1Z7MA

Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
318
structure length
311
Chain Sequence
YLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of the hetero-octameric ATP phosphoribosyl transferase through subunit interface rearrangement by a tRNA synthetase paralog.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transferase
molecule keywords ATP phosphoribosyltransferase regulatory subunit
total genus 100
structure length 311
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1z7mA00
4H2WA 4L87A 1USYC 4UP7A 3L1AA 2AKWA 3PCOA 3ERRA 2J3LA 4Q6GA 4HWSA 4UP8A 1ASYA 2ZR2A 4YRTA 1EOVA 3LSSA 2I4MA 2CGHA 4O2DA 1B70B 3RGLA 2DKGA 3VQXA 2QHSA 2DZ9A 3QTCA 4K88A 4K86A 3RKWA 2I4LA 3A31A 1FYFA 4P71A 4WI1A 2ALYA 2EJFA 11ASA 1GGMA 4LNSA 2AKWB 2Q5IA 4P73C 4OP0A 2Q7HA 3IG2A 1YFTA 2E1HA 4TVAB 1L0WA 2CIMA 3L4GB 4CH5A 1ADJA 3FJPA 4X5OA 2CJBA 4H02A 1E24A 4OLFA 2IY5B 3UGQA 4EX5A 2DEQA 4RDXA 3QNEA 4XTYA 3V8KA 2AMCA 2ODRD 4UP9A 5C51B 3RKXA 4YCUA 4XEMA 1B7YA 2ALYB 3ICAA 3HFVA 3TEGA 2ZT7A 4P3OA 4P3PA 2DU7A 3HXXA 3HXYA 1WLEA 3HFZA 4KR3A 2QHUA 1QF6A 1E1OA 1NYQA 4YYEA 4G85A 4YRNA 2ZGWA 3V7SA 2IY5A 2ZT6A 3G1ZA 2RHSB 2E41A 2ZIOA 4CH6A 3QO8A 4G84A 1NJ8A 4ZTZB 2EJGA 2CJAA 1X2HA 2FYKA 2ARTA 4HWPA 4HWTA 2CJ9A 2ZZEA 4P72A 3LSQA 4H2UA 2E3CA 2Q7GA 1KMMA 1SETA 2DU5A 1C0AA 3REXA 2PMFA 2XGTA 2ZR3A 3P8VA 1HC7A 3MF2A 4TVYA 4YRRA 2EWNA 1ASZA 1WPYA 1G5IA 2ZZGA 3HTZA 3PZCA 4H2SA 2Q7EA 1WNLA 4PHCA 4DQ2A 3R07A 4YROA 1YFRA 4HVCA 2DXTA 2G4CA 3IKLA 4HWOA 1YFSA 1EQRA 3I7FA 4P72C 4TVWA 3HXVA 3W3SA 2ZT5A 1NJ5A 2J3MA 3REUA 1NNHA 5KNNA 3V7RA 4XTVA 2QHVA 1E1TA 2DTIA 1SESA 3HY1A 2ZZFA 1LYLA 1HXDA 2XTIA 4YRFA 5HGQA 3L2ZA 1WYDA 1W66A 12ASA 1WQWA 3NETA 4CS4A 3A74A 4P75C 1ATIA 4XTZA 4PG3A 2ZNIA 1HTTA 4YP0A 4YRLA 1EIYA 2ZIMA 1H4VB 3RF1A 4ZIBA 2ARSA 3V8LA 2ZINA 4CS3A 2P0LA 2QHTA 4RQFA 3RACA 1NJ1A 3KFUA 1E22A 4E51A 2ZT8A 4TQFA 3L4GA 4TWAA 4WJ3M 3QO5A 4YRGA 1NJ2A 3A32A 2Q5HA 2E64A 4YCWA 4YRMA 1VQZA 2EL9A 2RHSA 4HWRA 1B70A 2DDZA 3P8TA 1H4QA 3E9IA 4HA8A 3E9HA 3CMQA 3A7RA 3HY0A 4XU3A 2DQ0A 5E3IA 4YRSA 4BW9A 4YRJA 4K87A 3TEHB 3P8YA 4H2YA 4AH6A 4XU1A 4YRPA 5K1PA 1NYRA 1EVKA 1NJ6A 4NCXA 1PYSB 3VBBA 4P71C 1G51A 1X54A 4Q15A 3EFSA 2DTHA 3PCOB 4CS2A 4XU0A 4RQEA 2AMCB 2C7IA 3NENA 1B76A 3HXWA 1BIBA 4CH4A 4UPAA 4H2VA 3HRIA 3BFMA 3MF1A 2DVEA 4YREA 3LC0A 1IL2A 3IKMB 1H4TA 3VQWA 3HFZB 2DTOA 5C52B 3TEHA 1JJCB 1ADYA 1BBWA 3HXZA 2EJ9A 2E5AA 1Z7MA 1G5HA 2EAYA 2ZXFA 3NEMA 1PYSA 5C53B 3WQZA 3V7CA 1EIYB 3RKYA 4P3NA 4H2XB 2I4OA 3UGTA 3HRKA 4XEOA 2ODRC 3VQVA 3A7AA 1YB3A 4KQEA 4TVAA 3TUPA 2DJZA 1KOGA 2ZNJA 1YGBA 1USYA 3DSQA 1N9WA 1JJCA 4H2TA 3BJUA 1BIAA 2ZCEA 1SERA 2DZCA 4XU2A 4WF2A 4YRQA 3UFGA 3M4QA 1KMNA 4KR2A 3A7UA 4WJ4A 4P74A 4H2XA 3VQYA 1EVLA 4YDQA 1EFWA 4ZTUB 4XTWA 3RL6A 1Z7NA 5ELOA 5K1XA 1QE0A 2PMEA 4CH3A 5ELNA 1X01A 4YPFA 3A5ZA 4XTUA 4XTXA 1B8AA 4P73A 2HNIA 4YRCA 2I4NA 2DXUA 4BWAA 3EFRA 4EO4A 1J5WA 2RHQA 3QO7A 4J15A 2DQ3A 3NELA 3MEYA 5F5WA 3UH0A 1H4SA 1X2GA 2ARUA 1B7YB 4P74C 3M4PA 2E10A 4RMFA 4YRIA 4YRKA 3OD1A 3RIRA 3RUXA 4TTVA 1X56A 2E65A 2C8MA 3IALA 3A5YA 3HXUA 1WU7A 2ZTGA 4P75A 4YCVA 1WQ7A 3V8JA 1SRYA 1X55A 2RHQB 4DPGA 1BBUA 1RIQA 2P5IA 4TQDA
chains in the Genus database with same CATH superfamily
4H2WA 4L87A 1USYC 4UP7A 3L1AA 2AKWA 3PCOA 3ERRA 4HT4A 2J3LA 4Q6GA 4HWSA 4UP8A 1ASYA 2ZR2A 4YRTA 1EOVA 2A8EA 3LSSA 2I4MA 2CGHA 4O2DA 1B70B 3RGLA 2DKGA 3VQXA 2QHSA 2DZ9A 3QTCA 4K88A 4K86A 3RKWA 2I4LA 3A31A 1FYFA 4P71A 4WI1A 2ALYA 2EJFA 11ASA 1GGMA 4LNSA 2AKWB 2Q5IA 3MQZA 4P73C 4OP0A 2Q7HA 3IG2A 1YFTA 2E1HA 4TVAB 1L0WA 2CIMA 3L4GB 4CH5A 1ADJA 3FJPA 4X5OA 2CJBA 4H02A 1E24A 4OLFA 2IY5B 3UGQA 4EX5A 2DEQA 4RDXA 3QNEA 4XTYA 3V8KA 2AMCA 2ODRD 4UP9A 5C51B 3RKXA 4YCUA 4XEMA 1B7YA 2ALYB 3ICAA 3HFVA 3TEGA 2ZT7A 4P3OA 4P3PA 2DU7A 3HXXA 3HXYA 1WLEA 3HFZA 4KR3A 4LVJA 2QHUA 1QF6A 1E1OA 1NYQA 4YYEA 4G85A 4YRNA 2ZGWA 3V7SA 2IY5A 2ZT6A 3G1ZA 2RHSB 2E41A 2ZIOA 4CH6A 3QO8A 4G84A 1NJ8A 4ZTZB 2EJGA 2CJAA 1X2HA 2FYKA 2ARTA 4HWPA 4HWTA 2CJ9A 2ZZEA 4P72A 3LSQA 4H2UA 2E3CA 2Q7GA 2NS6A 4LVKA 1KMMA 1SETA 2DU5A 1C0AA 3REXA 2PMFA 2XGTA 2ZR3A 3P8VA 1HC7A 3MF2A 4TVYA 4YRRA 2EWNA 1ASZA 1WPYA 1G5IA 2ZZGA 3HTZA 3PZCA 4H2SA 2Q7EA 1WNLA 4PHCA 4DQ2A 3R07A 4YROA 1YFRA 4HVCA 2DXTA 2G4CA 3IKLA 4HWOA 1YFSA 1EQRA 3I7FA 4P72C 4TVWA 3HXVA 3W3SA 2ZT5A 1NJ5A 2J3MA 3REUA 1NNHA 5KNNA 3V7RA 4XTVA 2QHVA 1E1TA 2DTIA 1SESA 3HY1A 2ZZFA 1LYLA 1HXDA 2XTIA 4YRFA 5HGQA 3L2ZA 1WYDA 1W66A 12ASA 1WQWA 3NETA 4CS4A 3A74A 4P75C 1ATIA 4XTZA 4PG3A 2ZNIA 1HTTA 4YP0A 4YRLA 1EIYA 2ZIMA 1H4VB 3RF1A 4ZIBA 2ARSA 3V8LA 2ZINA 4CS3A 2P0LA 2QHTA 4RQFA 3RACA 4LVMA 1NJ1A 3KFUA 1E22A 4E51A 2ZT8A 4TQFA 3L4GA 4TWAA 4WJ3M 3QO5A 4YRGA 1NJ2A 3A32A 2Q5HA 2E64A 4YCWA 4YRMA 1VQZA 2EL9A 2RHSA 4HWRA 1B70A 2DDZA 3P8TA 1H4QA 3E9IA 4HA8A 3E9HA 3CMQA 3A7RA 3HY0A 4XU3A 2DQ0A 5E3IA 4YRSA 4BW9A 4YRJA 4K87A 3TEHB 3P8YA 4H2YA 4AH6A 4XU1A 4YRPA 5K1PA 1NYRA 4LVIA 1EVKA 1NJ6A 4NCXA 1PYSB 3VBBA 4P71C 1G51A 1X54A 4Q15A 3EFSA 2DTHA 3PCOB 4CS2A 4XU0A 4RQEA 2AMCB 2C7IA 3NENA 1B76A 3HXWA 1BIBA 4CH4A 4UPAA 4H2VA 3HRIA 3BFMA 3MF1A 2DVEA 4YREA 3LC0A 1IL2A 3IKMB 1H4TA 3VQWA 3HFZB 2DTOA 5C52B 3TEHA 1JJCB 1ADYA 1BBWA 3HXZA 2EJ9A 2E5AA 1Z7MA 1G5HA 2EAYA 2ZXFA 3NEMA 1PYSA 5C53B 3WQZA 3V7CA 1EIYB 3RKYA 4P3NA 4H2XB 2I4OA 3UGTA 3HRKA 4XEOA 2ODRC 3VQVA 3A7AA 1YB3A 4KQEA 4TVAA 3TUPA 2DJZA 1KOGA 2ZNJA 1YGBA 1USYA 3DSQA 1N9WA 1JJCA 4H2TA 3BJUA 1BIAA 2ZCEA 1SERA 2DZCA 4XU2A 4WF2A 4LVLA 4YRQA 3UFGA 3M4QA 1KMNA 4KR2A 3A7UA 4WJ4A 4P74A 4H2XA 3VQYA 1EVLA 4YDQA 1EFWA 4ZTUB 4XTWA 3RL6A 1Z7NA 5ELOA 5K1XA 1QE0A 2PMEA 4CH3A 5ELNA 1X01A 4YPFA 3A5ZA 4XTUA 4XTXA 1B8AA 4P73A 2HNIA 4YRCA 2I4NA 2DXUA 4BWAA 3EFRA 4EO4A 1J5WA 2RHQA 3QO7A 4J15A 2DQ3A 3NELA 3MEYA 5F5WA 3UH0A 1H4SA 1X2GA 2ARUA 1B7YB 4P74C 3M4PA 2E10A 4RMFA 4YRIA 4YRKA 3OD1A 3RIRA 3RUXA 4TTVA 1X56A 2E65A 2C8MA 3IALA 3A5YA 3HXUA 1WU7A 2ZTGA 4P75A 4YCVA 1WQ7A 3V8JA 1SRYA 1X55A 2RHQB 4DPGA 1BBUA 1RIQA 2P5IA 4TQDA
chains in the Genus database with same CATH topology
4H2WA 4L87A 1USYC 4UP7A 3L1AA 2AKWA 3PCOA 3ERRA 4HT4A 2J3LA 4Q6GA 4HWSA 4UP8A 1ASYA 2ZR2A 4YRTA 1EOVA 2A8EA 3LSSA 2I4MA 2CGHA 4O2DA 1B70B 3RGLA 2DKGA 3VQXA 2QHSA 2DZ9A 3QTCA 4K88A 4K86A 3RKWA 2I4LA 3A31A 1FYFA 4P71A 4WI1A 2ALYA 2EJFA 11ASA 1GGMA 4LNSA 2AKWB 2Q5IA 3MQZA 4P73C 4OP0A 2Q7HA 3IG2A 1YFTA 2E1HA 4TVAB 1L0WA 2CIMA 3L4GB 4CH5A 1ADJA 3FJPA 4X5OA 2CJBA 4H02A 1E24A 4OLFA 2IY5B 3UGQA 4EX5A 2DEQA 4RDXA 3QNEA 4XTYA 3V8KA 2AMCA 2ODRD 4UP9A 5C51B 3RKXA 4YCUA 4XEMA 1B7YA 2ALYB 3ICAA 3HFVA 3TEGA 2ZT7A 4P3OA 4P3PA 2DU7A 3HXXA 3HXYA 1WLEA 3HFZA 4KR3A 4LVJA 2QHUA 1QF6A 1E1OA 1NYQA 4YYEA 4G85A 4YRNA 2ZGWA 3V7SA 2IY5A 2ZT6A 3G1ZA 2RHSB 2E41A 2ZIOA 4CH6A 3QO8A 4G84A 1NJ8A 4ZTZB 2EJGA 2CJAA 1X2HA 2FYKA 2ARTA 4HWPA 4HWTA 2CJ9A 2ZZEA 4P72A 3LSQA 4H2UA 2E3CA 2Q7GA 2NS6A 4LVKA 1KMMA 1SETA 2DU5A 1C0AA 3REXA 2PMFA 2XGTA 2ZR3A 3P8VA 1HC7A 3MF2A 4TVYA 4YRRA 2EWNA 1ASZA 1WPYA 1G5IA 2ZZGA 3HTZA 3PZCA 4H2SA 2Q7EA 1WNLA 4PHCA 4DQ2A 3R07A 4YROA 1YFRA 4HVCA 2DXTA 2G4CA 3IKLA 4HWOA 1YFSA 1EQRA 3I7FA 4P72C 4TVWA 3HXVA 3W3SA 2ZT5A 1NJ5A 2J3MA 3REUA 1NNHA 5KNNA 3V7RA 4XTVA 2QHVA 1E1TA 2DTIA 1SESA 3HY1A 2ZZFA 1LYLA 1HXDA 2XTIA 4YRFA 5HGQA 3L2ZA 1WYDA 1W66A 12ASA 1WQWA 3NETA 4CS4A 3A74A 4P75C 1ATIA 4XTZA 4PG3A 2ZNIA 1HTTA 4YP0A 4YRLA 1EIYA 2ZIMA 1H4VB 3RF1A 4ZIBA 2ARSA 3V8LA 2ZINA 4CS3A 2P0LA 2QHTA 4RQFA 3RACA 4LVMA 1NJ1A 3KFUA 1E22A 4E51A 2ZT8A 4TQFA 3L4GA 4TWAA 4WJ3M 3QO5A 4YRGA 1NJ2A 3A32A 2Q5HA 2E64A 4YCWA 4YRMA 1VQZA 2EL9A 2RHSA 4HWRA 1B70A 2DDZA 3P8TA 1H4QA 3E9IA 4HA8A 3E9HA 3CMQA 3A7RA 3HY0A 4XU3A 2DQ0A 5E3IA 4YRSA 4BW9A 4YRJA 4K87A 3TEHB 3P8YA 4H2YA 4AH6A 4XU1A 4YRPA 5K1PA 1NYRA 4LVIA 1EVKA 1NJ6A 4NCXA 1PYSB 3VBBA 4P71C 1G51A 1X54A 4Q15A 3EFSA 2DTHA 3PCOB 4CS2A 4XU0A 4RQEA 2AMCB 2C7IA 3NENA 1B76A 3HXWA 1BIBA 4CH4A 4UPAA 4H2VA 3HRIA 3BFMA 3MF1A 2DVEA 4YREA 3LC0A 1IL2A 3IKMB 1H4TA 3VQWA 3HFZB 2DTOA 5C52B 3TEHA 1JJCB 1ADYA 1BBWA 3HXZA 2EJ9A 2E5AA 1Z7MA 1G5HA 2EAYA 2ZXFA 3NEMA 1PYSA 5C53B 3WQZA 3V7CA 1EIYB 3RKYA 4P3NA 4H2XB 2I4OA 3UGTA 3HRKA 4XEOA 2ODRC 3VQVA 3A7AA 1YB3A 4KQEA 4TVAA 3TUPA 2DJZA 1KOGA 2ZNJA 1YGBA 1USYA 3DSQA 1N9WA 1JJCA 4H2TA 3BJUA 1BIAA 2ZCEA 1SERA 2DZCA 4XU2A 4WF2A 4LVLA 4YRQA 3UFGA 3M4QA 1KMNA 4KR2A 3A7UA 4WJ4A 4P74A 4H2XA 3VQYA 1EVLA 4YDQA 1EFWA 4ZTUB 4XTWA 3RL6A 1Z7NA 5ELOA 5K1XA 1QE0A 2PMEA 4CH3A 5ELNA 1X01A 4YPFA 3A5ZA 4XTUA 4XTXA 1B8AA 4P73A 2HNIA 4YRCA 2I4NA 2DXUA 4BWAA 3EFRA 4EO4A 1J5WA 2RHQA 3QO7A 4J15A 2DQ3A 3NELA 3MEYA 5F5WA 3UH0A 1H4SA 1X2GA 2ARUA 1B7YB 4P74C 3M4PA 2E10A 4RMFA 4YRIA 4YRKA 3OD1A 3RIRA 3RUXA 4TTVA 1X56A 2E65A 2C8MA 3IALA 3A5YA 3HXUA 1WU7A 2ZTGA 4P75A 4YCVA 1WQ7A 3V8JA 1SRYA 1X55A 2RHQB 4DPGA 1BBUA 1RIQA 2P5IA 4TQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2W A;  4L87 A;  1USY C;  4UP7 A;  3L1A A;  2AKW A;  3PCO A;  3ERR A;  2J3L A;  4Q6G A;  4HWS A;  4UP8 A;  1ASY A;  2ZR2 A;  4YRT A;  1EOV A;  3LSS A;  2I4M A;  2CGH A;  4O2D A;  1B70 B;  3RGL A;  2DKG A;  3VQX A;  2QHS A;  2DZ9 A;  3QTC A;  4K88 A;  4K86 A;  3RKW A;  2I4L A;  3A31 A;  1FYF A;  4P71 A;  4WI1 A;  2ALY A;  2EJF A;  11AS A;  1GGM A;  4LNS A;  2AKW B;  2Q5I A;  4P73 C;  4OP0 A;  2Q7H A;  3IG2 A;  1YFT A;  2E1H A;  4TVA B;  1L0W A;  2CIM A;  3L4G B;  4CH5 A;  1ADJ A;  3FJP A;  4X5O A;  2CJB A;  4H02 A;  1E24 A;  4OLF A;  2IY5 B;  3UGQ A;  4EX5 A;  2DEQ A;  4RDX A;  3QNE A;  4XTY A;  3V8K A;  2AMC A;  2ODR D;  4UP9 A;  5C51 B;  3RKX A;  4YCU A;  4XEM A;  1B7Y A;  2ALY B;  3ICA A;  3HFV A;  3TEG A;  2ZT7 A;  4P3O A;  4P3P A;  2DU7 A;  3HXX A;  3HXY A;  1WLE A;  3HFZ A;  4KR3 A;  2QHU A;  1QF6 A;  1E1O A;  1NYQ A;  4YYE A;  4G85 A;  4YRN A;  2ZGW A;  3V7S A;  2IY5 A;  2ZT6 A;  3G1Z A;  2RHS B;  2E41 A;  2ZIO A;  4CH6 A;  3QO8 A;  4G84 A;  1NJ8 A;  4ZTZ B;  2EJG A;  2CJA A;  1X2H A;  2FYK A;  2ART A;  4HWP A;  4HWT A;  2CJ9 A;  2ZZE A;  4P72 A;  3LSQ A;  4H2U A;  2E3C A;  2Q7G A;  1KMM A;  1SET A;  2DU5 A;  1C0A A;  3REX A;  2PMF A;  2XGT A;  2ZR3 A;  3P8V A;  1HC7 A;  3MF2 A;  4TVY A;  4YRR A;  2EWN A;  1ASZ A;  1WPY A;  1G5I A;  2ZZG A;  3HTZ A;  3PZC A;  4H2S A;  2Q7E A;  1WNL A;  4PHC A;  4DQ2 A;  3R07 A;  4YRO A;  1YFR A;  4HVC A;  2DXT A;  2G4C A;  3IKL A;  4HWO A;  1YFS A;  1EQR A;  3I7F A;  4P72 C;  4TVW A;  3HXV A;  3W3S A;  2ZT5 A;  1NJ5 A;  2J3M A;  3REU A;  1NNH A;  5KNN A;  3V7R A;  4XTV A;  2QHV A;  1E1T A;  2DTI A;  1SES A;  3HY1 A;  2ZZF A;  1LYL A;  1HXD A;  2XTI A;  4YRF A;  5HGQ A;  3L2Z A;  1WYD A;  1W66 A;  12AS A;  1WQW A;  3NET A;  4CS4 A;  3A74 A;  4P75 C;  1ATI A;  4XTZ A;  4PG3 A;  2ZNI A;  1HTT A;  4YP0 A;  4YRL A;  1EIY A;  2ZIM A;  1H4V B;  3RF1 A;  4ZIB A;  2ARS A;  3V8L A;  2ZIN A;  4CS3 A;  2P0L A;  2QHT A;  4RQF A;  3RAC A;  1NJ1 A;  3KFU A;  1E22 A;  4E51 A;  2ZT8 A;  4TQF A;  3L4G A;  4TWA A;  4WJ3 M;  3QO5 A;  4YRG A;  1NJ2 A;  3A32 A;  2Q5H A;  2E64 A;  4YCW A;  4YRM A;  1VQZ A;  2EL9 A;  2RHS A;  4HWR A;  1B70 A;  2DDZ A;  3P8T A;  1H4Q A;  3E9I A;  4HA8 A;  3E9H A;  3CMQ A;  3A7R A;  3HY0 A;  4XU3 A;  2DQ0 A;  5E3I A;  4YRS A;  4BW9 A;  4YRJ A;  4K87 A;  3TEH B;  3P8Y A;  4H2Y A;  4AH6 A;  4XU1 A;  4YRP A;  5K1P A;  1NYR A;  1EVK A;  1NJ6 A;  4NCX A;  1PYS B;  3VBB A;  4P71 C;  1G51 A;  1X54 A;  4Q15 A;  3EFS A;  2DTH A;  3PCO B;  4CS2 A;  4XU0 A;  4RQE A;  2AMC B;  2C7I A;  3NEN A;  1B76 A;  3HXW A;  1BIB A;  4CH4 A;  4UPA A;  4H2V A;  3HRI A;  3BFM A;  3MF1 A;  2DVE A;  4YRE A;  3LC0 A;  1IL2 A;  3IKM B;  1H4T A;  3VQW A;  3HFZ B;  2DTO A;  5C52 B;  3TEH A;  1JJC B;  1ADY A;  1BBW A;  3HXZ A;  2EJ9 A;  2E5A A;  1Z7M A;  1G5H A;  2EAY A;  2ZXF A;  3NEM A;  1PYS A;  5C53 B;  3WQZ A;  3V7C A;  1EIY B;  3RKY A;  4P3N A;  4H2X B;  2I4O A;  3UGT A;  3HRK A;  4XEO A;  2ODR C;  3VQV A;  3A7A A;  1YB3 A;  4KQE A;  4TVA A;  3TUP A;  2DJZ A;  1KOG A;  2ZNJ A;  1YGB A;  1USY A;  3DSQ A;  1N9W A;  1JJC A;  4H2T A;  3BJU A;  1BIA A;  2ZCE A;  1SER A;  2DZC A;  4XU2 A;  4WF2 A;  4YRQ A;  3UFG A;  3M4Q A;  1KMN A;  4KR2 A;  3A7U A;  4WJ4 A;  4P74 A;  4H2X A;  3VQY A;  1EVL A;  4YDQ A;  1EFW A;  4ZTU B;  4XTW A;  3RL6 A;  1Z7N A;  5ELO A;  5K1X A;  1QE0 A;  2PME A;  4CH3 A;  5ELN A;  1X01 A;  4YPF A;  3A5Z A;  4XTU A;  4XTX A;  1B8A A;  4P73 A;  2HNI A;  4YRC A;  2I4N A;  2DXU A;  4BWA A;  3EFR A;  4EO4 A;  1J5W A;  2RHQ A;  3QO7 A;  4J15 A;  2DQ3 A;  3NEL A;  3MEY A;  5F5W A;  3UH0 A;  1H4S A;  1X2G A;  2ARU A;  1B7Y B;  4P74 C;  3M4P A;  2E10 A;  4RMF A;  4YRI A;  4YRK A;  3OD1 A;  3RIR A;  3RUX A;  4TTV A;  1X56 A;  2E65 A;  2C8M A;  3IAL A;  3A5Y A;  3HXU A;  1WU7 A;  2ZTG A;  4P75 A;  4YCV A;  1WQ7 A;  3V8J A;  1SRY A;  1X55 A;  2RHQ B;  4DPG A;  1BBU A;  1RIQ A;  2P5I A;  4TQD A; 
#chains in the Genus database with same CATH topology
 4H2W A;  4L87 A;  1USY C;  4UP7 A;  3L1A A;  2AKW A;  3PCO A;  3ERR A;  4HT4 A;  2J3L A;  4Q6G A;  4HWS A;  4UP8 A;  1ASY A;  2ZR2 A;  4YRT A;  1EOV A;  2A8E A;  3LSS A;  2I4M A;  2CGH A;  4O2D A;  1B70 B;  3RGL A;  2DKG A;  3VQX A;  2QHS A;  2DZ9 A;  3QTC A;  4K88 A;  4K86 A;  3RKW A;  2I4L A;  3A31 A;  1FYF A;  4P71 A;  4WI1 A;  2ALY A;  2EJF A;  11AS A;  1GGM A;  4LNS A;  2AKW B;  2Q5I A;  3MQZ A;  4P73 C;  4OP0 A;  2Q7H A;  3IG2 A;  1YFT A;  2E1H A;  4TVA B;  1L0W A;  2CIM A;  3L4G B;  4CH5 A;  1ADJ A;  3FJP A;  4X5O A;  2CJB A;  4H02 A;  1E24 A;  4OLF A;  2IY5 B;  3UGQ A;  4EX5 A;  2DEQ A;  4RDX A;  3QNE A;  4XTY A;  3V8K A;  2AMC A;  2ODR D;  4UP9 A;  5C51 B;  3RKX A;  4YCU A;  4XEM A;  1B7Y A;  2ALY B;  3ICA A;  3HFV A;  3TEG A;  2ZT7 A;  4P3O A;  4P3P A;  2DU7 A;  3HXX A;  3HXY A;  1WLE A;  3HFZ A;  4KR3 A;  4LVJ A;  2QHU A;  1QF6 A;  1E1O A;  1NYQ A;  4YYE A;  4G85 A;  4YRN A;  2ZGW A;  3V7S A;  2IY5 A;  2ZT6 A;  3G1Z A;  2RHS B;  2E41 A;  2ZIO A;  4CH6 A;  3QO8 A;  4G84 A;  1NJ8 A;  4ZTZ B;  2EJG A;  2CJA A;  1X2H A;  2FYK A;  2ART A;  4HWP A;  4HWT A;  2CJ9 A;  2ZZE A;  4P72 A;  3LSQ A;  4H2U A;  2E3C A;  2Q7G A;  2NS6 A;  4LVK A;  1KMM A;  1SET A;  2DU5 A;  1C0A A;  3REX A;  2PMF A;  2XGT A;  2ZR3 A;  3P8V A;  1HC7 A;  3MF2 A;  4TVY A;  4YRR A;  2EWN A;  1ASZ A;  1WPY A;  1G5I A;  2ZZG A;  3HTZ A;  3PZC A;  4H2S A;  2Q7E A;  1WNL A;  4PHC A;  4DQ2 A;  3R07 A;  4YRO A;  1YFR A;  4HVC A;  2DXT A;  2G4C A;  3IKL A;  4HWO A;  1YFS A;  1EQR A;  3I7F A;  4P72 C;  4TVW A;  3HXV A;  3W3S A;  2ZT5 A;  1NJ5 A;  2J3M A;  3REU A;  1NNH A;  5KNN A;  3V7R A;  4XTV A;  2QHV A;  1E1T A;  2DTI A;  1SES A;  3HY1 A;  2ZZF A;  1LYL A;  1HXD A;  2XTI A;  4YRF A;  5HGQ A;  3L2Z A;  1WYD A;  1W66 A;  12AS A;  1WQW A;  3NET A;  4CS4 A;  3A74 A;  4P75 C;  1ATI A;  4XTZ A;  4PG3 A;  2ZNI A;  1HTT A;  4YP0 A;  4YRL A;  1EIY A;  2ZIM A;  1H4V B;  3RF1 A;  4ZIB A;  2ARS A;  3V8L A;  2ZIN A;  4CS3 A;  2P0L A;  2QHT A;  4RQF A;  3RAC A;  4LVM A;  1NJ1 A;  3KFU A;  1E22 A;  4E51 A;  2ZT8 A;  4TQF A;  3L4G A;  4TWA A;  4WJ3 M;  3QO5 A;  4YRG A;  1NJ2 A;  3A32 A;  2Q5H A;  2E64 A;  4YCW A;  4YRM A;  1VQZ A;  2EL9 A;  2RHS A;  4HWR A;  1B70 A;  2DDZ A;  3P8T A;  1H4Q A;  3E9I A;  4HA8 A;  3E9H A;  3CMQ A;  3A7R A;  3HY0 A;  4XU3 A;  2DQ0 A;  5E3I A;  4YRS A;  4BW9 A;  4YRJ A;  4K87 A;  3TEH B;  3P8Y A;  4H2Y A;  4AH6 A;  4XU1 A;  4YRP A;  5K1P A;  1NYR A;  4LVI A;  1EVK A;  1NJ6 A;  4NCX A;  1PYS B;  3VBB A;  4P71 C;  1G51 A;  1X54 A;  4Q15 A;  3EFS A;  2DTH A;  3PCO B;  4CS2 A;  4XU0 A;  4RQE A;  2AMC B;  2C7I A;  3NEN A;  1B76 A;  3HXW A;  1BIB A;  4CH4 A;  4UPA A;  4H2V A;  3HRI A;  3BFM A;  3MF1 A;  2DVE A;  4YRE A;  3LC0 A;  1IL2 A;  3IKM B;  1H4T A;  3VQW A;  3HFZ B;  2DTO A;  5C52 B;  3TEH A;  1JJC B;  1ADY A;  1BBW A;  3HXZ A;  2EJ9 A;  2E5A A;  1Z7M A;  1G5H A;  2EAY A;  2ZXF A;  3NEM A;  1PYS A;  5C53 B;  3WQZ A;  3V7C A;  1EIY B;  3RKY A;  4P3N A;  4H2X B;  2I4O A;  3UGT A;  3HRK A;  4XEO A;  2ODR C;  3VQV A;  3A7A A;  1YB3 A;  4KQE A;  4TVA A;  3TUP A;  2DJZ A;  1KOG A;  2ZNJ A;  1YGB A;  1USY A;  3DSQ A;  1N9W A;  1JJC A;  4H2T A;  3BJU A;  1BIA A;  2ZCE A;  1SER A;  2DZC A;  4XU2 A;  4WF2 A;  4LVL A;  4YRQ A;  3UFG A;  3M4Q A;  1KMN A;  4KR2 A;  3A7U A;  4WJ4 A;  4P74 A;  4H2X A;  3VQY A;  1EVL A;  4YDQ A;  1EFW A;  4ZTU B;  4XTW A;  3RL6 A;  1Z7N A;  5ELO A;  5K1X A;  1QE0 A;  2PME A;  4CH3 A;  5ELN A;  1X01 A;  4YPF A;  3A5Z A;  4XTU A;  4XTX A;  1B8A A;  4P73 A;  2HNI A;  4YRC A;  2I4N A;  2DXU A;  4BWA A;  3EFR A;  4EO4 A;  1J5W A;  2RHQ A;  3QO7 A;  4J15 A;  2DQ3 A;  3NEL A;  3MEY A;  5F5W A;  3UH0 A;  1H4S A;  1X2G A;  2ARU A;  1B7Y B;  4P74 C;  3M4P A;  2E10 A;  4RMF A;  4YRI A;  4YRK A;  3OD1 A;  3RIR A;  3RUX A;  4TTV A;  1X56 A;  2E65 A;  2C8M A;  3IAL A;  3A5Y A;  3HXU A;  1WU7 A;  2ZTG A;  4P75 A;  4YCV A;  1WQ7 A;  3V8J A;  1SRY A;  1X55 A;  2RHQ B;  4DPG A;  1BBU A;  1RIQ A;  2P5I A;  4TQD A; 
#chains in the Genus database with same CATH homology
 4H2W A;  4L87 A;  1USY C;  4UP7 A;  3L1A A;  2AKW A;  3PCO A;  3ERR A;  4HT4 A;  2J3L A;  4Q6G A;  4HWS A;  4UP8 A;  1ASY A;  2ZR2 A;  4YRT A;  1EOV A;  2A8E A;  3LSS A;  2I4M A;  2CGH A;  4O2D A;  1B70 B;  3RGL A;  2DKG A;  3VQX A;  2QHS A;  2DZ9 A;  3QTC A;  4K88 A;  4K86 A;  3RKW A;  2I4L A;  3A31 A;  1FYF A;  4P71 A;  4WI1 A;  2ALY A;  2EJF A;  11AS A;  1GGM A;  4LNS A;  2AKW B;  2Q5I A;  3MQZ A;  4P73 C;  4OP0 A;  2Q7H A;  3IG2 A;  1YFT A;  2E1H A;  4TVA B;  1L0W A;  2CIM A;  3L4G B;  4CH5 A;  1ADJ A;  3FJP A;  4X5O A;  2CJB A;  4H02 A;  1E24 A;  4OLF A;  2IY5 B;  3UGQ A;  4EX5 A;  2DEQ A;  4RDX A;  3QNE A;  4XTY A;  3V8K A;  2AMC A;  2ODR D;  4UP9 A;  5C51 B;  3RKX A;  4YCU A;  4XEM A;  1B7Y A;  2ALY B;  3ICA A;  3HFV A;  3TEG A;  2ZT7 A;  4P3O A;  4P3P A;  2DU7 A;  3HXX A;  3HXY A;  1WLE A;  3HFZ A;  4KR3 A;  4LVJ A;  2QHU A;  1QF6 A;  1E1O A;  1NYQ A;  4YYE A;  4G85 A;  4YRN A;  2ZGW A;  3V7S A;  2IY5 A;  2ZT6 A;  3G1Z A;  2RHS B;  2E41 A;  2ZIO A;  4CH6 A;  3QO8 A;  4G84 A;  1NJ8 A;  4ZTZ B;  2EJG A;  2CJA A;  1X2H A;  2FYK A;  2ART A;  4HWP A;  4HWT A;  2CJ9 A;  2ZZE A;  4P72 A;  3LSQ A;  4H2U A;  2E3C A;  2Q7G A;  2NS6 A;  4LVK A;  1KMM A;  1SET A;  2DU5 A;  1C0A A;  3REX A;  2PMF A;  2XGT A;  2ZR3 A;  3P8V A;  1HC7 A;  3MF2 A;  4TVY A;  4YRR A;  2EWN A;  1ASZ A;  1WPY A;  1G5I A;  2ZZG A;  3HTZ A;  3PZC A;  4H2S A;  2Q7E A;  1WNL A;  4PHC A;  4DQ2 A;  3R07 A;  4YRO A;  1YFR A;  4HVC A;  2DXT A;  2G4C A;  3IKL A;  4HWO A;  1YFS A;  1EQR A;  3I7F A;  4P72 C;  4TVW A;  3HXV A;  3W3S A;  2ZT5 A;  1NJ5 A;  2J3M A;  3REU A;  1NNH A;  5KNN A;  3V7R A;  4XTV A;  2QHV A;  1E1T A;  2DTI A;  1SES A;  3HY1 A;  2ZZF A;  1LYL A;  1HXD A;  2XTI A;  4YRF A;  5HGQ A;  3L2Z A;  1WYD A;  1W66 A;  12AS A;  1WQW A;  3NET A;  4CS4 A;  3A74 A;  4P75 C;  1ATI A;  4XTZ A;  4PG3 A;  2ZNI A;  1HTT A;  4YP0 A;  4YRL A;  1EIY A;  2ZIM A;  1H4V B;  3RF1 A;  4ZIB A;  2ARS A;  3V8L A;  2ZIN A;  4CS3 A;  2P0L A;  2QHT A;  4RQF A;  3RAC A;  4LVM A;  1NJ1 A;  3KFU A;  1E22 A;  4E51 A;  2ZT8 A;  4TQF A;  3L4G A;  4TWA A;  4WJ3 M;  3QO5 A;  4YRG A;  1NJ2 A;  3A32 A;  2Q5H A;  2E64 A;  4YCW A;  4YRM A;  1VQZ A;  2EL9 A;  2RHS A;  4HWR A;  1B70 A;  2DDZ A;  3P8T A;  1H4Q A;  3E9I A;  4HA8 A;  3E9H A;  3CMQ A;  3A7R A;  3HY0 A;  4XU3 A;  2DQ0 A;  5E3I A;  4YRS A;  4BW9 A;  4YRJ A;  4K87 A;  3TEH B;  3P8Y A;  4H2Y A;  4AH6 A;  4XU1 A;  4YRP A;  5K1P A;  1NYR A;  4LVI A;  1EVK A;  1NJ6 A;  4NCX A;  1PYS B;  3VBB A;  4P71 C;  1G51 A;  1X54 A;  4Q15 A;  3EFS A;  2DTH A;  3PCO B;  4CS2 A;  4XU0 A;  4RQE A;  2AMC B;  2C7I A;  3NEN A;  1B76 A;  3HXW A;  1BIB A;  4CH4 A;  4UPA A;  4H2V A;  3HRI A;  3BFM A;  3MF1 A;  2DVE A;  4YRE A;  3LC0 A;  1IL2 A;  3IKM B;  1H4T A;  3VQW A;  3HFZ B;  2DTO A;  5C52 B;  3TEH A;  1JJC B;  1ADY A;  1BBW A;  3HXZ A;  2EJ9 A;  2E5A A;  1Z7M A;  1G5H A;  2EAY A;  2ZXF A;  3NEM A;  1PYS A;  5C53 B;  3WQZ A;  3V7C A;  1EIY B;  3RKY A;  4P3N A;  4H2X B;  2I4O A;  3UGT A;  3HRK A;  4XEO A;  2ODR C;  3VQV A;  3A7A A;  1YB3 A;  4KQE A;  4TVA A;  3TUP A;  2DJZ A;  1KOG A;  2ZNJ A;  1YGB A;  1USY A;  3DSQ A;  1N9W A;  1JJC A;  4H2T A;  3BJU A;  1BIA A;  2ZCE A;  1SER A;  2DZC A;  4XU2 A;  4WF2 A;  4LVL A;  4YRQ A;  3UFG A;  3M4Q A;  1KMN A;  4KR2 A;  3A7U A;  4WJ4 A;  4P74 A;  4H2X A;  3VQY A;  1EVL A;  4YDQ A;  1EFW A;  4ZTU B;  4XTW A;  3RL6 A;  1Z7N A;  5ELO A;  5K1X A;  1QE0 A;  2PME A;  4CH3 A;  5ELN A;  1X01 A;  4YPF A;  3A5Z A;  4XTU A;  4XTX A;  1B8A A;  4P73 A;  2HNI A;  4YRC A;  2I4N A;  2DXU A;  4BWA A;  3EFR A;  4EO4 A;  1J5W A;  2RHQ A;  3QO7 A;  4J15 A;  2DQ3 A;  3NEL A;  3MEY A;  5F5W A;  3UH0 A;  1H4S A;  1X2G A;  2ARU A;  1B7Y B;  4P74 C;  3M4P A;  2E10 A;  4RMF A;  4YRI A;  4YRK A;  3OD1 A;  3RIR A;  3RUX A;  4TTV A;  1X56 A;  2E65 A;  2C8M A;  3IAL A;  3A5Y A;  3HXU A;  1WU7 A;  2ZTG A;  4P75 A;  4YCV A;  1WQ7 A;  3V8J A;  1SRY A;  1X55 A;  2RHQ B;  4DPG A;  1BBU A;  1RIQ A;  2P5I A;  4TQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...