1Z7MA

Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
318
structure length
311
Chain Sequence
YLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP phosphoribosyltransferase regulatory subunit
publication title Activation of the hetero-octameric ATP phosphoribosyl transferase through subunit interface rearrangement by a tRNA synthetase paralog.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transferase
total genus 100
structure length 311
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1z7mA00
1YFSA 4P73A 3RGLA 3VQYA 1Z7MA 3QTCA 2AMCB 3HY1A 2ZCEA 3W3SA 2EWNA 3I7FA 2I4OA 4YYEA 3HXUA 4HWRA 5E3IA 1B76A 2DVEA 4XU3A 2RHSB 2ZR2A 1WQWA 1J5WA 3RUXA 4YRTA 4OLFA 4KQEA 2J3MA 3LSQA 1WU7A 2CJBA 4XTYA 3HFZA 3IKMB 2ODRC 4YDQA 5C52B 1WYDA 2Q5IA 3UFGA 4YROA 3A32A 4TTVA 1KMNA 1HTTA 4TVAA 2P5IA 2E5AA 4YRIA 1X2HA 4CS3A 3IALA 2EJ9A 4HA8A 4P3NA 2FYKA 4YRNA 3REXA 2DJZA 2RHQA 4UP8A 12ASA 1RIQA 4TVWA 4YRQA 2G4CA 2ALYA 3RACA 4TQFA 3M4QA 4P74A 3LSSA 4OP0A 4P3PA 4HWPA 4O2DA 2AKWB 4L87A 4TQDA 3UGQA 4TVYA 2QHSA 3VBBA 3A7RA 5KNNA 4CH6A 4AH6A 2DZ9A 1ASYA 2Q7EA 1X56A 1X55A 3HRIA 1WPYA 4H2XA 4H2SA 3V8LA 4UP9A 1NYRA 3A5YA 1KOGA 3V7CA 4WJ4A 4H02A 1JJCB 2DXTA 2IY5A 1NJ8A 1LYLA 3E9IA 1B7YB 1VQZA 2QHUA 4K87A 2CJ9A 1ATIA 3G1ZA 3V7RA 1SRYA 4DQ2A 4YRGA 3L4GA 1WLEA 1ASZA 3TEGA 2DTOA 2ZXFA 3HXXA 2I4LA 2Q7GA 2EAYA 2ODRD 1E1OA 1HXDA 1SETA 4YRSA 3QO7A 2DEQA 2ZGWA 3P8YA 11ASA 4P72C 3PCOA 2ZR3A 2E3CA 2P0LA 1QF6A 1QE0A 3HTZA 3V8KA 4HWSA 3HXZA 3V7SA 3L4GB 1PYSA 3LC0A 2DTHA 3HFVA 3BJUA 4YRFA 4P75A 4PHCA 2DQ0A 4G84A 2HNIA 1E1TA 3EFRA 4YCWA 1X2GA 4LNSA 3QO8A 3TEHA 2ZINA 3P8TA 2DZCA 1YFTA 4Q15A 2QHTA 2EJFA 2ZTGA 5ELNA 3QNEA 2ARSA 2ZZGA 1YB3A 2CJAA 2ZT7A 3HFZB 1X01A 1YGBA 3TUPA 3EFSA 4YCUA 3A74A 4WJ3M 1EFWA 2E64A 1B70A 1ADYA 4P74C 4K86A 1W66A 3ICAA 1EQRA 1X54A 2J3LA 4YRCA 2E65A 3UH0A 1EIYA 3V8JA 2E1HA 4TVAB 4YRJA 1BBWA 1HC7A 3E9HA 4YRKA 4YPFA 2EL9A 4XTXA 1N9WA 1E24A 1B8AA 4CH5A 2RHQB 3HXVA 4YREA 1E22A 2DTIA 4XTWA 1H4VB 3RKYA 1USYA 2ALYB 4P71C 4UPAA 2CGHA 1NJ6A 3A5ZA 3NETA 3DSQA 4P73C 2ZT6A 4RQEA 2CIMA 1C0AA 1NYQA 3A31A 1NNHA 1BIAA 4EX5A 2Q5HA 4ZTZB 5F5WA 2ZNIA 2I4MA 3A7AA 4YRPA 4H2XB 5K1XA 5K1PA 2QHVA 5HGQA 2ZNJA 4XTUA 5ELOA 5C53B 1FYFA 4XU1A 1NJ1A 1ADJA 2DXUA 2IY5B 3HXYA 3FJPA 1GGMA 4Q6GA 3CMQA 4H2VA 4WF2A 1SERA 4E51A 3NENA 2E10A 1NJ5A 1BBUA 4BWAA 1IL2A 3P8VA 4P72A 4P75C 2ZIOA 4BW9A 3IKLA 4ZIBA 4ZTUB 1H4QA 1G5HA 4YRMA 4XEMA 3PCOB 4RMFA 4XTVA 2DQ3A 4YRLA 1WNLA 1EOVA 4G85A 3L2ZA 4HVCA 3KFUA 1PYSB 3BFMA 4XU2A 4NCXA 4X5OA 4KR2A 5C51B 3IG2A 1KMMA 3MEYA 1Z7NA 3HRKA 2ZT5A 2ZZFA 4RQFA 4KR3A 4XEOA 4H2WA 1EVLA 3RIRA 4PG3A 4YP0A 1EVKA 2AKWA 3HXWA 4H2YA 1H4SA 3UGTA 3TEHB 3HY0A 1G51A 3RKWA 3VQWA 2E41A 2I4NA 3RKXA 2ZT8A 4CS2A 4K88A 4XU0A 3QO5A 3VQVA 3RF1A 4YRRA 2DU7A 3RL6A 3PZCA 4CH4A 1JJCA 2EJGA 1G5IA 4RDXA 4TWAA 1B7YA 1USYC 2Q7HA 1B70B 3NEMA 1SESA 2ZZEA 4DPGA 2DKGA 1BIBA 4YCVA 1L0WA 4HWOA 3MF1A 2DU5A 1YFRA 4H2UA 4CS4A 2PMFA 4H2TA 2AMCA 3ERRA 2ARTA 3OD1A 3A7UA 1EIYB 2DDZA 4HWTA 2PMEA 1NJ2A 3MF2A 1WQ7A 3VQXA 4WI1A 4EO4A 2XGTA 3NELA 3L1AA 3M4PA 2XTIA 4P71A 4CH3A 2ZIMA 4J15A 4P3OA 3REUA 2C8MA 1H4TA 2RHSA 2C7IA 3R07A 4XTZA 3WQZA 2ARUA 4UP7A
chains in the Genus database with same CATH superfamily
1YFSA 4P73A 3RGLA 3VQYA 1Z7MA 3QTCA 2AMCB 3HY1A 2ZCEA 3W3SA 2EWNA 3I7FA 2I4OA 4YYEA 3HXUA 4HWRA 5E3IA 4LVIA 1B76A 2DVEA 4XU3A 2RHSB 2ZR2A 1WQWA 1J5WA 3RUXA 4YRTA 4LVJA 4OLFA 4KQEA 2J3MA 3LSQA 1WU7A 2CJBA 4XTYA 3HFZA 3IKMB 2ODRC 4YDQA 4HT4A 5C52B 1WYDA 2Q5IA 3UFGA 4YROA 3A32A 4TTVA 1KMNA 1HTTA 4TVAA 2P5IA 2E5AA 4YRIA 1X2HA 4CS3A 3IALA 2EJ9A 4HA8A 4P3NA 2FYKA 4YRNA 3REXA 2DJZA 2RHQA 4UP8A 12ASA 1RIQA 4TVWA 4YRQA 2G4CA 2ALYA 3RACA 4TQFA 3M4QA 4P74A 3LSSA 4OP0A 4P3PA 4HWPA 4O2DA 2AKWB 4L87A 4TQDA 3UGQA 4TVYA 2QHSA 3VBBA 3A7RA 5KNNA 4CH6A 4AH6A 2DZ9A 1ASYA 2Q7EA 1X56A 1X55A 3HRIA 1WPYA 4H2XA 4H2SA 3V8LA 4UP9A 1NYRA 3A5YA 1KOGA 3V7CA 4WJ4A 4H02A 1JJCB 2DXTA 2IY5A 1NJ8A 1LYLA 3E9IA 1B7YB 1VQZA 2QHUA 4K87A 2CJ9A 1ATIA 3G1ZA 3V7RA 1SRYA 4DQ2A 4YRGA 3L4GA 1WLEA 1ASZA 3TEGA 4LVMA 2DTOA 2ZXFA 3HXXA 2I4LA 2Q7GA 2EAYA 2ODRD 1E1OA 1HXDA 1SETA 4YRSA 3QO7A 2DEQA 2ZGWA 3P8YA 11ASA 4P72C 3PCOA 2ZR3A 2E3CA 4LVKA 2P0LA 1QF6A 1QE0A 3HTZA 3V8KA 4HWSA 3HXZA 3V7SA 3L4GB 1PYSA 3LC0A 2DTHA 3HFVA 3BJUA 4YRFA 4P75A 2NS6A 4PHCA 2DQ0A 4G84A 2HNIA 1E1TA 3EFRA 4YCWA 1X2GA 4LNSA 3QO8A 3TEHA 2ZINA 3P8TA 2DZCA 1YFTA 4Q15A 2QHTA 2EJFA 2ZTGA 5ELNA 3QNEA 2ARSA 2ZZGA 1YB3A 2CJAA 2ZT7A 3HFZB 1X01A 1YGBA 3TUPA 3EFSA 4YCUA 3A74A 4WJ3M 1EFWA 2E64A 1B70A 1ADYA 4P74C 4K86A 1W66A 3ICAA 1EQRA 1X54A 2J3LA 4YRCA 2E65A 3UH0A 1EIYA 3V8JA 2E1HA 4TVAB 4YRJA 1BBWA 1HC7A 3E9HA 4YRKA 4YPFA 2EL9A 4XTXA 1N9WA 1E24A 1B8AA 4CH5A 2RHQB 3HXVA 4YREA 1E22A 2DTIA 4XTWA 1H4VB 3RKYA 1USYA 2ALYB 4P71C 4UPAA 2CGHA 1NJ6A 3A5ZA 3MQZA 3NETA 3DSQA 4P73C 2ZT6A 4RQEA 2CIMA 1C0AA 1NYQA 3A31A 1NNHA 1BIAA 4EX5A 2Q5HA 4ZTZB 5F5WA 2ZNIA 2I4MA 3A7AA 4YRPA 4H2XB 5K1XA 5K1PA 2QHVA 5HGQA 2ZNJA 4XTUA 5ELOA 5C53B 1FYFA 4XU1A 1NJ1A 1ADJA 2DXUA 2IY5B 3HXYA 3FJPA 1GGMA 4Q6GA 3CMQA 4H2VA 4WF2A 1SERA 4E51A 3NENA 2E10A 1NJ5A 1BBUA 4BWAA 1IL2A 3P8VA 4P72A 4P75C 2ZIOA 4BW9A 3IKLA 4ZIBA 4ZTUB 1H4QA 1G5HA 4YRMA 4XEMA 3PCOB 4RMFA 4XTVA 2DQ3A 4YRLA 1WNLA 1EOVA 4G85A 3L2ZA 4LVLA 4HVCA 3KFUA 1PYSB 3BFMA 4XU2A 4NCXA 4X5OA 4KR2A 5C51B 3IG2A 1KMMA 3MEYA 1Z7NA 3HRKA 2ZT5A 2ZZFA 4RQFA 4KR3A 4XEOA 4H2WA 1EVLA 3RIRA 4PG3A 4YP0A 1EVKA 2AKWA 3HXWA 4H2YA 1H4SA 3UGTA 3TEHB 2A8EA 3HY0A 1G51A 3RKWA 3VQWA 2E41A 2I4NA 3RKXA 2ZT8A 4CS2A 4K88A 4XU0A 3QO5A 3VQVA 3RF1A 4YRRA 2DU7A 3RL6A 3PZCA 4CH4A 1JJCA 2EJGA 1G5IA 4RDXA 4TWAA 1B7YA 1USYC 2Q7HA 1B70B 3NEMA 1SESA 2ZZEA 4DPGA 2DKGA 1BIBA 4YCVA 1L0WA 4HWOA 3MF1A 2DU5A 1YFRA 4H2UA 4CS4A 2PMFA 4H2TA 2AMCA 3ERRA 2ARTA 3OD1A 3A7UA 1EIYB 2DDZA 4HWTA 2PMEA 1NJ2A 3MF2A 1WQ7A 3VQXA 4WI1A 4EO4A 2XGTA 3NELA 3L1AA 3M4PA 2XTIA 4P71A 4CH3A 2ZIMA 4J15A 4P3OA 3REUA 2C8MA 1H4TA 2RHSA 2C7IA 3R07A 4XTZA 3WQZA 2ARUA 4UP7A
chains in the Genus database with same CATH topology
1YFSA 4P73A 3RGLA 3VQYA 1Z7MA 3QTCA 2AMCB 3HY1A 2ZCEA 3W3SA 2EWNA 3I7FA 2I4OA 4YYEA 3HXUA 4HWRA 5E3IA 4LVIA 1B76A 2DVEA 4XU3A 2RHSB 2ZR2A 1WQWA 1J5WA 3RUXA 4YRTA 4LVJA 4OLFA 4KQEA 2J3MA 3LSQA 1WU7A 2CJBA 4XTYA 3HFZA 3IKMB 2ODRC 4YDQA 4HT4A 5C52B 1WYDA 2Q5IA 3UFGA 4YROA 3A32A 4TTVA 1KMNA 1HTTA 4TVAA 2P5IA 2E5AA 4YRIA 1X2HA 4CS3A 3IALA 2EJ9A 4HA8A 4P3NA 2FYKA 4YRNA 3REXA 2DJZA 2RHQA 4UP8A 12ASA 1RIQA 4TVWA 4YRQA 2G4CA 2ALYA 3RACA 4TQFA 3M4QA 4P74A 3LSSA 4OP0A 4P3PA 4HWPA 4O2DA 2AKWB 4L87A 4TQDA 3UGQA 4TVYA 2QHSA 3VBBA 3A7RA 5KNNA 4CH6A 4AH6A 2DZ9A 1ASYA 2Q7EA 1X56A 1X55A 3HRIA 1WPYA 4H2XA 4H2SA 3V8LA 4UP9A 1NYRA 3A5YA 1KOGA 3V7CA 4WJ4A 4H02A 1JJCB 2DXTA 2IY5A 1NJ8A 1LYLA 3E9IA 1B7YB 1VQZA 2QHUA 4K87A 2CJ9A 1ATIA 3G1ZA 3V7RA 1SRYA 4DQ2A 4YRGA 3L4GA 1WLEA 1ASZA 3TEGA 4LVMA 2DTOA 2ZXFA 3HXXA 2I4LA 2Q7GA 2EAYA 2ODRD 1E1OA 1HXDA 1SETA 4YRSA 3QO7A 2DEQA 2ZGWA 3P8YA 11ASA 4P72C 3PCOA 2ZR3A 2E3CA 4LVKA 2P0LA 1QF6A 1QE0A 3HTZA 3V8KA 4HWSA 3HXZA 3V7SA 3L4GB 1PYSA 3LC0A 2DTHA 3HFVA 3BJUA 4YRFA 4P75A 2NS6A 4PHCA 2DQ0A 4G84A 2HNIA 1E1TA 3EFRA 4YCWA 1X2GA 4LNSA 3QO8A 3TEHA 2ZINA 3P8TA 2DZCA 1YFTA 4Q15A 2QHTA 2EJFA 2ZTGA 5ELNA 3QNEA 2ARSA 2ZZGA 1YB3A 2CJAA 2ZT7A 3HFZB 1X01A 1YGBA 3TUPA 3EFSA 4YCUA 3A74A 4WJ3M 1EFWA 2E64A 1B70A 1ADYA 4P74C 4K86A 1W66A 3ICAA 1EQRA 1X54A 2J3LA 4YRCA 2E65A 3UH0A 1EIYA 3V8JA 2E1HA 4TVAB 4YRJA 1BBWA 1HC7A 3E9HA 4YRKA 4YPFA 2EL9A 4XTXA 1N9WA 1E24A 1B8AA 4CH5A 2RHQB 3HXVA 4YREA 1E22A 2DTIA 4XTWA 1H4VB 3RKYA 1USYA 2ALYB 4P71C 4UPAA 2CGHA 1NJ6A 3A5ZA 3MQZA 3NETA 3DSQA 4P73C 2ZT6A 4RQEA 2CIMA 1C0AA 1NYQA 3A31A 1NNHA 1BIAA 4EX5A 2Q5HA 4ZTZB 5F5WA 2ZNIA 2I4MA 3A7AA 4YRPA 4H2XB 5K1XA 5K1PA 2QHVA 5HGQA 2ZNJA 4XTUA 5ELOA 5C53B 1FYFA 4XU1A 1NJ1A 1ADJA 2DXUA 2IY5B 3HXYA 3FJPA 1GGMA 4Q6GA 3CMQA 4H2VA 4WF2A 1SERA 4E51A 3NENA 2E10A 1NJ5A 1BBUA 4BWAA 1IL2A 3P8VA 4P72A 4P75C 2ZIOA 4BW9A 3IKLA 4ZIBA 4ZTUB 1H4QA 1G5HA 4YRMA 4XEMA 3PCOB 4RMFA 4XTVA 2DQ3A 4YRLA 1WNLA 1EOVA 4G85A 3L2ZA 4LVLA 4HVCA 3KFUA 1PYSB 3BFMA 4XU2A 4NCXA 4X5OA 4KR2A 5C51B 3IG2A 1KMMA 3MEYA 1Z7NA 3HRKA 2ZT5A 2ZZFA 4RQFA 4KR3A 4XEOA 4H2WA 1EVLA 3RIRA 4PG3A 4YP0A 1EVKA 2AKWA 3HXWA 4H2YA 1H4SA 3UGTA 3TEHB 2A8EA 3HY0A 1G51A 3RKWA 3VQWA 2E41A 2I4NA 3RKXA 2ZT8A 4CS2A 4K88A 4XU0A 3QO5A 3VQVA 3RF1A 4YRRA 2DU7A 3RL6A 3PZCA 4CH4A 1JJCA 2EJGA 1G5IA 4RDXA 4TWAA 1B7YA 1USYC 2Q7HA 1B70B 3NEMA 1SESA 2ZZEA 4DPGA 2DKGA 1BIBA 4YCVA 1L0WA 4HWOA 3MF1A 2DU5A 1YFRA 4H2UA 4CS4A 2PMFA 4H2TA 2AMCA 3ERRA 2ARTA 3OD1A 3A7UA 1EIYB 2DDZA 4HWTA 2PMEA 1NJ2A 3MF2A 1WQ7A 3VQXA 4WI1A 4EO4A 2XGTA 3NELA 3L1AA 3M4PA 2XTIA 4P71A 4CH3A 2ZIMA 4J15A 4P3OA 3REUA 2C8MA 1H4TA 2RHSA 2C7IA 3R07A 4XTZA 3WQZA 2ARUA 4UP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFS A;  4P73 A;  3RGL A;  3VQY A;  1Z7M A;  3QTC A;  2AMC B;  3HY1 A;  2ZCE A;  3W3S A;  2EWN A;  3I7F A;  2I4O A;  4YYE A;  3HXU A;  4HWR A;  5E3I A;  1B76 A;  2DVE A;  4XU3 A;  2RHS B;  2ZR2 A;  1WQW A;  1J5W A;  3RUX A;  4YRT A;  4OLF A;  4KQE A;  2J3M A;  3LSQ A;  1WU7 A;  2CJB A;  4XTY A;  3HFZ A;  3IKM B;  2ODR C;  4YDQ A;  5C52 B;  1WYD A;  2Q5I A;  3UFG A;  4YRO A;  3A32 A;  4TTV A;  1KMN A;  1HTT A;  4TVA A;  2P5I A;  2E5A A;  4YRI A;  1X2H A;  4CS3 A;  3IAL A;  2EJ9 A;  4HA8 A;  4P3N A;  2FYK A;  4YRN A;  3REX A;  2DJZ A;  2RHQ A;  4UP8 A;  12AS A;  1RIQ A;  4TVW A;  4YRQ A;  2G4C A;  2ALY A;  3RAC A;  4TQF A;  3M4Q A;  4P74 A;  3LSS A;  4OP0 A;  4P3P A;  4HWP A;  4O2D A;  2AKW B;  4L87 A;  4TQD A;  3UGQ A;  4TVY A;  2QHS A;  3VBB A;  3A7R A;  5KNN A;  4CH6 A;  4AH6 A;  2DZ9 A;  1ASY A;  2Q7E A;  1X56 A;  1X55 A;  3HRI A;  1WPY A;  4H2X A;  4H2S A;  3V8L A;  4UP9 A;  1NYR A;  3A5Y A;  1KOG A;  3V7C A;  4WJ4 A;  4H02 A;  1JJC B;  2DXT A;  2IY5 A;  1NJ8 A;  1LYL A;  3E9I A;  1B7Y B;  1VQZ A;  2QHU A;  4K87 A;  2CJ9 A;  1ATI A;  3G1Z A;  3V7R A;  1SRY A;  4DQ2 A;  4YRG A;  3L4G A;  1WLE A;  1ASZ A;  3TEG A;  2DTO A;  2ZXF A;  3HXX A;  2I4L A;  2Q7G A;  2EAY A;  2ODR D;  1E1O A;  1HXD A;  1SET A;  4YRS A;  3QO7 A;  2DEQ A;  2ZGW A;  3P8Y A;  11AS A;  4P72 C;  3PCO A;  2ZR3 A;  2E3C A;  2P0L A;  1QF6 A;  1QE0 A;  3HTZ A;  3V8K A;  4HWS A;  3HXZ A;  3V7S A;  3L4G B;  1PYS A;  3LC0 A;  2DTH A;  3HFV A;  3BJU A;  4YRF A;  4P75 A;  4PHC A;  2DQ0 A;  4G84 A;  2HNI A;  1E1T A;  3EFR A;  4YCW A;  1X2G A;  4LNS A;  3QO8 A;  3TEH A;  2ZIN A;  3P8T A;  2DZC A;  1YFT A;  4Q15 A;  2QHT A;  2EJF A;  2ZTG A;  5ELN A;  3QNE A;  2ARS A;  2ZZG A;  1YB3 A;  2CJA A;  2ZT7 A;  3HFZ B;  1X01 A;  1YGB A;  3TUP A;  3EFS A;  4YCU A;  3A74 A;  4WJ3 M;  1EFW A;  2E64 A;  1B70 A;  1ADY A;  4P74 C;  4K86 A;  1W66 A;  3ICA A;  1EQR A;  1X54 A;  2J3L A;  4YRC A;  2E65 A;  3UH0 A;  1EIY A;  3V8J A;  2E1H A;  4TVA B;  4YRJ A;  1BBW A;  1HC7 A;  3E9H A;  4YRK A;  4YPF A;  2EL9 A;  4XTX A;  1N9W A;  1E24 A;  1B8A A;  4CH5 A;  2RHQ B;  3HXV A;  4YRE A;  1E22 A;  2DTI A;  4XTW A;  1H4V B;  3RKY A;  1USY A;  2ALY B;  4P71 C;  4UPA A;  2CGH A;  1NJ6 A;  3A5Z A;  3NET A;  3DSQ A;  4P73 C;  2ZT6 A;  4RQE A;  2CIM A;  1C0A A;  1NYQ A;  3A31 A;  1NNH A;  1BIA A;  4EX5 A;  2Q5H A;  4ZTZ B;  5F5W A;  2ZNI A;  2I4M A;  3A7A A;  4YRP A;  4H2X B;  5K1X A;  5K1P A;  2QHV A;  5HGQ A;  2ZNJ A;  4XTU A;  5ELO A;  5C53 B;  1FYF A;  4XU1 A;  1NJ1 A;  1ADJ A;  2DXU A;  2IY5 B;  3HXY A;  3FJP A;  1GGM A;  4Q6G A;  3CMQ A;  4H2V A;  4WF2 A;  1SER A;  4E51 A;  3NEN A;  2E10 A;  1NJ5 A;  1BBU A;  4BWA A;  1IL2 A;  3P8V A;  4P72 A;  4P75 C;  2ZIO A;  4BW9 A;  3IKL A;  4ZIB A;  4ZTU B;  1H4Q A;  1G5H A;  4YRM A;  4XEM A;  3PCO B;  4RMF A;  4XTV A;  2DQ3 A;  4YRL A;  1WNL A;  1EOV A;  4G85 A;  3L2Z A;  4HVC A;  3KFU A;  1PYS B;  3BFM A;  4XU2 A;  4NCX A;  4X5O A;  4KR2 A;  5C51 B;  3IG2 A;  1KMM A;  3MEY A;  1Z7N A;  3HRK A;  2ZT5 A;  2ZZF A;  4RQF A;  4KR3 A;  4XEO A;  4H2W A;  1EVL A;  3RIR A;  4PG3 A;  4YP0 A;  1EVK A;  2AKW A;  3HXW A;  4H2Y A;  1H4S A;  3UGT A;  3TEH B;  3HY0 A;  1G51 A;  3RKW A;  3VQW A;  2E41 A;  2I4N A;  3RKX A;  2ZT8 A;  4CS2 A;  4K88 A;  4XU0 A;  3QO5 A;  3VQV A;  3RF1 A;  4YRR A;  2DU7 A;  3RL6 A;  3PZC A;  4CH4 A;  1JJC A;  2EJG A;  1G5I A;  4RDX A;  4TWA A;  1B7Y A;  1USY C;  2Q7H A;  1B70 B;  3NEM A;  1SES A;  2ZZE A;  4DPG A;  2DKG A;  1BIB A;  4YCV A;  1L0W A;  4HWO A;  3MF1 A;  2DU5 A;  1YFR A;  4H2U A;  4CS4 A;  2PMF A;  4H2T A;  2AMC A;  3ERR A;  2ART A;  3OD1 A;  3A7U A;  1EIY B;  2DDZ A;  4HWT A;  2PME A;  1NJ2 A;  3MF2 A;  1WQ7 A;  3VQX A;  4WI1 A;  4EO4 A;  2XGT A;  3NEL A;  3L1A A;  3M4P A;  2XTI A;  4P71 A;  4CH3 A;  2ZIM A;  4J15 A;  4P3O A;  3REU A;  2C8M A;  1H4T A;  2RHS A;  2C7I A;  3R07 A;  4XTZ A;  3WQZ A;  2ARU A;  4UP7 A; 
#chains in the Genus database with same CATH topology
 1YFS A;  4P73 A;  3RGL A;  3VQY A;  1Z7M A;  3QTC A;  2AMC B;  3HY1 A;  2ZCE A;  3W3S A;  2EWN A;  3I7F A;  2I4O A;  4YYE A;  3HXU A;  4HWR A;  5E3I A;  4LVI A;  1B76 A;  2DVE A;  4XU3 A;  2RHS B;  2ZR2 A;  1WQW A;  1J5W A;  3RUX A;  4YRT A;  4LVJ A;  4OLF A;  4KQE A;  2J3M A;  3LSQ A;  1WU7 A;  2CJB A;  4XTY A;  3HFZ A;  3IKM B;  2ODR C;  4YDQ A;  4HT4 A;  5C52 B;  1WYD A;  2Q5I A;  3UFG A;  4YRO A;  3A32 A;  4TTV A;  1KMN A;  1HTT A;  4TVA A;  2P5I A;  2E5A A;  4YRI A;  1X2H A;  4CS3 A;  3IAL A;  2EJ9 A;  4HA8 A;  4P3N A;  2FYK A;  4YRN A;  3REX A;  2DJZ A;  2RHQ A;  4UP8 A;  12AS A;  1RIQ A;  4TVW A;  4YRQ A;  2G4C A;  2ALY A;  3RAC A;  4TQF A;  3M4Q A;  4P74 A;  3LSS A;  4OP0 A;  4P3P A;  4HWP A;  4O2D A;  2AKW B;  4L87 A;  4TQD A;  3UGQ A;  4TVY A;  2QHS A;  3VBB A;  3A7R A;  5KNN A;  4CH6 A;  4AH6 A;  2DZ9 A;  1ASY A;  2Q7E A;  1X56 A;  1X55 A;  3HRI A;  1WPY A;  4H2X A;  4H2S A;  3V8L A;  4UP9 A;  1NYR A;  3A5Y A;  1KOG A;  3V7C A;  4WJ4 A;  4H02 A;  1JJC B;  2DXT A;  2IY5 A;  1NJ8 A;  1LYL A;  3E9I A;  1B7Y B;  1VQZ A;  2QHU A;  4K87 A;  2CJ9 A;  1ATI A;  3G1Z A;  3V7R A;  1SRY A;  4DQ2 A;  4YRG A;  3L4G A;  1WLE A;  1ASZ A;  3TEG A;  4LVM A;  2DTO A;  2ZXF A;  3HXX A;  2I4L A;  2Q7G A;  2EAY A;  2ODR D;  1E1O A;  1HXD A;  1SET A;  4YRS A;  3QO7 A;  2DEQ A;  2ZGW A;  3P8Y A;  11AS A;  4P72 C;  3PCO A;  2ZR3 A;  2E3C A;  4LVK A;  2P0L A;  1QF6 A;  1QE0 A;  3HTZ A;  3V8K A;  4HWS A;  3HXZ A;  3V7S A;  3L4G B;  1PYS A;  3LC0 A;  2DTH A;  3HFV A;  3BJU A;  4YRF A;  4P75 A;  2NS6 A;  4PHC A;  2DQ0 A;  4G84 A;  2HNI A;  1E1T A;  3EFR A;  4YCW A;  1X2G A;  4LNS A;  3QO8 A;  3TEH A;  2ZIN A;  3P8T A;  2DZC A;  1YFT A;  4Q15 A;  2QHT A;  2EJF A;  2ZTG A;  5ELN A;  3QNE A;  2ARS A;  2ZZG A;  1YB3 A;  2CJA A;  2ZT7 A;  3HFZ B;  1X01 A;  1YGB A;  3TUP A;  3EFS A;  4YCU A;  3A74 A;  4WJ3 M;  1EFW A;  2E64 A;  1B70 A;  1ADY A;  4P74 C;  4K86 A;  1W66 A;  3ICA A;  1EQR A;  1X54 A;  2J3L A;  4YRC A;  2E65 A;  3UH0 A;  1EIY A;  3V8J A;  2E1H A;  4TVA B;  4YRJ A;  1BBW A;  1HC7 A;  3E9H A;  4YRK A;  4YPF A;  2EL9 A;  4XTX A;  1N9W A;  1E24 A;  1B8A A;  4CH5 A;  2RHQ B;  3HXV A;  4YRE A;  1E22 A;  2DTI A;  4XTW A;  1H4V B;  3RKY A;  1USY A;  2ALY B;  4P71 C;  4UPA A;  2CGH A;  1NJ6 A;  3A5Z A;  3MQZ A;  3NET A;  3DSQ A;  4P73 C;  2ZT6 A;  4RQE A;  2CIM A;  1C0A A;  1NYQ A;  3A31 A;  1NNH A;  1BIA A;  4EX5 A;  2Q5H A;  4ZTZ B;  5F5W A;  2ZNI A;  2I4M A;  3A7A A;  4YRP A;  4H2X B;  5K1X A;  5K1P A;  2QHV A;  5HGQ A;  2ZNJ A;  4XTU A;  5ELO A;  5C53 B;  1FYF A;  4XU1 A;  1NJ1 A;  1ADJ A;  2DXU A;  2IY5 B;  3HXY A;  3FJP A;  1GGM A;  4Q6G A;  3CMQ A;  4H2V A;  4WF2 A;  1SER A;  4E51 A;  3NEN A;  2E10 A;  1NJ5 A;  1BBU A;  4BWA A;  1IL2 A;  3P8V A;  4P72 A;  4P75 C;  2ZIO A;  4BW9 A;  3IKL A;  4ZIB A;  4ZTU B;  1H4Q A;  1G5H A;  4YRM A;  4XEM A;  3PCO B;  4RMF A;  4XTV A;  2DQ3 A;  4YRL A;  1WNL A;  1EOV A;  4G85 A;  3L2Z A;  4LVL A;  4HVC A;  3KFU A;  1PYS B;  3BFM A;  4XU2 A;  4NCX A;  4X5O A;  4KR2 A;  5C51 B;  3IG2 A;  1KMM A;  3MEY A;  1Z7N A;  3HRK A;  2ZT5 A;  2ZZF A;  4RQF A;  4KR3 A;  4XEO A;  4H2W A;  1EVL A;  3RIR A;  4PG3 A;  4YP0 A;  1EVK A;  2AKW A;  3HXW A;  4H2Y A;  1H4S A;  3UGT A;  3TEH B;  2A8E A;  3HY0 A;  1G51 A;  3RKW A;  3VQW A;  2E41 A;  2I4N A;  3RKX A;  2ZT8 A;  4CS2 A;  4K88 A;  4XU0 A;  3QO5 A;  3VQV A;  3RF1 A;  4YRR A;  2DU7 A;  3RL6 A;  3PZC A;  4CH4 A;  1JJC A;  2EJG A;  1G5I A;  4RDX A;  4TWA A;  1B7Y A;  1USY C;  2Q7H A;  1B70 B;  3NEM A;  1SES A;  2ZZE A;  4DPG A;  2DKG A;  1BIB A;  4YCV A;  1L0W A;  4HWO A;  3MF1 A;  2DU5 A;  1YFR A;  4H2U A;  4CS4 A;  2PMF A;  4H2T A;  2AMC A;  3ERR A;  2ART A;  3OD1 A;  3A7U A;  1EIY B;  2DDZ A;  4HWT A;  2PME A;  1NJ2 A;  3MF2 A;  1WQ7 A;  3VQX A;  4WI1 A;  4EO4 A;  2XGT A;  3NEL A;  3L1A A;  3M4P A;  2XTI A;  4P71 A;  4CH3 A;  2ZIM A;  4J15 A;  4P3O A;  3REU A;  2C8M A;  1H4T A;  2RHS A;  2C7I A;  3R07 A;  4XTZ A;  3WQZ A;  2ARU A;  4UP7 A; 
#chains in the Genus database with same CATH homology
 1YFS A;  4P73 A;  3RGL A;  3VQY A;  1Z7M A;  3QTC A;  2AMC B;  3HY1 A;  2ZCE A;  3W3S A;  2EWN A;  3I7F A;  2I4O A;  4YYE A;  3HXU A;  4HWR A;  5E3I A;  4LVI A;  1B76 A;  2DVE A;  4XU3 A;  2RHS B;  2ZR2 A;  1WQW A;  1J5W A;  3RUX A;  4YRT A;  4LVJ A;  4OLF A;  4KQE A;  2J3M A;  3LSQ A;  1WU7 A;  2CJB A;  4XTY A;  3HFZ A;  3IKM B;  2ODR C;  4YDQ A;  4HT4 A;  5C52 B;  1WYD A;  2Q5I A;  3UFG A;  4YRO A;  3A32 A;  4TTV A;  1KMN A;  1HTT A;  4TVA A;  2P5I A;  2E5A A;  4YRI A;  1X2H A;  4CS3 A;  3IAL A;  2EJ9 A;  4HA8 A;  4P3N A;  2FYK A;  4YRN A;  3REX A;  2DJZ A;  2RHQ A;  4UP8 A;  12AS A;  1RIQ A;  4TVW A;  4YRQ A;  2G4C A;  2ALY A;  3RAC A;  4TQF A;  3M4Q A;  4P74 A;  3LSS A;  4OP0 A;  4P3P A;  4HWP A;  4O2D A;  2AKW B;  4L87 A;  4TQD A;  3UGQ A;  4TVY A;  2QHS A;  3VBB A;  3A7R A;  5KNN A;  4CH6 A;  4AH6 A;  2DZ9 A;  1ASY A;  2Q7E A;  1X56 A;  1X55 A;  3HRI A;  1WPY A;  4H2X A;  4H2S A;  3V8L A;  4UP9 A;  1NYR A;  3A5Y A;  1KOG A;  3V7C A;  4WJ4 A;  4H02 A;  1JJC B;  2DXT A;  2IY5 A;  1NJ8 A;  1LYL A;  3E9I A;  1B7Y B;  1VQZ A;  2QHU A;  4K87 A;  2CJ9 A;  1ATI A;  3G1Z A;  3V7R A;  1SRY A;  4DQ2 A;  4YRG A;  3L4G A;  1WLE A;  1ASZ A;  3TEG A;  4LVM A;  2DTO A;  2ZXF A;  3HXX A;  2I4L A;  2Q7G A;  2EAY A;  2ODR D;  1E1O A;  1HXD A;  1SET A;  4YRS A;  3QO7 A;  2DEQ A;  2ZGW A;  3P8Y A;  11AS A;  4P72 C;  3PCO A;  2ZR3 A;  2E3C A;  4LVK A;  2P0L A;  1QF6 A;  1QE0 A;  3HTZ A;  3V8K A;  4HWS A;  3HXZ A;  3V7S A;  3L4G B;  1PYS A;  3LC0 A;  2DTH A;  3HFV A;  3BJU A;  4YRF A;  4P75 A;  2NS6 A;  4PHC A;  2DQ0 A;  4G84 A;  2HNI A;  1E1T A;  3EFR A;  4YCW A;  1X2G A;  4LNS A;  3QO8 A;  3TEH A;  2ZIN A;  3P8T A;  2DZC A;  1YFT A;  4Q15 A;  2QHT A;  2EJF A;  2ZTG A;  5ELN A;  3QNE A;  2ARS A;  2ZZG A;  1YB3 A;  2CJA A;  2ZT7 A;  3HFZ B;  1X01 A;  1YGB A;  3TUP A;  3EFS A;  4YCU A;  3A74 A;  4WJ3 M;  1EFW A;  2E64 A;  1B70 A;  1ADY A;  4P74 C;  4K86 A;  1W66 A;  3ICA A;  1EQR A;  1X54 A;  2J3L A;  4YRC A;  2E65 A;  3UH0 A;  1EIY A;  3V8J A;  2E1H A;  4TVA B;  4YRJ A;  1BBW A;  1HC7 A;  3E9H A;  4YRK A;  4YPF A;  2EL9 A;  4XTX A;  1N9W A;  1E24 A;  1B8A A;  4CH5 A;  2RHQ B;  3HXV A;  4YRE A;  1E22 A;  2DTI A;  4XTW A;  1H4V B;  3RKY A;  1USY A;  2ALY B;  4P71 C;  4UPA A;  2CGH A;  1NJ6 A;  3A5Z A;  3MQZ A;  3NET A;  3DSQ A;  4P73 C;  2ZT6 A;  4RQE A;  2CIM A;  1C0A A;  1NYQ A;  3A31 A;  1NNH A;  1BIA A;  4EX5 A;  2Q5H A;  4ZTZ B;  5F5W A;  2ZNI A;  2I4M A;  3A7A A;  4YRP A;  4H2X B;  5K1X A;  5K1P A;  2QHV A;  5HGQ A;  2ZNJ A;  4XTU A;  5ELO A;  5C53 B;  1FYF A;  4XU1 A;  1NJ1 A;  1ADJ A;  2DXU A;  2IY5 B;  3HXY A;  3FJP A;  1GGM A;  4Q6G A;  3CMQ A;  4H2V A;  4WF2 A;  1SER A;  4E51 A;  3NEN A;  2E10 A;  1NJ5 A;  1BBU A;  4BWA A;  1IL2 A;  3P8V A;  4P72 A;  4P75 C;  2ZIO A;  4BW9 A;  3IKL A;  4ZIB A;  4ZTU B;  1H4Q A;  1G5H A;  4YRM A;  4XEM A;  3PCO B;  4RMF A;  4XTV A;  2DQ3 A;  4YRL A;  1WNL A;  1EOV A;  4G85 A;  3L2Z A;  4LVL A;  4HVC A;  3KFU A;  1PYS B;  3BFM A;  4XU2 A;  4NCX A;  4X5O A;  4KR2 A;  5C51 B;  3IG2 A;  1KMM A;  3MEY A;  1Z7N A;  3HRK A;  2ZT5 A;  2ZZF A;  4RQF A;  4KR3 A;  4XEO A;  4H2W A;  1EVL A;  3RIR A;  4PG3 A;  4YP0 A;  1EVK A;  2AKW A;  3HXW A;  4H2Y A;  1H4S A;  3UGT A;  3TEH B;  2A8E A;  3HY0 A;  1G51 A;  3RKW A;  3VQW A;  2E41 A;  2I4N A;  3RKX A;  2ZT8 A;  4CS2 A;  4K88 A;  4XU0 A;  3QO5 A;  3VQV A;  3RF1 A;  4YRR A;  2DU7 A;  3RL6 A;  3PZC A;  4CH4 A;  1JJC A;  2EJG A;  1G5I A;  4RDX A;  4TWA A;  1B7Y A;  1USY C;  2Q7H A;  1B70 B;  3NEM A;  1SES A;  2ZZE A;  4DPG A;  2DKG A;  1BIB A;  4YCV A;  1L0W A;  4HWO A;  3MF1 A;  2DU5 A;  1YFR A;  4H2U A;  4CS4 A;  2PMF A;  4H2T A;  2AMC A;  3ERR A;  2ART A;  3OD1 A;  3A7U A;  1EIY B;  2DDZ A;  4HWT A;  2PME A;  1NJ2 A;  3MF2 A;  1WQ7 A;  3VQX A;  4WI1 A;  4EO4 A;  2XGT A;  3NEL A;  3L1A A;  3M4P A;  2XTI A;  4P71 A;  4CH3 A;  2ZIM A;  4J15 A;  4P3O A;  3REU A;  2C8M A;  1H4T A;  2RHS A;  2C7I A;  3R07 A;  4XTZ A;  3WQZ A;  2ARU A;  4UP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...