1Z7MA

Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
318
structure length
311
Chain Sequence
YLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP phosphoribosyltransferase regulatory subunit
publication title Activation of the hetero-octameric ATP phosphoribosyl transferase through subunit interface rearrangement by a tRNA synthetase paralog.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transferase
total genus 100
structure length 311
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1z7mA00
3L4GA 4H2VA 1E1OA 4H2SA 1B70A 4P3NA 1JJCA 2ZTGA 3A31A 1HC7A 2EWNA 3V7SA 3E9HA 3V8LA 4YRTA 4XTUA 3V7RA 4P72C 2ZZEA 1NJ8A 1YGBA 2I4NA 3HXUA 2ARUA 1EFWA 3RL6A 1EQRA 4NCXA 4DQ2A 1YFTA 4RQFA 3PZCA 2ZZFA 3IKMB 1NYRA 2ZR3A 4XU0A 4WF2A 3P8YA 1B7YA 2ZIMA 4YCVA 2EAYA 2ZT8A 4H2WA 4H02A 4XTYA 3VBBA 1BBUA 4P73C 2ARTA 4WI1A 4ZIBA 3A5YA 3RKWA 5K1PA 2ZCEA 4K87A 1ASZA 2ALYB 2DVEA 3W3SA 3V8JA 3LC0A 2I4OA 3NENA 3RKXA 1YB3A 2DKGA 3UGQA 2IY5A 3A74A 4XU3A 2Q5HA 2DU7A 4TQDA 4HVCA 4J15A 3R07A 4H2YA 4WJ4A 4YRSA 5C53B 2QHVA 1NYQA 1EIYA 4O2DA 3HFZB 4P74C 1PYSA 2XGTA 3EFSA 3NELA 2J3MA 1E22A 1G51A 4CH6A 4YREA 3KFUA 4TTVA 1JJCB 3P8TA 4CH3A 1H4QA 4XTWA 2Q7HA 2EJ9A 2ZT6A 3VQWA 3TEHA 4H2UA 4UPAA 2DU5A 2ODRD 4YRIA 2RHSA 1BIBA 4CH4A 3A7RA 1USYA 1VQZA 5ELOA 3I7FA 1HTTA 3A7UA 4PG3A 3REXA 2AKWA 4KQEA 4WJ3M 2PMFA 4G85A 5F5WA 1B7YB 3HFVA 2HNIA 1ATIA 2G4CA 1RIQA 3G1ZA 4HWPA 4HA8A 3OD1A 1X55A 5K1XA 1WQ7A 3FJPA 3HXYA 1WNLA 3RGLA 4YROA 2RHQA 1B76A 2DXUA 3HXZA 2DDZA 1SESA 4HWSA 2DXTA 3DSQA 2Q5IA 3IKLA 12ASA 2ZXFA 2EJGA 3QNEA 5C51B 3BJUA 5ELNA 4HWRA 1WLEA 3NEMA 1WQWA 3HTZA 1J5WA 1NJ6A 1ASYA 3HRKA 1EIYB 1ADJA 4EX5A 4BW9A 1G5HA 4EO4A 1NNHA 3L1AA 1EOVA 2E41A 4KR2A 3LSSA 2P5IA 2E64A 1H4SA 2AMCA 2DQ3A 4TVYA 4XU1A 2FYKA 1BBWA 2Q7EA 4E51A 3TEHB 1E1TA 3ICAA 2CIMA 4XU2A 3A32A 1SERA 1HXDA 2RHSB 4PHCA 4TQFA 1X2HA 2DJZA 1L0WA 3HXXA 3MF1A 2QHSA 4XTZA 4YP0A 4ZTUB 3HXVA 4L87A 3MF2A 1X54A 4KR3A 2DZ9A 3QTCA 3HY1A 2ZT7A 4K86A 1KOGA 1WYDA 4YRGA 3UFGA 4OLFA 1N9WA 4OP0A 3UH0A 1KMMA 3L4GB 2XTIA 1B70B 1SETA 4DPGA 2PMEA 2DTHA 5KNNA 3VQXA 1LYLA 1WU7A 3QO5A 3EFRA 3TEGA 3QO8A 2RHQB 3RACA 2CGHA 2ZNJA 2E10A 4UP9A 4YPFA 2CJBA 1G5IA 3HXWA 1X56A 3PCOA 4XEMA 2DTOA 11ASA 2EJFA 3QO7A 4YRPA 3REUA 3BFMA 4H2XA 1QE0A 4RDXA 4HWOA 4TVAA 2QHUA 4G84A 4YCWA 3CMQA 4H2TA 4BWAA 1H4TA 2ZZGA 2AMCB 4CS4A 3NETA 4CH5A 4P75A 5E3IA 4P71A 4UP8A 3TUPA 1SRYA 1QF6A 2E5AA 2DEQA 1KMNA 4LNSA 4YRJA 2E3CA 2ZINA 2IY5B 1GGMA 3M4PA 3V7CA 1H4VB 2DZCA 1E24A 3RF1A 2CJAA 4CS2A 2ARSA 2QHTA 4XTVA 1PYSB 1X2GA 1EVLA 4TVWA 3E9IA 2J3LA 1EVKA 4ZTZB 2CJ9A 1BIAA 1NJ2A 4YYEA 4X5OA 4YRLA 1Z7NA 1NJ5A 3L2ZA 3ERRA 2P0LA 4P72A 1B8AA 2C7IA 2ZIOA 3RIRA 2ZNIA 4P3PA 4UP7A 3PCOB 3WQZA 3RUXA 5C52B 1FYFA 4H2XB 2AKWB 2E1HA 3IALA 4YRCA 2Q7GA 4YRFA 4TVAB 4Q15A 3VQVA 4XEOA 3A7AA 4P73A 1YFRA 4YDQA 1W66A 5HGQA 3V8KA 4RMFA 1ADYA 4Q6GA 2I4LA 4YRRA 2E65A 3A5ZA 1C0AA 4YRKA 1USYC 3M4QA 1YFSA 3MEYA 4XTXA 1X01A 2ZGWA 3HY0A 4YRMA 4P3OA 3IG2A 4RQEA 2ZT5A 4P74A 4TWAA 2ZR2A 2C8MA 4CS3A 4HWTA 4AH6A 4YRQA 2ALYA 3LSQA 4P75C 3P8VA 2I4MA 4P71C 1IL2A 1NJ1A 3VQYA 3RKYA 2DQ0A 4YRNA 2EL9A 1Z7MA 4YCUA 3HFZA 3HRIA 4K88A 3UGTA 2DTIA 2ODRC 1WPYA
chains in the Genus database with same CATH superfamily
3L4GA 4H2VA 1E1OA 4H2SA 1B70A 4P3NA 1JJCA 2ZTGA 3A31A 1HC7A 2EWNA 3V7SA 3E9HA 3V8LA 4YRTA 4XTUA 3V7RA 4P72C 2ZZEA 1NJ8A 1YGBA 2I4NA 3HXUA 2ARUA 1EFWA 3RL6A 1EQRA 4NCXA 4DQ2A 1YFTA 4RQFA 3PZCA 2ZZFA 3IKMB 1NYRA 2ZR3A 4XU0A 4WF2A 3P8YA 1B7YA 2ZIMA 4YCVA 2EAYA 2ZT8A 4H2WA 4H02A 4XTYA 3VBBA 1BBUA 4P73C 2ARTA 4WI1A 4ZIBA 4LVJA 4LVMA 3A5YA 3RKWA 5K1PA 2ZCEA 4K87A 1ASZA 2ALYB 2DVEA 3W3SA 3V8JA 3LC0A 2I4OA 3NENA 3RKXA 4LVIA 1YB3A 2DKGA 3UGQA 2IY5A 3A74A 4XU3A 2Q5HA 2DU7A 4TQDA 4HVCA 4J15A 3R07A 4H2YA 4WJ4A 4YRSA 5C53B 2QHVA 1NYQA 1EIYA 4O2DA 3HFZB 4P74C 1PYSA 2XGTA 3EFSA 3NELA 2J3MA 1E22A 1G51A 4CH6A 4YREA 3KFUA 4TTVA 1JJCB 3P8TA 4CH3A 1H4QA 4XTWA 2Q7HA 2EJ9A 2ZT6A 3VQWA 3TEHA 4H2UA 4UPAA 2DU5A 2ODRD 4YRIA 2RHSA 1BIBA 4CH4A 3A7RA 1USYA 1VQZA 5ELOA 3I7FA 1HTTA 3A7UA 4PG3A 3REXA 2AKWA 4KQEA 4WJ3M 2PMFA 4G85A 5F5WA 1B7YB 3HFVA 2HNIA 1ATIA 2G4CA 1RIQA 3G1ZA 4HWPA 4HA8A 3OD1A 1X55A 5K1XA 1WQ7A 3FJPA 3HXYA 1WNLA 3RGLA 4YROA 2RHQA 1B76A 2DXUA 3HXZA 2DDZA 1SESA 4HWSA 2DXTA 3DSQA 2Q5IA 3IKLA 12ASA 2ZXFA 2EJGA 3QNEA 5C51B 3BJUA 5ELNA 4HWRA 1WLEA 3NEMA 1WQWA 3HTZA 1J5WA 1NJ6A 1ASYA 3HRKA 1EIYB 1ADJA 4EX5A 4BW9A 1G5HA 4EO4A 1NNHA 3L1AA 1EOVA 2E41A 4KR2A 3LSSA 2P5IA 2E64A 1H4SA 2AMCA 2DQ3A 4TVYA 4XU1A 2FYKA 1BBWA 2Q7EA 4E51A 3TEHB 1E1TA 3ICAA 2CIMA 4XU2A 3A32A 1SERA 1HXDA 2RHSB 4PHCA 4TQFA 1X2HA 2DJZA 1L0WA 3HXXA 3MF1A 2QHSA 4XTZA 4YP0A 4ZTUB 3HXVA 4L87A 3MF2A 1X54A 4KR3A 2DZ9A 3QTCA 3HY1A 2ZT7A 4K86A 1KOGA 2NS6A 1WYDA 4YRGA 3UFGA 4OLFA 1N9WA 4OP0A 3UH0A 1KMMA 3L4GB 2XTIA 1B70B 1SETA 4DPGA 2PMEA 2DTHA 5KNNA 3VQXA 1LYLA 1WU7A 3QO5A 3EFRA 3TEGA 3QO8A 2RHQB 3RACA 2CGHA 2ZNJA 2E10A 4UP9A 4YPFA 2CJBA 1G5IA 3HXWA 1X56A 3PCOA 4XEMA 2DTOA 11ASA 2EJFA 3QO7A 4YRPA 3REUA 3BFMA 4H2XA 1QE0A 4RDXA 4HWOA 4TVAA 2QHUA 4G84A 4YCWA 3CMQA 4H2TA 4BWAA 1H4TA 2ZZGA 2AMCB 4CS4A 3MQZA 3NETA 4CH5A 4P75A 5E3IA 4P71A 4UP8A 3TUPA 1SRYA 1QF6A 2E5AA 2DEQA 1KMNA 4LNSA 4YRJA 2E3CA 2ZINA 2IY5B 1GGMA 3M4PA 3V7CA 1H4VB 2DZCA 1E24A 3RF1A 2CJAA 4CS2A 2ARSA 2QHTA 4XTVA 1PYSB 1X2GA 1EVLA 4TVWA 3E9IA 2J3LA 1EVKA 4ZTZB 2CJ9A 1BIAA 1NJ2A 4YYEA 4X5OA 4YRLA 1Z7NA 1NJ5A 3L2ZA 3ERRA 2P0LA 4P72A 1B8AA 2C7IA 2ZIOA 3RIRA 2ZNIA 4P3PA 4UP7A 3PCOB 3WQZA 3RUXA 4LVKA 5C52B 1FYFA 4H2XB 2AKWB 2E1HA 3IALA 4YRCA 2Q7GA 4YRFA 4TVAB 4Q15A 3VQVA 4XEOA 3A7AA 4P73A 1YFRA 4YDQA 1W66A 5HGQA 3V8KA 4RMFA 1ADYA 4Q6GA 2I4LA 4YRRA 2E65A 3A5ZA 1C0AA 4YRKA 1USYC 3M4QA 1YFSA 3MEYA 4XTXA 1X01A 2ZGWA 3HY0A 4YRMA 4P3OA 3IG2A 4RQEA 2ZT5A 4P74A 4TWAA 4HT4A 2ZR2A 2C8MA 4CS3A 4HWTA 4AH6A 4YRQA 2ALYA 3LSQA 4P75C 3P8VA 2I4MA 4P71C 1IL2A 1NJ1A 2A8EA 3VQYA 3RKYA 2DQ0A 4YRNA 4LVLA 2EL9A 1Z7MA 4YCUA 3HFZA 3HRIA 4K88A 3UGTA 2DTIA 2ODRC 1WPYA
chains in the Genus database with same CATH topology
3L4GA 4H2VA 1E1OA 4H2SA 1B70A 4P3NA 1JJCA 2ZTGA 3A31A 1HC7A 2EWNA 3V7SA 3E9HA 3V8LA 4YRTA 4XTUA 3V7RA 4P72C 2ZZEA 1NJ8A 1YGBA 2I4NA 3HXUA 2ARUA 1EFWA 3RL6A 1EQRA 4NCXA 4DQ2A 1YFTA 4RQFA 3PZCA 2ZZFA 3IKMB 1NYRA 2ZR3A 4XU0A 4WF2A 3P8YA 1B7YA 2ZIMA 4YCVA 2EAYA 2ZT8A 4H2WA 4H02A 4XTYA 3VBBA 1BBUA 4P73C 2ARTA 4WI1A 4ZIBA 4LVJA 4LVMA 3A5YA 3RKWA 5K1PA 2ZCEA 4K87A 1ASZA 2ALYB 2DVEA 3W3SA 3V8JA 3LC0A 2I4OA 3NENA 3RKXA 4LVIA 1YB3A 2DKGA 3UGQA 2IY5A 3A74A 4XU3A 2Q5HA 2DU7A 4TQDA 4HVCA 4J15A 3R07A 4H2YA 4WJ4A 4YRSA 5C53B 2QHVA 1NYQA 1EIYA 4O2DA 3HFZB 4P74C 1PYSA 2XGTA 3EFSA 3NELA 2J3MA 1E22A 1G51A 4CH6A 4YREA 3KFUA 4TTVA 1JJCB 3P8TA 4CH3A 1H4QA 4XTWA 2Q7HA 2EJ9A 2ZT6A 3VQWA 3TEHA 4H2UA 4UPAA 2DU5A 2ODRD 4YRIA 2RHSA 1BIBA 4CH4A 3A7RA 1USYA 1VQZA 5ELOA 3I7FA 1HTTA 3A7UA 4PG3A 3REXA 2AKWA 4KQEA 4WJ3M 2PMFA 4G85A 5F5WA 1B7YB 3HFVA 2HNIA 1ATIA 2G4CA 1RIQA 3G1ZA 4HWPA 4HA8A 3OD1A 1X55A 5K1XA 1WQ7A 3FJPA 3HXYA 1WNLA 3RGLA 4YROA 2RHQA 1B76A 2DXUA 3HXZA 2DDZA 1SESA 4HWSA 2DXTA 3DSQA 2Q5IA 3IKLA 12ASA 2ZXFA 2EJGA 3QNEA 5C51B 3BJUA 5ELNA 4HWRA 1WLEA 3NEMA 1WQWA 3HTZA 1J5WA 1NJ6A 1ASYA 3HRKA 1EIYB 1ADJA 4EX5A 4BW9A 1G5HA 4EO4A 1NNHA 3L1AA 1EOVA 2E41A 4KR2A 3LSSA 2P5IA 2E64A 1H4SA 2AMCA 2DQ3A 4TVYA 4XU1A 2FYKA 1BBWA 2Q7EA 4E51A 3TEHB 1E1TA 3ICAA 2CIMA 4XU2A 3A32A 1SERA 1HXDA 2RHSB 4PHCA 4TQFA 1X2HA 2DJZA 1L0WA 3HXXA 3MF1A 2QHSA 4XTZA 4YP0A 4ZTUB 3HXVA 4L87A 3MF2A 1X54A 4KR3A 2DZ9A 3QTCA 3HY1A 2ZT7A 4K86A 1KOGA 2NS6A 1WYDA 4YRGA 3UFGA 4OLFA 1N9WA 4OP0A 3UH0A 1KMMA 3L4GB 2XTIA 1B70B 1SETA 4DPGA 2PMEA 2DTHA 5KNNA 3VQXA 1LYLA 1WU7A 3QO5A 3EFRA 3TEGA 3QO8A 2RHQB 3RACA 2CGHA 2ZNJA 2E10A 4UP9A 4YPFA 2CJBA 1G5IA 3HXWA 1X56A 3PCOA 4XEMA 2DTOA 11ASA 2EJFA 3QO7A 4YRPA 3REUA 3BFMA 4H2XA 1QE0A 4RDXA 4HWOA 4TVAA 2QHUA 4G84A 4YCWA 3CMQA 4H2TA 4BWAA 1H4TA 2ZZGA 2AMCB 4CS4A 3MQZA 3NETA 4CH5A 4P75A 5E3IA 4P71A 4UP8A 3TUPA 1SRYA 1QF6A 2E5AA 2DEQA 1KMNA 4LNSA 4YRJA 2E3CA 2ZINA 2IY5B 1GGMA 3M4PA 3V7CA 1H4VB 2DZCA 1E24A 3RF1A 2CJAA 4CS2A 2ARSA 2QHTA 4XTVA 1PYSB 1X2GA 1EVLA 4TVWA 3E9IA 2J3LA 1EVKA 4ZTZB 2CJ9A 1BIAA 1NJ2A 4YYEA 4X5OA 4YRLA 1Z7NA 1NJ5A 3L2ZA 3ERRA 2P0LA 4P72A 1B8AA 2C7IA 2ZIOA 3RIRA 2ZNIA 4P3PA 4UP7A 3PCOB 3WQZA 3RUXA 4LVKA 5C52B 1FYFA 4H2XB 2AKWB 2E1HA 3IALA 4YRCA 2Q7GA 4YRFA 4TVAB 4Q15A 3VQVA 4XEOA 3A7AA 4P73A 1YFRA 4YDQA 1W66A 5HGQA 3V8KA 4RMFA 1ADYA 4Q6GA 2I4LA 4YRRA 2E65A 3A5ZA 1C0AA 4YRKA 1USYC 3M4QA 1YFSA 3MEYA 4XTXA 1X01A 2ZGWA 3HY0A 4YRMA 4P3OA 3IG2A 4RQEA 2ZT5A 4P74A 4TWAA 4HT4A 2ZR2A 2C8MA 4CS3A 4HWTA 4AH6A 4YRQA 2ALYA 3LSQA 4P75C 3P8VA 2I4MA 4P71C 1IL2A 1NJ1A 2A8EA 3VQYA 3RKYA 2DQ0A 4YRNA 4LVLA 2EL9A 1Z7MA 4YCUA 3HFZA 3HRIA 4K88A 3UGTA 2DTIA 2ODRC 1WPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4G A;  4H2V A;  1E1O A;  4H2S A;  1B70 A;  4P3N A;  1JJC A;  2ZTG A;  3A31 A;  1HC7 A;  2EWN A;  3V7S A;  3E9H A;  3V8L A;  4YRT A;  4XTU A;  3V7R A;  4P72 C;  2ZZE A;  1NJ8 A;  1YGB A;  2I4N A;  3HXU A;  2ARU A;  1EFW A;  3RL6 A;  1EQR A;  4NCX A;  4DQ2 A;  1YFT A;  4RQF A;  3PZC A;  2ZZF A;  3IKM B;  1NYR A;  2ZR3 A;  4XU0 A;  4WF2 A;  3P8Y A;  1B7Y A;  2ZIM A;  4YCV A;  2EAY A;  2ZT8 A;  4H2W A;  4H02 A;  4XTY A;  3VBB A;  1BBU A;  4P73 C;  2ART A;  4WI1 A;  4ZIB A;  3A5Y A;  3RKW A;  5K1P A;  2ZCE A;  4K87 A;  1ASZ A;  2ALY B;  2DVE A;  3W3S A;  3V8J A;  3LC0 A;  2I4O A;  3NEN A;  3RKX A;  1YB3 A;  2DKG A;  3UGQ A;  2IY5 A;  3A74 A;  4XU3 A;  2Q5H A;  2DU7 A;  4TQD A;  4HVC A;  4J15 A;  3R07 A;  4H2Y A;  4WJ4 A;  4YRS A;  5C53 B;  2QHV A;  1NYQ A;  1EIY A;  4O2D A;  3HFZ B;  4P74 C;  1PYS A;  2XGT A;  3EFS A;  3NEL A;  2J3M A;  1E22 A;  1G51 A;  4CH6 A;  4YRE A;  3KFU A;  4TTV A;  1JJC B;  3P8T A;  4CH3 A;  1H4Q A;  4XTW A;  2Q7H A;  2EJ9 A;  2ZT6 A;  3VQW A;  3TEH A;  4H2U A;  4UPA A;  2DU5 A;  2ODR D;  4YRI A;  2RHS A;  1BIB A;  4CH4 A;  3A7R A;  1USY A;  1VQZ A;  5ELO A;  3I7F A;  1HTT A;  3A7U A;  4PG3 A;  3REX A;  2AKW A;  4KQE A;  4WJ3 M;  2PMF A;  4G85 A;  5F5W A;  1B7Y B;  3HFV A;  2HNI A;  1ATI A;  2G4C A;  1RIQ A;  3G1Z A;  4HWP A;  4HA8 A;  3OD1 A;  1X55 A;  5K1X A;  1WQ7 A;  3FJP A;  3HXY A;  1WNL A;  3RGL A;  4YRO A;  2RHQ A;  1B76 A;  2DXU A;  3HXZ A;  2DDZ A;  1SES A;  4HWS A;  2DXT A;  3DSQ A;  2Q5I A;  3IKL A;  12AS A;  2ZXF A;  2EJG A;  3QNE A;  5C51 B;  3BJU A;  5ELN A;  4HWR A;  1WLE A;  3NEM A;  1WQW A;  3HTZ A;  1J5W A;  1NJ6 A;  1ASY A;  3HRK A;  1EIY B;  1ADJ A;  4EX5 A;  4BW9 A;  1G5H A;  4EO4 A;  1NNH A;  3L1A A;  1EOV A;  2E41 A;  4KR2 A;  3LSS A;  2P5I A;  2E64 A;  1H4S A;  2AMC A;  2DQ3 A;  4TVY A;  4XU1 A;  2FYK A;  1BBW A;  2Q7E A;  4E51 A;  3TEH B;  1E1T A;  3ICA A;  2CIM A;  4XU2 A;  3A32 A;  1SER A;  1HXD A;  2RHS B;  4PHC A;  4TQF A;  1X2H A;  2DJZ A;  1L0W A;  3HXX A;  3MF1 A;  2QHS A;  4XTZ A;  4YP0 A;  4ZTU B;  3HXV A;  4L87 A;  3MF2 A;  1X54 A;  4KR3 A;  2DZ9 A;  3QTC A;  3HY1 A;  2ZT7 A;  4K86 A;  1KOG A;  1WYD A;  4YRG A;  3UFG A;  4OLF A;  1N9W A;  4OP0 A;  3UH0 A;  1KMM A;  3L4G B;  2XTI A;  1B70 B;  1SET A;  4DPG A;  2PME A;  2DTH A;  5KNN A;  3VQX A;  1LYL A;  1WU7 A;  3QO5 A;  3EFR A;  3TEG A;  3QO8 A;  2RHQ B;  3RAC A;  2CGH A;  2ZNJ A;  2E10 A;  4UP9 A;  4YPF A;  2CJB A;  1G5I A;  3HXW A;  1X56 A;  3PCO A;  4XEM A;  2DTO A;  11AS A;  2EJF A;  3QO7 A;  4YRP A;  3REU A;  3BFM A;  4H2X A;  1QE0 A;  4RDX A;  4HWO A;  4TVA A;  2QHU A;  4G84 A;  4YCW A;  3CMQ A;  4H2T A;  4BWA A;  1H4T A;  2ZZG A;  2AMC B;  4CS4 A;  3NET A;  4CH5 A;  4P75 A;  5E3I A;  4P71 A;  4UP8 A;  3TUP A;  1SRY A;  1QF6 A;  2E5A A;  2DEQ A;  1KMN A;  4LNS A;  4YRJ A;  2E3C A;  2ZIN A;  2IY5 B;  1GGM A;  3M4P A;  3V7C A;  1H4V B;  2DZC A;  1E24 A;  3RF1 A;  2CJA A;  4CS2 A;  2ARS A;  2QHT A;  4XTV A;  1PYS B;  1X2G A;  1EVL A;  4TVW A;  3E9I A;  2J3L A;  1EVK A;  4ZTZ B;  2CJ9 A;  1BIA A;  1NJ2 A;  4YYE A;  4X5O A;  4YRL A;  1Z7N A;  1NJ5 A;  3L2Z A;  3ERR A;  2P0L A;  4P72 A;  1B8A A;  2C7I A;  2ZIO A;  3RIR A;  2ZNI A;  4P3P A;  4UP7 A;  3PCO B;  3WQZ A;  3RUX A;  5C52 B;  1FYF A;  4H2X B;  2AKW B;  2E1H A;  3IAL A;  4YRC A;  2Q7G A;  4YRF A;  4TVA B;  4Q15 A;  3VQV A;  4XEO A;  3A7A A;  4P73 A;  1YFR A;  4YDQ A;  1W66 A;  5HGQ A;  3V8K A;  4RMF A;  1ADY A;  4Q6G A;  2I4L A;  4YRR A;  2E65 A;  3A5Z A;  1C0A A;  4YRK A;  1USY C;  3M4Q A;  1YFS A;  3MEY A;  4XTX A;  1X01 A;  2ZGW A;  3HY0 A;  4YRM A;  4P3O A;  3IG2 A;  4RQE A;  2ZT5 A;  4P74 A;  4TWA A;  2ZR2 A;  2C8M A;  4CS3 A;  4HWT A;  4AH6 A;  4YRQ A;  2ALY A;  3LSQ A;  4P75 C;  3P8V A;  2I4M A;  4P71 C;  1IL2 A;  1NJ1 A;  3VQY A;  3RKY A;  2DQ0 A;  4YRN A;  2EL9 A;  1Z7M A;  4YCU A;  3HFZ A;  3HRI A;  4K88 A;  3UGT A;  2DTI A;  2ODR C;  1WPY A; 
#chains in the Genus database with same CATH topology
 3L4G A;  4H2V A;  1E1O A;  4H2S A;  1B70 A;  4P3N A;  1JJC A;  2ZTG A;  3A31 A;  1HC7 A;  2EWN A;  3V7S A;  3E9H A;  3V8L A;  4YRT A;  4XTU A;  3V7R A;  4P72 C;  2ZZE A;  1NJ8 A;  1YGB A;  2I4N A;  3HXU A;  2ARU A;  1EFW A;  3RL6 A;  1EQR A;  4NCX A;  4DQ2 A;  1YFT A;  4RQF A;  3PZC A;  2ZZF A;  3IKM B;  1NYR A;  2ZR3 A;  4XU0 A;  4WF2 A;  3P8Y A;  1B7Y A;  2ZIM A;  4YCV A;  2EAY A;  2ZT8 A;  4H2W A;  4H02 A;  4XTY A;  3VBB A;  1BBU A;  4P73 C;  2ART A;  4WI1 A;  4ZIB A;  4LVJ A;  4LVM A;  3A5Y A;  3RKW A;  5K1P A;  2ZCE A;  4K87 A;  1ASZ A;  2ALY B;  2DVE A;  3W3S A;  3V8J A;  3LC0 A;  2I4O A;  3NEN A;  3RKX A;  4LVI A;  1YB3 A;  2DKG A;  3UGQ A;  2IY5 A;  3A74 A;  4XU3 A;  2Q5H A;  2DU7 A;  4TQD A;  4HVC A;  4J15 A;  3R07 A;  4H2Y A;  4WJ4 A;  4YRS A;  5C53 B;  2QHV A;  1NYQ A;  1EIY A;  4O2D A;  3HFZ B;  4P74 C;  1PYS A;  2XGT A;  3EFS A;  3NEL A;  2J3M A;  1E22 A;  1G51 A;  4CH6 A;  4YRE A;  3KFU A;  4TTV A;  1JJC B;  3P8T A;  4CH3 A;  1H4Q A;  4XTW A;  2Q7H A;  2EJ9 A;  2ZT6 A;  3VQW A;  3TEH A;  4H2U A;  4UPA A;  2DU5 A;  2ODR D;  4YRI A;  2RHS A;  1BIB A;  4CH4 A;  3A7R A;  1USY A;  1VQZ A;  5ELO A;  3I7F A;  1HTT A;  3A7U A;  4PG3 A;  3REX A;  2AKW A;  4KQE A;  4WJ3 M;  2PMF A;  4G85 A;  5F5W A;  1B7Y B;  3HFV A;  2HNI A;  1ATI A;  2G4C A;  1RIQ A;  3G1Z A;  4HWP A;  4HA8 A;  3OD1 A;  1X55 A;  5K1X A;  1WQ7 A;  3FJP A;  3HXY A;  1WNL A;  3RGL A;  4YRO A;  2RHQ A;  1B76 A;  2DXU A;  3HXZ A;  2DDZ A;  1SES A;  4HWS A;  2DXT A;  3DSQ A;  2Q5I A;  3IKL A;  12AS A;  2ZXF A;  2EJG A;  3QNE A;  5C51 B;  3BJU A;  5ELN A;  4HWR A;  1WLE A;  3NEM A;  1WQW A;  3HTZ A;  1J5W A;  1NJ6 A;  1ASY A;  3HRK A;  1EIY B;  1ADJ A;  4EX5 A;  4BW9 A;  1G5H A;  4EO4 A;  1NNH A;  3L1A A;  1EOV A;  2E41 A;  4KR2 A;  3LSS A;  2P5I A;  2E64 A;  1H4S A;  2AMC A;  2DQ3 A;  4TVY A;  4XU1 A;  2FYK A;  1BBW A;  2Q7E A;  4E51 A;  3TEH B;  1E1T A;  3ICA A;  2CIM A;  4XU2 A;  3A32 A;  1SER A;  1HXD A;  2RHS B;  4PHC A;  4TQF A;  1X2H A;  2DJZ A;  1L0W A;  3HXX A;  3MF1 A;  2QHS A;  4XTZ A;  4YP0 A;  4ZTU B;  3HXV A;  4L87 A;  3MF2 A;  1X54 A;  4KR3 A;  2DZ9 A;  3QTC A;  3HY1 A;  2ZT7 A;  4K86 A;  1KOG A;  2NS6 A;  1WYD A;  4YRG A;  3UFG A;  4OLF A;  1N9W A;  4OP0 A;  3UH0 A;  1KMM A;  3L4G B;  2XTI A;  1B70 B;  1SET A;  4DPG A;  2PME A;  2DTH A;  5KNN A;  3VQX A;  1LYL A;  1WU7 A;  3QO5 A;  3EFR A;  3TEG A;  3QO8 A;  2RHQ B;  3RAC A;  2CGH A;  2ZNJ A;  2E10 A;  4UP9 A;  4YPF A;  2CJB A;  1G5I A;  3HXW A;  1X56 A;  3PCO A;  4XEM A;  2DTO A;  11AS A;  2EJF A;  3QO7 A;  4YRP A;  3REU A;  3BFM A;  4H2X A;  1QE0 A;  4RDX A;  4HWO A;  4TVA A;  2QHU A;  4G84 A;  4YCW A;  3CMQ A;  4H2T A;  4BWA A;  1H4T A;  2ZZG A;  2AMC B;  4CS4 A;  3MQZ A;  3NET A;  4CH5 A;  4P75 A;  5E3I A;  4P71 A;  4UP8 A;  3TUP A;  1SRY A;  1QF6 A;  2E5A A;  2DEQ A;  1KMN A;  4LNS A;  4YRJ A;  2E3C A;  2ZIN A;  2IY5 B;  1GGM A;  3M4P A;  3V7C A;  1H4V B;  2DZC A;  1E24 A;  3RF1 A;  2CJA A;  4CS2 A;  2ARS A;  2QHT A;  4XTV A;  1PYS B;  1X2G A;  1EVL A;  4TVW A;  3E9I A;  2J3L A;  1EVK A;  4ZTZ B;  2CJ9 A;  1BIA A;  1NJ2 A;  4YYE A;  4X5O A;  4YRL A;  1Z7N A;  1NJ5 A;  3L2Z A;  3ERR A;  2P0L A;  4P72 A;  1B8A A;  2C7I A;  2ZIO A;  3RIR A;  2ZNI A;  4P3P A;  4UP7 A;  3PCO B;  3WQZ A;  3RUX A;  4LVK A;  5C52 B;  1FYF A;  4H2X B;  2AKW B;  2E1H A;  3IAL A;  4YRC A;  2Q7G A;  4YRF A;  4TVA B;  4Q15 A;  3VQV A;  4XEO A;  3A7A A;  4P73 A;  1YFR A;  4YDQ A;  1W66 A;  5HGQ A;  3V8K A;  4RMF A;  1ADY A;  4Q6G A;  2I4L A;  4YRR A;  2E65 A;  3A5Z A;  1C0A A;  4YRK A;  1USY C;  3M4Q A;  1YFS A;  3MEY A;  4XTX A;  1X01 A;  2ZGW A;  3HY0 A;  4YRM A;  4P3O A;  3IG2 A;  4RQE A;  2ZT5 A;  4P74 A;  4TWA A;  4HT4 A;  2ZR2 A;  2C8M A;  4CS3 A;  4HWT A;  4AH6 A;  4YRQ A;  2ALY A;  3LSQ A;  4P75 C;  3P8V A;  2I4M A;  4P71 C;  1IL2 A;  1NJ1 A;  2A8E A;  3VQY A;  3RKY A;  2DQ0 A;  4YRN A;  4LVL A;  2EL9 A;  1Z7M A;  4YCU A;  3HFZ A;  3HRI A;  4K88 A;  3UGT A;  2DTI A;  2ODR C;  1WPY A; 
#chains in the Genus database with same CATH homology
 3L4G A;  4H2V A;  1E1O A;  4H2S A;  1B70 A;  4P3N A;  1JJC A;  2ZTG A;  3A31 A;  1HC7 A;  2EWN A;  3V7S A;  3E9H A;  3V8L A;  4YRT A;  4XTU A;  3V7R A;  4P72 C;  2ZZE A;  1NJ8 A;  1YGB A;  2I4N A;  3HXU A;  2ARU A;  1EFW A;  3RL6 A;  1EQR A;  4NCX A;  4DQ2 A;  1YFT A;  4RQF A;  3PZC A;  2ZZF A;  3IKM B;  1NYR A;  2ZR3 A;  4XU0 A;  4WF2 A;  3P8Y A;  1B7Y A;  2ZIM A;  4YCV A;  2EAY A;  2ZT8 A;  4H2W A;  4H02 A;  4XTY A;  3VBB A;  1BBU A;  4P73 C;  2ART A;  4WI1 A;  4ZIB A;  4LVJ A;  4LVM A;  3A5Y A;  3RKW A;  5K1P A;  2ZCE A;  4K87 A;  1ASZ A;  2ALY B;  2DVE A;  3W3S A;  3V8J A;  3LC0 A;  2I4O A;  3NEN A;  3RKX A;  4LVI A;  1YB3 A;  2DKG A;  3UGQ A;  2IY5 A;  3A74 A;  4XU3 A;  2Q5H A;  2DU7 A;  4TQD A;  4HVC A;  4J15 A;  3R07 A;  4H2Y A;  4WJ4 A;  4YRS A;  5C53 B;  2QHV A;  1NYQ A;  1EIY A;  4O2D A;  3HFZ B;  4P74 C;  1PYS A;  2XGT A;  3EFS A;  3NEL A;  2J3M A;  1E22 A;  1G51 A;  4CH6 A;  4YRE A;  3KFU A;  4TTV A;  1JJC B;  3P8T A;  4CH3 A;  1H4Q A;  4XTW A;  2Q7H A;  2EJ9 A;  2ZT6 A;  3VQW A;  3TEH A;  4H2U A;  4UPA A;  2DU5 A;  2ODR D;  4YRI A;  2RHS A;  1BIB A;  4CH4 A;  3A7R A;  1USY A;  1VQZ A;  5ELO A;  3I7F A;  1HTT A;  3A7U A;  4PG3 A;  3REX A;  2AKW A;  4KQE A;  4WJ3 M;  2PMF A;  4G85 A;  5F5W A;  1B7Y B;  3HFV A;  2HNI A;  1ATI A;  2G4C A;  1RIQ A;  3G1Z A;  4HWP A;  4HA8 A;  3OD1 A;  1X55 A;  5K1X A;  1WQ7 A;  3FJP A;  3HXY A;  1WNL A;  3RGL A;  4YRO A;  2RHQ A;  1B76 A;  2DXU A;  3HXZ A;  2DDZ A;  1SES A;  4HWS A;  2DXT A;  3DSQ A;  2Q5I A;  3IKL A;  12AS A;  2ZXF A;  2EJG A;  3QNE A;  5C51 B;  3BJU A;  5ELN A;  4HWR A;  1WLE A;  3NEM A;  1WQW A;  3HTZ A;  1J5W A;  1NJ6 A;  1ASY A;  3HRK A;  1EIY B;  1ADJ A;  4EX5 A;  4BW9 A;  1G5H A;  4EO4 A;  1NNH A;  3L1A A;  1EOV A;  2E41 A;  4KR2 A;  3LSS A;  2P5I A;  2E64 A;  1H4S A;  2AMC A;  2DQ3 A;  4TVY A;  4XU1 A;  2FYK A;  1BBW A;  2Q7E A;  4E51 A;  3TEH B;  1E1T A;  3ICA A;  2CIM A;  4XU2 A;  3A32 A;  1SER A;  1HXD A;  2RHS B;  4PHC A;  4TQF A;  1X2H A;  2DJZ A;  1L0W A;  3HXX A;  3MF1 A;  2QHS A;  4XTZ A;  4YP0 A;  4ZTU B;  3HXV A;  4L87 A;  3MF2 A;  1X54 A;  4KR3 A;  2DZ9 A;  3QTC A;  3HY1 A;  2ZT7 A;  4K86 A;  1KOG A;  2NS6 A;  1WYD A;  4YRG A;  3UFG A;  4OLF A;  1N9W A;  4OP0 A;  3UH0 A;  1KMM A;  3L4G B;  2XTI A;  1B70 B;  1SET A;  4DPG A;  2PME A;  2DTH A;  5KNN A;  3VQX A;  1LYL A;  1WU7 A;  3QO5 A;  3EFR A;  3TEG A;  3QO8 A;  2RHQ B;  3RAC A;  2CGH A;  2ZNJ A;  2E10 A;  4UP9 A;  4YPF A;  2CJB A;  1G5I A;  3HXW A;  1X56 A;  3PCO A;  4XEM A;  2DTO A;  11AS A;  2EJF A;  3QO7 A;  4YRP A;  3REU A;  3BFM A;  4H2X A;  1QE0 A;  4RDX A;  4HWO A;  4TVA A;  2QHU A;  4G84 A;  4YCW A;  3CMQ A;  4H2T A;  4BWA A;  1H4T A;  2ZZG A;  2AMC B;  4CS4 A;  3MQZ A;  3NET A;  4CH5 A;  4P75 A;  5E3I A;  4P71 A;  4UP8 A;  3TUP A;  1SRY A;  1QF6 A;  2E5A A;  2DEQ A;  1KMN A;  4LNS A;  4YRJ A;  2E3C A;  2ZIN A;  2IY5 B;  1GGM A;  3M4P A;  3V7C A;  1H4V B;  2DZC A;  1E24 A;  3RF1 A;  2CJA A;  4CS2 A;  2ARS A;  2QHT A;  4XTV A;  1PYS B;  1X2G A;  1EVL A;  4TVW A;  3E9I A;  2J3L A;  1EVK A;  4ZTZ B;  2CJ9 A;  1BIA A;  1NJ2 A;  4YYE A;  4X5O A;  4YRL A;  1Z7N A;  1NJ5 A;  3L2Z A;  3ERR A;  2P0L A;  4P72 A;  1B8A A;  2C7I A;  2ZIO A;  3RIR A;  2ZNI A;  4P3P A;  4UP7 A;  3PCO B;  3WQZ A;  3RUX A;  4LVK A;  5C52 B;  1FYF A;  4H2X B;  2AKW B;  2E1H A;  3IAL A;  4YRC A;  2Q7G A;  4YRF A;  4TVA B;  4Q15 A;  3VQV A;  4XEO A;  3A7A A;  4P73 A;  1YFR A;  4YDQ A;  1W66 A;  5HGQ A;  3V8K A;  4RMF A;  1ADY A;  4Q6G A;  2I4L A;  4YRR A;  2E65 A;  3A5Z A;  1C0A A;  4YRK A;  1USY C;  3M4Q A;  1YFS A;  3MEY A;  4XTX A;  1X01 A;  2ZGW A;  3HY0 A;  4YRM A;  4P3O A;  3IG2 A;  4RQE A;  2ZT5 A;  4P74 A;  4TWA A;  4HT4 A;  2ZR2 A;  2C8M A;  4CS3 A;  4HWT A;  4AH6 A;  4YRQ A;  2ALY A;  3LSQ A;  4P75 C;  3P8V A;  2I4M A;  4P71 C;  1IL2 A;  1NJ1 A;  2A8E A;  3VQY A;  3RKY A;  2DQ0 A;  4YRN A;  4LVL A;  2EL9 A;  1Z7M A;  4YCU A;  3HFZ A;  3HRI A;  4K88 A;  3UGT A;  2DTI A;  2ODR C;  1WPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...