1Z74A

Crystal structure of e.coli arna dehydrogenase (decarboxylase) domain, r619y mutant
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
342
structure length
326
Chain Sequence
RTRVLILGVNGFIGNHLTERLLREDHYEVYGLDIGSDAISRFLNHPHFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNPENEASIEELGEMLLASFEKHPLRHHFPPFAGFRVEHYKPSIRNAHRCLDWEPKIDMQETIDETLDFFLRTVDLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein ArnA
publication title Structure and Mechanism of ArnA: Conformational Change Implies Ordered Dehydrogenase Mechanism in Key Enzyme for Polymyxin Resistance
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 326
sequence length 342
ec nomenclature ec 1.1.1.305: UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating).
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1z74A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1z74A02
1DIAA 4HFMA 2GF2A 4DXHA 3F46A 3G49A 3ETGA 3JQBC 4I8XA 4RDHA 2PD6A 2ZTVA 3H9QA 4UUMA 3WGYA 2DTDA 2B5VA 4BGIA 3KEOA 4E5NA 4MVJG 5KWEA 1ZH8A 4WE3A 4U5QA 1TT5B 3ZW8A 4WLNA 1NXQA 4IQ0A 4WLVA 2YDXA 4EZBA 2P9GA 4NG5A 2A9FA 2GUGA 5I7FA 3QP9A 1VKOA 2HKIA 1HRDA 3TZ6A 2CDBA 4BNJA 2Q50A 2ZIZA 1CRWG 1PGOA 3OQBA 4J1SA 4K1LA 5CEEA 1AE1A 1PS9A 4I5FA 1JAXA 2EW8A 4URFA 4IY1A 4HADA 1TI7A 2AA3A 5IDYA 3VH1A 3WBFA 5ER6A 4ZJUA 2I99A 2CFCA 5EESA 4U7WA 5JCJD 3LDHA 3PQEA 3AM4A 3BTVA 2GN8A 1LTHR 1Y1PA 2YHIA 2WYUA 3VVCA 3LT4A 1HDXA 4IQ8A 1AHHA 1P3DA 2X58A 5JO0A 2ZJ1A 3U4DA 1B8UA 2P2SA 4Z3DA 6ADHA 1E0DA 3GEGA 4E6PA 4FS3A 4DGSA 2E4AA 3LQFA 4ALJA 4DRYA 1R4MA 2V7PA 3GGPA 4R41A 3HWRA 4U6QA 4YXFA 2W2KA 3LYLA 1HYEA 3OIDA 4I1IA 3OM9A 3VTFA 3AU8A 5HWSA 1X7DA 1MG0A 4ESOA 1DFGA 2XXBA 3WICA 2NVUB 1LC0A 2HSDA 4Z9YA 4CUJA 3PJFA 2Z5LA 3ZNOA 2GSDA 4XYBA 4UEJA 4FFNA 4BNIA 4E12A 3VC7A 1JN0A 1NHWA 2IEDA 4XDZA 4CR6A 3INTA 2V6MA 1Z73A 2DPHA 1U5CA 2ZCUA 1HZJA 2B4TO 1U2GA 3I83A 4XX0A 4IINA 4J9VA 4ONEA 2R6JA 5FF9A 5DBGA 1YBVA 1T2AA 3WIEA 1D4FA 1LDEA 2C29D 3AUAA 1PSDA 1AXEA 1NVTA 3GVIA 1G0NA 2SCUA 1R16A 2VCYA 1OAAA 4B79A 5ITVA 1K6JA 1NVMB 1XELA 5C5IA 3QHAA 3ZWVA 1ZMOA 2ZB8A 4KDEA 4UVHA 4KP7A 1J0XO 2NTVA 4O1MA 3O4RA 1C0LA 4P4LA 1DB3A 3LF2A 3NDRA 3ABIA 4I5DA 5GZ1A 1LLQA 1N7HA 7ADHA 4FSHA 4A7PA 3H5RA 4L74A 4MKRA 2D2IA 4CM3A 4NFYA 3WJ7A 3IQDB 1H2HA 5FI3A 4JROA 1R0KA 5HRUA 5F5LA 2YQ4A 3JQ7B 4OIMA 1SZJG 2I5PO 1OZAA 3DQPA 5JBIA 4XJSA 9LDTA 1B26A 1Y5MA 3TZKA 1OOEA 1E7RA 2QRLA 1Q2XA 3AW9A 4KZPA 1R6DA 4MVJI 3NGXA 3S55A 5DCYA 1XYGA 5MDHA 4CLRB 4HWKA 3AWDA 9LDBA 4DYDA 3K5PA 4P4NA 1P0FA 1DSSG 1JTVA 1N92A 4GWKA 1KC3A 4YDRA 1XSEA 1ZFNA 4RCVA 4RVHA 1TT7A 1AUPA 4KUEA 1EVIA 3H3JA 4EUFA 1HTBA 4BNKA 1NNUA 2YFQA 3SLKA 4MIOA 1KBZA 3AJRA 4CMGA 1XIVA 4MP3A 4FQ8A 3ZNQA 2IZZA 1R15A 4PLGA 1RM4A 1LSUA 1YJ8A 1LQTA 1UUFA 2JHGA 1ARZA 3DEYX 3OFSA 4ALLA 1PS8A 4NJMB 1RJWA 3PWSA 3DZIA 3U5TA 2HQ1A 3AOEC 1HDCA 1DO8A 3PWKA 1E6EA 1E7WA 2Y93A 4OAQA 2RBEA 5K0ZA 2HU2A 4PG5A 4LK3A 5CDGA 1CJCA 1VLLA 1JWBB 2EP7A 3CEAA 1VJ0A 5L3ZA 3CE6A 1ZUD1 1Y9EA 4CMAA 2W90A 2OP0A 4Y67A 3DWFA 4FFOA 3I23A 4JLWA 3C7DB 3T4EA 3RFTA 4DYVA 3MJVA 3BIOA 5CDUA 3NAQA 4I5EA 2QZ9A 3E8XA 4LSMA 1D1TA 2I6TA 2AG8A 1VL0A 5CEFA 1KERA 3P2YA 1D1SA 1R0LA 3PJEA 5U9CA 1PGJA 4XRGA 3TZQA 1HSOA 4MIYA 3DO5A 4ZHSA 4UUPA 4BQRA 2X4GA 4FDAA 4Q3DA 4B4VA 3GN1A 4MPDA 4FOSA 1GCUA 3AY7A 3PZBA 4N5LA 1CQJA 4FCCA 5COBA 3X2FA 4J0FA 3NT2A 2Y1CA 2GZ2A 1X1TA 4I08A 1H0KA 4OQYA 2VNSA 1NPTO 3PJGA 4K6FA 4RVGA 4RVDA 3H9JA 1Y6JA 3ZDFA 5DN9A 4OXKA 2HDHA 2FWMX 3LT1A 3DTTA 4IDDA 3UN1A 4QXMA 2C7GA 3L4BC 4W82A 1G0OA 5DULA 4WNCA 5T67A 1NPDA 2PK3A 3OA0A 3WQRA 1E5QA 1QRRA 4F3YA 4ITUA 3JQGA 4CUKA 4B8WA 2POQX 4ZICA 4RVFA 3GNQA 2V65A 2EGHA 1V9LA 5BNFA 4CL8A 1Z6ZA 3VKUA 3AFMA 4K9DA 1HT0A 4J1TA 5EJ2A 5G0VA 3SJ7A 3CTMA 3ZWNA 2B5WA 1BSVA 2HJSA 4UUNA 4CM4B 1T2DA 3PYMA 1PQPA 1ZKMA 2BGKA 3UCFA 1NM5A 5COAA 4CMEA 1WW8A 4MVJF 5FYDA 1GZ4A 4RLSA 3F47A 2GN4A 4TRRA 3AM3A 4Y6PA 5CDTA 4DVJA 2FHSA 3LLSA 4AFNA 4DTIA 1E7MA 3PI7A 5L51A 1LSJA 4IMRA 3NDJA 4IDCA 1GPJA 3PIDA 1C1DB 4FPXA 5CPFA 1ZEJA 3ON5A 1N1EA 4XEHA 4NBUA 4RV9A 1IY8A 3MEQA 3FNFA 3N7UA 3EYWA 4HXYA 4PLTA 5BSHA 1YONA 3P2OA 4E5PA 1ZEMA 2ZYGA 4MVJA 4ALMA 2C82A 2V6GA 2WWRA 1ZK2A 1LLCA 1HLPA 4R3NA 1UXHA 4RPLA 4GGOA 1NQOA 4GI2A 2X86A 3D3WB 4CLXA 1PL6A 5A3VA 3LZ6A 4ALNA 3KETA 3JQ9C 4GPD1 4CODB 4D42A 3WGZA 3C85A 4BNUA 4RPKA 2Y0DA 3D7LA 1B2LA 1E3WB 1LDNA 1YS4A 3I4FA 4ZGWA 3ASUA 2PGJA 1TB4A 1VJ1A 2BI7A 1PL7A 5C7LO 1DC5A 3RBXA 4JIGA 2QG4A 4A0SA 1QSGA 5ER9A 3R1IA 4ZRNA 1PQUA 4H7PA 4F6LA 3KTDA 5F1OA 4XB2A 5K9ZA 3MJTA 5IN5A 3DAFA 4E21A 5G4KA 3IUPA 1QKIA 4BNTA 3BMNA 4PN3A 3AY6A 1I2ZA 1NHGA 1CEQA 2GLXA 3KYDB 5JCXA 3PHJA 1EZ4A 4BO3A 4YA6A 1QXSA 4PG8A 2VZ0A 3STHA 3MJEA 4BNHA 3GY0A 3WYEA 2NVBA 4GQAA 1ISMA 1F14A 1VL6A 3DHEA 1VRWA 5KKAA 5ITWA 4PCVA 1UR5A 1J6UA 4W7IA 2C59A 2Y05A 4DIFA 3E9MA 3JQ8A 5EERA 3GF4A 1ADCA 3W4JA 3V2GA 3HDHA 5JW6A 2G82A 3IMFA 3P7MA 5AOVA 4XIJA 3JD2A 3SC6A 1QYCA 5A1TA 2DM6A 2D5AA 2GCGA 4GX0A 1KVSA 3GR6A 3EZLA 1H6CA 2WJPA 4DMMA 5C37A 2D8AA 2JD1A 4NNJA 4CMHA 1ISIA 1L7DA 1PZEA 3JQAA 5GZ6A 2OZPA 3BXXA 5T6BA 4U0JA 5CAEA 1GTMA 3Q9NA 4FIZA 4QO8A 2HMSA 4BO1A 2NM0A 1DLJA 1LC3A 1PR3A 1PU2A 2CUKA 4W4TA 4WLOA 4YT4A 4GX2A 4DIOA 1NFRA 3O8QB 3NGLA 1HEUA 2Q99A 3FPCA 4L73A 2C7VA 1X0VA 3E6AA 4L4RA 2ZTUA 3G3EA 3GVPA 3AFNA 5FI5A 3CSDA 4Z9FA 1ADFA 3L9WA 1E3IA 1UZNA 1NAIA 3QWFA 3SX2A 3WS7A 4UUOA 2NWQA 1OBFO 2NV6A 1LBEA 5BSEA 4HFRA 2EF1A 3EAGA 3NKLA 4XIYA 4EW6A 1LI4A 2B35A 2NADA 3RI3A 4IIVA 4J91A 2Y99A 3GFBA 3ENKA 5L4LA 1DXYA 3D3EA 4LGVA 1GZ6A 3GDOA 3JQFA 3K31A 2XOXA 5A9SA 1T4DA 1BW9B 5JY1A 5BSGA 2HMWA 1B0AA 1WZIA 4YQYA 5DF1A 1MGOA 4GVXA 3R3SA 4J7XA 3Q9UA 1V35A 4AG3A 2GNAA 2I9PA 3A4VA 4D7AA 5I7EA 3LLVA 4XR9A 1ZMTA 3K6JA 4W6ZA 2JCVA 1U7TA 2VRCD 2PNFA 3G17A 3O38A 4RDIA 5TNXA 4GKBA 3IKTA 3ZV6A 1P74A 3BHJA 4FN4A 1SCUA 3RBVA 3RVDA 1V8BA 2PR2A 1HDZA 5I9NA 1M67A 4NBVA 1EVJA 5DCWA 4NU6A 4R16A 1MXHA 1NPYA 5HM8A 2BH9A 4Q3NA 4BNNA 1QYWA 2B83A 4BB6A 3D64A 3TWOA 5DP2A 2WMDA 3ZU4A 3RFXA 3ZWXA 1U2DA 1QG6A 1YWGO 1LSOA 1ZBQA 4E2YA 3HHPA 5I8ZA 3NYWA 5A05A 3WSWA 5G0WA 4BNWA 3K73O 3VZSA 1PZGA 4I9HA 2IDZA 2X0RA 3KYCB 1C14A 1GEEA 3I1JA 3SC4A 2VTDA 5I7SA 1PJ2A 4GBJA 4OOEA 3DXFA 4BNZA 1KVUA 4NBRA 5TLSA 1PR9A 1SEVA 3GHHA 2B36A 3ORFA 4F6CA 5B4VA 1Y5RA 3LVFO 3JYOA 5AXDA 2Q2WA 2WYWA 2CVZA 5TIIA 2AQHA 3ZCXA 1WMAA 3HE3A 4ZQBA 1HWYA 4PLPA 2AEFA 1T2EA 3JQDA 4J90A 3TSCA 4OSOA 4XKJA 3RJ9A 1E77A 3BTUA 3A28A 3WNQA 2RCYA 3H9UA 1W4ZA 2BFOA 2DKNA 2VWGA 2BFAA 1K5HA 4AJJA 3WXBA 1B8PA 3MWDB 5FFFA 5U4QA 3ZWPA 5ICMA 3JD4A 2CDCA 1Z74A 2VYNA 3GUYA 2X0NA 5IJZA 4WCFA 4LRSB 3S2FA 1JU9A 4PLHA 3PHGA 3H5NA 1BHSA 1B3RA 2NVWA 1BXKA 3ADPA 5EN4A 3AUTA 3BTSA 2X5JO 2YFHA 3VZPA 4YB8A 3KV3O 2C0CA 3WSVA 4CQLB 3UKOA 3CZMA 1U1IA 2GZ1A 1F12A 4ZVVA 4EJ0A 1U3VA 4DLBA 1Y8RB 3UGKA 2GASA 4XDYA 4B3HA 4Q9NA 1ISFA 3BZUA 2HMUA 1YQXA 5T8KC 3AK4A 3DR3A 3PPIA 3DOCA 3G0OA 5A5FA 2C54A 2A94A 3H2SA 2JCYA 3IAHA 2YDYA 4IGFA 4L0QA 1LSSA 3QVTA 1A5ZA 1QMGA 2Y0EA 4Y6SA 4XYEA 3U0BA 2BMAA 1W73A 2D5CA 1HSZA 3GK3A 2BELA 1O5IA 1QYVA 4Z9XA 2OBYA 1F8FA 1Z7BA 1VKNA 2VN8A 4IJKA 4JJGA 3D0OA 3FD8A 3MTGA 1DPGA 4BO0A 2X23A 3CH6A 3H9GA 3UH1A 1XQ1A 3B1JA 1GYPA 4R9RA 4YRBA 3TF5A 4ALKA 1E92A 4PZDA 4K26A 4LRTB 3A14A 4HNGA 3WIDA 3KZVA 2GRAA 4PLWA 1W8DA 2HK7A 1IUKA 2B4RO 1O94A 3GGGA 4WPGA 4BB5A 3KYBA 4EEZA 2CVOA 3HUDA 3BMCA 3FI9A 1FDUA 4UVEA 1ISHA 3JV7A 1HLDA 3GOHA 5G2OA 1NQTA 2PH5A 4CM8B 4JK3A 4OQZA 3ICCA 1KEWA 2YHUA 2CF6A 4OXNA 1BDMA 3JTMA 1DLIA 3OIGA 3PZRA 4O59O 3ZHZA 4B7XA 3B20A 4HNHA 1PZFA 1DRUA 2QIOA 3QQPA 2DVMA 3ETEA 5CEJA 1DJQA 4Z6KA 1MX3A 1UP4A 4TMFA 1OMOA 1M66A 3GVHA 4TVOA 1GD1O 3DBHA 4IZHA 3C3XA 2FY8A 3I9OA 1TT5A 2IRWA 2WDZA 5G4LA 2O7SA 1H2BA 8LDHA 2CZCA 1ZJYA 2PTGA 1FDTA 4HUJA 1ADGA 4FFPA 2F1KA 1PTJA 1N9GB 3NEPX 3DZHA 3F6YA 4ZQHA 1VE9A 3DMTA 4KQWA 4WCDA 4PVCA 3KSZO 4J7CA 2QW8A 3I9MA 2BGLA 3QIVA 4ZQFA 1MG5A 3AU9A 4RGBA 5KVVA 3I9KA 1VL8A 3DHNA 4OO3A 4R1TA 2EG9A 3S2EA 2Q1TA 3MJ4A 1ORRA 5IXSA 3H8VA 4P22A 1H9BA 1WMBA 1SNYA 3FNEA 1F8GA 3R3JA 4KOAA 4OYRA 4KUHA 4XCVA 4AJOA 1ML3A 4DWVA 3KRTA 1ISJA 3ZU5A 4ND2A 4UAGA 1B15A 2VUTA 4B3JA 4BGEA 1SMKA 1UJMA 4PRKA 4DQXA 1PJSA 1DC6A 4J16A 1GDHA 3ROMA 1CF2O 1CDOA 3Q3CA 3V2HA 3VKVA 4G81A 2WE8A 4EJ6A 3U4IA 1DC4A 1VC2A 3NV9A 3QRWA 5ILGA 3DFZA 3ONDA 1XLTA 3PP8A 4OL9A 3K2BA 3TOZA 4Y98A 2Q1UA 3I4CA 1FDWA 3HDYA 5TC4A 4N54A 3BAZA 2VZ8A 4XGKA 1VSVA 1KC1A 3QW2A 2W8ZA 1UXIA 1TVEA 1PQWA 1ZNQO 1O9BA 1YQDA 1HDYA 1PJQA 1K2WA 3FRJA 3FR8A 5DNAA 3FNGA 5IFLA 3JQ6A 3KO8A 3OJLA 4R9SA 5DT9A 4Q3EA 4WGGA 1DDOA 4JN6B 3JSAA 2IYPA 3UOGA 4M8SA 1E3SA 2YW9A 5G0UA 4QFDA 4WOKA 1PL8A 3C7CB 3UF0A 2OXIA 4J2HA 2Z1MA 4C7JA 2HUNA 1HE2A 1EUDA 2YHIB 3F5QA 4LSWA 4MINA 4NQZA 1E7QA 2Q2VA 1ZSYA 4IS3A 4II3A 5CP8A 1NWHA 3OIFA 1GYQA 2EERA 3PFFA 2PA3A 3RUHA 5BSFA 4FBGA 1I01A 3LT0A 4ND4A 4XQCA 3I6QA 1DAOA 2BHLA 3HNPA 1DHRA 3CINA 1KY4A 1T25A 2I66A 4PG4A 1EVZA 5AYVA 2DUUA 4E3ZA 1RYDA 2BRUA 4ND3A 4DMLA 5ADHA 5ICSA 1F0YA 4S3MA 3UAGA 4PLCA 3M1LA 2EWMA 4M87A 3ZV5A 3PHLA 3JQFC 4RJTA 4CQMA 2G76A 3RQSA 5KVSA 2W2LA 1YDEA 1J4AA 3UCEA 1YB5A 3ULKA 2Y1DA 2OP1A 4NH4A 3KSUA 2H5LA 5IZ4A 3GQVA 2D0IA 1NWCA 1E3EA 2Q45A 1A7KA 3JQ7A 1Z82A 4BHTA 4ZN6A 4YRDA 1NX6A 4RPJA 2AXQA 1Z7EA 4BO5A 2BD0A 4BS9A 1P1IA 4L76A 3KVOA 2O3JA 3ITDA 2X0JA 4RF2A 2P9EA 4YJGA 4AJLA 5EIOA 4A10A 1LUAA 1DEHA 2PKQP 2FOIA 3ANMA 3C1AA 3OICA 4U0KA 3ITKA 4CLRA 2Z95A 2VRBA 4XGNA 2CDAA 4B7CA 2NNLD 4D3SA 4PRLA 5TS3A 2CY0A 3ROQA 3C8MA 1X7HA 4MP6A 2VNAA 1R37A 1XWFA 4G5HA 5JSFA 4J3FA 2FPIA 1EE9A 2JJYA 4EITA 5AQ1A 2CVQA 4HP8A 3E9NA 2R00A 2NU7A 3G1TA 3GRPA 1PJBA 4NJMA 4P8RA 4CM5A 3WX0A 2A4KA 4WECA 3BMQB 3JYPA 4EYEA 1T26A 4OXYA 4F45A 2DBQA 1ZK4A 4II2A 1T1SA 1N7GA 2X5OA 1NASA 5JPIA 2DBVO 4Q3BA 1T24A 5A4DA 1E1MA 2GR9A 3HDJA 4MVJD 4PZCA 4Y8VA 1KEVA 3FHLA 1XCBA 3LC2O 4DUPA 3ETDA 2DU8A 4E5YA 1SOVA 4WASA 4UREA 2Q4BA 4FGSA 1E6UA 1UDCA 3ZN2A 3ZWBA 1PJLA 4TZTA 2VWQA 1VSUA 4IDEA 5B12A 2NQ8A 1JVBA 2O4UX 5KIAA 1H6BA 3QVSA 2UV8A 1Q0LA 3PRJA 2OMEA 4IM7A 3PIIA 2VHXA 3DBRB 3KBOA 3PFWO 5JCJA 1U8XX 2DUWA 4BMVA 2XXJA 1NTOA 2AE1A 3CUKA 4IDAA 1C0KA 4YYZA 2FP4A 1P1RA 4CL3A 3ZU2A 4GKVA 4BQPA 2EKQA 3L0DA 4DPKA 4EBFA 5CPBA 2EIHA 3OQ1A 3GZNA 4B3IA 2FSVA 1ZO8A 2H6EA 1CIVA 4E5MA 3H7AA 4J6FA 1E3LA 1QV7A 4PLZA 4BGVA 3SLGA 3FNHA 1HF3A 4JGBA 1YRLA 4FC6A 4ZQEA 3PYLA 2J8ZA 3ZNPA 4BO7A 1X13A 1EDOA 3DHYA 3HSKA 1KS9A 1KEUA 2R2GA 2IZ1A 1HKUA 3NDIA 4OGWA 5TGDA 3ZV4A 4Z3KA 4R54A 1NR7A 4R1UA 5HA5A 1V3UA 4M49A 2HK8A 4JBGA 3GC6A 3D5TA 1P77A 1PJ4A 3D1LA 3WLEA 1WNTA 2J5KA 1CWUA 3MOGA 2O23A 4LW8A 2HAEA 3GLQA 3GGOA 4K28A 4WUVA 3RC2A 3QVWA 5EINA 1ZSVA 1I33A 4YTEA 3WYBA 3OEYA 1LDYA 2ZCVA 3EW7A 4BNGA 1KY5A 1DBVO 1A27A 4FFMA 4CM4A 1NFFA 1LRLA 3JQAD 1I3KA 5I7VA 5JMPA 4JBHA 3RFVA 4KUGA 4QO7A 1FXSA 3E18A 3DTYA 3IP3A 4O63O 3F3SA 1NBOA 3SJUA 2D59A 3TOXA 1GR0A 1X7GA 3FR7A 3PLNA 4CMIB 5G0TA 4EDFA 4E5KA 1IHXA 3PGJA 4GLLA 4RORA 3I52A 2C07A 4ALIA 1IULA 3RIHA 2VUUA 1EMDA 1HDOA 1C1DA 3E5MA 3OJ0A 2NQTA 3ZH2A 3WGQA 2RH8A 5DBIA 2Y68A 2WD7B 1VJTA 2ZQYA 3ZI0A 5KJFA 4PZEA 1SAYA 3NRCA 4GX1A 5DBFA 5DCUA 4H16A 4JXKA 1DC3A 3S2GA 1LLDA 4C4OA 1R66A 2PGDA 3RAJA 3NT4A 4YT8A 2IZ0A 2VHZA 4M89A 2Q46A 1C1XB 3D3WA 3B6ZA 3RC9A 4B8ZA 1P1HA 1YOVA 5TT0A 3JD1A 2P5UA 4B7UA 5I8WA 1KIFA 1EUCA 3L9XA 1LDBA 1EE2A 4RVSA 5IXYA 3TZCA 1E3WA 3W4KA 4AJ4A 2DPGA 4AJHA 4MVJM 3WBBA 5CG1A 2EXXA 4RVUA 3QWIA 4NR0A 4OOFA 1WVGA 1PJ3A 3DOJA 4BMSA 3KEQA 1B16A 1QR6A 3W8DA 1TXGA 3ANLA 2FZWA 1IZ0A 1ENPA 2Y0CA 2FR8A 3DZKA 2A92A 2WM3A 3RWBA 3KYDA 2NU6A 1KVTA 1L1FA 5AXBA 1FK8A 3CXRA 5H83A 1D8AA 1P33A 2ZATA 1CYDA 3QE3A 3ST7A 3FWNA 3VPSA 3ADOA 3H4VA 1CQIA 2NLOA 1N5DA 3ZV3A 2JD2A 1JKIA 3WJAA 4CMBA 3Q2KA 1I2BA 1M76A 2GN9A 4XYGA 1BTOA 1FMCA 2GZ3A 2HMTA 3RSHA 2VUSA 3GA0A 1T2CA 5HS4A 4NIMA 4CMCA 1HETA 3LF1A 5JYDA 4R68A 5H81A 3HN7A 2J6IA 3DBVO 1LRJA 3TNLA 3B1FA 5TX7A 4A26A 1O8CA 2E6UX 4N5NA 4YJFA 5L7YA 3GDGA 4CM9A 3JYLA 4DLLA 4BGUA 3AY3A 4RF4A 2TMGA 2VTEA 3W8FA 1U28A 1XA0A 2UUOA 2TMDA 2B4QA 1A4IA 2NU9A 3ZW9A 4LMPA 4YJHB 1GPDG 2AQIA 4YAKA 2VYND 1O89A 3UHAA 7MDHA 4J7UA 4CR8A 3WMXA 4ZA2A 4F46A 4CM1A 4WLFA 2ZK7A 4QTZA 1T2FA 1BGVA 3O8QA 3AOGA 4CV0A 3BMNB 3D4OA 4DA9A 1U4OA 2G0TA 2X9VA 3HQ4O 1BWSA 3I9LA 2DTEA 2EV9A 2FR0A 1EUZA 2ZB3A 1GAEO 3G79A 5F5NA 5BT9A 5KJ6A 2RHCA 2FPGA 4J43A 4R5MA 1JWAB 1GUZA 2NSDA 2O50A 5LDGA 2GYYA 3FTNA 4YT2A 3LU1A 3HFSA 2QRJA 2WYVA 1ZXLA 1N8KA 2B0JA 2GERA 3CPSA 3SEFA 4DIBA 2JD0A 1MV8A 4M86A 3JQEA 1EVYA 2JL1A 4HY3A 4YBZA 5MGBA 4JQCA 2P4QA 4NI5A 3OBBA 4AJ1A 4KDFA 2YUTA 1Y81A 1I2CA 1BW9A 3FBGA 2O3SA 2X6TA 1LJ8A 1Y7TA 3VPHA 1JKFA 1VI2A 4G2NA 1LNQA 1KEPA 3EC7A 3OJEA 1AN9A 3D4PA 3K2EA 4A03A 2X8LA 3JQAB 1XDWA 5TT1A 4FOOA 1GADO 1U4SA 3I6IA 3RROA 4CM7A 4J0EA 4W9NA 4HFNA 4MVJP 4RQTA 2BFPA 1H5QA 2E82A 1ZJZA 3DMYA 3NJ4A 3TL3A 4DREA 2XF8A 5JNLA 2YV1A 1YL5A 2G17A 5LC1A 4EJMA 3GG2A 4CLOA 2R00C 5GMOA 3WNVA 3AUUA 2Q1WA 1A4UA 1S7CA 3WWYA 2Q1SA 4UEKA 4CMKA 1U3WA 3KYCA 5L40A 4AJKA 1DRVA 3EDMA 2Q3EA 2RHRA 3DZFA 1OC2A 1Z45A 1Y8QB 2FZEA 4H3VA 3A1NA 3OECA 2X7HA 1ZW1A 2GDZA 2DBRA 5B4TA 3RBZA 2W98A 3C1OA 3K9QO 5DOZA 1V3VA 2FRDA 3DC2A 1EQUA 1XR3A 4HKTA 4ZD6A 2O3RA 4FJ1A 2VHVA 3ZWOA 5HTOA 5L4SA 2PZMA 4YCAA 3KHUA 4CR7A 3E9QA 4XQ9A 4CV1A 3BMOB 4NDNE 2O48X 2PLAA 4PGFA 2YYYA 4TROA 3RCBA 1HXHA 3RU9A 1K0UA 4IJUA 3HJAA 1X0XA 1WDLA 4LN1A 5C3MA 2O2SA 4A5OA 3K8ZA 3M6IA 1RM0A 5EQFA 4Q3CA 3L6OO 4CLDA 1M2WA 1NFQA 4MJLA 3QA9A 5H82A 2EW2A 3PQDA 2HJRA 1YL7A 1ENZA 3W4IA 4OMUA 4BNFA 1FJHA 1HE3A 2I3AA 4S1VA 3U9LA 3NT5A 4B4WA 1LXCA 4HFJA 4DLAA 3HB4X 2XPCA 4CQLA 2NU8A 3LSYA 2LDBA 1I5RA 5A3JA 5T57A 3VHRA 4ZU3A 4YJDA 2HLPA 3IC5A 3Q2IA 3B1KA 4CJXA 3Q11A 3ROKA 3KLPX 4J2OA 4L8VA 5ILOA 4AJPA 3L4SO 3H2ZA 4UVDA 4J9UE 3I5MA 1U5AA 4CPDA 4R1SA 3AOEA 3GFGA 3K96A 4ROSA 3EMKA 1OC4A 4BNYA 2X22A 4FFLA 3ZGYA 1DFHA 1QLHA 3DBLB 5HS6A 1MP0A 3QJ5A 1WXDA 4XB1A 1RWBA 1R4NB 3V2UA 1P1FA 1MA0A 1DRWA 1YXMA 4XRRA 1H6DA 1LDMA 1PS0A 5JE8A 3PWZA 5THKA 4IUYA 3V1YA 4R51A 4H15A 2BLLA 4Z0PA 1KOLA 3OP4A 4G65A 1UP7A 3FCOA 4GAEA 5DP1A 2V6BA 3VZRA 1XU7A 4LCJA 4QSMA 4Z0HO 3P5SA 3OJOA 4GMGA 1YL6A 4A27A 3BA1A 4QECA 2VWHA 4BVAA 4CM8A 1IYZA 1PJTA 4CMEC 1SPXA 2I76A 1A71A 2ZKLA 1AXGA 5L7TA 3DZGA 1I8TA 2G1UA 3RUDA 4D46A 4NZ9A 3H6KA 2O3QA 1VPDA 4CM6A 3PQFA 3RUEA 1QYXA 3JYQA 2WEKA 3KUXA 1G1AA 1W6UA 3OHSX 3WQSB 1MUUA 3WMWA 1UXGA 3R6DA 4KWIA 5I9LA 3L4BA 3GEDA 3TFQA 3UXYA 2OHXA 4CQMD 1BXGA 1YO6A 5F3RA 5IZCA 3PLRA 2W2LD 1SC6A 1YE3A 1HDGO 3PHHA 1O0SA 1SB8A 1PX0A 1PZHA 3E03A 4TSKA 4Q39A 1EFKA 4B4OA 1YDWA 5EMHA 2CMDA 3PHIA 3ZWMA 4CLEA 2EGGA 4WK6A 1SO8A 4YACA 3DDNA 3MWEB 2UDPA 2V6FA 3RC7A 3V1TC 3UW3A 4I5GA 2HRZA 4YAEA 5CDSA 1PGNA 3QWAA 4WKGA 2X1HA 2ZTLA 2FMUA 1C0IA 4RL6A 2VYVA 3HADA 1O6ZA 2YV2A 4UULA 2NTNA 1GZ3A 2JKVA 1A72A 1PWXA 2RAFA 3RUAA 1IZ9A 1L7EA 1RYEA 1MFZA 2PKRA 2B37A 4CLHA 1UZLA 3GG9A 4YQZA 4ID9A 5A9RA 3O03A 4GSKA 4QFCA 2HCTA 2OUIA 3KXDA 3VDRA 1EDZA 4JBIA 2FSSA 4E13A 3GN2A 3ZWCA 3E48A 1EK5A 1XGKA 2HRBA 3DBHB 1XU9A 4M1QA 2EKPA 5L7WA 3INRA 4NHEA 3VH4A 4IMPA 4YR9A 3CMMA 4KMSA 4O5OA 2ZTMA 4J1QA 3F4LA 4E4YA 5COQA 1GFSA 5KOIA 1ISGA 4JJFA 3WFIA 2C20A 3D4NA 4J4BA 4EGFA 3OJFA 1WDMA 4TRJA 1DFIA 4RPHA 3UUWA 5THQA 3ONEA 2EP5A 4GMFA 3HFGA 4ZQGA 4R01A 1WP4A 1YB1A 2H9IA 3DZBA 4WOJA 1A7AA 3MTJA 4NK5A 1B3BA 4N18A 3JQ9A 1HZZA 4OSPA 2PD4A 1N2SA 3EZYA 4DPMA 1V0JA 1AGNA 5AVOA 3T4XA 1LRKA 1ZK3A 3WGOA 4HV4A 2NVUA 2ET6A 3F5SA 1Q7BA 4NFSA 1MC4A 2AQKA 1ONOA 4P38A 4BO9A 3A06A 3OEWA 3H5AA 1I24A 2VHYA 4ILKA 4GGPA 2RIRA 4L9RA 4K6CA 3TFOA 1LDGA 4KWHA 3WQQA 2LDXA 5DDIP 5DOVA 3I9JA 1ZXBA 3HDQA 4TRMA 1NQ5A 3QLJA 2QQ5A 4OHUA 1IE3A 1BVRA 3BHMA 4AJNA 4HX5A 2YV3A 1BVUA 1Y9AA 4RZHA 3UVEA 3Q1LA 4CUZA 5B4UA 3WTCA 5LCXA 1UP6A 1I32A 4TVBA 1OFGA 4R1NA 3V5NA 4J4TA 3EK2A 3VH2A 4O0LA 2AG5A 3W8EA 1E6WA 5F1KA 5EL0A 4CV3A 1QORA 3SBOA 2P91A 4M55A 3N58A 4RO0A 3ZU3A 3GPIA 1G6KA 1R4MB 2QYTA 2VWPA 3WGGA 3DFUA 3GMSA 4WEQA 3KB6A 1GEGA 2W2KB 1HL3A 3WYCA 3JQCA 4J4HA 3WGTA 4YVFA 2O3UA 3C1TA 4I9UA 3W6UA 4BNMA 1EEHA 3BTOA 1P31A 3BHIA 4RLHA 1M6HA 3QSGA 3QWBA 4D41A 5C7IO 3IP1A 3PJDA 4GLOA 4YAJA 3VPXA 4MP8A 3S1LA 4W9NC 3AUSA 5L9AA 3DZJA 1P0CA 1ZVMA 4D3FA 3GVXA 5GY7A 1I30A 1P1JA 3ZHXA 4BO6A 3L6DA 1CETA 2GD1O 2O3TA 2UAGA 1P45A 3FF4A 1JW9B 5G0SA 3RUIA 3ZHYA 1F17A 4LCEA 1MC5A 3K92A 1I10A 3M1AA 4MO2A 5K6AA 1DOHA 5TF4A 5C7OO 1BMDA 2EJVA 3G1UA 4Y6RA 5JLAA 1JVSA 1YQGA 3TN7A 1M6WA 3U49A 2DTXA 1YGYA 1H6AA 2O7QA 1WDKA 4BNLA 1SEPA 3BMQA 4B4UA 5BNIA 5HBRA 2PV7A 4KTTE 4CQMB 3L77A 4LISA 5JC8A 4E32A 3IDSA 1ONPA 1BG6A 1GUFA 2FR1A 4N5MA 1FF9A 2GPTA 1E1LA 2EEZA 2OL4A 3A9WA 3QWHA 4KQXA 3ZWWA 2AW5A 2OGUA 4D43A 5IDQA 4YT5A 3R0IA 1SOWA 5EPOA 2Q49A 2AE2A 2EKLA 2CF5A 4NPCA 3KM0A 2PZJA 4R4JA 4MKZA 3FWZA 4IBOA 5JY6A 4YJGB 2DAPA 4FJ0A 4QEDA 4NK4A 4L4SA 1DIBA 4YEDA 4LVUA 4E33A 1XKQA 4YAGA 3DB2A 4U8GA 1XG5A 3DBRA 1X1EA 2OBNA 5TRTA 4QQRA 4BKOA 4E2XA 5ES3A 5JS6A 2OO5A 3GAFA 2DBZA 2D1YA 3AI1A 2Y67A 4XA8A 1IPEA 2Y1FA 4WCFC 1IB6A 4TWRA 5JAMA 5JAIA 3E82A 3HN2A 2VZ9A 5LDHA 5IDWA 1KVQA 2I67A 2J5RA 1YJQA 2YZ7A 3JD3A 4GWGA 4PG6A 5AXAA 4BIIA 1X15A 4XR4A 3AM5A 4JP3A 5JFOA 1ZK1A 4PVDA 5BNTA 1H9AA 5TSDA 1D3AA 1PIWA 2YJZA 4BL5A 1WAMA 2OFPA 2YQ5A 5JDIA 2C5EA 1IOLA 1SBYA 4D3DA 4WNIA 3W1VA 5KTKA 1H94A 1FDVA 1Q7CA 5I9MA 3NJ8A 1GUYA 4DC0A 1UXKA 1HE5A 2J3IA 4M54A 4Z0TA 1JDJA 3V8BA 3EUWA 4EEXA 2H63A 1HDRA 4D0RA 3CZRA 1GQQA 2FPPA 2ILTA 4A2CA 1ZSNA 1UAGA 4CM9D 2FN7A 1I0ZA 1DJNA 4FFRA 2C5AA 5JYEA 1KETA 1T1RA 2J3JA 2PGLA 3W6ZA 3CKYA 2HK9A 3TRIA 5L53A 1JKJA 3VPGA 3NTQA 4O6VA 2J5QA 4DQVA 3TZHA 1ONNA 3U4CA 3ZHBA 1IPFA 2A35A 4IJWA 3U3XA 1A9YA 1J49A 1U8FO 3GZNB 3IKVA 4OKNA 4CMIA 4XJTA 5KCZA 3INGA 1GL3A 1NVGA 1DIRA 3WGHA 1LX6A 3RKUA 4NBTA 4PLVA 4EUEA 5KNLA 4NFHA 4NJOA 4IGEA 4TZKA 5JAZA 3WGIA 3VAZA 5FEUA 3ZNNA 5A03A 5CDYA 1MXFA 2OOSA 2I65A 2GN6A 5A9TA 5T8KA 4IS2A 1QP8A 2WD7A 1Q0HA 4AL4A 5IZCC 2C2YA 1ENYA 3MOIA 4Q3AA 4TRNA 1VM6A 4AJIA 3TDKA 1UDAA 3F1KA 4RQUA 1S6YA 2UYYA 3IJRA 4BNVA 1FDSA 3PDUA 3PDJA 5AXCA 3RUCA 2HO5A 3LC7O 1YB4A 2IODA 3E5RA 4YRAA 1C1XA 2AMFA 1GV1A 1LU9A 1UDBA 5KVQA 2NACA 2X9NA 4GSLA 4LVCA 2NUAA 3DMTC 2BI8A 4PFJA 3MZ0A 4BKRA 3JQGB 4XD2A 5JDCA 5L4NA 3H9EO 2QZZA 1RM5A 1YBMA 3DAGA 5IF3A 5IAAA 4X54A 1UXJA 3N74A 1Q1NA 4UEOA 1UZMA 3E1KA 3IS3A 3IUSA 1Z75A 3JYNA 2YY7A 2Y1EA 5IG2A 1PJCA 4JCOA 4XQEA 3MJSA 1HE4A 5B1YA 4WLEA 1D7OA 4P4GA 1A9ZA 4NMHA 4TQGA 1V6AA 1Q0QA 4EUHA 2O4CA 2WE7A 3RASA 4KTVE 3GNSA 2VHWA 3WG9A 3S2IA 4BKPA 1B14A 2DQ4A 3FPLA 4D44A 1YBAA 2X0IA 1WPQA 4JJIA 4E31A 1EK6A 3QY9A 3T7CA 5KJCA 1W0CA 1Q7GA 1LLUA 1EQ2A 1WLYA 3C7AA 4I9NA 3NUGA 2E48A 3HZZA 1YOVB 2ZJ0A 4E2ZA 3JQBA 3WR5A 4WJZA 4R69A 2AHRA 2WSBA 4RPGA 3PTZA 1EBUA 4UVIA 3WTBA 5IN4A 3L07A 3SXPA 5A02A 1OI7A 3C24A 4BO2A 1JLLA 4YWJA 3IIEA 3GRKA 3WOHA 4YJHA 2J3HA 4IDGA 4IXWA 4XQGA 3PK0A 3KSDO 4OH1A 8ADHA 3V1UA 5IDXA 1RM3A 2HMVA 2J3KA 3T7EA 1P1KA 3WLFA 2VOJA 1LEHA 3CMCO 1LA2A 2VOEA 3Q0EA 3OF2A 1HYHA 3OQ6A 5B37A 2E49A 4ND1A 3U62A 1GCOA 3EGOA 5GZ3A 5A06A 4IPTA 1QLJA 5JXWA 5G4KB 1WWKA 1XQ6A 1BXZA 3NTRA 4TKLA 2QYSA 2C2XA 2JAHA 4BV9A 1U9JA 4XYLA 3WFJA 1E3JA 2WD8A 1NAHA 1TA4A 4MOWA 3M2TA 1R0SA 2H1SA 2G5CA 3RUFA 5BR7A 4RF5A 1AHIA 4BO8A 3JCZA 2UUPA 4IJVA 3UFXA 4QUKA 1IHYA 3JQ8B 2O2YA 4RF3A 4YJFB 1P9LA 1PEDA 2P4HX 2WTBA 3KLMX 4R5HA 5T5QA 1ULUA 3HG7A 2XAAA 1QYDA 2AEJA 4AICA 4D0SA 1E5LA 3F9IA 5A5EA 1ENOA 1UAYA 2IXBA 4D45A 4C7KA 4NU5A 4DPLA 5JC1A 2ZQZA 5L95A 3IJPA 2CD9A 1K89A 3OH8A 3OMLA 1DHTA 1EFLA 1K3TA 4FGWA 4PLFA 2CSUA 5K6AC 4W99A 3GMDA 4DL9A 4QT0A 4TKMA 4BV8A 2Y1OA 1BRMA 2IEBA 2Z1NA 3I9NA 1TLTA 5TQVA 2PKQO 1MB4A 1NQAO 4XWYA 1GQ2A 3Q6IA 3EVNA 4CV2A 1IL0A 5JO9A 2DFVA 4PLYA 4XZ3A 1JQBA 1J5PA 3F1LA 3GNTA 4EI2A 4JP2A 4GL4A 5FWNA 2DT5A 5A04A 3MCVA 1EBFA 4PIVA 2OORA 2JAPA 1WZEA 4AJ2A 2PZKA 2UVDA 2P68A 3RD5A 3WWZA 5JAQA 3PVZA 3PYXA 3GAZA 2CNBA 4FJ2A 5KVCA 3ICPA 1Y8QA 4XGIA 4IZIA 3S8MA 1U7HA 2ZB7A 3TQHA 5TJ9A 1ZK0A 3GPDG 3PXXA 3ZWYA 1E7YA 1UH5A 1R12A 4JX8A 3JD0A 1ZCJA 4WEOA 1B8VA 1YKFA 1V3TA 4ZRMA 4U6SA 1SB9A 1YH3A 3IOYA 4GX5A 1ULSA 3RC1A 4A73A 2VT3A 5ENDA 3WDSA 2PH3A 1K6IA 3I3OA 3TL2A 4BO4A 1H93A 2X9GA 2Q4EA 4ND5A 1GYRA 2PWZA 3BMOA 4UVGA 5A9SB 5L45A 1C3VA 4IDBA 2P5YA 2QX7A 3COSA 1K6XA 3KOUA 1U3UA 3DL2A 4FW8A 5T64A 3DONA 5TJHA 1GU7A 2BKAA 3VZQA 5F21A 4BKQA 4FR5A 1HYGA 1MLDA 1ADBA 2EHDA 2VYVD 3RJ5A 4DC1A 2JFGA 4HBGA 2JCXA 4CLOB 4QX6A 2AEMA 2GO1A 1O95A 3GHYA 5KJ1A 2Y66A 1JA9A 3X2EA 2GGSA 4MVJH 3DAPA 4MKXA 3GEMA 5CHEA 3H65A 2W4QA 1YVEI 4BKUA 4PG7A 1E1NA 3IL2A 3OETA 1DAPA 2NTJA 4D79A 2Q2QA 4BUCA 5JDIC 3EY4A 2B69A 1KVRA 2DLDA 2IXAA 4E30A 3O26A 1ZIDA 1CERA 1RKXA 2PZLA 3GH3A 2P9CA 5F1PA 1RPNA 1Y8RA 1BDBA 2ZYDA 3LT2A 3RKRA 5KJEA 1DIGA 3DBLA 2D4AA 4BMNA 4DQUA 3ANNA 4IIUA 1GQYA 2IYOA 1R4NA 3QVXA 2AQ8A 4GVLA 4J1NA 4Y9DA 3UICA 1GY8A 4BOYA 2PY6A 1I3MA 3VVBA 1NYTA 3NX4A 4MDHA 3U4HA 3GUCA 1PGQA 1PGPA 1M75A 5DZSA 2BF7A 1N1GA 3VOSA 3AI2A 2JFHA 1ZZEA 3OA2A 2DC1A 3DOOA 1C0PA 4CMJA 2ZB4A 1T4BA 3GT0A 2QRKA 1ID1A 2QHXA 2JFFA 4OKIA 3VPFA 3O9ZA 4W7HA 2I3GA 3U09A 2JHFA 2PD3A 4WCFB 1MFPA 4AJEA 1NR1A 3ENNA 4LMRA 1E7SA 4AVYA 1GV0A 3ONFA 4FD3A 4OJNA 1F06A 1U3TA 4INAA 3BYZA 3VTZA 2E37A 3ROPA 3ASVA 4J49A 2BGMA 3FN4A 3GZ4A 4YPOA 3OSUA 3GDFA 1I3LA 3LK7A 4RZIA 5CFZA 3QV1A 4OM8A 3PEFA 1TEHA 3FBTA 3PGXA 2PFGA 1QV6A 5KKCA 3H3FA 4XYMA 4JNKA 3F4BA 4IDFA 4IXTA 4L75A 3L6EA 5ENVA 4MVJE 5JDCC 1NP3A 3VH3A 2DFDA 3CIFA 5BQFA 3M2PA 3D5QA 5EQDA 2Y1GA 4L4XA 3SVTA 3AI3A 1N9GA 3ZWAA 4E0BA 1B7GO 4YAIA 6LDHA 1XEAA 3LC1O 5JMWA 4MIEA 2D3TA 3FTPA 2BFMA 3EVTA 4WLUA 2X5KO 1PWZA 5U1PA 4R3WA 1I3NA 2EJWA 2VRCA 1LQUA 3VDQA 1DIHA 1P44A 4BNXA 3NTOA 4IQGA 5J23A 2IE0A 4DBVO 4E2WA 3B70A 4GH5A 3TJRA 3P19A 3RU7A 2VQ3A 3BMCB 3K30A 3HB5X 3GVCA 4NBWA 3UCXA 4FB5A 1X14A 3FSRA 1KYQA 3MJCA 5CG2A 2VT2A 2F00A 3ZZNA 2RH4A 3EHEA 4N7RA 4DBZA 1JAYA 4FC7A 3QVOA 3TPCA 1I36A 1E1KA 3WB9A 2ZYAA 1BXGB 1XHLA
chains in the Genus database with same CATH superfamily
3UT5A 2IDMA 3MXTA 3VJRA 1P9WA 4ODIA 3E3OA 5DJ5A 3G49A 4C6RA 2QRUA 4I8XA 3K0CC 2PD6A 3H9QA 4P82A 4QL3A 4RDHA 2DTDA 5AKLA 2ECPA 3OC0A 1TT5B 2EF0A 3ZW8A 2GEVA 3GI1A 4BN0A 4QYSA 2I0FA 2B9EA 2P9GA 4NG5A 2A9FA 1UBOS 3HYSA 4UXIA 3DL4A 2WJGA 4OJMX 3WQHA 5EHQA 3NWOA 3ONNA 5GINE 3TTTA 4WIAA 2Q0SA 5C7YA 1RZRD 2AI2A 5CYOA 2IYSA 2Q50A 4KIFA 4KXUA 4ITRC 1XRNA 4H6PA 4P53A 4OYLA 1OASA 1CZNA 4H60A 4I5FA 4EL5A 4DMUB 3CV3A 1VMKA 2Y4OA 1I14A 3QXJA 1FFBA 4J0KA 2ROQA 2COKA 4I5IA 1BYUA 3KE9A 1TM7E 4N3GA 4X45A 2DWUA 1DRJA 2O8NA 1J00A 3IKTA 2I99A 4MV9A 5EESA 4KE8A 3TBHA 3KLBA 3PQEA 1OFTA 4JEIA 1STOA 2GN8A 3RVMA 1BAPA 1X7ZA 1Y1PA 4F38A 2B82A 2IUUA 2WHQA 3E84A 4LSGA 3LT4A 2ZSIA 1YZTA 1GGFA 2I6QA 5FOTA 4B09A 3VOBA 4BAUA 3WL8A 3ZQJA 5JO0A 2GILA 1B8UA 4Z3DA 3THWB 3IPYA 3GEGA 4P6VF 5EWMA 4E6PA 3K1ZA 2OLKA 4EMTA 1HH4A 3U16A 1J07A 5EZYB 2Q4RA 4DGSA 1ZWLA 3AM1A 3MWJA 1R4MA 2V7PA 2AKAB 3LOUA 3LSTA 2PWAA 4HGPA 3W5SA 5MN4A 1JIIA 2NXWA 1YQQA 4H08A 2W2KA 4K88A 4Q4JA 1OGJA 1OD6A 5K01A 4HRXA 2XUIA 2IZOA 2BEWB 5FPTA 3D2LA 4JCCA 5K8JB 4PR0A 1YNOA 4YAFA 1TF5A 3OM9A 4MYCA 3VTFA 2XTJA 3BCUA 5HWSA 1G98A 5ECYA 1W4BA 3EQ6A 4P4SB 4EECA 4J3JA 2C2ZA 2NVUB 1LC0A 2O1SA 2YIDA 4Z9YA 4CUJA 3UPUA 1G8YA 1VE1A 2IIPA 1Y34E 3DE3X 2A88A 4CHGA 3Q3VA 1M1XB 2ZS9A 3FUTA 4FFNA 3VC7A 5CB4F 2VP4A 1N2HA 2PCJA 2FFRA 3X44A 1MN6A 4X8OA 4MVWA 1ZIOA 4JJKA 4NV3A 2V6MA 3ZKWB 1Z73A 4MQ6A 2DPHA 2W2QA 1U5CA 1N5KA 1IFXA 3QNWA 4TTSA 4KR9A 2VK4A 1TW2A 1U2GA 3PUWA 3WHIA 4NKRA 3AHHA 4AZTA 3WIEA 3IA7A 4BFSA 1LDEA 3AUAA 3GVIA 1G0NA 2SCUA 1TUEA 1NXXA 2FMFA 2FWIA 4K9QA 2BFEA 2GAIA 4BKUA 3G59A 4GI7A 1ZMOA 3TZLA 1MO5A 3THYA 1P4SA 4ZAFA 3RK0A 1Z6QA 2VJDA 3JQQA 4KP7A 1J0XO 4RANA 3N2GA 3DOHA 2FZKA 2PJRA 5A4FS 3IBGA 4O1MA 3IR5A 2QVBA 1SUAA 3NUZA 2R60A 1QVZA 3W2GA 4P4LA 1WXIA 3PC2A 3F49S 3T5MA 3ABIA 2D2XA 1GQSA 3G2MA 3PFBA 1CQWA 1KU0A 2FG6C 1A2QA 3V7WA 2XE8A 1CUAA 3E0QA 3GLRA 2JGLA 4XUGB 5IK2A 4XB6B 4B33A 1KH1A 2VT6A 1Z36A 1OI3A 3BF7A 3CSUA 4L74A 4MKRA 1RRKA 5LMCA 4UQLA 4GU5A 3WJ7A 1Z33A 3IQDB 1H2HA 4P34A 3IJEB 2YQ4A 4I1UA 4BZXA 1E8MA 2FDCA 1SZJG 2F4VB 1OZAA 3CLSD 1KZ4A 4XJSA 1RYFA 1YR3A 2QUIA 5ALXA 3KVRA 2XCIA 4DJJA 3HKEB 2E3JA 4D4MA 1C4WA 4REQB 4KXNA 2I62A 3T5AA 1RRCA 1P8JA 3DLAA 2PKYX 3I2FA 3AW9A 4MVJI 2XUZA 2P5TB 5D3KA 4EA8A 3ESRA 3FTEA 3AWDA 9LDBA 2H06A 1AHPA 4P4NA 2IU6A 3TS1A 1JTVA 3JAWA 5D1NA 1SBIA 4O2AB 5ALTA 2F90A 2XA9A 1TT7A 3KKMA 3OZSA 1AUPA 2AMVA 2EGUA 4KUEA 3ROFA 3H3JA 2VP5A 2HQOA 3P27A 4ZYWA 3DD1A 3FTQA 3T7KA 1KBZA 1M33A 3NBUA 2W5UA 3ZNQA 5DNDA 4V0KA 1O97C 5A71A 3PITA 1R15A 2VJBA 3BD6A 4B6RA 4LECA 5I45A 1ARZA 1XRPA 3O1LA 3E35A 3PVCA 4CF5A 2Q7DA 1G5QA 2XKKA 1T0PA 5LMNB 1RJWA 4D9JA 1R0XA 2BY4A 3PWSA 5AKZA 4XE5A 3IOMA 1RSZA 2NYAA 3CN9A 4X8HA 2HQ1A 1HDCA 1DO8A 5DGXA 1DT5A 2WJYA 3PR3A 1E94E 4DG9A 4F1KA 2CT8A 2RBEA 3UT6A 4X00A 1V9SA 4D80A 4LK3A 2QLMA 1V16B 3X1XA 4YRKA 2EP7A 2HBRA 3CEAA 1F4VA 2Q3LA 1PV2A 3CE6A 3OPYB 5L3ZA 1ZGJA 1W85B 4YDSA 4BLUA 3RNOA 2XRFA 1QIGA 3IE1A 1JEQB 2OP0A 3DWFA 4FFOA 2GM9A 3I23A 4HRAA 4JWTA 4XVHA 3QVJA 5CLHA 3TECE 3GLSA 5FH9A 2JLVA 1KJYA 2JRCA 1YC2A 3MJVA 2OC4A 3RFTA 4DYVA 1C3OA 4Y1GA 3VO1A 4KNYA 2GPSA 4PCLA 4BJ5A 3DE6X 2PUAA 4ZKDA 3GPCA 2K2WA 4LSMA 5LWHA 1D1TA 4BLPA 1J0BA 4LZNA 4A0HA 5K1ZA 1IRIA 5K7SA 2XIJA 2G72A 4TSRA 4PZPA 1JIXA 1WXQA 4LRUA 1ORTA 2Z5VA 1NUUA 4UNRA 1Z6YA 3PUHA 4HYYA 1PGJA 2ZP1A 4XRGA 2BM9A 1KYXA 3TZQA 2AJCA 3DO5A 4G8DA 1E2JA 2JLBA 3LXUX 5AM4A 3FTFA 1Z0JA 2AWNA 1S3GA 2WM2A 4BVEA 4MPDA 1KKLA 2UZIR 4JGGA 3REQA 3M1IA 4W5OA 4FNGA 3DG9A 5H9VA 3GLFA 3NEAA 4H2DA 2I7TA 3QIAA 1ECLA 1QV9A 4U9UA 1AOXA 2CV1A 1O3YA 3GMIA 3VOTA 4Z49A 1SJ9A 4XARA 1H0KA 4WESB 2VNSA 1NPTO 1RAHA 2Q0QA 3NR2A 2AJ8A 4QYWA 4BJ6A 4CF6A 3DL0A 3H9JA 1YTLA 2XB4A 3ZDFA 1XXHB 1K8YB 1PT7A 3OKFA 4OXKA 5HYVA 2HIHA 1VMDA 4IDDA 1DAEA 3T7TA 3ZQ6A 2L2QA 1ILWA 1G0OA 3SYKA 5DULA 3OE7D 2Z8ZA 4WNCA 1GVHA 1Z37A 2BR5A 4XIGS 5D6OA 5F51A 4FMDB 1GL7A 1VMEA 5LXTB 1EB8A 2GAJA 3L93A 1KSHA 3OA0A 4HWPA 4J1GA 2DEUA 2IYRA 4G1EB 1E5QA 4FZ5A 4F3YA 4ITUA 1D6JA 4ENWA 2HPAA 4YRJA 4CUKA 5IX8A 1D8TA 5CT6A 1JKJB 4Q12A 1C9YA 1XKLA 2G04A 4RVFA 4BX0A 4ZICA 1Z0SA 2GBIA 2NZYA 1EYZA 1V9LA 2V65A 2R8OA 4IRXA 5BNFA 3W1EA 2JIRA 1QO9A 1WCV1 3AFMA 3GIWA 4JSRA 1SCKA 4J1TA 1FX1A 3IOCA 4UZSA 1AF7A 1OFUA 2YYAA 3CTMA 3MWYW 1BSVA 4I3GA 3ZWNA 4RQBA 4DJ5X 2PUCA 4CM4B 2EYQA 3CUEF 1RJ9A 3VNBA 2AXNA 4ZYYA 2BGKA 2EFHB 1NM5A 3R09A 3RIXA 5COAA 1RAAA 1NC1A 4G1BA 3L6UA 1JDTA 1V5IA 5FYDA 3OLQA 1Z5OA 2GBLC 3F47A 2R0QC 5JAHA 1QG4A 3BFVA 3QE2A 3AM3A 1JHRA 3IDZA 3MJFA 1AO0A 1OZHA 4EG6A 1U99A 3FLMA 3WGKA 1JJVA 1NSFA 2D13A 1XCGB 2P67A 1NXPA 1QWOA 2ZYVX 4F1WA 2VHJA 1ZISA 1BVYF 3QZUA 1AGRA 5KC8A 3GAAA 1WL8A 4TLCA 4C6TB 4CU5A 2YWRA 2XKAA 4JLKA 4UQOA 4NBUA 1T4CA 4DR7B 1IY8A 2IS4A 3HACA 3G6KA 3C5CA 3MEQA 1N2CA 4CZ2A 3A0RB 9ATCA 4S1PA 1EXMA 2E4XA 4GOND 3EYWA 4UMDA 3USZA 4PLTA 5HP4A 3NBYC 3IQFA 4NABA 1TPZA 1JQEA 3KOYA 4MW2A 4KNVA 2V6GA 2KSQA 4HMPA 2BTQB 2WTAA 1JB1A 1GZHB 1NUQA 4R3NA 3W6PA 1BYIA 3RS8A 2W0MA 3QBEA 5JVDB 4GGOA 3PNLA 5TVGA 3HBJA 1K7YA 3NKVA 4GI2A 2YL2A 4OATA 3D3WB 1VPVA 4QGSA 4HXEB 5A3VA 4ALNA 1ZD1A 1M8JA 3HY4A 1TCBA 4CG2A 2QEQA 3F8TA 1PZNA 3V8VA 3C85A 4F6RA 2GK3A 4R40A 4RPKA 1C7EA 2FHPA 3MPOA 1U2PA 1USGA 1CNFA 2Y0DA 3ENWA 2O8BB 4AWXA 1YS4A 1LDNA 3I4FA 3NFYA 4MGKR 1N5JA 1TB4A 1UBUS 1PL7A 2BI7A 2Y27A 2OXFA 3EMVA 1WU7A 1KDVA 3ANXA 4BXOA 1LX7A 4HUQB 4JIGA 4POOA 2CYCA 1QFZA 5FWAA 2ZRHA 3ZZ0A 3AF2A 5ER9A 3R1IA 4LQCA 3FXAA 1PQUA 1U8EA 2C9DA 3E61A 4M0EA 5H3HA 3LH5A 5F1OA 4CG0A 5AW7A 2LUOA 3EX7C 2ZPTX 2R5NA 1QVWA 2UZ1B 1WCIB 5LQDA 1JEYA 1P2BA 2AG1A 3KOXA 3EXIA 5EE1A 2G5TA 4A0RA 4J07A 3MJTA 2JATA 5IN5A 4DM3A 4E21A 3IUPA 3O7MA 3HWSA 4FOTA 4I9FA 4BNTA 1NVWQ 1U2QA 4JC5A 1CEQA 3VSCA 4IEIA 3KYDB 4DCGA 1XMPA 2UYOA 4OUDB 4KIWA 2OC9A 1AKQA 1EZ4A 1Q7TA 2QDXA 4YA6A 3EC1A 4F8JA 2GWHA 3ZHSA 1A9PA 3STHA 3MJEA 1TAQA 1IK4A 4ZOAA 3RTAA 1FIUA 1GKUB 1USIA 3GY0A 2NVBA 4TS1A 1Z47A 3DHEA 2W6IA 5FRDA 4NC9A 5ITWA 4PCVA 1DXHA 1J6UA 2Y05A 3GJ7A 4KWCA 1ZMBA 3GF4A 1YI0A 5JNSA 1XTSA 1G2OA 4LZZA 4AQDA 2QTVB 3OZBA 5BNWA 3RVSA 4KV9A 3P7MA 5AOVA 4CCYA 3PA8A 5LIPA 3GB9A 3JD2A 3L7YA 4W8OA 1QYCA 1HY3A 2BBOA 3IB3A 2D5AA 2GCGA 5A1TA 4CEJB 2BDUA 2FWJA 5LBTA 4EKIA 1P29A 3GR6A 4Q7EA 1OV4A 1M7GA 1NN3A 5C37A 5AK6A 4DDKA 4DMMA 3KQNA 3AESA 1NI4B 2MYTA 2VPYA 4B31A 5TQ2A 5FWXA 4DDTA 3BH6A 5WRFA 4C5AA 1M5UA 1W9HA 3QU2A 3SR3A 4DCUA 3ZDBA 3B3FA 5F77A 2GPWA 1PZEA 4KXVA 4PGAA 4RKQA 1U8UA 5T6BA 2NU9B 1MOQA 4U0JA 2P2CA 4MUIA 3VFDA 3EIEA 3OX1A 3A1TA 4P84A 1T10A 2NM0A 1PR3A 2QRHA 1ZIYA 3KPWA 5C31A 3VAYA 4EPWA 4G23A 4C7MA 2R751 3WLMA 4D81A 3E6AA 4L4RA 1U0BB 1U3CA 4EJSB 4MXDA 3GVPA 5F4BA 5FI5A 3ZDYB 1T9ZA 3L9WA 1E3IA 5FLXA 3E58A 4DANA 4DCOA 5BWOA 5LZ4A 3K71B 4NCIA 4DLWA 3ED5A 2PMFA 3B85A 2NV6A 3LUKA 4M8NE 2HJVA 4LDJA 5EMKA 3FSGD 4ZV4A 4ZANA 2VJYA 4XIYA 2V54A 3ZYZA 2AUTA 3T3NA 3V46A 2JEYA 1XZHA 2B35A 1SVKA 3ZE0B 5I5GA 5CT8A 1PDWA 4WX2B 3T41A 4IIVA 4JASB 3GFBA 3WGMA 4LJ9A 5KAMA 2AMJA 2V0CA 2CHVA 1Y98A 2XOXA 3G89A 4DLZA 5TARA 2JGDA 4CIYA 3FOEC 4W5NA 3OFND 4YQYA 5DF1A 1Q0ZA 5K4HA 2R6HA 2AI1A 3C43A 3QEOA 4N01A 4R2LA 4FMBB 4O0MA 2DHQA 4ZOLB 4XWWA 1FFWA 2X0KA 2GNAA 1XL0A 2I9PA 3QU9A 4WFIA 5I7EA 1UBRS 5IWCA 4IILA 4MZDA 5LM3A 1Y6GA 4W6ZA 1FRZA 3DPIA 4MCAA 2PNFA 2W0SA 3ZV6A 4NZOA 4OV6B 4Q4HB 3KUUA 3KX2A 4FN4A 2OSBA 4R8RA 2HHHB 3N0XA 3E7DA 4TTQA 1C3JA 1ZKDA 1M67A 2KYRA 2NG1A 2ZDQA 4NBVA 5DCWA 3HABA 5HW0A 3IP5A 4M99A 3E53A 2UZAA 4TKUA 4ZVUA 5LZ8A 1PR5A 4DUGA 1TCUA 3N0TA 4RY8A 3LBNA 3RFXA 5KDDA 3D6JA 1XT6A 4TS9A 1YWGO 1JHZA 4RK7A 3T34A 5G53C 4ZAXA 1L1QA 3QE4A 5I8ZA 4O4HA 4QBKA 3ESQA 2KLHA 2R48A 2QN8A 2QRQA 3H6HA 2RKBA 3P5BA 3V6LA 3KOWA 4X1YB 1QCCA 3RK1A 1L5OA 2IU4A 3CGWA 3DKKA 4C30A 3NUQA 3UK6A 4WACA 1IPHA 2K2QB 3EISA 3VA7A 2W42A 2NNWB 4NBRA 4EI9A 2IS6A 1XXHE 4GZ5A 1HM5A 1RFGE 1UMCB 1NQUA 3RH0A 4Z2AA 2KLBA 4GM4A 3G6WA 3ORFA 4F6CA 5KYXA 1Y5RA 5BW6B 2J0SA 3AEKB 3TTSA 5AXDA 5KO2A 2OR3A 2GESA 4S1NA 2AQHA 4ZQBA 1TM4E 4U2BA 2MINB 4ZT5A 3IE0A 1HWYA 3PUXA 4EL0A 5FPSA 3WLRA 1T2EA 4RMIA 4C3VA 1W34A 2WKSA 3TJZA 1JR3A 3BTUA 1EFVA 2R8YA 2RCYA 4NV0A 5EA2A 3H9UA 5FOSA 2HPVA 5EUBA 4YQFA 5JJCA 1H85A 2VWGA 4PX2A 4JYBA 1K5HA 3GT3A 3VU9A 1MJGA 4PPQA 621PA 3AIIA 4Q1CA 1H8ED 4BVHA 1MJNA 1YVPA 1ZVKA 2Q6VA 3GUYA 5EIWA 4WBNA 1VZ2A 1EVEA 3SFZA 3ZHTA 1TK9A 1K8ZB 4QYTA 2ZB2A 3P2MA 3U44A 1BHSA 2M6LA 3FVTA 2FZGA 2P0YA 5EN4A 2QD1A 4CKEA 4BECA 1E1DA 4TYWA 2XYHA 1AJEA 2X5JO 4WZBB 3HVJA 1YSCA 2QGFA 4RH3A 4MLPA 1KMHB 4DSTA 3OQVA 5CNKA 3C8UA 5AK0A 1U1IA 1V7ZA 1IIBA 3Q8MA 2J3DA 3DDHA 3HP4A 3L8FA 2ZBGA 2RHBA 2YY6A 1Y3BE 5KSOA 3BZUA 2O2DA 2BL4A 2HMUA 2RGAA 3F3YA 3SSMA 3PPIA 3ZJTA 3A4LA 4BUZA 1I4OA 3H2SA 2A94A 1N0UA 2WT4A 1YB6A 3H87A 3MLBA 4I36A 3ZCTA 2JCYA 3IAHA 4PR3A 2YDYA 4L0QA 1LSSA 3TNFA 2JBHA 1K4KA 3QVTA 2PH1A 4Z99A 1S9HA 5AJTA 1HLFA 4P5PA 1HSZA 1PI3A 4R2JA 2BELA 1O5IA 2JFZA 4PZAA 1QYVA 4X85A 4Q9JA 4HB2A 4AROA 4Z9XA 3CRRA 4DABA 2QWXA 1Z7BA 4IIGA 2WJVA 3WYAA 4LF6B 2ZM5A 2WIKA 4O2BF 1LW6E 5FUQA 2WVJA 5IC4A 3D0OA 3FD8A 3MTGA 4BO0A 5KBYA 3A25A 3VHXA 4EK9A 4LF9B 5JLJA 3H9GA 2VL7A 2DLCX 2ZBFA 4G0XA 3NYQA 5EJIA 3L7MA 3RSLA 5BV2P 1TKAA 4PZDA 3GJXC 1A5TA 2JK1A 2QYHA 1U80A 4LRTB 1PG2A 4B80A 3HWWA 3A14A 5C8YF 2YS6A 4HNGA 3CLSC 3WIDA 3WKEA 3EGDA 4HDOB 1SM4A 4BLVA 4PLWA 2CLSA 2X6RA 4GM0A 1HNXB 2C94A 4I1SA 5LVAA 3QYJA 4KQKA 3KYBA 3WKCA 4BB5A 4D9FA 3HUDA 3ILYA 3FI9A 4UU1A 3QVLA 1M7BA 3GOHA 5JZMA 1VLJA 3EE6A 5A4KA 4LDRA 3WV4A 3ICCA 3NBMA 4LX8A 1ZU5A 1L7NA 2QP3A 2N75A 4OXNA 1PE0A 1DLIA 1HOXA 4YAOA 2BMWA 4M76B 1LPPA 4RKEA 4UM8B 5ALUA 3UC9A 3CRZA 4O2BA 2CGEA 1YS2X 2Q4TA 1QM5A 3E23A 4LJ8A 3L8HA 3QQPA 2Y8EA 2FPXA 1DJQA 3FDZB 4HGRA 4WKNA 4Z6KA 2ON6A 4L07A 1F8YA 2I4IA 4OAPA 4EGJA 1BZYA 5C8YA 2JZCA 1GD1O 3C3XA 4CNQA 1Y8ZA 3MN1A 2IRWA 1R9JA 2B1JA 5CIQA 5IF9A 4WY5A 5CK5A 5LMZA 8LDHA 3LLCA 1FDTA 4DM4A 3AJEA 1R74A 4HUJA 3WNBA 2PEZA 1YR2A 2F1KA 3KTAB 2OGTA 4Z7NB 3FZGA 1NDQA 1SKAA 5I6DA 5KYYA 1QAOA 3KWJA 1XMQB 4ZJYA 2PFSA 1I7NA 5AW2A 2PG3A 4GUDA 3P0EA 3O83A 2OKGA 2FZ4A 1YDGA 4WCDA 4LDPA 4UHDA 1QDLB 2NPIA 3E9ZA 3D5EA 2GLTA 2XNDD 3QIVA 4P92A 4ZQFA 1YFJA 4RGBA 5FOVA 3L7DA 3ILXA 1K7XB 1VL8A 4KU4A 4OO3A 1RJDA 2B21A 4L4UA 1ZA1A 2B8EA 4OXIA 3S2ZA 4C0BA 5CXXA 1VA5A 3KEFA 2ZWVA 3HA2A 1UZUA 3FB1A 4DLUA 2CL6X 1G21A 2R1TB 2YZ2A 4IHJF 3M5PA 1ZIXA 5AUQA 1F7VA 1CYEA 4MI9A 4XCVA 1OYYA 3D6NB 3BKXA 3ZU5A 5ITZA 2B1QA 1B15A 2BSQA 2VBIA 3HKBA 1SMKA 3N2KA 4PO8A 4OYYA 1Y4DE 1R8YA 3CFYA 3BL6A 1GDHA 2JAUA 1LVUA 1PSZA 1CDOA 1P60A 1X80A 3Q3CA 5AMXA 3UK2A 3ZKWA 1UJ4A 5FAXA 4C7VA 3VKVA 4DG5A 1AZLA 3D43A 3E7XA 4ZDKA 4WOPA 4EGSA 4QU8A 2HCRA 4HAZA 1Y6RA 3AFIA 5EJ2A 1XLTA 1RDFA 4E4TA 5HGXA 2H4HA 3MSCA 3TPFA 1T5TA 2JHCA 2Q1UA 2BI4A 2O52A 4RGYA 4EGQA 1JHQA 2ATXA 2AVNA 1UBKS 3HDYA 3WLHA 4R1MA 3NBAA 4RA6B 1ADYA 3BAZA 1EFDN 1XVAA 5K0CA 5IWAB 2ZIAA 2ZSEA 3H5LA 4M83A 2XMBA 5DWDA 5LD2B 5JNRA 1QS0A 1ZNQO 4Y0VA 3B3GA 2H7YA 2X3UA 3FNIA 3KWFA 3ZEIA 5AW0A 1HDYA 5REQA 2VUIB 2P4EA 1WM1A 3JQ6A 2VPQA 4R2MA 5E2IA 2XE6A 2JKYA 2W71A 1N6HA 4H7JA 3WBJA 4B6FA 1KRXA 2QTWB 5KQPA 2IYPA 1QTIA 5LWQA 1J23A 2YW9A 5CCXA 1GGMA 4WOKA 4N0MA 1KOGA 1OV6A 3SEZA 3UF0A 4YCNA 4F7DA 4DYHA 1QGUA 1AA9A 3W5JA 1IVSA 1C7RA 4C7JA 2HUNA 5KNBH 1EUDA 2B34A 1UKBA 2RHDA 3SVLA 1V71A 3F5QA 4NQZA 1E7QA 4II3A 1UEIA 1NWHA 2H1IA 2PA3A 2YVQA 2MTBA 1U1DA 1I01A 5B53A 4XQCA 4B2LA 2UYHA 4DIEA 2DE0X 4LYEA 3THRA 2X1VA 3OQMA 4OCZA 2JLXA 1W46A 1W35A 2J48A 4IQ4A 3K0SA 3HNPA 3JRWA 4LV6A 3X1JA 2X76A 3ESBA 1KY4A 2C83A 1EFAA 4QNNA 5AYVA 3EEFA 3OCVA 1FMTA 1RYDA 4QUGA 4ZJPA 4LBYA 1DJLA 4LKRA 1E61A 4Q3OA 3RGGA 2XCSB 1K63A 1ZZGA 2ZIEA 4S3MA 3KDAA 4MVYA 4U2EA 4BVKA 1QDUA 1JDSA 1H3FA 2EWMA 4M87A 3ZV5A 1IWPB 1Z6AA 1OAOA 2AK3A 4TLEA 4HNAA 4YCBA 4ER6A 5AUPB 5CNIA 3RQSA 4OI0A 5KVSA 1GNPA 2IYVA 1YDEA 1RI2A 3UCEA 1C1YA 2OP1A 1MRZA 4NH4A 3KSUA 5DM4A 2ST1A 5TGTA 5BVHA 2ZRDA 5IZ4A 1FDOA 1PR0A 2DFTA 2AFRA 1Z6PA 5A7GA 3CUUA 1ICIA 3MTDA 3TRJA 1A7KA 4JQZA 3SS8A 2O05A 1YVUA 3DQZA 3I09A 4OP3A 5AI5A 1QGZA 2C77A 4YASA 4RPJA 4AKTA 5LN1A 3GPLA 5ELXA 4BGDA 1P1IA 1T8TA 3KVOA 3ITDA 1N2GA 5H7XA 1YMVA 4AJLA 4CEIA 4JLOA 4WXMA 2WU3A 1DEHA 2BMJA 2FOIA 3WMFA 5CNMA 3OICA 4U0KA 3ZJVA 3BN3A 1EAMA 2NN3C 4TV8B 4XX0B 4CLRA 4DFDA 4RSHA 4RTRA 5EPUA 4L6CA 2K5UA 3GEEA 3ONWA 4XGNA 4AZ3B 3TLJA 3ZZTA 4EMUA 1JEDA 1OIXA 2CDAA 2ZANA 2FEOA 2FAXA 3M0EA 2NNLD 4MICA 5HJ5A 4Q7MB 3AVTA 3VGJA 4URWR 2BFCA 2XLBA 4WZBE 2E1RA 5DN6A 3OI7A 4MP6A 4EKGA 2XQFA 4AB1A 3PD0A 1XXLA 4C04A 1Y5IA 2JJYA 1EE9A 5AQ1A 3D81A 4EITA 4OLAA 1JS1X 4F96A 3O2QB 2C8KA 3NDPA 4DF3A 3IUYA 2R00A 1H8HA 4Q1BA 4R2IA 4XSHA 3G1TA 3TSAA 2RHGB 5ED0A 3GBSA 1K92A 4YV2A 3ERCA 3R6GA 1ZH0A 1T26A 1FRNA 4TTVA 1GITA 5DISB 1E5TA 4F45A 2DBQA 4U8HA 2V7BA 1JLMA 5A4DA 5B1HA 1P4AA 2I1QA 2OK8A 4L85A 2DETA 2WI8A 3PGKA 1JSZA 2NT3A 4QREA 1YUBA 5AM0A 1QIIA 3T5DA 3UYKA 4W9RA 1GNRA 2DU8A 4KDRA 3NYIA 1Q1BA 1G38A 3KJNA 3GAMA 5BN1A 3R0QA 2ZWOA 4L5CA 3DPSA 1N3LA 3DXXA 5BSUA 2HA5A 1SRQA 2B8NA 4BTLA 1CXZA 1ZPDA 1VSUA 4GMXA 2XEDA 5B12A 3SFVA 1JVBA 2O4UX 2MYNA 1EFPB 2W6QA 1MGPA 1GG8A 1Q0LA 1JIQA 2OMEA 4MVXA 2VHXA 2CCKA 2OBFA 1OA1A 2G88A 2JGMA 2DRIA 5DNYB 2Q3HA 1DBRA 3N2LA 2HDOA 4IDAA 3TGPA 2FP4A 2PWBA 4ZEVA 2B1RA 3ZU2A 3A4NA 4B81A 3L0DA 4DPKA 1MEOA 2H1HA 5CPBA 3IH5A 1MQAA 1OZ0A 4MS1A 1VOTA 1U2ZA 2P2GA 4ZV9A 4ASUA 2H6EA 1Y8CA 1Y8AA 3A3KA 3H7AA 5E0OA 5GGXA 1CRPA 1G6Q1 3NWJA 4PLZA 2CMHA 4U2DA 5IBRA 5CCDA 2Q1YA 3BJMA 2GM4A 3TMKA 2ID9A 2VF8A 1HF3A 4GKKB 1GPBA 3ELUA 1XKXA 2JLYA 2WSYB 5DK6A 4ZQEA 4LJ5A 5EWJA 4WK4B 3TLKA 3HUEA 2PMWB 1X13A 3DHYA 4BJHB 4BO7A 2BKXA 1PW7A 1RYZA 2SNIE 3A1WA 2FSIA 2ZSBA 1QRTA 2IZ1A 1HKUA 4B5LA 1XTBA 3DE2X 4Z3KA 5EHZA 1KI8A 1VLQA 1FYVA 1AUQA 1ID8A 4KE7A 2HK8A 4JBGA 3ZU3A 4QATA 4DREA 5GV7A 1OX4A 3D5TA 4D4GA 1HNZB 3KR2A 4DQXA 1G291 3VC1A 4FD2A 3CNLA 4LW8A 4BX3A 4BX2A 3GGOA 3BULA 4PNHA 3RC2A 2IUTA 3OEYA 4BNGA 2GEBA 1DBVO 1A27A 1LRLA 4JQOA 1I3KA 3DD5A 2OHOA 4MV4A 2P9FA 4LVNA 3OTWA 3AGPA 2ISSD 4ETWA 3E18A 3HU1A 4AMZA 2IV3A 3F3SA 5JAUA 3SJUA 3TOXA 3ITNA 4C4TA 3KOOA 3PLNA 1I5OA 1HT1E 2G4CA 2Z4TA 2W6CX 3HCPA 4ZP1A 4NBLA 2QMQA 4GLLA 4PFQA 3W2HA 4BTEA 3EQ7A 4B3RB 3CUYA 3I52A 1Y1KE 5DLPA 4HAIA 3ZX4A 4KAXA 1SVNA 4MAFA 2X2OA 4XOIA 1OFVA 3ITEA 3E5MA 3OJ0A 4C4SA 5JCPA 3K5WA 2YTZA 2NQTA 2AN5A 4FI3C 5F4ZA 5AK3A 4HDKB 5L3SA 2HM7A 2WD7B 1P4RA 2QRNA 3PNPA 2H8KA 2ZFUA 1SAYA 3CX8A 5DTRA 5DCUA 3S2GA 4JXKA 3TG8A 2FJPA 3IQIX 3THSA 2EJBA 3UTDA 4PICA 2WU4A 3SS9X 5E1OA 4FZVA 2P3SA 3JALB 3NT4A 4RVNA 2WNHA 1NVVQ 2VHZA 1S2DA 5A2QA 1FLAA 4IXDA 4E88A 2JA1A 1RCFA 1IQRA 1FY2A 5E9QA 2OXCA 1YOVA 5TT0A 1DARA 2Y1WA 4D9HA 3K1AA 1Q3KA 2NTYC 3WE7A 3A4MA 3PWTA 1EUCA 1CFJA 1LDBA 3A2MA 2RI1A 3GJ0A 3ZUGA 1VCNA 2RSLA 3L43A 3N53A 3OZEA 4NMWA 5BYKA 4AJHA 1R5NA 3QQ5A 1DX9A 4OOFA 2Z8YA 2NZUG 4WFQA 1WVGA 1UWLA 3DOJA 1EKXA 1OHHA 3KEQA 3P9QA 5EUMA 1OI2A 3PNQA 2OYRA 3ZCQA 1MZVA 1BXRA 2DERA 2BONA 1C41A 2P3QA 3SHWA 3LVBA 3W8DA 1XDGA 3QKWA 2SKCA 5JCOA 4LHSA 2FZWA 4KQ9A 2FR8A 1P17A 3DZKA 5ALVA 3FIUA 2BMDA 3DTVB 4CGYA 4KX5A 5IYZF 4JZKA 1VIMA 1VBNA 1TYBE 2NU6A 4MR8B 3SX0A 3TJMA 1WULS 5C1DA 1FK8A 3LVQE 2ZE5A 1W36B 2ETXA 4I3FA 3FGOA 4ZYLA 1JDZA 1P33A 1CYDA 2EWWA 4WN9B 3S44A 1TK2A 4FCWA 4HDRA 2VDWA 1KJIA 3PE3A 3AEQB 3GLHB 4MQ4A 1RFLA 4XGRA 1F2TB 2XHEA 3ADOA 1IQUA 1VKHA 2ZR8A 4LOAA 5IH7A 4ABTA 3I04A 2WTMA 5AJXA 3K6SB 3N70A 1Z83A 1RCTE 1XCOA 4YO7A 4YMHA 3I6YA 1TKRA 3KZ1E 3L6CA 2LD4A 2AD5A 5EJEA 1U63A 4EMSA 4XYGA 1BTOA 1P62B 1ACMA 1FMCA 3RSHA 2FZ5A 4IZOA 4R9VA 3EQ9A 4NIMA 4FMCB 4CMCA 3EFHA 2VSXA 4P5DA 3LF1A 1TCVA 4QYIA 5FOWA 2OVFA 3RYHB 3B6MA 1LRJA 3QUCA 2HU5A 1F60A 3AZQA 3B1FA 3JWIA 5IYZA 1FYXA 4A26A 1O8CA 2CNDA 5L7YA 4DLLA 4CM9A 3DXYA 4NFLA 1HG1A 5IM5A 3ADKA 2WJHA 4YPFA 1JLLB 3NIWA 3DMFA 3E2MA 3VR2D 1AF4A 3W8FA 1AQIA 4BEJA 2TMDA 4U39A 1VPLA 1T2UA 2H1WA 1REQB 2ZJ5A 2GVDC 1U2EA 3JX9A 3KC2A 4L5AA 3WK9A 1PW5A 4YAKA 3Q8LA 2VYND 2GD2A 3HDVA 1O89A 3ODGA 4JLMA 3RDPA 3UHAA 2H5IA 2ZOSA 4L6IA 3UJPA 4J7UA 5HVNA 4F46A 4ZA2A 4CM1A 5LP1A 4N65A 4HDSA 1AQUA 4LPSA 3F67A 4YIKA 4TYYA 2BUCA 3ID6C 1U4OA 4Q7LA 1XKTA 4IV5A 1MRNA 3FROA 1BWSA 2QTHA 3I9LA 4YO8A 6AT1A 1SUSA 1EU1A 3U39A 1EUZA 4HDMB 4NCKA 2QI9C 2ZB3A 2ODPA 2ZBRA 4LJ4A 3OE5A 5KJ6A 5K0GA 1JEAA 2QTNA 1MQ8B 1OU0A 1T6NA 4Z4QA 4KN9S 2O50A 1KOFA 2NSDA 4MR9A 4E7PA 5AI0A 2O8CB 3FTNA 3HLKA 3HFSA 2W2OA 3ROXA 1E1CB 2QRJA 3AVPA 3SBEA 2OCGA 2F6RA 4C76A 2OHFA 4FYHA 3WZLA 2ZBQA 4WADA 3S3TA 3JQEA 4CN9A 1EVYA 2JL1A 1OXXK 1VG9B 3PSAA 3WQBA 5BVGB 1ZJWA 3DOIA 3GWGA 2YXDA 1RZVA 3OBBA 4E1VA 4AJ1A 3JARA 3BL8A 4FDUA 4P08A 1BW9A 5CDFE 5LFAA 4LSZA 4BMOB 4MHTA 4N48A 3LY8A 2DJIA 2GVZC 1KEPA 3EC7A 1RWMA 4RZXA 1R8SA 3CLKA 1TVCA 3OJCA 4KOEC 3MFQA 1P4JA 2Q9BA 3H2GA 3O75A 1N78A 3SK0A 1SQ6A 5AVKA 3JQAB 2Q5JA 5LOVA 2BUAA 1Q0RA 4OA5A 4UD2A 2QTCA 1NIJA 3JPWA 3B1XA 2FQWA 4BTVA 2E18A 1P72A 4LF4B 1SUDA 4Z2YA 1GADO 3RODA 4QXAA 1PT8A 5E7QA 3I6IA 1I6LA 5JS7A 2HT1A 1V11B 3HXTA 3M9WA 3Q8XB 4LJLA 4BFWA 4PXSA 4J0EA 2IV7A 4CM7A 4HFNA 4W5HA 2OWEA 4ZODA 3TL3A 4M7RA 3LG2A 1K0FA 5GONF 3E7FA 3BM5A 5JNLA 2X0FA 3QUQA 4ER3A 2KHZA 2G17A 3C16C 3KXKA 3NBQA 4EJMA 2VTBB 4AS1A 3LDUA 3LCMA 1ETUA 2IHJA 4CCWA 5T6MA 3W9YA 1P0PA 1NKVA 2N9UA 2C9ZA 4X91A 2NOAA 5IANA 4BVBA 1UT6A 4CMKA 2ZROA 4BQIA 1EFCA 1JIUA 1XVIA 4PRZA 4X3CA 1TM2A 4JI6B 2G28A 4HEJA 4DR2B 3DHWC 1RMTA 3NBKA 4X9XA 5SYNA 4AJKA 3EDMA 2BYTA 5KVVA 2Q9CA 2RHRA 3RSQA 1Z45A 3W5AA 4DVGA 2V4ZA 5E7IA 2JB9A 3NM5A 2XRYA 1YF3A 1JKXA 1T4GA 3TVYA 5CVJA 2CXUA 3KPVA 4TTRA 4EAAA 4D96A 3L3BA 4ZCMA 2GYWA 1SXJC 2W98A 5KNBD 3TUJC 3C1OA 2C5HA 2FRDA 1B74A 3UAOA 3KAPA 3P1JA 4KXXA 1RQRA 2WHXA 2XDAA 3ETLA 3QMMA 3R3UA 4H3HB 2Z04A 3CHYA 2DQSA 3EXFA 1Z4MA 2FK7A 2ZUSA 1T8YA 4Q21A 1MHTA 1SUEA 3HDTA 3E9QA 3KHUA 4XQ9A 3IMEA 5KSYA 3BMOB 4HH1A 4UHHA 5CLJA 4AI6A 2QM8A 3WLQA 2I78A 4PX3A 5I5EA 4KQFA 1G7CA 2Z56A 4A4DA 4EY4A 5E0KB 4HF7A 3RAFC 5C3MA 3K8ZA 4MA0A 2UVPA 4OQDA 5EQFA 2WKQA 4Q3CA 1NFQA 3N0VA 2XITA 4UM7A 3HBFA 2D1FA 2LIPA 3QA9A 4RH0A 2EW2A 4QGGA 2HJRA 5D7NA 2I3AA 4KGVA 3LM8A 4ZU6X 3TB6A 3HO6A 1V95A 3RYFA 3C1UA 2Q62A 3U9LA 3T9EA 3W79A 4RABA 5J47A 1SHZA 2QZPA 3HB4X 1W25A 2ASVA 2GBCA 3VI4B 2NU8A 1XCMA 2LDBA 3GZTB 1U04A 4X3OA 1CJMA 1RLMA 3TTYA 2IOQA 4F5YA 5JXWA 4XPZA 2XMZA 2ZBVA 3K5HA 2NZXA 4YJDA 2HLPA 2OGZA 2R6DA 4KSBA 4OL0A 3ROKA 3NIGB 2FEWB 5CW1A 4L8VA 2PYDA 5ILOA 4ZOBA 4UVDA 3H2ZA 1PD0A 4Y2HA 1VYHA 1CJUC 1MIOA 3SICE 4CPDA 4UCXA 3DHVA 4UPEA 1WCWA 2ZUUA 3GFGA 3L7NA 4GXNA 4IOMA 4ZZ2A 2NYVA 2CV2A 1RE0A 1P2SA 4BNYA 2CUNA 3P0JA 2ZT6A 3UYLA 1MP0A 1RXVA 1WXDA 1KFCB 1RWBA 4XB1A 4R6XA 4EX6A 2ZJZA 3ZY4A 2PUJA 4N7JA 5K8IA 4JYCA 3RO7A 4OFWA 1X94A 4X1OA 3TE6A 3OX3A 5EJGA 4XRRA 3UENA 1H6DA 2AN9A 4HWGA 1E3TA 1PS0A 4YMWA 5BYJA 5UKDA 3W77A 5BR1A 1J0DA 1HQDA 2GTPA 5THKA 1KK0A 3M6WA 4YLGA 2PXCA 3UH0A 4IUYA 4FHDA 5AWFC 1HNWB 1BN7A 3IIIA 4QPDA 1V2GA 4LKOA 5TDHA 2F48A 2PS1A 1KOLA 1KWGA 2PL3A 2JG3A 3N5KA 1BD3A 4CCSA 3BBPA 3DOUA 2OXTA 3VZRA 4Y1FA 2ZDGA 1P1CA 3S2YA 1JMYA 1QPBA 2JIZA 1XHEA 1ZOLA 4O4IB 4DMRA 2FMIA 1UZAA 2TS1A 2J4DA 5E6UB 3FF1A 1IYZA 1DEKA 5J3JA 2B4AA 2FMTA 2I76A 2ZKLA 1W5TA 4LE0A 5ESDA 1SC9A 4PZYA 3CJTA 4MQLA 3CGGA 1I8TA 5C1BA 1POWA 4KO4S 2UYCA 4FXPA 3WGLA 3HA5A 2X9QA 1SVMA 3WP0A 5JNTA 3T9BA 4M22A 4LDQA 3RRJA 3HRIA 2OV2A 1VPDA 3DVAA 1F5SA 1W75A 2EFJA 3GLHE 3JYQA 3L7AA 5BSWA 2CZGA 2QE7D 5FJIA 4BFCA 3VVLA 1J9ZA 2V7TA 2C2WA 5JQGF 5JBQA