 2ZS8A 1GQQA 4F0JA 2F55A 1JIJA 1ID8A 1JFRA 3JQFC 2FZKA 3ONEA 1Z82A 3S8MA 4DB4A 2UUAB 1LLUA 1ZNXA 1Y7LA 5JS1A 2ZRKA 1ZHHA 1OWNA 2YMPA 2W70A 1RQNA 4QICA 2V6MA 1KFJB 2JHCA 5AHXA 4G26A 1US8A 1ZXLA 3FFTA 3G7SA 1LC3A 1CDZA 3ZD8A 5B12A 5JZSA 4JQCA 5D3MA 5BV2P 2J4FA 5FEUA 4LCEA 1Q0TA 3SYKA 3QBDA 4CFYA 1LDBA 5ECWA 3CEPB 5GP1A 1WXHA 4DVJA 3CEHA 2GA8A 7ADHA 5C4MA 4TZTA 1EXNA 3C5CA 1L1RA 4LMRA 3UKDA 3NC0C 1S2GA 2Z04A 2D54A 3QFFA 1X3LA 4IEFB 2G77B 4ML3A 3NZEA 1E62A 4IGEA 5EWMB 4C43A 1Q17A 5FR1A 1IE3A 3ADCA 3O3OB 2NVBA 4KBYA 2GCOA 5TQ0A 4AYWA 4EFKA 5TIIA 3PNKA 1DTWA 3PBKA 2P3QA 4WXHA 4LGYA 1FP2A 1CY6A 2QVZX 3ETNA 1RJDA 3X1WA 1C3OA 3F8WA 2AN4A 1AC5A 3AK4A 4N0PA 2BGLA 1CJBA 4TN5A 2UU9B 2GB4A 3BXXA 5PGMA 1SBIA 4KRXA 1JG3A 3ZY2A 3TECE 3IPAA 5E6SB 3C3JA 4FJ1A 5FO0A 2AUMA 3UJ6A 3WZLA 4D0RA 3UWDA 1LRKA 2Y0BA 1S4QA 4FLEA 2NUBA 2C77A 2YASA 2JW5A 1KHHA 1QHIA 3PIRA 1H3EA 3E23A 3L4SO 2ZI6A 4ZICA 3I76A 3O26A 2DFDA 2XXBA 3CR8A 3QPAA 1JMKC 2BGRA 3ETCA 4OHBA 1YR1A 2R6JA 5DTEA 4A7PA 4D9GA 1JZQA 3W7BA 4CV3A 3LT1A 1TJ4A 1XHEA 1FIUA 1VJRA 4ER6A 5CPFA 2PCJA 1NXQA 1QH8A 2QPTA 4ISCA 2NVUB 3VX3A 3BS4A 1CVIA 1NW3A 3HKBB 4OLFA 2QAIA 4RZ2A 2F2TA 4UKDA 3X1KA 2YV5A 2OECA 4AKIA 3AVWA 1H0KA 3KAQA 3IA2A 4FSHA 4LMPA 1BN7A 4EKNB 4F91B 4I50B 1KNXA 1DBIA 4PVDA 1QTIA 4LY6A 2GM5A 2DC1A 1R6DA 1TB4A 2GFQA 3C6XA 4BMDA 4YJDA 4ENQA 3EZXA 1NWHA 1GGFA 1V5IA 2UVPA 2FFHA 3CTMA 1J0CA 4IG4A 3ZS8A 2B34A 1LK5A 5BURA 1SM4A 1QF6A 1GZ7A 5T67A 1N2OA 1U7OA 2X7HA 4MQEB 1A4UA 2PA3A 4NU5A 5E2AA 2BPOA 5FOWA 1KVRA 2CF6A 2VTKA 1J9EA 1YA8A 2IHKA 2V6IA 1YU6A 5EPUA 5IU6A 3A1FA 3HB0A 4G0NA 3EB9A 3HSSA 2ZBEA 3T3MB 4EA8A 1S2NA 1E1YA 2ODPA 1WV0A 3WS7A 4F72A 1H6DA 3ELDA 2O57A 4L85A 1NTOA 1X9HA 3TF5A 2RD2A 1VRCA 2FSUA 3CZ4A 3WMXA 1ILEA 3ZXXA 2D0DA 1K9SA 3ZQUA 3DDUA 1ODCA 1Z7GA 4OK3A 4AP6A 4JI3B 5FA8A 4NTZA 2IHYA 3B1JA 4NYMQ 2GM3A 4ZARA 5HS6A 3E9ZA 3V3TA 3WYNA 4CQMA 5A3JA 3IT0A 3DPSA 1GL9B 1W73A 6ABPA 1O6ZA 3QEMB 1EGAA 1D1SA 3AKDA 2H1SA 1ENPA 2PSHA 3AB3A 1XLVA 2ATEA 1LDMA 3LYUA 1Y63A 3P71T 4EHHA 1L4EA 1LBQA 4O1IA 4M0FA 3DZGA 1JPVA 2GLXA 3OESA 2H5LA 5KKAA 4AZWA 1Z7BA 4IEIA 3FTPA 4ZT2A 1LBSA 1E98A 2FPPB 3GVHA 2ZTSA 2ONJA 2KX7A 5CEFA 3F3SA 2PUAA 4FOLA 3A6FA 1FLAA 4LXUA 5JCOC 3F0TA 3I0ZA 1Y9EA 1GA4A 4YAFA 4HQFA 2GH1A 5EZYB 4IGAA 1CUZA 1GL7A 4GQIA 4JJIA 2WHPB 4BO8A 2HJWA 4WAUA 3A6KA 3Q0EA 4ZKDA 1L5OA 1QX3A 3L8DA 3K94A 4F04A 2QYOA 1J0DA 4FJ0A 2FOIA 4GZ3A 1GPDG 4ATNA 1NA5A 1O0BA 2DR0A 4BB9A 2G17A 2G4LA 3QELA 4MQFA 2H2AA 1ECPA 2HHCA 2OB1A 3PR2B 1FPMA 1EFCA 2QGZA 5AVZA 2OLJA 1ZR4A 1T9GR 4M0KA 3Q7SA 1K2WA 5BWMA 2YZGA 4KGXA 4QA9A 4Q4DA 2ODAA 2OHIA 3IAAA 4QZVA 1U3CA 3KQWA 1F2UA 1H5QA 4M9XA 1EX9A 3QE4A 3X1MA 4YRSA 3UQYS 2W4MA 5HA5A 5HW0A 1XMPA 2NU6B 2QVBA 1SB8A 2WR8A 2Y1WA 2BF4A 2PVSA 3GPDG 4MHTA 1TT5B 5FI0B 3HJNA 2CHEA 3M8KA 3LUHA 3WFJA 3H18A 3L0BA 4NENB 4ZMBA 1UXIA 4OH7A 1GAQA 3WL5A 1ZONA 3IO5A 1GPBA 4IIEA 1G5IA 2CDBA 2BN4A 3P27A 4FE4A 3HY3A 2PMFA 5ARCA 5KREA 4OFWA 2ZRCA 1TF5A 1QCZA 4QODA 3B3GA 5JC1A 1U0TA 4JLOA 1GTSA 4H08A 1AH2A 3ORYA 2PRKA 2XQFA 4AC9A 3VR1A 2E1PA 3MS4A 3AVUA 2J3JA 3NYQA 1SRRA 1OWLA 4W1RA 5JWHA 1ECJA 1JHPA 2BR5A 4HEQA 1XVVA 2XEDA 3T7JA 4E21A 4MRPA 2J5QA 2WKWA 2Y2UA 1KK1A 2RGXA 5E7JA 1PEKE 1L5LA 3WGZA 4D9IA 4Z7OB 1IXKA 4RXTA 2A2ZA 4F46A 4Z4GA 5JG7A 3SYLA 2MINB 5HHTA 3B51X 3AIIA 4NJMB 1KZ1A 4I4TB 4ZJZA 1NJFA 2C8KA 2IHJA 5G02A 3MQ2A 2QA5A 4OREX 2A1TR 3O9ZA 2HHJA 4OMFG 4WKGA 5K4AA 3O47A 2RKBA 3PYMA 4FGWA 4JC5A 4X71A 3OLCX 1C1XA 2H16A 5G1OA 1HNZB 1PK9A 4HO1X 5DSTA 2PV0A 3CEAA 3QZUA 1KI1A 4LY3A 3O4HA 2RGBA 4LOIA 3HUUA 3ZCPA 4RKWA 4ZT4A 4R0MA 1RWXA 1VA5A 3LT5A 4QRIA 2WAMA 1WU7A 2GX6A 1PFUA 1KWKA 1FFBA 1UEXC 1CF4A 1J8VA 4P22A 1TU3A 1GZ5A 2DPGA 3DH0A 5D3ZA 2O3RA 1JDSA 2ZWIA 4JYCA 1FDTA 1NJ2A 4UQPA 5HBGA 1V8DA 1C7QA 2D6FA 2VJMB 4E5YA 3RC7A 2I2BA 5CEEA 4J1TA 2A3NA 4ZTUB 4H0CA 4RSGA 5B3KA 2QMEA 1JR4A 1X38A 3GRFA 3L4EA 3DYBA 3I9FA 5J5AA 3WVNA 1L7EA 2PX5A 5JPDA 1SOMA 3OPYI 4ZZ1A 4AO6A 4R5HA 3HR4A 3ZVRA 3LUBA 3UH1A 1QG4A 2QWXA 1Q7GA 3GI1A 3ND9A 2LDXA 4N65A 3PXCX 4JJGA 3HA7A 2XXJA 3C3MA 3KJXA 3P2MA 1N7IA 4H0NA 3D3KA 2NSLA 1H22A 3DD5A 2WE8A 3Q8WA 1YSCA 4LDJA 5I9MA 3RNOA 2BTOA 4O4IF 1WPGA 2GRJA 3O2QB 1E3WB 3ZGXA 4HXGA 3DTYA 2J30A 2WTAA 1YRAA 2QX9A 3JSAA 3OZEA 3IUNA 4Q9NA 3RG2A 4AWAA 2XCSB 5FQNA 4LYHA 2I55A 3W7AA 4BNFA 1RYDA 3AESB 1J0AA 3PS9A 4OLAA 3WY9A 3SC2A 1KI6B 1PO7A 1BZYA 2JLRA 2PL9A 3D4PA 3L18A 3TSYA 1TM3E 3WQHA 4QUKA 1T0JB 2G04A 3DYVA 1QYVA 3GGDA 2RDMA 1KMQA 1FRZA 2X13A 3MINA 4GOKA 5KX5B 2X3UA 1BTOA 4FGZA 2CKDA 3T95A 2KLBA 4HXEB 1RZRD 3I1IA 3OQVA 4IDPA 4DM3A 1OT5A 2WMYA 1PJ3A 3LDAA 4CV2A 1LU9A 1QS0B 1EDZA 4LZOA 5LQNA 1RLUA 2A92A 4WVFA 3ZDBA 1ZJYA 4DA0A 4ADSG 4FZJA 1XXHB 3LX8A 1D2HA 2GTPA 4JHXA 2YYSA 4MYDA 5EJGA 1YA6A 3AKYA 4QYXA 5BVHB 4FE3A 3M2TA 1Y8QB 3FYUA 3MBIA 1QZTA 4XIYA 1QZUA 2O2DA 3HB1A 4BMVA 5HKOA 4R7ZA 4RTMA 1YRYE 3EZ2A 2LR0A 2W4IA 1NVEA 4E33A 1D1TA 1RHJA 3OEWA 2QRPA 2QU8A 2ZWAA 4ZVSA 4WCFC 5AK6A 3VYTB 2IHZA 1ZN8A 1T8SA 2JI8A 4XWKA 5LQAA 1QO7A 1M2JA 1NF8A 2PUHA 2YV3A 3AZOA 3I83A 3IOEA 5H3LA 3T54A 4EENA 1D4OA 4LHSA 3OO1A 3NHAA 3PDJA 2Y1OA 4TTVA 2RGAA 3K0FA 3FVQA 3OOWA 1KDOA 3SM3A 3BRWA 5HJ7A 5LYJB 2QQ0A 3TAUA 4CLXA 5ADUS 1JF8A 1FFWA 1RWNA 4K9KA 4MW7A 5F73A 5LZ7A 3C3WA 1X1CA 5ILGA 4CPDA 4DWWA 3VNQA 4YJFA 4F7DA 2QW0X 4BX2A 2JK0A 4CMJA 1PTKA 2H57A 1QRTA 5CA0F 2HNAA 4BYMA 3G0HA 4KIJA 3U3JA 3DCJA 1WCWA 2A9VA 3ZDFA 4TQ9A 4L75A 3PPIA 1KBZA 3QNMA 3ZIAD 5JD3A 4ZZIA 4Y9SA 1W4LA 1U8AA 3OPXA 4OBEA 4X3OA 4QT4A 3EZ9A 4I1PA 1QCYA 4JBYA 3RQIA 2NYRA 1CQXA 5LJLA 4HK4A 5EKXA 3OE7A 3U3RA 2D3WA 3IQIX 1W4RA 4ONEA 4B7AA 4Q9HA 5F4BA 4TKVA 3A1CA 2YIVX 5SYAA 4D8XA 2GEBA 1ONBA 1I30A 2PKEA 3LRTA 4AJOA 3QOYA 3FPBA 1NWCA 4D0NA 3GLIE 3K9CA 1FDSA 3MCTA 3SD7A 2W48A 3PKIA 1XZQA 3ANMA 3RAGA 4INOA 2GHIA 2WHRA 1Y34E 2N1BA 2JJ8A 3UMGA 3VPXA 4Q7MB 1SOUA 1QCCA 2FP4A 4DAEA 2D8MA 2Q0QA 3AUSA 4N49A 5AVUA 1WVIA 1EUDA 2C07A 2IYSA 2FSVC 2QRKA 2R86A 3ZLJA 2J9FA 4Q03A 2QRZA 2OAGA 1N3YA 4JOQA 1SWVA 4X63A 1KJIA 1M34B 3AF0A 3OJOA 4TM7A 1UKVY 3VNAA 1CE8B 5JZ9A 4BWGA 3A28A 5AJXA 1QWOA 2YQ5A 2B6NA 1YMUA 5KQLA 3NV7A 4RV4A 2MR5A 3KEGA 5EWLA 2P2ZA 1GU0A 5LNK6 1GPH1 5LA6F 3FRJA 4DUGA 2IY7A 3ES9A 1MFPA 3TL3A 1CULC 2XVXA 1KDZA 1IN5A 5A9RA 4LS3A 1W9HA 3DVAB 2XYVA 3DO8A 4BQOA 2Z1DA 1N2JA 3L7YA 4FCTA 4AQDA 2WTUA 1OLUB 7GPBA 1WUTA 2SKDA 2Y8EA 1CUGA 1G7CA 1JXOA 1OAAA 1WS6A 3GRYA 3NLLA 4M54A 3WIUA 3FWYA 4RY9A 1TYDE 2OBBA 5LLSA 1FYFA 4NFLA 4NJOA 5IANA 1G21A 2FMUA 5DCYA 3ENNA 4D9KA 4RH1A 2FN7A 4QGHA 2ALJA 4UHEA 4WBSA 2ANBA 2CXOA 2RKWA 2PUFA 3DR3A 4QHTA 1P2FA 4RU1A 4BKMA 1QG6A 3B20A 1XDUA 4LHVA 1TZMA 5GTDA 2RONA 4H60A 4KR3A 3A1TA 3D6TB 1D0VA 1EM6A 1E9EA 3HGMA 1SUFA 1ATIA 1B43A 1E5LA 2QZJA 4MKHA 4YV7A 2XE7A 2GRUA 1L7VC 5FD8A 5AW8A 1RRPA 2JFVA 4AZ0B 3G23A 3HY6A 4LZJA 4KQCA 4UZEA 1L1FA 2JBWA 1XA4A 4XUDA 2OZLB 1U2SA 3A9WA 3CTPA 3H9BA 4A6EA 2A58A 2BFBB 2CF5A 3FGZA 1WBBA 1V25A 1VBKA 3QWFA 1DWUA 1V6AA 2G5CA 3M49A 4K9DA 4YJHA 4YMSA 4WCVA 2I22A 5ALXA 3SLKA 3TAXA 1QO0D 1J7JA 1T4BA 4YUVA 1R0ZA 2JVIA 2A86A 4TV8B 4K88A 2VT6A 4YAJA 3QEJA 5H70A 4BNIA 1G8YA 1I7PA 2KW5A 4JQOA 1KMHB 3C8MA 4DDKA 3FCYA 2IOHA 3SHVA 4IS3A 3RW9A 1FP4B 1KAEA 4C3ZA 2W2KA 3R3JA 1JHAA 3B9PA 4IDQA 2BGJA 3C7AA 1KO1A 3KU1A 3SC6A 3WSTA 1TD9A 2HYIC 5FHQA 2Z4SA 3K0KA 4XW2A 1BG6A 1U0JA 2PEZA 1ADYA 4FHCA 2PIDA 4HTAA 1DOAA 3PWTA 4JOBA 2ZJ2A 2Q4OA 1RC8A 4DV1B 2M9MA 3V4ZA 4DWOA 5L45A 3KYCB 5IUNC 1E9RA 5I01A 1PL7A 5IS2A 3UATA 4BPBA 3TRDA 4NAVA 3UAVA 2IYPA 3NEYA 4G9BA 4OL9A 1QFYA 1F0YA 2C2KA 2ETXA 2CVHA 4KWIA 3EXFB 3RM3A 1E32A 3DZ8A 4MW2A 2HBQA 4ZU6X 5JEEA 5JYEA 3WA6A 5HTOA 5KYYA 1M2EA 1P73A 3B78A 1H2WA 2AXQA 3R9XA 4D92A 1NR7A 1FSFA 1GTMA 4C07A 4UTVA 1H93A 2H06A 2Z8YA 1LSJA 2PSSA 4DLWA 1JIXA 1GCAA 2JFHA 5BN5B 1SVIA 2JCVA 2XBMA 3AEQA 4E1VA 3DEJA 2DMRA 2FE1A 1ZVQA 2XUAA 4HZIA 2YW2A 2R87A 2Q9BA 4BMCA 5ABPA 3OTQA 1IMOA 1HYEA 5BN1A 3KD3A 4OI1A 3W79A 1A5SB 3DCIA 2OHFA 3K71B 2UYGA 2CC2A 1QAQA 3G17A 3BB3A 1WWKA 1SZDA 3ESYA 3RBZA 2H9IA 3L7OA 5EFOA 5T64A 1SBQA 2VC2B 3E22A 4GWLA 1IUKA 4RBNA 1Z56C 2IIPA 1QHNA 2F6RA 1IRXA 2P1DA 2XWJI 3OVMA 4JQYA 3RLFA 4DPLA 2RIRA 5HZMA 2Q8PA 1L7NA 3JQ6A 1D2RA 2IX3A 2IUYA 3GP3A 3QX7A 2GKSA 4QRHA 3MD0A 1BXKA 4RD1A 4R1PA 1WHSA 1OFIA 2P5UA 3VR6A 2XGSA 4C3OB 4Q48A 3TQTA 2ZPTX 4BGPA 3T6KA