1Z7KB

Crystal structure of trypsin- ovomucoid turkey egg white inhibitor complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
VPMDCSRYPNTTSEEGKVMILCNKALNPVCGTDGVTYDNECVLCAHNLEQGTSVGKKHDGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Crystal structure of trypsin-turkey egg white inhibitor complex
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 11
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07648 Kazal_2 Kazal-type serine protease inhibitor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.30 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1z7kB00
3QTLD 1CHOI 1CSOI 2M5XA 1SGQI 1HPTA 1R0RI 2OVOA 1IW4A 2XRCA 1TGSI 2NU4I 1DS2I 2QQDA 1CT4I 1DS3I 3TJQA 2KMPA 1UVFA 2B0UC 2JZMA 4OVOA 1PCEA 1IY6A 1HDLA 1AN1I 2SGQI 3SGQI 2KMRA 2BUSA 4HGUA 2ERWA 1SGNI 2WCYA 5DAEA 2SGEI 5JHWC 2F3CI 1CGII 1PJUA 2GKTI 1SGRI 2GKRI 1M8BA 2QQCA 1CGJI 1MT1A 2P6AC 2KMOA 1Z7KB 2SGPI 1PPFI 1CT0I 1OYVI 1TUSA 1YTPA 2V53A 2N52A 2JXDA 2JYYA 2LEOA 1M8CA 1TBRR 2NU2I 1BUSA 1SGYI 1OMTA 2SGFI 3SEKC 1LR9A 1N13A 1SGPI 2N17A 1CE3A 1HJAI 2ARPF 2NU1I 3HH2C 1H0ZA 1OVOA 1TBQR 1KMAA 1IY5A 2GKVA 2NU0I 1FYBA 1BMOA 1CT2I 4SGBI 1Y1BA 4GI3C 2KMQA 1UVGA 1YU6C 1LR8A 2KCXA 3SGBI 1SGEI 1SGDI 1NUBA 1TURA 1UUCA 2SGDI 1TIHA 1Y1CA 1LR7A 2N71A 3B4VC 2NU3I 1OMUA 3OVOA
chains in the Genus database with same CATH superfamily
3QTLD 1CHOI 2VRWB 5CCMA 1CSOI 2K9HA 2M5XA 1SGQI 2ORWA 1HPTA 1KBEA 2OZUA 3FSYA 4UXHA 3FSXA 3E59A 9WGAA 1R0RI 1FY7A 1K7VA 2OVOA 2E5RA 1IW4A 1W3SA 2XRCA 4WP4A 5CCLA 3RU0A 5E3RA 1TGSI 1HEVA 2NU4I 2V1CC 1DS2I 5FUWA 2QQDA 5EX0A 1WGCA 3GOXA 2GIVA 2E73A 2GVIA 1CT4I 3VE5A 1KBFA 1DS3I 2RC4A 1UHAA 3TJQA 2KMPA 1UVFA 3TOBA 1FARA 2B0UC 2JZMA 5FUXA 2L7XA 4OVOA 3FC3A 7WGAA 1FAQA 1U5KA 1PCEA 1IY6A 3UFFA 1ULMA 1PTQA 2X52A 1HDLA 2ODDA 2ORVA 1ULKA 1AN1I 2V1CA 2W0TA 2SGQI 3SGQI 2KMRA 2BUSA 3R5BA 2DKVA 4HGUA 1PTRA 1XA6A 2DIPA 2ERWA 3UGDA 2OU2A 1SGNI 3UEYA 2WCYA 5DAEA 2SGEI 1XX6A 5JHWC 1MJ9A 2QQ0A 2F3CI 1CGII 1MJBA 2CJSC 1PJUA 2CWHA 2J9RA 3UOEA 2GKTI 5J8FA 3VDUA 4MPIA 1SGRI 2DB6A 3MEKA 3TO6A 3OXLA 2GKRI 3KY9A 1M8BA 3TO9A 5FUVA 3QAHA 2QQCA 5HI7A 3UGLA 1CGJI 4UXIA 1MT1A 2ROWA 3QWPA 1Q9BA 2P6AC 2QQEA 2KMOA 1Z7KB 2X3TA 1NXUA 2SGPI 3CXLA 1PPFI 1CT0I 1Y8FA 1OYVI 1VDDA 2CWGA 2N1AB 2OD1A 3BJIA 3OXFA 2J87A 1R79A 1K7TA 1TUSA 1YTPA 1TOTA 2V53A 1MJAA 1P9GA 2WGCA 2N52A 2JXDA 2UZ3A 2ENNA 1TBNA 2JYYA 2LEOA 2WVJA 2LUYA 2FNFX 1M8CA 5FUYA 1TBRR 2NU2I 2QPOA 2ENZA 1BUSA 1SGYI 1OMTA 2SGFI 3SEKC 2UVOA 3R5AA 1LR9A 4DNCA 2ELIA 1N13A 1SGPI 2N17A 1CE3A 1HJAI 2ARPF 2A20A 2NU1I 2LB7A 2L8EA 2B8TA 4E1PA 1W4RA 3R5DA 3D00A 3HH2C 1H0ZA 1K7UA 1OVOA 1TBQR 1WGTA 5J8CA 3E2IA 1KMAA 4UXJA 1IY5A 5E3PA 4L9MA 2GKVA 2NU0I 5EX3A 1FYBA 1XBTA 1BMOA 1CT2I 3OL0A 4SGBI 1S20A 3TOAA 4FKDA 1X74A 4A24A 2RIJA 1Y1BA 4JCVE 3TO7A 5HQ8A 2YUUA 1RFHA 1V1HA 1X4SA 2JW6A 4AMLA 5E3QA 1WTJA 1Z2IA 2YQPA 3OXGA 4GI3C 2CWFA 1ULNA 1UVGA 2KMQA 1YU6C 1LR8A 2KCXA 3SGBI 3R5CA 1TBOA 1SGEI 4E1RA 2PQ8A 1WKXA 4B6DA 1SGDI 1NUBA 1TURA 1UUCA 2SGDI 1V1IA 3UGIA 1TIHA 3PDNA 1Y1CA 2JA1A 3UEJA 1P9ZA 1LR7A 3VDPA 2Y0MA 2N71A 3B4VC 2NU3I 1OMUA 3OVOA
chains in the Genus database with same CATH topology
3QTLD 1CHOI 2VRWB 5CCMA 1CSOI 2K9HA 2M5XA 1SGQI 2ORWA 1HPTA 1KBEA 4UXHA 3E59A 1R0RI 2OVOA 2E5RA 1IW4A 1W3SA 2XRCA 5CCLA 3RU0A 1TGSI 2NU4I 2V1CC 1DS2I 5FUWA 2QQDA 5EX0A 3GOXA 2E73A 2GVIA 1CT4I 3VE5A 1KBFA 1DS3I 3TJQA 2KMPA 1UVFA 1FARA 2B0UC 2JZMA 5FUXA 2L7XA 4OVOA 3FC3A 1FAQA 1U5KA 1PCEA 1IY6A 3UFFA 1PTQA 1HDLA 2ODDA 2ORVA 1AN1I 2V1CA 2W0TA 2SGQI 3SGQI 2KMRA 2BUSA 4HGUA 1PTRA 1XA6A 2DIPA 2ERWA 3UGDA 1SGNI 3UEYA 2WCYA 5DAEA 2SGEI 1XX6A 5JHWC 2QQ0A 2F3CI 1CGII 2CJSC 1PJUA 2J9RA 2GKTI 3VDUA 1SGRI 2DB6A 3MEKA 3OXLA 2GKRI 3KY9A 1M8BA 5FUVA 2QQCA 5HI7A 3UGLA 1CGJI 4UXIA 1MT1A 2ROWA 3QWPA 2P6AC 2QQEA 2KMOA 1Z7KB 2SGPI 3CXLA 1PPFI 1CT0I 1Y8FA 1OYVI 1VDDA 2N1AB 3BJIA 2OD1A 3OXFA 2J87A 1R79A 1TUSA 1YTPA 1TOTA 2V53A 2N52A 2JXDA 2UZ3A 2ENNA 1TBNA 2JYYA 2LEOA 2WVJA 2LUYA 2FNFX 1M8CA 5FUYA 1TBRR 2NU2I 2QPOA 2ENZA 1BUSA 1SGYI 1OMTA 2SGFI 3SEKC 1LR9A 2ELIA 1N13A 1SGPI 2N17A 1CE3A 1HJAI 2ARPF 2A20A 2NU1I 2L8EA 2B8TA 4E1PA 1W4RA 3D00A 3HH2C 1H0ZA 1OVOA 1TBQR 3E2IA 1KMAA 4UXJA 1IY5A 5EX3A 4L9MA 2GKVA 2NU0I 1FYBA 1XBTA 1BMOA 1CT2I 3OL0A 4SGBI 4FKDA 1X74A 4A24A 1Y1BA 4JCVE 5HQ8A 2YUUA 1RFHA 1V1HA 1X4SA 2JW6A 2YQPA 4GI3C 3OXGA 2KMQA 1UVGA 1YU6C 1LR8A 2KCXA 3SGBI 1TBOA 1SGEI 4E1RA 4B6DA 1SGDI 1NUBA 1TURA 1UUCA 2SGDI 1V1IA 3UGIA 1TIHA 3PDNA 1Y1CA 2JA1A 3UEJA 1LR7A 3VDPA 2N71A 3B4VC 2NU3I 1OMUA 3OVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QTL D;  1CHO I;  1CSO I;  2M5X A;  1SGQ I;  1HPT A;  1R0R I;  2OVO A;  1IW4 A;  2XRC A;  1TGS I;  2NU4 I;  1DS2 I;  2QQD A;  1CT4 I;  1DS3 I;  3TJQ A;  2KMP A;  1UVF A;  2B0U C;  2JZM A;  4OVO A;  1PCE A;  1IY6 A;  1HDL A;  1AN1 I;  2SGQ I;  3SGQ I;  2KMR A;  2BUS A;  4HGU A;  2ERW A;  1SGN I;  2WCY A;  5DAE A;  2SGE I;  5JHW C;  2F3C I;  1CGI I;  1PJU A;  2GKT I;  1SGR I;  2GKR I;  1M8B A;  2QQC A;  1CGJ I;  1MT1 A;  2P6A C;  2KMO A;  1Z7K B;  2SGP I;  1PPF I;  1CT0 I;  1OYV I;  1TUS A;  1YTP A;  2V53 A;  2N52 A;  2JXD A;  2JYY A;  2LEO A;  1M8C A;  1TBR R;  2NU2 I;  1BUS A;  1SGY I;  1OMT A;  2SGF I;  3SEK C;  1LR9 A;  1N13 A;  1SGP I;  2N17 A;  1CE3 A;  1HJA I;  2ARP F;  2NU1 I;  3HH2 C;  1H0Z A;  1OVO A;  1TBQ R;  1KMA A;  1IY5 A;  2GKV A;  2NU0 I;  1FYB A;  1BMO A;  1CT2 I;  4SGB I;  1Y1B A;  4GI3 C;  2KMQ A;  1UVG A;  1YU6 C;  1LR8 A;  2KCX A;  3SGB I;  1SGE I;  1SGD I;  1NUB A;  1TUR A;  1UUC A;  2SGD I;  1TIH A;  1Y1C A;  1LR7 A;  2N71 A;  3B4V C;  2NU3 I;  1OMU A;  3OVO A; 
#chains in the Genus database with same CATH topology
 3QTL D;  1CHO I;  2VRW B;  5CCM A;  1CSO I;  2K9H A;  2M5X A;  1SGQ I;  2ORW A;  1HPT A;  1KBE A;  2OZU A;  3FSY A;  4UXH A;  3FSX A;  3E59 A;  9WGA A;  1R0R I;  1FY7 A;  1K7V A;  2OVO A;  2E5R A;  1IW4 A;  1W3S A;  2XRC A;  4WP4 A;  5CCL A;  3RU0 A;  5E3R A;  1TGS I;  1HEV A;  2NU4 I;  2V1C C;  1DS2 I;  5FUW A;  2QQD A;  5EX0 A;  1WGC A;  3GOX A;  2GIV A;  2E73 A;  2GVI A;  1CT4 I;  3VE5 A;  1KBF A;  1DS3 I;  2RC4 A;  1UHA A;  3TJQ A;  2KMP A;  1UVF A;  3TOB A;  1FAR A;  2B0U C;  2JZM A;  5FUX A;  2L7X A;  4OVO A;  3FC3 A;  7WGA A;  1FAQ A;  1U5K A;  1PCE A;  1IY6 A;  3UFF A;  1ULM A;  1PTQ A;  2X52 A;  1HDL A;  2ODD A;  2ORV A;  1ULK A;  1AN1 I;  2V1C A;  2W0T A;  2SGQ I;  3SGQ I;  2KMR A;  2BUS A;  3R5B A;  2DKV A;  4HGU A;  1PTR A;  1XA6 A;  2DIP A;  2ERW A;  3UGD A;  2OU2 A;  1SGN I;  3UEY A;  2WCY A;  5DAE A;  2SGE I;  1XX6 A;  5JHW C;  1MJ9 A;  2QQ0 A;  2F3C I;  1CGI I;  1MJB A;  2CJS C;  1PJU A;  2CWH A;  2J9R A;  3UOE A;  2GKT I;  5J8F A;  3VDU A;  4MPI A;  1SGR I;  2DB6 A;  3MEK A;  3TO6 A;  3OXL A;  2GKR I;  3KY9 A;  1M8B A;  3TO9 A;  5FUV A;  3QAH A;  2QQC A;  5HI7 A;  3UGL A;  1CGJ I;  4UXI A;  1MT1 A;  2ROW A;  3QWP A;  1Q9B A;  2P6A C;  2QQE A;  2KMO A;  1Z7K B;  2X3T A;  1NXU A;  2SGP I;  3CXL A;  1PPF I;  1CT0 I;  1Y8F A;  1OYV I;  1VDD A;  2CWG A;  2N1A B;  2OD1 A;  3BJI A;  3OXF A;  2J87 A;  1R79 A;  1K7T A;  1TUS A;  1YTP A;  1TOT A;  2V53 A;  1MJA A;  1P9G A;  2WGC A;  2N52 A;  2JXD A;  2UZ3 A;  2ENN A;  1TBN A;  2JYY A;  2LEO A;  2WVJ A;  2LUY A;  2FNF X;  1M8C A;  5FUY A;  1TBR R;  2NU2 I;  2QPO A;  2ENZ A;  1BUS A;  1SGY I;  1OMT A;  2SGF I;  3SEK C;  2UVO A;  3R5A A;  1LR9 A;  4DNC A;  2ELI A;  1N13 A;  1SGP I;  2N17 A;  1CE3 A;  1HJA I;  2ARP F;  2A20 A;  2NU1 I;  2LB7 A;  2L8E A;  2B8T A;  4E1P A;  1W4R A;  3R5D A;  3D00 A;  3HH2 C;  1H0Z A;  1K7U A;  1OVO A;  1TBQ R;  1WGT A;  5J8C A;  3E2I A;  1KMA A;  4UXJ A;  1IY5 A;  5E3P A;  4L9M A;  2GKV A;  2NU0 I;  5EX3 A;  1FYB A;  1XBT A;  1BMO A;  1CT2 I;  3OL0 A;  4SGB I;  1S20 A;  3TOA A;  4FKD A;  1X74 A;  4A24 A;  2RIJ A;  1Y1B A;  4JCV E;  3TO7 A;  5HQ8 A;  2YUU A;  1RFH A;  1V1H A;  1X4S A;  2JW6 A;  4AML A;  5E3Q A;  1WTJ A;  1Z2I A;  2YQP A;  3OXG A;  4GI3 C;  2CWF A;  1ULN A;  1UVG A;  2KMQ A;  1YU6 C;  1LR8 A;  2KCX A;  3SGB I;  3R5C A;  1TBO A;  1SGE I;  4E1R A;  2PQ8 A;  1WKX A;  4B6D A;  1SGD I;  1NUB A;  1TUR A;  1UUC A;  2SGD I;  1V1I A;  3UGI A;  1TIH A;  3PDN A;  1Y1C A;  2JA1 A;  3UEJ A;  1P9Z A;  1LR7 A;  3VDP A;  2Y0M A;  2N71 A;  3B4V C;  2NU3 I;  1OMU A;  3OVO A; 
#chains in the Genus database with same CATH homology
 3QTL D;  1CHO I;  2VRW B;  5CCM A;  1CSO I;  2K9H A;  2M5X A;  1SGQ I;  2ORW A;  1HPT A;  1KBE A;  4UXH A;  3E59 A;  1R0R I;  2OVO A;  2E5R A;  1IW4 A;  1W3S A;  2XRC A;  5CCL A;  3RU0 A;  1TGS I;  2NU4 I;  2V1C C;  1DS2 I;  5FUW A;  2QQD A;  5EX0 A;  3GOX A;  2E73 A;  2GVI A;  1CT4 I;  3VE5 A;  1KBF A;  1DS3 I;  3TJQ A;  2KMP A;  1UVF A;  1FAR A;  2B0U C;  2JZM A;  5FUX A;  2L7X A;  4OVO A;  3FC3 A;  1FAQ A;  1U5K A;  1PCE A;  1IY6 A;  3UFF A;  1PTQ A;  1HDL A;  2ODD A;  2ORV A;  1AN1 I;  2V1C A;  2W0T A;  2SGQ I;  3SGQ I;  2KMR A;  2BUS A;  4HGU A;  1PTR A;  1XA6 A;  2DIP A;  2ERW A;  3UGD A;  1SGN I;  3UEY A;  2WCY A;  5DAE A;  2SGE I;  1XX6 A;  5JHW C;  2QQ0 A;  2F3C I;  1CGI I;  2CJS C;  1PJU A;  2J9R A;  2GKT I;  3VDU A;  1SGR I;  2DB6 A;  3MEK A;  3OXL A;  2GKR I;  3KY9 A;  1M8B A;  5FUV A;  2QQC A;  5HI7 A;  3UGL A;  1CGJ I;  4UXI A;  1MT1 A;  2ROW A;  3QWP A;  2P6A C;  2QQE A;  2KMO A;  1Z7K B;  2SGP I;  3CXL A;  1PPF I;  1CT0 I;  1Y8F A;  1OYV I;  1VDD A;  2N1A B;  3BJI A;  2OD1 A;  3OXF A;  2J87 A;  1R79 A;  1TUS A;  1YTP A;  1TOT A;  2V53 A;  2N52 A;  2JXD A;  2UZ3 A;  2ENN A;  1TBN A;  2JYY A;  2LEO A;  2WVJ A;  2LUY A;  2FNF X;  1M8C A;  5FUY A;  1TBR R;  2NU2 I;  2QPO A;  2ENZ A;  1BUS A;  1SGY I;  1OMT A;  2SGF I;  3SEK C;  1LR9 A;  2ELI A;  1N13 A;  1SGP I;  2N17 A;  1CE3 A;  1HJA I;  2ARP F;  2A20 A;  2NU1 I;  2L8E A;  2B8T A;  4E1P A;  1W4R A;  3D00 A;  3HH2 C;  1H0Z A;  1OVO A;  1TBQ R;  3E2I A;  1KMA A;  4UXJ A;  1IY5 A;  5EX3 A;  4L9M A;  2GKV A;  2NU0 I;  1FYB A;  1XBT A;  1BMO A;  1CT2 I;  3OL0 A;  4SGB I;  4FKD A;  1X74 A;  4A24 A;  1Y1B A;  4JCV E;  5HQ8 A;  2YUU A;  1RFH A;  1V1H A;  1X4S A;  2JW6 A;  2YQP A;  4GI3 C;  3OXG A;  2KMQ A;  1UVG A;  1YU6 C;  1LR8 A;  2KCX A;  3SGB I;  1TBO A;  1SGE I;  4E1R A;  4B6D A;  1SGD I;  1NUB A;  1TUR A;  1UUC A;  2SGD I;  1V1I A;  3UGI A;  1TIH A;  3PDN A;  1Y1C A;  2JA1 A;  3UEJ A;  1LR7 A;  3VDP A;  2N71 A;  3B4V C;  2NU3 I;  1OMU A;  3OVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...