1Z7RA

Solution structure of reduced glutaredoxin c1 from populus tremula x tremuloides
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
117
structure length
117
Chain Sequence
MASKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAATAKNPAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaredoxin
publication title Structural Insight into Poplar Glutaredoxin C1 with a Bridging Iron-Sulfur Cluster at the Active Site
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
molecule tags Electron transport
total genus 39
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z7rA00
1AQVA 4DSSA 1TOFA 1SD8A 4PQIA 4IS0A 4WF4A 4OFMA 1R5PA 3VWUA 16GSA 1TI1A 1G6YA 4ILFA 4OFTA 3GKNA 3HDCA 13GSA 1K3LA 3GV1A 2P31A 4HU9A 1YF1A 2DBCA 2WZ9A 4YH2A 1ZL9A 4KUNA 2J23A 2HSHA 3DMLA 4PNFA 4ZBBA 4JR6A 2V1MA 5J41A 4GQFA 4BVYA 3VWVA 4F0BA 1ERUA 4OFNA 2R37A 3EU3A 1T4YA 4L0WA 4F82A 2AUVA 5D9XA 2DJJA 1Z5YE 4N11A 4KB3A 2EIOA 4IQ1A 5D8IA 2C0GA 2VD0A 4LMVA 5HR0A 1M2AA 3F6FA 2VL2C 4K0GA 4WBRD 1X5EA 1MTCA 1ZMAA 4DVCA 1K0OA 1GNEA 1F2EA 4OO4A 4PXOA 2LEGA 1FHEA 5EL8A 2M80A 19GSA 2KHPA 2RIIA 5INYA 4N30A 1VF4A 2VCTA 4I8BA 5ECIB 3WT2A 3DYRA 2QKEA 2B5XA 3FR6A 4K7IA 3H93A 1A0FA 2E0QA 2QC7A 1FB6A 4G19A 2TRXA 5A4WA 4V1Ap 1X0RA 1G7EA 3IHQA 2GZYA 3GN3A 1O85A 3ZL5A 3KIJA 3PH9A 2WS2A 2X8GA 1A8LA 1XPVA 1F3AA 4EVMA 4ZL9A 4IGJA 3VPQA 1TRSA 4ECCA 4ULXA 3C1SA 2I3YA 3S9FA 2X64A 2WJUA 5ENUA 4ZB9A 3PR8A 1K0AA 5CRWA 1A8YA 4WR5A 2C0EA 4OD7A 3CBUA 4OWYA 2GSQA 4JRRA 3U5RE 2IWTA 2PWJA 3PGTA 3KEBA 5CRGA 1ML6A 2DIYA 2MYGA 3KGKA 1XFLA 5F8BA 3KTLA 2JSZA 3F9UA 3VK9A 2H1BA 2YZHA 3N5OA 3P8WA 3M9JA 2KUCA 1HYUA 1FOVA 3MDKA 4WETA 3ZTLA 1J08A 3I69A 5JCWA 1A23A 1ERTA 1K3YA 4PX1A 2H71A 3G7IA 2VM2A 2FWGA 4TN8A 1M9AA 4KAEA 4V2MA 2OE1A 3ZREA 4BWQA 5D73A 4XRAA 2C1YA 1TK0B 3FY7A 1KNGA 3WGEA 1KTEA 3BOAA 2WDUA 3F8UA 2WCIA 2H72A 3KJYA 1WIKA 3CMIA 3EU4A 4LL1B 3KP9A 2K18A 2B7JA 2YOIA 3Q18A 3HKRA 5GAPD 3FZAA 3D4MA 1SYXA 3LWAA 3TKSA 4P3YB 4MK3A 4O92A 1OAZA 4JU5A 1DE1A 2PMTA 2LJRA 4I2UA 1N8JA 3A3TA 3F3RA 3NOFA 4Q5QA 3I43A 1JHBA 1YEXA 2VLVA 1ERVA 5D96A 1OC9A 2GQKA 4EL1A 4ZILA 1MD3A 4D73A 5IPHA 4YQMA 1YKAA 3I9V2 1OC8A 2GSSA 1G7OA 3MWHA 2GGTA 2HFDA 2IPAA 5CNWA 1M7TA 2VCXA 1OKTA 4TR3A 1AUCA 3CRTA 1U3IA 1XWGA 1U3AA 2CAQA 5ECPB 3BCIA 5D9VA 2IFQB 1UN2A 2MMAA 1J9BA 2H19A 3KMNA 4EDZA 5CAXA 3GIXA 1A2LA 5EPFA 4HQSA 3VFIA 4KE3A 1WE0A 4IELA 2CT6A 5AIVA 3RAZA 4NMUA 2R2JA 1A2MA 1K0MA 4HS1A 1C72A 4ZL7A 4H86A 1VF2A 4J56E 2IMIA 4RQRA 4TW5A 3HXSA 1O8WA 3GL3A 4XCSA 2MMNA 3UAPA 1I5GA 5DALA 1SENA 2VLTA 2TRCP 3FR3A 2HZEB 2CA8A 5IO2A 2YNXA 1GSSA 5A4UA 3GX0A 4ECBA 3DGQA 3LFLA 3IDVA 2O8VB 4BL7A 5F0GA 2DLXA 5GSTA 2JSYA 3HVXA 1VF1A 2HRNA 1ZZYA 4HDEA 4TXVA 1KEBA 3FEUA 4TR0A 1F9MA 2FUG2 1GWCA 5H5QA 4JBBA 1FG4A 2B5EA 4CW9A 4ML6A 2YN1A 3E9JB 2F3MA 1ZYEA 3QD9A 3KM6A 4XHMA 4FIWA 5IO0A 3PINA 5D93A 4HJ2A 2FNOA 3FYGA 3AY8A 1X5DA 1UC7A 2CZ2A 3QAWA 2F9SA 3WGDA 2CZ3A 3TGZA 1YY7A 2DJKA 2LNSA 1H4OA 5ELAA 2YWIA 2LQOA 3ZYWA 5IMAA 4MJBA 1JLVA 5HFKA 1VF3A 6GSSA 11GSA 3KH9A 4QL9A 1ZYQB 3HHVA 1WJKA 1V98A 3ME8A 4V1Ag 3NIVA 4OMVA 4WKWA 1WWJA 1F6MC 3EINA 4ZB6A 4GTUA 1GULA 3FZ4A 2HYXA 4ZXGA 4I5QA 1GUHA 4GWRA 2EIQA 4L8EA 2FWFA 2LRNA 1ZGNA 4FH8A 2XC2A 5HFIA 3BD2A 1RQMA 4HI7A 3H8QA 1AC1A 2GQMA 1DE2A 4GF0A 1JZWA 2MMOA 3GH9A 2CX3A 4MMMA 1YQ1A 3IOSA 5AN1A 1GH2A 2GSRA 1NSWA 4GLTA 1GTBA 4ZBAA 4PUFC 1AW9A 1GTAA 2R3XA 1K0BA 5ABRA 3QAVA 2RM5A 3P90A 2J9HA 3FKFA 5J4UA 2KLXA 3HY2A 1PSQA 2LRCA 2C0DA 4EXJA 3QFBC 1R5AA 3TRPA 2AYTA 1AAZA 2E2MA 2GVPA 1BX9A 1TK5B 3F4RA 4HZ4A 1WPIA 1BG5A 1K0DA 2DJ3A 4AGSA 4BA7A 2CAIA 3IXRA 4WXTA 1AQWA 2B5YA 3RDWA 2FY6A 1ZCPA 4PGTA 3R2QA 4FYBA 1V9WA 1B4QA 3Q74A 3IE3A 4MZCA 3TRXA 5IMDA 2M72A 2REMA 4EDYA 3GSTA 3EMPA 1QQ2A 1ABAA 2NBSA 4KH7A 2FA4A 5LNKe 3C7MA 5B7CA 10GSA 3KXOA 3QFAC 1EEJA 2B6MA 3F4SA 4DSRA 7GSSA 2E2GA 3EE2A 3F0IA 4G10A 4NV2A 2DSAA 1MDKA 3L4NA 1HNCA 2VL2A 2DJ1A 1EZKA 2A2RA 2H0HA 3F63A 2MZCA 1XWAA 1BYEA 5C00A 2B7KA 5J5NA 3QOUA 4F0CA 4MF6A 4LL4B 4ZBDA 2QSIA 5CYYA 3APOA 4NV5A 18GSA 1NHOA 3APQA 2DMLA 5JCGA 1YKCA 2LKUA 3BBYA 1GLPA 4TKYA 3LYKA 2H1GA 1XZOA 2K8SA 3ZIJA 1X9SB 2H1DA 3TJJA 2PU9C 4GQCA 1IYHA 2DJ2A 5DJMA 1O73A 5HR3A 1B8XA 1O8XA 2B1KA 4HZ2A 4TRXA 3J7Yb 2EC4A 2RUEA 4AJ7A 5IPGA 2HI7A 3VURA 1QK8A 3GYKA 2C4JA 1SYRA 4K7OA 1O81A 3P2AA 3F3QA 3GSSA 3US3A 3D0ZA 4N0VA 6GSTA 2FCHA 1Y6EA 5A4VA 3KTBA 4KDXA 3CTGA 2DC5A 4V2LA 2JZRA 4MLYA 1ST9A 1Z9HA 2PBJA 3HJMA 2GZZA 4IVFA 5J3RA 3IAM2 2L5LA 4GSTA 5ECHB 4G2EA 4ZL8A 3IC4A 2H66A 2XPDA 2TIRA 2XPEA 2R5GA 4TR1B 2H1AA 2HNLA 1R26A 3TCOA 2G0FA 2KP1A 2H75A 1EWXA 1K0CA 3GNJA 1T4ZA 3J7Yk 5DQYA 4JR4A 2V6KA 2NPBA 2VD1A 3D22A 1GSFA 4F2IA 2X99A 3O76A 3G7YA 2CV4A 2HZEA 3VI7A 2LV3A 2YP6A 2OE3A 4Q5NA 3UIWA 2JU5A 4IHUA 4YAVA 4G9HA 2FHEA 2HXKA 2FWEA 3UOMA 1SJ6A 3EYTA 5H5RA 2AHEA 2I9HA 1YJ6A 17GSA 4HJMA 1TW9A 1A24A 3O3TA 1TTZA 2H73A 1U87A 1GL8A 3ZMKA 5DAKB 4MJEA 3TJBA 4DSSB 5L71A 3RBTA 1GTUA 2OJLA 2RM6A 5CO3A 3GMFA 1FB0A 3VLNA 2I4AA 3GKKA 1XBSA 2ZUPA 1XCCA 4JEDA 3CTFA 4OO5A 1BAYA 3ZMLA 5ECRB 4LA1A 1GSQA 3CSHA 1MEKA 2Z9SA 3DEXA 1EOHA 3F6DA 3A5WA 4FYUA 1XOBA 2VM1A 3DVWA 3GTUB 4JZQA 1X9MB 3P7XA 4EO3A 1SKWB 3M0FA 4MH3A 1FVKA 1GP1A 3APSA 1MDJA 3KZQA 3BCKA 4XIHA 3IK7A 4DEJA 4MJCA 1B9YC 3HVVA 2NDOA 3ZFLA 4IP1A 3DVXA 1SK2A 1FO5A 1BJXA 2YWNA 4EC0A 1LU4A 1VGLA 4MP4A 3CSIA 1A0RP 5G5EA 2ON5A 5KN0A 4MDCA 2C80A 5J9BA 3RHBA 5DBQA 2L6CA 3HCZA 2KP2A 5KN3A 3TKSC 2RLIA 1YZXA 5ECKB 4E8EA 3L9UA 2IL3A 3HA9A 4BPYA 5B8BA 2IJYA 3H79A 2H6XA 2B1LA 4MJAA 3O6TA 3GFKA 4K8MA 4XRDA 5B6MA 5ECLB 5JCUA 1OVNA 4EKZA 1OYJA 1HD2A 1TDIA 4MCUA 3UBLA 4O5RA 1HQOA 2YWMA 3GKMA 1T3BA 2WGRA 3FHKA 4TOPA 1EP8A 4NPBA 3A2WA 2L4QA 3WT1A 5JWRB 1THOA 4NHZA 2M46A 3GRXA 2PERA 3A2VA 3LXTA 1T7PB 4K6XA 5IMVA 3G9BA 1EOGA 4GSSA 2G2QA 5AIXA 2I1UA 3A2XA 1B9XC 4N10A 4MH2A 1AQXA 4E8HA 3TKSE 1SJIA 5IIZA 1LJRA 4HQZA 3FK8A 4MF7A 1EV9A 5GZZB 2AJQB 4GSNA 2H01A 2XBQA 2RUFA 3IBHA 1OKDA 5E59A 2IMEA 3M8NA 4IBPA 4Z7XA 3HYPA 2H6YA 1TRVA 1GSYA 1M99A 1TP9A 3CYNA 1V58A 4J57E 1YEPA 1SU9A 6GSVA 4QL7A 5FT3A 4NXIA 2H70A 3TUEA 4GXZA 1TU8A 4X0XA 3K8NA 2AB6A 5ECNB 3L9SA 1CQGA 1EV4A 4LLRA 1HNAA 3HVSA 2CVDA 3WYWA 1Z3EA 3UARA 1AIUA 1QFNA 2LJAA 3G7JA 2YV7A 4HUAA 4IQAA 2LS5A 2OACA 1R7HA 1BEDA 3TDGA 2WRTA 2A2SA 2GQLA 2V41A 3LGCA 2VL9A 1Q98A 1JFUA 5FWGA 1USBA 3L0HA 2C3QA 4WF5A 3ZITA 5CREA 1IYIA 5HR2A 4HU7A 4MZWA 1K3OA 5CRHA 4OCEA 2JL4A 1WP0A 5LCZA 1ON4A 1B4PA 1S3AA 1M9BA 4KX4A 4J2FA 2VUPA 1PN9A 3C73A 2KOKA 4N0ZA 3D5JA 5G31A 3ED3A 1NHYA 3EWLA 3IPZA 5ECQB 4ACSA 1UVZA 2LTKA 3RPPA 2FGXA 2CQ9A 1N2AA 4MZBA 1W4VA 2PUKC 1R4WA 1NM3A 2GTUA 6GSWA 4PUAA 5AGYA 3E0UA 3ZVJD 4F03A 3M1GA 2V2GA 4AF2A 4Q5RA 2C0FA 3HD5A 1SKRB 3BJ5A 4IP6A 4BWSA 3EURA 1YF0A 2H76A 1XVWA 3HZ8A 3GA4A 6GSUA 4TR1A 5G1KA 2DJ0A 5JWOB 2A4VA 2C8UA 2H0GA 2OA7A 5F05A 1Z7RA 9GSSA 3TJFA 1F37A 2YJ7A 4KSMA 5DJLA 4CDOA 3ERGA 3GURA 3TKQA 4IJIA 4O32A 2CX4A 1E2YA 1GSEA 2MBSA 4CHSA 3MAKA 2L57A 3IRAA 4GCIA 1VRSD 5G1LA 1S3DA 2EIRA 4PQ1A 2K6VA 3WGXA 1B48A 1PX6A 3F4TA 1HNBA 5ID2B 4X1UA 1QUWA 3UVHA 1GUMA 5J9CA 5F07A 1TJDA 1Z6MA 1JZOA 5DAKA 4EF0A 1OE7A 1ERWA 4ECIA 4O7HA 3RPNA 3LSZA 1PKZA 5CP1A 5GAND 3E3EA 1SJZA 3QMXA 1MD4A 1DSBA 2VCQA 5A5KA 1DUGA 2OE0A 1GUKA 1EGRA 3IAS2 1XIYA 4NWYA 5KEJA 2LJKA 5KN2A 3UBKA 3TB2A 1SL0B 5B8AA 3ERWA 2AAWA 5LD0A 1TXXA 4GRFA 1SK1A 3VI5A 5C04A 5KN1A 5ECMB 1FAAA 1QGVA 1I9DA 3GTUA 3CXGA 5F06A 2ON7A 3JCML 2N5BA 5DCGA 5EY6A 2H8LA 3FR9A 4V2NA 3FW2A 2N5FA 5IMZA 4FO5A 3TJKA 1EP7A 3RHCA 1CQHA 12GSA 3GH6A 3ISOA 3VWWA 3IR4A 3ZLPA 4HOJA 2HSYA 4KCAA 3LEFA 2E7PA 3DWVA 4Q5FA 2DMMA 3U6VA 3VWXA 1MDIA 1GRXA 2IFQA 3TOTA 2O7KA 5EVOA 2YANA 2FA8A 4POKA 5E4WA 2GDRA 3UL3A 5DQSA 3W8JA 4TVEA 1JZRA 4KCEA 5GSSA 1GTIA 3V1WA 5IQYA 4F9ZA 4IW9A 1G0TA 2FWHA 1V40A 4ID0A 1UA5A 2IMKA 4QQ7A 4XS4B 1ACVA 2GLRA 1YDKA 1XWKA 2BTOT 5COHA 5AISA 3L78A 1SK0A 2GSTA 2HLSA 4IJ3A 4KNDA 4NHWA 2O89A 2XHFA 3TRQA 5G30A 2HT9A 3C8EA 4TXOB 3IV4A 1TKDB 2VO4A 3DIEA 1KBNA 2K8VA 3QDNA 1URMA 1PMTA 2PGTA 5G5FA 8GSSA 2FLSA 2ZCTA 1DBYA 2C3TA 1XWBA 4IKHA 3DRNA 1X9WB 2L5OA 3L9VA 2B3SA 2O87A 6GSYA 4NAXA 2LNTA 2NTOA 3IK9A 4JE1A 2VOCA 1XWCA 2BJXA 3LG6A 4K0NA 2JZTA 3UVTA 2I81A 4PURA 3EC3A 1W89A 3UJ1A 2P0GA 4ZB8A 1PL2A 1XVQA 5HFGA 1K0NA 3QCPA 1PRXA 2VIMA 3TJGA 3Q6OA 2H30A 5HQPA 2VL3A 3VPTA 5IMFA 4WR4A 1Y25A 4PNGA 1RK4A 2C3NA 1QMVA 1E6BA 1M2BA 2MMZA 4KW6A 3CRUA 4IN0A 3QAGA 2WULA 3GKXA 3LJRA 1XW9A 3W6GA 1PGTA 4XS1A 1J0FA 3LXZA 3QR6A 1WMJA 4I97A 3EVIA 1THXA 2CVKA 2IMFA 5ELGA 1TRWA 5JWQB 1RW1A 5ECSA 1XXUA 3I6AA 2IN3A 1FW1A 3LQ7A 4KGIA 5B6NA 2H6ZA 4K2DA 1TRUA 2OKAA 2LQQA 3D21A 4ISDA 3C71A 1G6WA 3FRCA 3ZZXA 1F3BA 4MF5A 2H0IA 5ECOB 4DSQA 3ZFBA 4WEYA 2WB9A 1PX7A 3KMOA 4HEA2 2JACA 3ERFA 1NW2A 3KCMA 3KH7A 1U88A 4XS6A 2K9FA 2GZPA 3ME7A 3KD0A 2NVLA 3D6IA 4AJ8A 5IOXA 5G2ZA 2JADA 1JZDA 4EE0A 5IOWA 4K7NA 4POLA 2R6KA 4K9ZA 1BQ7A 3TKPA 2P5RA 2YZUA 3DD3A 1Z6NA 1M2DA 1XW5A 1SL2B 2F8FA 3FZ5A 4MABA 2L6DA 4KDUA 4TR4A 3H4KA 4L0UA 2MBTA 1U6TA 5H5SA 1EEMA 1SL1B 4LMWA 4X43A 4PQHA 3M3MA 4POBA 4WBJA 4ECJA 1LBKA 1V57A 2P5QA 2PVQA 1FVJA 3D4TA 2HE3A 1AXDA 5ID2A 1GSDA 1XW6A 2O85A 4RI6A 2HRFA 4RQXA 3H1NA 1Z7PA 4YQUA 3QPMA 4KSOA 2PPTA 4MA9A 4BVXA 4I2TA 2VCZA 1T00A 2F8AA 3UMAA 4OCFA 2PVOC 3HJPA 3M9KA 2OADA 2WFCA 2R4VA 1PQNA 4EUYA 3SBCA 1TU7A 2XBIA 4KA0A 1Q4JA 2X8HA 2VCWA 3SWLA 1SD9A 3ZIVA 2CVBA 4YAPA 2AV4A 5HR1A 2OBKA 2V6OA 1PD21 1X5CA 3LYPA 3GUSA 1H75A 3N9JA 3DXBA 2HZFA 2BMXA 4POMA 14GSA 2JZSA 2ALBA 5DDLA 2VCVA 4XTSA 1M0UA 2LSTA 4L5OA 2QGVA 1O6JA 5CRDA 2PN8A 1V2AA 3GHAA 1OC9B 1T1VA 3Q19A 4D73B 5D9TA 2LUSA 3C1RA 1JLWA 1PKWA 3UEMA 1S3CA 6GSXA 3GL5A 1GLQA 1PL1A 1OE8A 3WD6A 1QXHA 4RI7A 2DIZA 3MNGA 1ZOFA 3DKSA 3CSJA 5D9WA 1XOAA 2VLUA 2X8CA 2F51A 2FD3A 4FYCA 4I6XA 2H74A 2LRTA 2YJHA 3IA1A 1GSUA 3KP8A 2D2ZA 4MPFA 4K1FA 2YCDA 3FZ9A 4YQVA 3NZNA 4RUVA 5DVBA 1EGOA 1WRYA 2V32A 1SKSB 2GT6A 3ZVJA 1OC3A 3HZ4A 4XS4A 5IM9A 5DALB 3TKRA 4KDYA 2ZNMA 1WOUA 2IIYA 1ILOA 2GS3A 2IMDA 4ZIJA 4MPGA 2VAFA 1GNWA 1A2JA 4L5LA 22GSA 2N5AA 2YWOA 2YPMA 1TI3A 1O7UA 4TXOA 1PA3A 3LORA 1TK8B 3MSZA 3GX8A 3ZRDA 20GSA 2ES7A 3OR5A 2GT5A 1T8EB 5FHIA 4ML1A 2L59A 5DCHA 5IMCA 3TOUA 2OBIA 3W8SA 4AJ6A 2L4CA 3HJOA 3EMXA 2YV9A
chains in the Genus database with same CATH superfamily
1AQVA 4DSSA 1TOFA 1SD8A 4PQIA 4IS0A 4WF4A 4OFMA 1R5PA 3VWUA 16GSA 1TI1A 1G6YA 4ILFA 4OFTA 3GKNA 3HDCA 13GSA 1K3LA 3GV1A 2P31A 4HU9A 1YF1A 2DBCA 2WZ9A 4YH2A 1ZL9A 4KUNA 2J23A 2HSHA 3DMLA 4PNFA 4ZBBA 4JR6A 2V1MA 5J41A 4GQFA 4BVYA 3VWVA 4F0BA 1ERUA 4OFNA 2R37A 3EU3A 1T4YA 4L0WA 4F82A 2AUVA 5D9XA 2DJJA 1Z5YE 4N11A 4KB3A 2EIOA 4IQ1A 5D8IA 2C0GA 2VD0A 4LMVA 5HR0A 1M2AA 3F6FA 2VL2C 4O5QA 4K0GA 4WBRD 1X5EA 1MTCA 1ZMAA 4DVCA 1K0OA 1GNEA 1F2EA 4OO4A 4PXOA 2LEGA 1FHEA 5EL8A 4G0IA 2M80A 19GSA 2KHPA 2RIIA 5INYA 4N30A 1VF4A 2VCTA 4I8BA 5ECIB 3WT2A 3DYRA 2QKEA 2B5XA 3FR6A 4K7IA 3H93A 1A0FA 2E0QA 2QC7A 4BIKA 1FB6A 4G19A 2TRXA 5A4WA 4V1Ap 1X0RA 1G7EA 3IHQA 2GZYA 3GN3A 1O85A 3ZL5A 3KIJA 3PH9A 2WS2A 2X8GA 1A8LA 1XPVA 1F3AA 4EVMA 4ZL9A 4IGJA 3VPQA 1TRSA 4ECCA 4ULXA 3C1SA 2I3YA 3S9FA 2X64A 2WJUA 5ENUA 4ZB9A 4PTSA 3PR8A 1K0AA 5CRWA 1A8YA 4WR5A 2C0EA 4OD7A 4A5PA 3CBUA 4OWYA 2GSQA 4JRRA 3U5RE 2IWTA 2PWJA 3PGTA 3KEBA 5CRGA 1ML6A 2DIYA 2MYGA 3KGKA 1XFLA 5F8BA 3KTLA 2JSZA 3F9UA 3VK9A 2H1BA 2YZHA 3N5OA 3P8WA 3M9JA 4K2XA 2KUCA 1HYUA 1FOVA 3MDKA 4WETA 3ZTLA 1J08A 3I69A 5JCWA 1A23A 1ERTA 1K3YA 4PX1A 2H71A 3G7IA 2VM2A 4G0KA 2FWGA 4TN8A 1M9AA 4KAEA 4V2MA 2OE1A 3ZREA 4BWQA 5D73A 4XRAA 2C1YA 1TK0B 5BMUA 3FY7A 1KNGA 3WGEA 1KTEA 3BOAA 2WDUA 3F8UA 2WCIA 2H72A 3KJYA 1WIKA 3CMIA 3EU4A 4LL1B 3KP9A 2K18A 2B7JA 2YOIA 3Q18A 3HKRA 5GAPD 3FZAA 3D4MA 1SYXA 3LWAA 3TKSA 4P3YB 4MK3A 4O92A 1OAZA 1XG8A 4JU5A 1DE1A 2PMTA 2LJRA 4I2UA 1N8JA 3A3TA 3F3RA 3NOFA 4Q5QA 3I43A 1JHBA 1YEXA 2VLVA 1ERVA 5D96A 1OC9A 2GQKA 4EL1A 4ZILA 1MD3A 4D73A 5IPHA 4YQMA 1YKAA 3I9V2 1OC8A 2GSSA 1G7OA 3MWHA 2GGTA 2HFDA 2IPAA 5CNWA 1M7TA 2VCXA 1OKTA 4TR3A 1AUCA 3CRTA 1U3IA 1XWGA 1U3AA 3MIXA 2CAQA 5ECPB 3BCIA 5D9VA 2IFQB 1UN2A 2MMAA 1J9BA 2H19A 3KMNA 4YKFA 4EDZA 5CAXA 3GIXA 1A2LA 5BRTA 5EPFA 4HQSA 3VFIA 4KE3A 1WE0A 4IELA 4K5RA 2CT6A 2QA1A 5AIVA 3RAZA 4NMUA 2R2JA 1A2MA 1K0MA 4HS1A 1C72A 1ZYPA 4ZL7A 4H86A 1VF2A 4J56E 2IMIA 4RQRA 4TW5A 3HXSA 1O8WA 3GL3A 4XCSA 2MMNA 3UAPA 1I5GA 5DALA 1SENA 2VLTA 2TRCP 3FR3A 2HZEB 2CA8A 5IO2A 2YNXA 1GSSA 5A4UA 3GX0A 4ECBA 3DGQA 3LFLA 3IDVA 5KOXA 2O8VB 4BL7A 5F0GA 2DLXA 5GSTA 2JSYA 3HVXA 1VF1A 2HRNA 1ZZYA 4HDEA 4TXVA 1KEBA 3FEUA 4TR0A 1F9MA 2FUG2 1GWCA 5H5QA 4JBBA 1FG4A 2B5EA 4CW9A 4ML6A 2YN1A 3E9JB 2F3MA 1ZYEA 3QD9A 3KM6A 4XHMA 4FIWA 5IO0A 3PINA 5D93A 4HJ2A 2FNOA 3FYGA 3AY8A 1X5DA 1UC7A 2CZ2A 3QAWA 2F9SA 3WGDA 2CZ3A 3TGZA 1YY7A 2DJKA 2LNSA 1H4OA 5ELAA 2YWIA 4O5UA 2LQOA 3ZYWA 5IMAA 4MJBA 4ICYA 4HSCX 1JLVA 5HFKA 1VF3A 6GSSA 11GSA 3KH9A 4QL9A 1ZYQB 3CQFA 3HHVA 1WJKA 1V98A 3ME8A 4V1Ag 3NIVA 4OMVA 4WKWA 1WWJA 1F6MC 3EINA 4ZB6A 4GTUA 1GULA 3FZ4A 2HYXA 4ZXGA 4I5QA 1GUHA 4GWRA 2EIQA 4L8EA 2FWFA 2LRNA 1ZGNA 4FH8A 2XC2A 5HFIA 3BD2A 1RQMA 4HI7A 3H8QA 1AC1A 2GQMA 1DE2A 4GF0A 1JZWA 2MMOA 3GH9A 2CX3A 3IC8A 4MMMA 1YQ1A 3IOSA 5AN1A 1GH2A 2GSRA 1NSWA 4GLTA 1GTBA 2R0PA 4ZBAA 4PUFC 1AW9A 1GTAA 2R3XA 1K0BA 5ABRA 3QAVA 2RM5A 3P90A 2J9HA 2DKIA 3FKFA 5J4UA 2KLXA 3MYDA 3HY2A 1PSQA 2LRCA 2C0DA 4EXJA 3QFBC 1R5AA 3TRPA 2AYTA 1AAZA 2E2MA 2GVPA 1BX9A 1TK5B 3F4RA 4HZ4A 1WPIA 1BG5A 1K0DA 2DJ3A 4AGSA 4BA7A 2CAIA 3IXRA 4WXTA 1AQWA 2B5YA 3RDWA 2FY6A 1ZCPA 3LW9A 4PGTA 3R2QA 4FYBA 1V9WA 1B4QA 3Q74A 3IE3A 4MZCA 3TRXA 5IMDA 2M72A 2REMA 4EDYA 3GSTA 3EMPA 1QQ2A 1ABAA 2NBSA 4KH7A 2FA4A 5LNKe 3C7MA 5B7CA 10GSA 3KXOA 3QFAC 1EEJA 2B6MA 3F4SA 4DSRA 7GSSA 2E2GA 3EE2A 3F0IA 4G10A 4NV2A 2DSAA 1MDKA 3L4NA 1HNCA 2VL2A 2DJ1A 1EZKA 2A2RA 2H0HA 3F63A 2MZCA 1XWAA 1BYEA 5C00A 2B7KA 5J5NA 3QOUA 4F0CA 4MF6A 4LL4B 4ZBDA 2QSIA 5CYYA 3APOA 4NV5A 18GSA 1NHOA 3APQA 2DMLA 5JCGA 1YKCA 2LKUA 3BBYA 1GLPA 4TKYA 3LYKA 2H1GA 1XZOA 2K8SA 3ZIJA 1X9SB 2H1DA 3TJJA 2PU9C 4EIQA 1S3RA 4GQCA 1IYHA 2DJ2A 5DJMA 1O73A 5HR3A 1B8XA 1O8XA 2B1KA 4HZ2A 4TRXA 3J7Yb 2EC4A 3PPUA 2RUEA 4AJ7A 5IPGA 2HI7A 3VURA 1QK8A 3GYKA 2C4JA 1SYRA 4K7OA 1O81A 3P2AA 3F3QA 3GSSA 3US3A 3D0ZA 4KF9A 4N0VA 6GSTA 2FCHA 1Y6EA 5A4VA 3KTBA 4KDXA 3CTGA 2DC5A 4V2LA 2JZRA 4MLYA 1ST9A 1Z9HA 2PBJA 3HJMA 2GZZA 4IVFA 5J3RA 3IAM2 2L5LA 4GSTA 5ECHB 4G2EA 4ZL8A 3IC4A 2H66A 2XPDA 2TIRA 2XPEA 2R5GA 4TR1B 2H1AA 2HNLA 1R26A 3TCOA 2G0FA 2KP1A 2H75A 1EWXA 1K0CA 3GNJA 1T4ZA 3J7Yk 5DQYA 4JR4A 2V6KA 2NPBA 2VD1A 3D22A 1GSFA 4F2IA 2X99A 3O76A 3G7YA 2CV4A 2HZEA 4CY8A 3VI7A 2LV3A 2YP6A 2OE3A 4Q5NA 3UIWA 1PN0A 2JU5A 4IHUA 4YAVA 4G9HA 2FHEA 2HXKA 2FWEA 3UOMA 1SJ6A 2HSMA 3EYTA 5H5RA 2AHEA 2I9HA 1YJ6A 17GSA 4HJMA 1TW9A 1A24A 3O3TA 1TTZA 2H73A 1U87A 1GL8A 3ZMKA 5DAKB 4MJEA 3TJBA 4EIPA 4DSSB 5L71A 3RBTA 1GTUA 2OJLA 2RM6A 5CO3A 3GMFA 1FB0A 3VLNA 2I4AA 3GKKA 1XBSA 2ZUPA 1XCCA 4JEDA 3CTFA 4OO5A 1BAYA 3ZMLA 5ECRB 4LA1A 3FMWA 1GSQA 3CSHA 1MEKA 2R0GA 1M3JA 2Z9SA 3DEXA 1EOHA 4YKGA 3F6DA 3A5WA 4FYUA 1XOBA 2VM1A 3DVWA 3GTUB 4JZQA 1X9MB 3P7XA 4EO3A 1SKWB 3M0FA 4MH3A 1FVKA 1GP1A 3APSA 1MDJA 3KZQA 3BCKA 4XIHA 3IK7A 4DEJA 4MJCA 1B9YC 3HVVA 2NDOA 3ZFLA 4IP1A 3DVXA 1SK2A 1FO5A 1BJXA 2YWNA 4EC0A 1LU4A 1VGLA 4MP4A 3CSIA 1A0RP 5G5EA 2ON5A 5KN0A 4MDCA 2C80A 5J9BA 3RHBA 5DBQA 2L6CA 3HCZA 2KP2A 5KN3A 3TKSC 2RLIA 1YZXA 5ECKB 4E8EA 3L9UA 2IL3A 3HA9A 4BPYA 5B8BA 2IJYA 3H79A 2H6XA 2B1LA 4MJAA 3O6TA 3GFKA 4K8MA 4XRDA 5B6MA 5ECLB 5JCUA 1OVNA 4EKZA 1OYJA 1HD2A 1TDIA 4MCUA 3UBLA 4O5RA 1HQOA 2YWMA 3GKMA 1T3BA 2WGRA 3FHKA 2DKHA 4TOPA 1EP8A 4NPBA 3A2WA 2L4QA 3WT1A 5JWRB 1THOA 4NHZA 2M46A 3GRXA 2PERA 3A2VA 3LXTA 1T7PB 4K6XA 5IMVA 3G9BA 1EOGA 4GSSA 2G2QA 5AIXA 2I1UA 3A2XA 1B9XC 4N10A 4MH2A 1AQXA 4E8HA 3TKSE 1SJIA 5IIZA 1LJRA 4HQZA 3FK8A 4MF7A 1EV9A 5GZZB 2AJQB 4GSNA 2H01A 2XBQA 2RUFA 3IBHA 1OKDA 5E59A 2IMEA 3M8NA 4IBPA 4Z7XA 3HYPA 2H6YA 1TRVA 1GSYA 1M99A 1TP9A 3CYNA 1V58A 4J57E 1YEPA 1SU9A 6GSVA 4QL7A 5FT3A 4NXIA 2H70A 3TUEA 4GXZA 1TU8A 4X0XA 3K8NA 2AB6A 5ECNB 3L9SA 1CQGA 1EV4A 4LLRA 1HNAA 3HVSA 2CVDA 3WYWA 1Z3EA 3UARA 1AIUA 1QFNA 2LJAA 3G7JA 2YV7A 4HUAA 4IQAA 1M3IA 4FQUA 2LS5A 2OACA 1R7HA 1BEDA 3TDGA 2WRTA 2A2SA 2GQLA 2V41A 3LGCA 2VL9A 1Q98A 1JFUA 5FWGA 1USBA 3L0HA 2C3QA 1ZYNA 4WF5A 3ZITA 5CREA 1IYIA 5HR2A 4HU7A 4MZWA 1K3OA 5CRHA 4OCEA 2JL4A 1WP0A 5LCZA 1ON4A 1B4PA 1S3AA 1M9BA 4KX4A 4J2FA 2VUPA 1PN9A 3C73A 2KOKA 4MNNA 4N0ZA 3D5JA 5G31A 3ED3A 1NHYA 3EWLA 3IPZA 5ECQB 4ACSA 1UVZA 2LTKA 3RPPA 2FGXA 2CQ9A 1N2AA 4MZBA 1W4VA 2PUKC 1R4WA 1NM3A 2GTUA 6GSWA 4PUAA 5AGYA 3E0UA 3ZVJD 4F03A 3M1GA 2V2GA 4AF2A 4Q5RA 2C0FA 3HD5A 1SKRB 3BJ5A 4IP6A 4BWSA 3EURA 2QA2A 1YF0A 2H76A 1XVWA 3HZ8A 3GA4A 6GSUA 4G0LA 4TR1A 5G1KA 2DJ0A 5JWOB 2A4VA 2C8UA 2H0GA 2OA7A 5F05A 1Z7RA 9GSSA 3TJFA 1F37A 2YJ7A 4KSMA 5DJLA 4CDOA 3ERGA 3GURA 3TKQA 4IJIA 4O32A 2CX4A 1E2YA 1GSEA 2MBSA 4CHSA 3MAKA 2L57A 3IRAA 4GCIA 1VRSD 5G1LA 1S3DA 2EIRA 4PQ1A 2K6VA 3WGXA 1B48A 1PX6A 3F4TA 1HNBA 5ID2B 4X1UA 1QUWA 3UVHA 1GUMA 5J9CA 5F07A 1TJDA 1Z6MA 1JZOA 4BVXB 5DAKA 4EF0A 1OE7A 1ERWA 4ECIA 5KOWA 4O7HA 3RPNA 3LSZA 1PKZA 5CP1A 5GAND 1PFOA 3E3EA 1SJZA 3QMXA 1MD4A 1DSBA 2VCQA 5A5KA 1DUGA 2OE0A 1GUKA 1EGRA 3IAS2 1XIYA 4NWYA 5KEJA 2LJKA 5KN2A 3UBKA 3TB2A 1SL0B 5B8AA 3ERWA 2AAWA 5LD0A 1TXXA 4GRFA 1SK1A 3VI5A 5C04A 5KN1A 5ECMB 1FAAA 1QGVA 1I9DA 3GTUA 3CXGA 5F06A 2ON7A 3JCML 2N5BA 5DCGA 5EY6A 2H8LA 3FR9A 4V2NA 3FW2A 2N5FA 5IMZA 4FO5A 3TJKA 1EP7A 3RHCA 1CQHA 12GSA 3GH6A 3ISOA 3VWWA 3IR4A 3ZLPA 4HOJA 2HSYA 4KCAA 3LEFA 2E7PA 3DWVA 4Q5FA 2DMMA 3U6VA 3VWXA 1MDIA 1GRXA 2IFQA 3TOTA 2O7KA 5EVOA 2YANA 2FA8A 4POKA 5E4WA 2GDRA 3UL3A 5DQSA 3W8JA 4TVEA 1JZRA 4KCEA 5GSSA 1GTIA 3V1WA 5IQYA 4F9ZA 4IW9A 1G0TA 2FWHA 1V40A 4ID0A 1UA5A 2IMKA 4QQ7A 4Z2UA 4XS4B 1ACVA 2GLRA 1YDKA 1XWKA 2BTOT 5COHA 5AISA 3L78A 1SK0A 2GSTA 2HLSA 4IJ3A 4KNDA 4NHWA 2O89A 3IHGA 2XHFA 3R3EA 3TRQA 5G30A 2HT9A 3C8EA 4TXOB 3IV4A 1TKDB 2VO4A 3DIEA 1KBNA 2K8VA 3QDNA 1URMA 2UZ8A 1PMTA 2PGTA 5G5FA 8GSSA 2FLSA 2ZCTA 1DBYA 2C3TA 1XWBA 4IKHA 3DRNA 1X9WB 2L5OA 3L9VA 2B3SA 2O87A 6GSYA 4NAXA 2LNTA 2NTOA 3IK9A 4JE1A 2VOCA 1XWCA 2BJXA 4Z2TA 3LG6A 4K0NA 2JZTA 3UVTA 2I81A 4PURA 3EC3A 1W89A 3UJ1A 2P0GA 4ZB8A 1PL2A 1XVQA 5HFGA 1K0NA 3QCPA 1PRXA 2VIMA 3TJGA 4BVYB 3Q6OA 2H30A 5HQPA 2VL3A 3VPTA 5IMFA 4WR4A 1Y25A 3A5IA 4PNGA 1RK4A 2C3NA 1QMVA 1E6BA 1M2BA 2MMZA 4KW6A 3CRUA 1FOHA 4IN0A 3QAGA 2WULA 3GKXA 3LJRA 1XW9A 3W6GA 1PGTA 4XS1A 1J0FA 3LXZA 3QR6A 1WMJA 4I97A 3EVIA 1THXA 2CVKA 2IMFA 5ELGA 1TRWA 5JWQB 1RW1A 5ECSA 1XXUA 3I6AA 2IN3A 1FW1A 2A4HA 3LQ7A 4KGIA 5B6NA 2H6ZA 4K2DA 1TRUA 2OKAA 2LQQA 3D21A 4ISDA 3C71A 1G6WA 3FRCA 3ZZXA 2R0CA 1F3BA 4MF5A 2H0IA 5ECOB 4DSQA 3ZFBA 4WEYA 2WB9A 1PX7A 3KMOA 2HRKA 4HEA2 2JACA 3ERFA 1NW2A 3KCMA 3KH7A 3EPTA 1U88A 4XS6A 2K9FA 2GZPA 4USSA 3ME7A 3KD0A 2NVLA 3D6IA 4AJ8A 5IOXA 5G2ZA 2JADA 1JZDA 4EE0A 5IOWA 4K7NA 4POLA 2R6KA 4K9ZA 1BQ7A 3TKPA 2P5RA 2YZUA 3DD3A 1Z6NA 1M2DA 1XW5A 1SL2B 2F8FA 3FZ5A 4MABA 2L6DA 4KDUA 4TR4A 3H4KA 4L0UA 2MBTA 1U6TA 5H5SA 1EEMA 1SL1B 4LMWA 4X43A 4PQHA 3M3MA 4POBA 4WBJA 4ECJA 1LBKA 2X49A 1V57A 2P5QA 2PVQA 2HRAA 1FVJA 3D4TA 2HE3A 1AXDA 5ID2A 1GSDA 1XW6A 2O85A 4X4JA 4RI6A 2HRFA 4RQXA 3H1NA 1Z7PA 4YQUA 3QPMA 4KSOA 2PPTA 4MA9A 4BVXA 4I2TA 2VCZA 1T00A 2F8AA 3UMAA 4OCFA 2PVOC 3HJPA 3M9KA 2OADA 2WFCA 2R4VA 1PQNA 4EUYA 3SBCA 1TU7A 2XBIA 4KA0A 1Q4JA 2X8HA 2VCWA 3SWLA 1SD9A 3ZIVA 2A2PA 2CVBA 4YAPA 2AV4A 5HR1A 2OBKA 2V6OA 1PD21 1X5CA 3LYPA 3GUSA 1H75A 3N9JA 3DXBA 4K5SA 2HZFA 2BMXA 4CY6A 4POMA 14GSA 2JZSA 2ALBA 5DDLA 2VCVA 4XTSA 1M0UA 2LSTA 4L5OA 2QGVA 1O6JA 2X4AA 5CRDA 2PN8A 1V2AA 3GHAA 1OC9B 1T1VA 3Q19A 4D73B 5D9TA 2LUSA 3C1RA 1JLWA 1PKWA 3UEMA 1S3CA 6GSXA 3GL5A 1GLQA 3HVNA 1PL1A 1OE8A 3WD6A 1QXHA 4RI7A 2DIZA 3MNGA 1ZOFA 3DKSA 3CSJA 5D9WA 1XOAA 2VLUA 2X8CA 2F51A 2FD3A 4FYCA 4Z2RA 4I6XA 2H74A 2LRTA 2YJHA 3IA1A 1GSUA 3KP8A 2D2ZA 4MPFA 4K1FA 2YCDA 3FZ9A 4YQVA 3NZNA 4RUVA 5DVBA 1EGOA 1WRYA 2V32A 1SKSB 2GT6A 3ZVJA 1OC3A 3HZ4A 4XS4A 5IM9A 5DALB 3TKRA 4KDYA 2ZNMA 1WOUA 2IIYA 1ILOA 2GS3A 2IMDA 4ZIJA 4MPGA 2VAFA 1GNWA 1A2JA 4L5LA 22GSA 2N5AA 2YWOA 2YPMA 1TI3A 1O7UA 4TXOA 1PA3A 3LORA 1TK8B 4BL7B 3MSZA 3GX8A 3ZRDA 20GSA 2ES7A 3OR5A 2GT5A 1T8EB 5FHIA 4ML1A 2L59A 5DCHA 5IMCA 3TOUA 2OBIA 3W8SA 4AJ6A 2L4CA 3HJOA 3EMXA 2YV9A
chains in the Genus database with same CATH topology
1AQVA 4DSSA 1TOFA 1SD8A 4PQIA 4IS0A 4WF4A 4OFMA 1R5PA 3VWUA 16GSA 1TI1A 1G6YA 4ILFA 4OFTA 3GKNA 3HDCA 13GSA 1K3LA 3GV1A 2P31A 4HU9A 1YF1A 2DBCA 2WZ9A 4YH2A 1ZL9A 4KUNA 2J23A 2HSHA 3DMLA 4PNFA 4ZBBA 4JR6A 2V1MA 5J41A 4GQFA 4BVYA 3VWVA 4F0BA 1ERUA 4OFNA 2R37A 3EU3A 1T4YA 4L0WA 4F82A 2AUVA 5D9XA 2DJJA 1Z5YE 4N11A 4KB3A 2EIOA 4IQ1A 5D8IA 2C0GA 2VD0A 4LMVA 5HR0A 1M2AA 3F6FA 2VL2C 4O5QA 4K0GA 4WBRD 1X5EA 1MTCA 1ZMAA 4DVCA 1K0OA 1GNEA 1F2EA 4OO4A 4PXOA 2LEGA 1FHEA 5EL8A 4G0IA 2M80A 19GSA 2KHPA 2RIIA 5INYA 4N30A 1VF4A 2VCTA 4I8BA 5ECIB 3WT2A 3DYRA 2QKEA 2B5XA 3FR6A 4K7IA 3H93A 1A0FA 2E0QA 2QC7A 1FB6A 4G19A 2TRXA 5A4WA 4V1Ap 1X0RA 1G7EA 3IHQA 2GZYA 3GN3A 1O85A 3ZL5A 3KIJA 3PH9A 2WS2A 2X8GA 1A8LA 1XPVA 1F3AA 4EVMA 4ZL9A 4IGJA 3VPQA 1TRSA 4ECCA 4ULXA 3C1SA 2I3YA 3S9FA 2X64A 2WJUA 5ENUA 4ZB9A 4PTSA 3PR8A 1K0AA 5CRWA 1A8YA 4WR5A 2C0EA 4OD7A 4A5PA 3CBUA 4OWYA 2GSQA 4JRRA 3U5RE 2IWTA 2PWJA 3PGTA 3KEBA 5CRGA 1ML6A 2DIYA 2MYGA 3KGKA 1XFLA 5F8BA 3KTLA 2JSZA 3F9UA 3VK9A 2H1BA 2YZHA 3N5OA 3P8WA 3M9JA 4K2XA 2KUCA 1HYUA 1FOVA 3MDKA 4WETA 3ZTLA 1J08A 3I69A 5JCWA 1A23A 1ERTA 1K3YA 4PX1A 2H71A 3G7IA 2VM2A 4G0KA 2FWGA 4TN8A 1M9AA 4KAEA 4V2MA 2OE1A 3ZREA 4BWQA 5D73A 4XRAA 2C1YA 1TK0B 5BMUA 3FY7A 1KNGA 3WGEA 1KTEA 3BOAA 2WDUA 3F8UA 2WCIA 2H72A 3KJYA 1WIKA 3CMIA 3EU4A 4LL1B 3KP9A 2K18A 2B7JA 2YOIA 3Q18A 3HKRA 5GAPD 3FZAA 3D4MA 1SYXA 3LWAA 3TKSA 4P3YB 4MK3A 4O92A 1OAZA 4JU5A 1DE1A 2PMTA 2LJRA 4I2UA 1N8JA 3A3TA 3F3RA 3NOFA 4Q5QA 3I43A 1JHBA 1YEXA 2VLVA 1ERVA 5D96A 1OC9A 2GQKA 4EL1A 4ZILA 1MD3A 4D73A 5IPHA 4YQMA 1YKAA 3I9V2 1OC8A 2GSSA 1G7OA 3MWHA 2GGTA 2HFDA 2IPAA 5CNWA 1M7TA 2VCXA 1OKTA 4TR3A 1AUCA 3CRTA 1U3IA 1XWGA 1U3AA 3MIXA 2CAQA 5ECPB 3BCIA 5D9VA 2IFQB 1UN2A 2MMAA 1J9BA 2H19A 3KMNA 4YKFA 4EDZA 5CAXA 3GIXA 1A2LA 5BRTA 5EPFA 4HQSA 3VFIA 4KE3A 1WE0A 4IELA 4K5RA 2CT6A 2QA1A 5AIVA 3RAZA 4NMUA 2R2JA 1A2MA 1K0MA 4HS1A 1C72A 1ZYPA 4ZL7A 4H86A 1VF2A 4J56E 2IMIA 4RQRA 4TW5A 3HXSA 1O8WA 3GL3A 4XCSA 2MMNA 3UAPA 1I5GA 5DALA 1SENA 2VLTA 2TRCP 3FR3A 2HZEB 2CA8A 5IO2A 2YNXA 1GSSA 5A4UA 3GX0A 4ECBA 3DGQA 3LFLA 3IDVA 5KOXA 2O8VB 4BL7A 5F0GA 2DLXA 5GSTA 2JSYA 3HVXA 1VF1A 2HRNA 1ZZYA 4HDEA 4TXVA 1KEBA 3FEUA 4TR0A 1F9MA 2FUG2 1GWCA 5H5QA 4JBBA 1FG4A 2B5EA 4CW9A 4ML6A 2YN1A 3E9JB 2F3MA 1ZYEA 3QD9A 3KM6A 4XHMA 4FIWA 5IO0A 3PINA 5D93A 4HJ2A 2FNOA 3FYGA 3AY8A 1X5DA 1UC7A 2CZ2A 3QAWA 2F9SA 3WGDA 2CZ3A 3TGZA 1YY7A 2DJKA 2LNSA 1H4OA 5ELAA 2YWIA 4O5UA 2LQOA 3ZYWA 5IMAA 4MJBA 4ICYA 1JLVA 5HFKA 1VF3A 6GSSA 11GSA 3KH9A 4QL9A 1ZYQB 3HHVA 1WJKA 1V98A 3ME8A 4V1Ag 3NIVA 4OMVA 4WKWA 1WWJA 1F6MC 3EINA 4ZB6A 4GTUA 1GULA 3FZ4A 2HYXA 4ZXGA 4I5QA 1GUHA 4GWRA 2EIQA 4L8EA 2FWFA 2LRNA 1ZGNA 4FH8A 2XC2A 5HFIA 3BD2A 1RQMA 4HI7A 3H8QA 1AC1A 2GQMA 1DE2A 4GF0A 1JZWA 2MMOA 3GH9A 2CX3A 3IC8A 4MMMA 1YQ1A 3IOSA 5AN1A 1GH2A 2GSRA 1NSWA 4GLTA 1GTBA 2R0PA 4ZBAA 4PUFC 1AW9A 1GTAA 2R3XA 1K0BA 5ABRA 3QAVA 2RM5A 3P90A 2J9HA 2DKIA 3FKFA 5J4UA 2KLXA 3MYDA 3HY2A 1PSQA 2LRCA 2C0DA 4EXJA 3QFBC 1R5AA 3TRPA 2AYTA 1AAZA 2E2MA 2GVPA 1BX9A 1TK5B 3F4RA 4HZ4A 1WPIA 1BG5A 1K0DA 2DJ3A 4AGSA 4BA7A 2CAIA 3IXRA 4WXTA 1AQWA 2B5YA 3RDWA 2FY6A 1ZCPA 3LW9A 4PGTA 3R2QA 4FYBA 1V9WA 1B4QA 3Q74A 3IE3A 4MZCA 3TRXA 5IMDA 2M72A 2REMA 4EDYA 3GSTA 3EMPA 1QQ2A 1ABAA 2NBSA 4KH7A 2FA4A 5LNKe 3C7MA 5B7CA 10GSA 3KXOA 3QFAC 1EEJA 2B6MA 3F4SA 4DSRA 7GSSA 2E2GA 3EE2A 3F0IA 4G10A 4NV2A 2DSAA 1MDKA 3L4NA 1HNCA 2VL2A 2DJ1A 1EZKA 2A2RA 2H0HA 3F63A 2MZCA 1XWAA 1BYEA 5C00A 2B7KA 5J5NA 3QOUA 4F0CA 4MF6A 4LL4B 4ZBDA 2QSIA 5CYYA 3APOA 4NV5A 18GSA 1NHOA 3APQA 2DMLA 5JCGA 1YKCA 2LKUA 3BBYA 1GLPA 4TKYA 3LYKA 2H1GA 1XZOA 2K8SA 3ZIJA 1X9SB 2H1DA 3TJJA 2PU9C 4EIQA 4GQCA 1IYHA 2DJ2A 5DJMA 1O73A 5HR3A 1B8XA 1O8XA 2B1KA 4HZ2A 4TRXA 3J7Yb 2EC4A 3PPUA 2RUEA 4AJ7A 5IPGA 2HI7A 3VURA 1QK8A 3GYKA 2C4JA 1SYRA 4K7OA 1O81A 3P2AA 3F3QA 3GSSA 3US3A 3D0ZA 4KF9A 4N0VA 6GSTA 2FCHA 1Y6EA 5A4VA 3KTBA 4KDXA 3CTGA 2DC5A 4V2LA 2JZRA 4MLYA 1ST9A 1Z9HA 2PBJA 3HJMA 2GZZA 4IVFA 5J3RA 3IAM2 2L5LA 4GSTA 5ECHB 4G2EA 4ZL8A 3IC4A 2H66A 2XPDA 2TIRA 2XPEA 2R5GA 4TR1B 2H1AA 2HNLA 1R26A 3TCOA 2G0FA 2KP1A 2H75A 1EWXA 1K0CA 3GNJA 1T4ZA 3J7Yk 5DQYA 4JR4A 2V6KA 2NPBA 2VD1A 3D22A 1GSFA 4F2IA 2X99A 3O76A 3G7YA 2CV4A 2HZEA 4CY8A 3VI7A 2LV3A 2YP6A 2OE3A 4Q5NA 3UIWA 1PN0A 2JU5A 4IHUA 4YAVA 4G9HA 2FHEA 2HXKA 2FWEA 3UOMA 1SJ6A 2HSMA 3EYTA 5H5RA 2AHEA 2I9HA 1YJ6A 17GSA 4HJMA 1TW9A 1A24A 3O3TA 1TTZA 2H73A 1U87A 1GL8A 3ZMKA 5DAKB 4MJEA 3TJBA 4EIPA 4DSSB 5L71A 3RBTA 1GTUA 2OJLA 2RM6A 5CO3A 3GMFA 1FB0A 3VLNA 2I4AA 3GKKA 1XBSA 2ZUPA 1XCCA 4JEDA 3CTFA 4OO5A 1BAYA 3ZMLA 5ECRB 4LA1A 3FMWA 1GSQA 3CSHA 1MEKA 2R0GA 2Z9SA 3DEXA 1EOHA 4YKGA 3F6DA 3A5WA 4FYUA 1XOBA 2VM1A 3DVWA 3GTUB 4JZQA 1X9MB 3P7XA 4EO3A 1SKWB 3M0FA 4MH3A 1FVKA 1GP1A 3APSA 1MDJA 3KZQA 3BCKA 4XIHA 3IK7A 4DEJA 4MJCA 1B9YC 3HVVA 2NDOA 3ZFLA 4IP1A 3DVXA 1SK2A 1FO5A 1BJXA 2YWNA 4EC0A 1LU4A 1VGLA 4MP4A 3CSIA 1A0RP 5G5EA 2ON5A 5KN0A 4MDCA 2C80A 5J9BA 3RHBA 5DBQA 2L6CA 3HCZA 2KP2A 5KN3A 3TKSC 2RLIA 1YZXA 5ECKB 4E8EA 3L9UA 2IL3A 3HA9A 4BPYA 5B8BA 2IJYA 3H79A 2H6XA 2B1LA 4MJAA 3O6TA 3GFKA 4K8MA 4XRDA 5B6MA 5ECLB 5JCUA 1OVNA 4EKZA 1OYJA 1HD2A 1TDIA 4MCUA 3UBLA 4O5RA 1HQOA 2YWMA 3GKMA 1T3BA 2WGRA 3FHKA 2DKHA 4TOPA 1EP8A 4NPBA 3A2WA 2L4QA 3WT1A 5JWRB 1THOA 4NHZA 2M46A 3GRXA 2PERA 3A2VA 3LXTA 1T7PB 4K6XA 5IMVA 3G9BA 1EOGA 4GSSA 2G2QA 5AIXA 2I1UA 3A2XA 1B9XC 4N10A 4MH2A 1AQXA 4E8HA 3TKSE 1SJIA 5IIZA 1LJRA 4HQZA 3FK8A 4MF7A 1EV9A 5GZZB 2AJQB 4GSNA 2H01A 2XBQA 2RUFA 3IBHA 1OKDA 5E59A 2IMEA 3M8NA 4IBPA 4Z7XA 3HYPA 2H6YA 1TRVA 1GSYA 1M99A 1TP9A 3CYNA 1V58A 4J57E 1YEPA 1SU9A 6GSVA 4QL7A 5FT3A 4NXIA 2H70A 3TUEA 4GXZA 1TU8A 4X0XA 3K8NA 2AB6A 5ECNB 3L9SA 1CQGA 1EV4A 4LLRA 1HNAA 3HVSA 2CVDA 3WYWA 1Z3EA 3UARA 1AIUA 1QFNA 2LJAA 3G7JA 2YV7A 4HUAA 4IQAA 4FQUA 2LS5A 2OACA 1R7HA 1BEDA 3TDGA 2WRTA 2A2SA 2GQLA 2V41A 3LGCA 2VL9A 1Q98A 1JFUA 5FWGA 1USBA 3L0HA 2C3QA 1ZYNA 4WF5A 3ZITA 5CREA 1IYIA 5HR2A 4HU7A 4MZWA 1K3OA 5CRHA 4OCEA 2JL4A 1WP0A 5LCZA 1ON4A 1B4PA 1S3AA 1M9BA 4KX4A 4J2FA 2VUPA 1PN9A 3C73A 2KOKA 4MNNA 4N0ZA 3D5JA 5G31A 3ED3A 1NHYA 3EWLA 3IPZA 5ECQB 4ACSA 1UVZA 2LTKA 3RPPA 2FGXA 2CQ9A 1N2AA 4MZBA 1W4VA 2PUKC 1R4WA 1NM3A 2GTUA 6GSWA 4PUAA 5AGYA 3E0UA 3ZVJD 4F03A 3M1GA 2V2GA 4AF2A 4Q5RA 2C0FA 3HD5A 1SKRB 3BJ5A 4IP6A 4BWSA 3EURA 2QA2A 1YF0A 2H76A 1XVWA 3HZ8A 3GA4A 6GSUA 4G0LA 4TR1A 5G1KA 2DJ0A 5JWOB 2A4VA 2C8UA 2H0GA 2OA7A 5F05A 1Z7RA 9GSSA 3TJFA 1F37A 2YJ7A 4KSMA 5DJLA 4CDOA 3ERGA 3GURA 3TKQA 4IJIA 4O32A 2CX4A 1E2YA 1GSEA 2MBSA 4CHSA 3MAKA 2L57A 3IRAA 4GCIA 1VRSD 5G1LA 1S3DA 2EIRA 4PQ1A 2K6VA 3WGXA 1B48A 1PX6A 3F4TA 1HNBA 5ID2B 4X1UA 1QUWA 3UVHA 1GUMA 5J9CA 5F07A 1TJDA 1Z6MA 1JZOA 4BVXB 5DAKA 4EF0A 1OE7A 1ERWA 4ECIA 5KOWA 4O7HA 3RPNA 3LSZA 1PKZA 5CP1A 5GAND 3E3EA 1SJZA 3QMXA 1MD4A 1DSBA 2VCQA 5A5KA 1DUGA 2OE0A 1GUKA 1EGRA 3IAS2 1XIYA 4NWYA 5KEJA 2LJKA 5KN2A 3UBKA 3TB2A 1SL0B 5B8AA 3ERWA 2AAWA 5LD0A 1TXXA 4GRFA 1SK1A 3VI5A 5C04A 5KN1A 5ECMB 1FAAA 1QGVA 1I9DA 3GTUA 3CXGA 5F06A 2ON7A 3JCML 2N5BA 5DCGA 5EY6A 2H8LA 3FR9A 4V2NA 3FW2A 2N5FA 5IMZA 4FO5A 3TJKA 1EP7A 3RHCA 1CQHA 12GSA 3GH6A 3ISOA 3VWWA 3IR4A 3ZLPA 4HOJA 2HSYA 4KCAA 3LEFA 2E7PA 3DWVA 4Q5FA 2DMMA 3U6VA 3VWXA 1MDIA 1GRXA 2IFQA 3TOTA 2O7KA 5EVOA 2YANA 2FA8A 4POKA 5E4WA 2GDRA 3UL3A 5DQSA 3W8JA 4TVEA 1JZRA 4KCEA 5GSSA 1GTIA 3V1WA 5IQYA 4F9ZA 4IW9A 1G0TA 2FWHA 1V40A 4ID0A 1UA5A 2IMKA 4QQ7A 4Z2UA 4XS4B 1ACVA 2GLRA 1YDKA 1XWKA 2BTOT 5COHA 5AISA 3L78A 1SK0A 2GSTA 2HLSA 4IJ3A 4KNDA 4NHWA 2O89A 3IHGA 2XHFA 3R3EA 3TRQA 5G30A 2HT9A 3C8EA 4TXOB 3IV4A 1TKDB 2VO4A 3DIEA 1KBNA 2K8VA 3QDNA 1URMA 2UZ8A 1PMTA 2PGTA 5G5FA 8GSSA 2FLSA 2ZCTA 1DBYA 2C3TA 1XWBA 4IKHA 3DRNA 1X9WB 2L5OA 3L9VA 2B3SA 2O87A 6GSYA 4NAXA 2LNTA 2NTOA 3IK9A 4JE1A 2VOCA 1XWCA 2BJXA 4Z2TA 3LG6A 4K0NA 2JZTA 3UVTA 2I81A 4PURA 3EC3A 1W89A 3UJ1A 2P0GA 4ZB8A 1PL2A 1XVQA 5HFGA 1K0NA 3QCPA 1PRXA 2VIMA 3TJGA 4BVYB 3Q6OA 2H30A 5HQPA 2VL3A 3VPTA 5IMFA 4WR4A 1Y25A 3A5IA 4PNGA 1RK4A 2C3NA 1QMVA 1E6BA 1M2BA 2MMZA 4KW6A 3CRUA 1FOHA 4IN0A 3QAGA 2WULA 3GKXA 3LJRA 1XW9A 3W6GA 1PGTA 4XS1A 1J0FA 3LXZA 3QR6A 1WMJA 4I97A 3EVIA 1THXA 2CVKA 2IMFA 5ELGA 1TRWA 5JWQB 1RW1A 5ECSA 1XXUA 3I6AA 2IN3A 1FW1A 2A4HA 3LQ7A 4KGIA 5B6NA 2H6ZA 4K2DA 1TRUA 2OKAA 2LQQA 3D21A 4ISDA 3C71A 1G6WA 3FRCA 3ZZXA 2R0CA 1F3BA 4MF5A 2H0IA 5ECOB 4DSQA 3ZFBA 4WEYA 2WB9A 1PX7A 3KMOA 2HRKA 4HEA2 2JACA 3ERFA 1NW2A 3KCMA 3KH7A 3EPTA 1U88A 4XS6A 2K9FA 2GZPA 4USSA 3ME7A 3KD0A 2NVLA 3D6IA 4AJ8A 5IOXA 5G2ZA 2JADA 1JZDA 4EE0A 5IOWA 4K7NA 4POLA 2R6KA 4K9ZA 1BQ7A 3TKPA 2P5RA 2YZUA 3DD3A 1Z6NA 1M2DA 1XW5A 1SL2B 2F8FA 3FZ5A 4MABA 2L6DA 4KDUA 4TR4A 3H4KA 4L0UA 2MBTA 1U6TA 5H5SA 1EEMA 1SL1B 4LMWA 4X43A 4PQHA 3M3MA 4POBA 4WBJA 4ECJA 1LBKA 2X49A 1V57A 2P5QA 2PVQA 2HRAA 1FVJA 3D4TA 2HE3A 1AXDA 5ID2A 1GSDA 1XW6A 2O85A 4X4JA 4RI6A 2HRFA 4RQXA 3H1NA 1Z7PA 4YQUA 3QPMA 4KSOA 2PPTA 4MA9A 4BVXA 4I2TA 2VCZA 1T00A 2F8AA 3UMAA 4OCFA 2PVOC 3HJPA 3M9KA 2OADA 2WFCA 2R4VA 1PQNA 4EUYA 3SBCA 1TU7A 2XBIA 4KA0A 1Q4JA 2X8HA 2VCWA 3SWLA 1SD9A 3ZIVA 2A2PA 2CVBA 4YAPA 2AV4A 5HR1A 2OBKA 2V6OA 1PD21 1X5CA 3LYPA 3GUSA 1H75A 3N9JA 3DXBA 4K5SA 2HZFA 2BMXA 4CY6A 4POMA 14GSA 2JZSA 2ALBA 5DDLA 2VCVA 4XTSA 1M0UA 2LSTA 4L5OA 2QGVA 1O6JA 2X4AA 5CRDA 2PN8A 1V2AA 3GHAA 1OC9B 1T1VA 3Q19A 4D73B 5D9TA 2LUSA 3C1RA 1JLWA 1PKWA 3UEMA 1S3CA 6GSXA 3GL5A 1GLQA 1PL1A 1OE8A 3WD6A 1QXHA 4RI7A 2DIZA 3MNGA 1ZOFA 3DKSA 3CSJA 5D9WA 1XOAA 2VLUA 2X8CA 2F51A 2FD3A 4FYCA 4Z2RA 4I6XA 2H74A 2LRTA 2YJHA 3IA1A 1GSUA 3KP8A 2D2ZA 4MPFA 4K1FA 2YCDA 3FZ9A 4YQVA 3NZNA 4RUVA 5DVBA 1EGOA 1WRYA 2V32A 1SKSB 2GT6A 3ZVJA 1OC3A 3HZ4A 4XS4A 5IM9A 5DALB 3TKRA 4KDYA 2ZNMA 1WOUA 2IIYA 1ILOA 2GS3A 2IMDA 4ZIJA 4MPGA 2VAFA 1GNWA 1A2JA 4L5LA 22GSA 2N5AA 2YWOA 2YPMA 1TI3A 1O7UA 4TXOA 1PA3A 3LORA 1TK8B 4BL7B 3MSZA 3GX8A 3ZRDA 20GSA 2ES7A 3OR5A 2GT5A 1T8EB 5FHIA 4ML1A 2L59A 5DCHA 5IMCA 3TOUA 2OBIA 3W8SA 4AJ6A 2L4CA 3HJOA 3EMXA 2YV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AQV A;  4DSS A;  1TOF A;  1SD8 A;  4PQI A;  4IS0 A;  4WF4 A;  4OFM A;  1R5P A;  3VWU A;  16GS A;  1TI1 A;  1G6Y A;  4ILF A;  4OFT A;  3GKN A;  3HDC A;  13GS A;  1K3L A;  3GV1 A;  2P31 A;  4HU9 A;  1YF1 A;  2DBC A;  2WZ9 A;  4YH2 A;  1ZL9 A;  4KUN A;  2J23 A;  2HSH A;  3DML A;  4PNF A;  4ZBB A;  4JR6 A;  2V1M A;  5J41 A;  4GQF A;  4BVY A;  3VWV A;  4F0B A;  1ERU A;  4OFN A;  2R37 A;  3EU3 A;  1T4Y A;  4L0W A;  4F82 A;  2AUV A;  5D9X A;  2DJJ A;  1Z5Y E;  4N11 A;  4KB3 A;  2EIO A;  4IQ1 A;  5D8I A;  2C0G A;  2VD0 A;  4LMV A;  5HR0 A;  1M2A A;  3F6F A;  2VL2 C;  4K0G A;  4WBR D;  1X5E A;  1MTC A;  1ZMA A;  4DVC A;  1K0O A;  1GNE A;  1F2E A;  4OO4 A;  4PXO A;  2LEG A;  1FHE A;  5EL8 A;  2M80 A;  19GS A;  2KHP A;  2RII A;  5INY A;  4N30 A;  1VF4 A;  2VCT A;  4I8B A;  5ECI B;  3WT2 A;  3DYR A;  2QKE A;  2B5X A;  3FR6 A;  4K7I A;  3H93 A;  1A0F A;  2E0Q A;  2QC7 A;  1FB6 A;  4G19 A;  2TRX A;  5A4W A;  4V1A p;  1X0R A;  1G7E A;  3IHQ A;  2GZY A;  3GN3 A;  1O85 A;  3ZL5 A;  3KIJ A;  3PH9 A;  2WS2 A;  2X8G A;  1A8L A;  1XPV A;  1F3A A;  4EVM A;  4ZL9 A;  4IGJ A;  3VPQ A;  1TRS A;  4ECC A;  4ULX A;  3C1S A;  2I3Y A;  3S9F A;  2X64 A;  2WJU A;  5ENU A;  4ZB9 A;  3PR8 A;  1K0A A;  5CRW A;  1A8Y A;  4WR5 A;  2C0E A;  4OD7 A;  3CBU A;  4OWY A;  2GSQ A;  4JRR A;  3U5R E;  2IWT A;  2PWJ A;  3PGT A;  3KEB A;  5CRG A;  1ML6 A;  2DIY A;  2MYG A;  3KGK A;  1XFL A;  5F8B A;  3KTL A;  2JSZ A;  3F9U A;  3VK9 A;  2H1B A;  2YZH A;  3N5O A;  3P8W A;  3M9J A;  2KUC A;  1HYU A;  1FOV A;  3MDK A;  4WET A;  3ZTL A;  1J08 A;  3I69 A;  5JCW A;  1A23 A;  1ERT A;  1K3Y A;  4PX1 A;  2H71 A;  3G7I A;  2VM2 A;  2FWG A;  4TN8 A;  1M9A A;  4KAE A;  4V2M A;  2OE1 A;  3ZRE A;  4BWQ A;  5D73 A;  4XRA A;  2C1Y A;  1TK0 B;  3FY7 A;  1KNG A;  3WGE A;  1KTE A;  3BOA A;  2WDU A;  3F8U A;  2WCI A;  2H72 A;  3KJY A;  1WIK A;  3CMI A;  3EU4 A;  4LL1 B;  3KP9 A;  2K18 A;  2B7J A;  2YOI A;  3Q18 A;  3HKR A;  5GAP D;  3FZA A;  3D4M A;  1SYX A;  3LWA A;  3TKS A;  4P3Y B;  4MK3 A;  4O92 A;  1OAZ A;  4JU5 A;  1DE1 A;  2PMT A;  2LJR A;  4I2U A;  1N8J A;  3A3T A;  3F3R A;  3NOF A;  4Q5Q A;  3I43 A;  1JHB A;  1YEX A;  2VLV A;  1ERV A;  5D96 A;  1OC9 A;  2GQK A;  4EL1 A;  4ZIL A;  1MD3 A;  4D73 A;  5IPH A;  4YQM A;  1YKA A;  3I9V 2;  1OC8 A;  2GSS A;  1G7O A;  3MWH A;  2GGT A;  2HFD A;  2IPA A;  5CNW A;  1M7T A;  2VCX A;  1OKT A;  4TR3 A;  1AUC A;  3CRT A;  1U3I A;  1XWG A;  1U3A A;  2CAQ A;  5ECP B;  3BCI A;  5D9V A;  2IFQ B;  1UN2 A;  2MMA A;  1J9B A;  2H19 A;  3KMN A;  4EDZ A;  5CAX A;  3GIX A;  1A2L A;  5EPF A;  4HQS A;  3VFI A;  4KE3 A;  1WE0 A;  4IEL A;  2CT6 A;  5AIV A;  3RAZ A;  4NMU A;  2R2J A;  1A2M A;  1K0M A;  4HS1 A;  1C72 A;  4ZL7 A;  4H86 A;  1VF2 A;  4J56 E;  2IMI A;  4RQR A;  4TW5 A;  3HXS A;  1O8W A;  3GL3 A;  4XCS A;  2MMN A;  3UAP A;  1I5G A;  5DAL A;  1SEN A;  2VLT A;  2TRC P;  3FR3 A;  2HZE B;  2CA8 A;  5IO2 A;  2YNX A;  1GSS A;  5A4U A;  3GX0 A;  4ECB A;  3DGQ A;  3LFL A;  3IDV A;  2O8V B;  4BL7 A;  5F0G A;  2DLX A;  5GST A;  2JSY A;  3HVX A;  1VF1 A;  2HRN A;  1ZZY A;  4HDE A;  4TXV A;  1KEB A;  3FEU A;  4TR0 A;  1F9M A;  2FUG 2;  1GWC A;  5H5Q A;  4JBB A;  1FG4 A;  2B5E A;  4CW9 A;  4ML6 A;  2YN1 A;  3E9J B;  2F3M A;  1ZYE A;  3QD9 A;  3KM6 A;  4XHM A;  4FIW A;  5IO0 A;  3PIN A;  5D93 A;  4HJ2 A;  2FNO A;  3FYG A;  3AY8 A;  1X5D A;  1UC7 A;  2CZ2 A;  3QAW A;  2F9S A;  3WGD A;  2CZ3 A;  3TGZ A;  1YY7 A;  2DJK A;  2LNS A;  1H4O A;  5ELA A;  2YWI A;  2LQO A;  3ZYW A;  5IMA A;  4MJB A;  1JLV A;  5HFK A;  1VF3 A;  6GSS A;  11GS A;  3KH9 A;  4QL9 A;  1ZYQ B;  3HHV A;  1WJK A;  1V98 A;  3ME8 A;  4V1A g;  3NIV A;  4OMV A;  4WKW A;  1WWJ A;  1F6M C;  3EIN A;  4ZB6 A;  4GTU A;  1GUL A;  3FZ4 A;  2HYX A;  4ZXG A;  4I5Q A;  1GUH A;  4GWR A;  2EIQ A;  4L8E A;  2FWF A;  2LRN A;  1ZGN A;  4FH8 A;  2XC2 A;  5HFI A;  3BD2 A;  1RQM A;  4HI7 A;  3H8Q A;  1AC1 A;  2GQM A;  1DE2 A;  4GF0 A;  1JZW A;  2MMO A;  3GH9 A;  2CX3 A;  4MMM A;  1YQ1 A;  3IOS A;  5AN1 A;  1GH2 A;  2GSR A;  1NSW A;  4GLT A;  1GTB A;  4ZBA A;  4PUF C;  1AW9 A;  1GTA A;  2R3X A;  1K0B A;  5ABR A;  3QAV A;  2RM5 A;  3P90 A;  2J9H A;  3FKF A;  5J4U A;  2KLX A;  3HY2 A;  1PSQ A;  2LRC A;  2C0D A;  4EXJ A;  3QFB C;  1R5A A;  3TRP A;  2AYT A;  1AAZ A;  2E2M A;  2GVP A;  1BX9 A;  1TK5 B;  3F4R A;  4HZ4 A;  1WPI A;  1BG5 A;  1K0D A;  2DJ3 A;  4AGS A;  4BA7 A;  2CAI A;  3IXR A;  4WXT A;  1AQW A;  2B5Y A;  3RDW A;  2FY6 A;  1ZCP A;  4PGT A;  3R2Q A;  4FYB A;  1V9W A;  1B4Q A;  3Q74 A;  3IE3 A;  4MZC A;  3TRX A;  5IMD A;  2M72 A;  2REM A;  4EDY A;  3GST A;  3EMP A;  1QQ2 A;  1ABA A;  2NBS A;  4KH7 A;  2FA4 A;  5LNK e;  3C7M A;  5B7C A;  10GS A;  3KXO A;  3QFA C;  1EEJ A;  2B6M A;  3F4S A;  4DSR A;  7GSS A;  2E2G A;  3EE2 A;  3F0I A;  4G10 A;  4NV2 A;  2DSA A;  1MDK A;  3L4N A;  1HNC A;  2VL2 A;  2DJ1 A;  1EZK A;  2A2R A;  2H0H A;  3F63 A;  2MZC A;  1XWA A;  1BYE A;  5C00 A;  2B7K A;  5J5N A;  3QOU A;  4F0C A;  4MF6 A;  4LL4 B;  4ZBD A;  2QSI A;  5CYY A;  3APO A;  4NV5 A;  18GS A;  1NHO A;  3APQ A;  2DML A;  5JCG A;  1YKC A;  2LKU A;  3BBY A;  1GLP A;  4TKY A;  3LYK A;  2H1G A;  1XZO A;  2K8S A;  3ZIJ A;  1X9S B;  2H1D A;  3TJJ A;  2PU9 C;  4GQC A;  1IYH A;  2DJ2 A;  5DJM A;  1O73 A;  5HR3 A;  1B8X A;  1O8X A;  2B1K A;  4HZ2 A;  4TRX A;  3J7Y b;  2EC4 A;  2RUE A;  4AJ7 A;  5IPG A;  2HI7 A;  3VUR A;  1QK8 A;  3GYK A;  2C4J A;  1SYR A;  4K7O A;  1O81 A;  3P2A A;  3F3Q A;  3GSS A;  3US3 A;  3D0Z A;  4N0V A;  6GST A;  2FCH A;  1Y6E A;  5A4V A;  3KTB A;  4KDX A;  3CTG A;  2DC5 A;  4V2L A;  2JZR A;  4MLY A;  1ST9 A;  1Z9H A;  2PBJ A;  3HJM A;  2GZZ A;  4IVF A;  5J3R A;  3IAM 2;  2L5L A;  4GST A;  5ECH B;  4G2E A;  4ZL8 A;  3IC4 A;  2H66 A;  2XPD A;  2TIR A;  2XPE A;  2R5G A;  4TR1 B;  2H1A A;  2HNL A;  1R26 A;  3TCO A;  2G0F A;  2KP1 A;  2H75 A;  1EWX A;  1K0C A;  3GNJ A;  1T4Z A;  3J7Y k;  5DQY A;  4JR4 A;  2V6K A;  2NPB A;  2VD1 A;  3D22 A;  1GSF A;  4F2I A;  2X99 A;  3O76 A;  3G7Y A;  2CV4 A;  2HZE A;  3VI7 A;  2LV3 A;  2YP6 A;  2OE3 A;  4Q5N A;  3UIW A;  2JU5 A;  4IHU A;  4YAV A;  4G9H A;  2FHE A;  2HXK A;  2FWE A;  3UOM A;  1SJ6 A;  3EYT A;  5H5R A;  2AHE A;  2I9H A;  1YJ6 A;  17GS A;  4HJM A;  1TW9 A;  1A24 A;  3O3T A;  1TTZ A;  2H73 A;  1U87 A;  1GL8 A;  3ZMK A;  5DAK B;  4MJE A;  3TJB A;  4DSS B;  5L71 A;  3RBT A;  1GTU A;  2OJL A;  2RM6 A;  5CO3 A;  3GMF A;  1FB0 A;  3VLN A;  2I4A A;  3GKK A;  1XBS A;  2ZUP A;  1XCC A;  4JED A;  3CTF A;  4OO5 A;  1BAY A;  3ZML A;  5ECR B;  4LA1 A;  1GSQ A;  3CSH A;  1MEK A;  2Z9S A;  3DEX A;  1EOH A;  3F6D A;  3A5W A;  4FYU A;  1XOB A;  2VM1 A;  3DVW A;  3GTU B;  4JZQ A;  1X9M B;  3P7X A;  4EO3 A;  1SKW B;  3M0F A;  4MH3 A;  1FVK A;  1GP1 A;  3APS A;  1MDJ A;  3KZQ A;  3BCK A;  4XIH A;  3IK7 A;  4DEJ A;  4MJC A;  1B9Y C;  3HVV A;  2NDO A;  3ZFL A;  4IP1 A;  3DVX A;  1SK2 A;  1FO5 A;  1BJX A;  2YWN A;  4EC0 A;  1LU4 A;  1VGL A;  4MP4 A;  3CSI A;  1A0R P;  5G5E A;  2ON5 A;  5KN0 A;  4MDC A;  2C80 A;  5J9B A;  3RHB A;  5DBQ A;  2L6C A;  3HCZ A;  2KP2 A;  5KN3 A;  3TKS C;  2RLI A;  1YZX A;  5ECK B;  4E8E A;  3L9U A;  2IL3 A;  3HA9 A;  4BPY A;  5B8B A;  2IJY A;  3H79 A;  2H6X A;  2B1L A;  4MJA A;  3O6T A;  3GFK A;  4K8M A;  4XRD A;  5B6M A;  5ECL B;  5JCU A;  1OVN A;  4EKZ A;  1OYJ A;  1HD2 A;  1TDI A;  4MCU A;  3UBL A;  4O5R A;  1HQO A;  2YWM A;  3GKM A;  1T3B A;  2WGR A;  3FHK A;  4TOP A;  1EP8 A;  4NPB A;  3A2W A;  2L4Q A;  3WT1 A;  5JWR B;  1THO A;  4NHZ A;  2M46 A;  3GRX A;  2PER A;  3A2V A;  3LXT A;  1T7P B;  4K6X A;  5IMV A;  3G9B A;  1EOG A;  4GSS A;  2G2Q A;  5AIX A;  2I1U A;  3A2X A;  1B9X C;  4N10 A;  4MH2 A;  1AQX A;  4E8H A;  3TKS E;  1SJI A;  5IIZ A;  1LJR A;  4HQZ A;  3FK8 A;  4MF7 A;  1EV9 A;  5GZZ B;  2AJQ B;  4GSN A;  2H01 A;  2XBQ A;  2RUF A;  3IBH A;  1OKD A;  5E59 A;  2IME A;  3M8N A;  4IBP A;  4Z7X A;  3HYP A;  2H6Y A;  1TRV A;  1GSY A;  1M99 A;  1TP9 A;  3CYN A;  1V58 A;  4J57 E;  1YEP A;  1SU9 A;  6GSV A;  4QL7 A;  5FT3 A;  4NXI A;  2H70 A;  3TUE A;  4GXZ A;  1TU8 A;  4X0X A;  3K8N A;  2AB6 A;  5ECN B;  3L9S A;  1CQG A;  1EV4 A;  4LLR A;  1HNA A;  3HVS A;  2CVD A;  3WYW A;  1Z3E A;  3UAR A;  1AIU A;  1QFN A;  2LJA A;  3G7J A;  2YV7 A;  4HUA A;  4IQA A;  2LS5 A;  2OAC A;  1R7H A;  1BED A;  3TDG A;  2WRT A;  2A2S A;  2GQL A;  2V41 A;  3LGC A;  2VL9 A;  1Q98 A;  1JFU A;  5FWG A;  1USB A;  3L0H A;  2C3Q A;  4WF5 A;  3ZIT A;  5CRE A;  1IYI A;  5HR2 A;  4HU7 A;  4MZW A;  1K3O A;  5CRH A;  4OCE A;  2JL4 A;  1WP0 A;  5LCZ A;  1ON4 A;  1B4P A;  1S3A A;  1M9B A;  4KX4 A;  4J2F A;  2VUP A;  1PN9 A;  3C73 A;  2KOK A;  4N0Z A;  3D5J A;  5G31 A;  3ED3 A;  1NHY A;  3EWL A;  3IPZ A;  5ECQ B;  4ACS A;  1UVZ A;  2LTK A;  3RPP A;  2FGX A;  2CQ9 A;  1N2A A;  4MZB A;  1W4V A;  2PUK C;  1R4W A;  1NM3 A;  2GTU A;  6GSW A;  4PUA A;  5AGY A;  3E0U A;  3ZVJ D;  4F03 A;  3M1G A;  2V2G A;  4AF2 A;  4Q5R A;  2C0F A;  3HD5 A;  1SKR B;  3BJ5 A;  4IP6 A;  4BWS A;  3EUR A;  1YF0 A;  2H76 A;  1XVW A;  3HZ8 A;  3GA4 A;  6GSU A;  4TR1 A;  5G1K A;  2DJ0 A;  5JWO B;  2A4V A;  2C8U A;  2H0G A;  2OA7 A;  5F05 A;  1Z7R A;  9GSS A;  3TJF A;  1F37 A;  2YJ7 A;  4KSM A;  5DJL A;  4CDO A;  3ERG A;  3GUR A;  3TKQ A;  4IJI A;  4O32 A;  2CX4 A;  1E2Y A;  1GSE A;  2MBS A;  4CHS A;  3MAK A;  2L57 A;  3IRA A;  4GCI A;  1VRS D;  5G1L A;  1S3D A;  2EIR A;  4PQ1 A;  2K6V A;  3WGX A;  1B48 A;  1PX6 A;  3F4T A;  1HNB A;  5ID2 B;  4X1U A;  1QUW A;  3UVH A;  1GUM A;  5J9C A;  5F07 A;  1TJD A;  1Z6M A;  1JZO A;  5DAK A;  4EF0 A;  1OE7 A;  1ERW A;  4ECI A;  4O7H A;  3RPN A;  3LSZ A;  1PKZ A;  5CP1 A;  5GAN D;  3E3E A;  1SJZ A;  3QMX A;  1MD4 A;  1DSB A;  2VCQ A;  5A5K A;  1DUG A;  2OE0 A;  1GUK A;  1EGR A;  3IAS 2;  1XIY A;  4NWY A;  5KEJ A;  2LJK A;  5KN2 A;  3UBK A;  3TB2 A;  1SL0 B;  5B8A A;  3ERW A;  2AAW A;  5LD0 A;  1TXX A;  4GRF A;  1SK1 A;  3VI5 A;  5C04 A;  5KN1 A;  5ECM B;  1FAA A;  1QGV A;  1I9D A;  3GTU A;  3CXG A;  5F06 A;  2ON7 A;  3JCM L;  2N5B A;  5DCG A;  5EY6 A;  2H8L A;  3FR9 A;  4V2N A;  3FW2 A;  2N5F A;  5IMZ A;  4FO5 A;  3TJK A;  1EP7 A;  3RHC A;  1CQH A;  12GS A;  3GH6 A;  3ISO A;  3VWW A;  3IR4 A;  3ZLP A;  4HOJ A;  2HSY A;  4KCA A;  3LEF A;  2E7P A;  3DWV A;  4Q5F A;  2DMM A;  3U6V A;  3VWX A;  1MDI A;  1GRX A;  2IFQ A;  3TOT A;  2O7K A;  5EVO A;  2YAN A;  2FA8 A;  4POK A;  5E4W A;  2GDR A;  3UL3 A;  5DQS A;  3W8J A;  4TVE A;  1JZR A;  4KCE A;  5GSS A;  1GTI A;  3V1W A;  5IQY A;  4F9Z A;  4IW9 A;  1G0T A;  2FWH A;  1V40 A;  4ID0 A;  1UA5 A;  2IMK A;  4QQ7 A;  4XS4 B;  1ACV A;  2GLR A;  1YDK A;  1XWK A;  2BTO T;  5COH A;  5AIS A;  3L78 A;  1SK0 A;  2GST A;  2HLS A;  4IJ3 A;  4KND A;  4NHW A;  2O89 A;  2XHF A;  3TRQ A;  5G30 A;  2HT9 A;  3C8E A;  4TXO B;  3IV4 A;  1TKD B;  2VO4 A;  3DIE A;  1KBN A;  2K8V A;  3QDN A;  1URM A;  1PMT A;  2PGT A;  5G5F A;  8GSS A;  2FLS A;  2ZCT A;  1DBY A;  2C3T A;  1XWB A;  4IKH A;  3DRN A;  1X9W B;  2L5O A;  3L9V A;  2B3S A;  2O87 A;  6GSY A;  4NAX A;  2LNT A;  2NTO A;  3IK9 A;  4JE1 A;  2VOC A;  1XWC A;  2BJX A;  3LG6 A;  4K0N A;  2JZT A;  3UVT A;  2I81 A;  4PUR A;  3EC3 A;  1W89 A;  3UJ1 A;  2P0G A;  4ZB8 A;  1PL2 A;  1XVQ A;  5HFG A;  1K0N A;  3QCP A;  1PRX A;  2VIM A;  3TJG A;  3Q6O A;  2H30 A;  5HQP A;  2VL3 A;  3VPT A;  5IMF A;  4WR4 A;  1Y25 A;  4PNG A;  1RK4 A;  2C3N A;  1QMV A;  1E6B A;  1M2B A;  2MMZ A;  4KW6 A;  3CRU A;  4IN0 A;  3QAG A;  2WUL A;  3GKX A;  3LJR A;  1XW9 A;  3W6G A;  1PGT A;  4XS1 A;  1J0F A;  3LXZ A;  3QR6 A;  1WMJ A;  4I97 A;  3EVI A;  1THX A;  2CVK A;  2IMF A;  5ELG A;  1TRW A;  5JWQ B;  1RW1 A;  5ECS A;  1XXU A;  3I6A A;  2IN3 A;  1FW1 A;  3LQ7 A;  4KGI A;  5B6N A;  2H6Z A;  4K2D A;  1TRU A;  2OKA A;  2LQQ A;  3D21 A;  4ISD A;  3C71 A;  1G6W A;  3FRC A;  3ZZX A;  1F3B A;  4MF5 A;  2H0I A;  5ECO B;  4DSQ A;  3ZFB A;  4WEY A;  2WB9 A;  1PX7 A;  3KMO A;  4HEA 2;  2JAC A;  3ERF A;  1NW2 A;  3KCM A;  3KH7 A;  1U88 A;  4XS6 A;  2K9F A;  2GZP A;  3ME7 A;  3KD0 A;  2NVL A;  3D6I A;  4AJ8 A;  5IOX A;  5G2Z A;  2JAD A;  1JZD A;  4EE0 A;  5IOW A;  4K7N A;  4POL A;  2R6K A;  4K9Z A;  1BQ7 A;  3TKP A;  2P5R A;  2YZU A;  3DD3 A;  1Z6N A;  1M2D A;  1XW5 A;  1SL2 B;  2F8F A;  3FZ5 A;  4MAB A;  2L6D A;  4KDU A;  4TR4 A;  3H4K A;  4L0U A;  2MBT A;  1U6T A;  5H5S A;  1EEM A;  1SL1 B;  4LMW A;  4X43 A;  4PQH A;  3M3M A;  4POB A;  4WBJ A;  4ECJ A;  1LBK A;  1V57 A;  2P5Q A;  2PVQ A;  1FVJ A;  3D4T A;  2HE3 A;  1AXD A;  5ID2 A;  1GSD A;  1XW6 A;  2O85 A;  4RI6 A;  2HRF A;  4RQX A;  3H1N A;  1Z7P A;  4YQU A;  3QPM A;  4KSO A;  2PPT A;  4MA9 A;  4BVX A;  4I2T A;  2VCZ A;  1T00 A;  2F8A A;  3UMA A;  4OCF A;  2PVO C;  3HJP A;  3M9K A;  2OAD A;  2WFC A;  2R4V A;  1PQN A;  4EUY A;  3SBC A;  1TU7 A;  2XBI A;  4KA0 A;  1Q4J A;  2X8H A;  2VCW A;  3SWL A;  1SD9 A;  3ZIV A;  2CVB A;  4YAP A;  2AV4 A;  5HR1 A;  2OBK A;  2V6O A;  1PD2 1;  1X5C A;  3LYP A;  3GUS A;  1H75 A;  3N9J A;  3DXB A;  2HZF A;  2BMX A;  4POM A;  14GS A;  2JZS A;  2ALB A;  5DDL A;  2VCV A;  4XTS A;  1M0U A;  2LST A;  4L5O A;  2QGV A;  1O6J A;  5CRD A;  2PN8 A;  1V2A A;  3GHA A;  1OC9 B;  1T1V A;  3Q19 A;  4D73 B;  5D9T A;  2LUS A;  3C1R A;  1JLW A;  1PKW A;  3UEM A;  1S3C A;  6GSX A;  3GL5 A;  1GLQ A;  1PL1 A;  1OE8 A;  3WD6 A;  1QXH A;  4RI7 A;  2DIZ A;  3MNG A;  1ZOF A;  3DKS A;  3CSJ A;  5D9W A;  1XOA A;  2VLU A;  2X8C A;  2F51 A;  2FD3 A;  4FYC A;  4I6X A;  2H74 A;  2LRT A;  2YJH A;  3IA1 A;  1GSU A;  3KP8 A;  2D2Z A;  4MPF A;  4K1F A;  2YCD A;  3FZ9 A;  4YQV A;  3NZN A;  4RUV A;  5DVB A;  1EGO A;  1WRY A;  2V32 A;  1SKS B;  2GT6 A;  3ZVJ A;  1OC3 A;  3HZ4 A;  4XS4 A;  5IM9 A;  5DAL B;  3TKR A;  4KDY A;  2ZNM A;  1WOU A;  2IIY A;  1ILO A;  2GS3 A;  2IMD A;  4ZIJ A;  4MPG A;  2VAF A;  1GNW A;  1A2J A;  4L5L A;  22GS A;  2N5A A;  2YWO A;  2YPM A;  1TI3 A;  1O7U A;  4TXO A;  1PA3 A;  3LOR A;  1TK8 B;  3MSZ A;  3GX8 A;  3ZRD A;  20GS A;  2ES7 A;  3OR5 A;  2GT5 A;  1T8E B;  5FHI A;  4ML1 A;  2L59 A;  5DCH A;  5IMC A;  3TOU A;  2OBI A;  3W8S A;  4AJ6 A;  2L4C A;  3HJO A;  3EMX A;  2YV9 A; 
#chains in the Genus database with same CATH topology
 1AQV A;  4DSS A;  1TOF A;  1SD8 A;  4PQI A;  4IS0 A;  4WF4 A;  4OFM A;  1R5P A;  3VWU A;  16GS A;  1TI1 A;  1G6Y A;  4ILF A;  4OFT A;  3GKN A;  3HDC A;  13GS A;  1K3L A;  3GV1 A;  2P31 A;  4HU9 A;  1YF1 A;  2DBC A;  2WZ9 A;  4YH2 A;  1ZL9 A;  4KUN A;  2J23 A;  2HSH A;  3DML A;  4PNF A;  4ZBB A;  4JR6 A;  2V1M A;  5J41 A;  4GQF A;  4BVY A;  3VWV A;  4F0B A;  1ERU A;  4OFN A;  2R37 A;  3EU3 A;  1T4Y A;  4L0W A;  4F82 A;  2AUV A;  5D9X A;  2DJJ A;  1Z5Y E;  4N11 A;  4KB3 A;  2EIO A;  4IQ1 A;  5D8I A;  2C0G A;  2VD0 A;  4LMV A;  5HR0 A;  1M2A A;  3F6F A;  2VL2 C;  4O5Q A;  4K0G A;  4WBR D;  1X5E A;  1MTC A;  1ZMA A;  4DVC A;  1K0O A;  1GNE A;  1F2E A;  4OO4 A;  4PXO A;  2LEG A;  1FHE A;  5EL8 A;  4G0I A;  2M80 A;  19GS A;  2KHP A;  2RII A;  5INY A;  4N30 A;  1VF4 A;  2VCT A;  4I8B A;  5ECI B;  3WT2 A;  3DYR A;  2QKE A;  2B5X A;  3FR6 A;  4K7I A;  3H93 A;  1A0F A;  2E0Q A;  2QC7 A;  4BIK A;  1FB6 A;  4G19 A;  2TRX A;  5A4W A;  4V1A p;  1X0R A;  1G7E A;  3IHQ A;  2GZY A;  3GN3 A;  1O85 A;  3ZL5 A;  3KIJ A;  3PH9 A;  2WS2 A;  2X8G A;  1A8L A;  1XPV A;  1F3A A;  4EVM A;  4ZL9 A;  4IGJ A;  3VPQ A;  1TRS A;  4ECC A;  4ULX A;  3C1S A;  2I3Y A;  3S9F A;  2X64 A;  2WJU A;  5ENU A;  4ZB9 A;  4PTS A;  3PR8 A;  1K0A A;  5CRW A;  1A8Y A;  4WR5 A;  2C0E A;  4OD7 A;  4A5P A;  3CBU A;  4OWY A;  2GSQ A;  4JRR A;  3U5R E;  2IWT A;  2PWJ A;  3PGT A;  3KEB A;  5CRG A;  1ML6 A;  2DIY A;  2MYG A;  3KGK A;  1XFL A;  5F8B A;  3KTL A;  2JSZ A;  3F9U A;  3VK9 A;  2H1B A;  2YZH A;  3N5O A;  3P8W A;  3M9J A;  4K2X A;  2KUC A;  1HYU A;  1FOV A;  3MDK A;  4WET A;  3ZTL A;  1J08 A;  3I69 A;  5JCW A;  1A23 A;  1ERT A;  1K3Y A;  4PX1 A;  2H71 A;  3G7I A;  2VM2 A;  4G0K A;  2FWG A;  4TN8 A;  1M9A A;  4KAE A;  4V2M A;  2OE1 A;  3ZRE A;  4BWQ A;  5D73 A;  4XRA A;  2C1Y A;  1TK0 B;  5BMU A;  3FY7 A;  1KNG A;  3WGE A;  1KTE A;  3BOA A;  2WDU A;  3F8U A;  2WCI A;  2H72 A;  3KJY A;  1WIK A;  3CMI A;  3EU4 A;  4LL1 B;  3KP9 A;  2K18 A;  2B7J A;  2YOI A;  3Q18 A;  3HKR A;  5GAP D;  3FZA A;  3D4M A;  1SYX A;  3LWA A;  3TKS A;  4P3Y B;  4MK3 A;  4O92 A;  1OAZ A;  1XG8 A;  4JU5 A;  1DE1 A;  2PMT A;  2LJR A;  4I2U A;  1N8J A;  3A3T A;  3F3R A;  3NOF A;  4Q5Q A;  3I43 A;  1JHB A;  1YEX A;  2VLV A;  1ERV A;  5D96 A;  1OC9 A;  2GQK A;  4EL1 A;  4ZIL A;  1MD3 A;  4D73 A;  5IPH A;  4YQM A;  1YKA A;  3I9V 2;  1OC8 A;  2GSS A;  1G7O A;  3MWH A;  2GGT A;  2HFD A;  2IPA A;  5CNW A;  1M7T A;  2VCX A;  1OKT A;  4TR3 A;  1AUC A;  3CRT A;  1U3I A;  1XWG A;  1U3A A;  3MIX A;  2CAQ A;  5ECP B;  3BCI A;  5D9V A;  2IFQ B;  1UN2 A;  2MMA A;  1J9B A;  2H19 A;  3KMN A;  4YKF A;  4EDZ A;  5CAX A;  3GIX A;  1A2L A;  5BRT A;  5EPF A;  4HQS A;  3VFI A;  4KE3 A;  1WE0 A;  4IEL A;  4K5R A;  2CT6 A;  2QA1 A;  5AIV A;  3RAZ A;  4NMU A;  2R2J A;  1A2M A;  1K0M A;  4HS1 A;  1C72 A;  1ZYP A;  4ZL7 A;  4H86 A;  1VF2 A;  4J56 E;  2IMI A;  4RQR A;  4TW5 A;  3HXS A;  1O8W A;  3GL3 A;  4XCS A;  2MMN A;  3UAP A;  1I5G A;  5DAL A;  1SEN A;  2VLT A;  2TRC P;  3FR3 A;  2HZE B;  2CA8 A;  5IO2 A;  2YNX A;  1GSS A;  5A4U A;  3GX0 A;  4ECB A;  3DGQ A;  3LFL A;  3IDV A;  5KOX A;  2O8V B;  4BL7 A;  5F0G A;  2DLX A;  5GST A;  2JSY A;  3HVX A;  1VF1 A;  2HRN A;  1ZZY A;  4HDE A;  4TXV A;  1KEB A;  3FEU A;  4TR0 A;  1F9M A;  2FUG 2;  1GWC A;  5H5Q A;  4JBB A;  1FG4 A;  2B5E A;  4CW9 A;  4ML6 A;  2YN1 A;  3E9J B;  2F3M A;  1ZYE A;  3QD9 A;  3KM6 A;  4XHM A;  4FIW A;  5IO0 A;  3PIN A;  5D93 A;  4HJ2 A;  2FNO A;  3FYG A;  3AY8 A;  1X5D A;  1UC7 A;  2CZ2 A;  3QAW A;  2F9S A;  3WGD A;  2CZ3 A;  3TGZ A;  1YY7 A;  2DJK A;  2LNS A;  1H4O A;  5ELA A;  2YWI A;  4O5U A;  2LQO A;  3ZYW A;  5IMA A;  4MJB A;  4ICY A;  4HSC X;  1JLV A;  5HFK A;  1VF3 A;  6GSS A;  11GS A;  3KH9 A;  4QL9 A;  1ZYQ B;  3CQF A;  3HHV A;  1WJK A;  1V98 A;  3ME8 A;  4V1A g;  3NIV A;  4OMV A;  4WKW A;  1WWJ A;  1F6M C;  3EIN A;  4ZB6 A;  4GTU A;  1GUL A;  3FZ4 A;  2HYX A;  4ZXG A;  4I5Q A;  1GUH A;  4GWR A;  2EIQ A;  4L8E A;  2FWF A;  2LRN A;  1ZGN A;  4FH8 A;  2XC2 A;  5HFI A;  3BD2 A;  1RQM A;  4HI7 A;  3H8Q A;  1AC1 A;  2GQM A;  1DE2 A;  4GF0 A;  1JZW A;  2MMO A;  3GH9 A;  2CX3 A;  3IC8 A;  4MMM A;  1YQ1 A;  3IOS A;  5AN1 A;  1GH2 A;  2GSR A;  1NSW A;  4GLT A;  1GTB A;  2R0P A;  4ZBA A;  4PUF C;  1AW9 A;  1GTA A;  2R3X A;  1K0B A;  5ABR A;  3QAV A;  2RM5 A;  3P90 A;  2J9H A;  2DKI A;  3FKF A;  5J4U A;  2KLX A;  3MYD A;  3HY2 A;  1PSQ A;  2LRC A;  2C0D A;  4EXJ A;  3QFB C;  1R5A A;  3TRP A;  2AYT A;  1AAZ A;  2E2M A;  2GVP A;  1BX9 A;  1TK5 B;  3F4R A;  4HZ4 A;  1WPI A;  1BG5 A;  1K0D A;  2DJ3 A;  4AGS A;  4BA7 A;  2CAI A;  3IXR A;  4WXT A;  1AQW A;  2B5Y A;  3RDW A;  2FY6 A;  1ZCP A;  3LW9 A;  4PGT A;  3R2Q A;  4FYB A;  1V9W A;  1B4Q A;  3Q74 A;  3IE3 A;  4MZC A;  3TRX A;  5IMD A;  2M72 A;  2REM A;  4EDY A;  3GST A;  3EMP A;  1QQ2 A;  1ABA A;  2NBS A;  4KH7 A;  2FA4 A;  5LNK e;  3C7M A;  5B7C A;  10GS A;  3KXO A;  3QFA C;  1EEJ A;  2B6M A;  3F4S A;  4DSR A;  7GSS A;  2E2G A;  3EE2 A;  3F0I A;  4G10 A;  4NV2 A;  2DSA A;  1MDK A;  3L4N A;  1HNC A;  2VL2 A;  2DJ1 A;  1EZK A;  2A2R A;  2H0H A;  3F63 A;  2MZC A;  1XWA A;  1BYE A;  5C00 A;  2B7K A;  5J5N A;  3QOU A;  4F0C A;  4MF6 A;  4LL4 B;  4ZBD A;  2QSI A;  5CYY A;  3APO A;  4NV5 A;  18GS A;  1NHO A;  3APQ A;  2DML A;  5JCG A;  1YKC A;  2LKU A;  3BBY A;  1GLP A;  4TKY A;  3LYK A;  2H1G A;  1XZO A;  2K8S A;  3ZIJ A;  1X9S B;  2H1D A;  3TJJ A;  2PU9 C;  4EIQ A;  1S3R A;  4GQC A;  1IYH A;  2DJ2 A;  5DJM A;  1O73 A;  5HR3 A;  1B8X A;  1O8X A;  2B1K A;  4HZ2 A;  4TRX A;  3J7Y b;  2EC4 A;  3PPU A;  2RUE A;  4AJ7 A;  5IPG A;  2HI7 A;  3VUR A;  1QK8 A;  3GYK A;  2C4J A;  1SYR A;  4K7O A;  1O81 A;  3P2A A;  3F3Q A;  3GSS A;  3US3 A;  3D0Z A;  4KF9 A;  4N0V A;  6GST A;  2FCH A;  1Y6E A;  5A4V A;  3KTB A;  4KDX A;  3CTG A;  2DC5 A;  4V2L A;  2JZR A;  4MLY A;  1ST9 A;  1Z9H A;  2PBJ A;  3HJM A;  2GZZ A;  4IVF A;  5J3R A;  3IAM 2;  2L5L A;  4GST A;  5ECH B;  4G2E A;  4ZL8 A;  3IC4 A;  2H66 A;  2XPD A;  2TIR A;  2XPE A;  2R5G A;  4TR1 B;  2H1A A;  2HNL A;  1R26 A;  3TCO A;  2G0F A;  2KP1 A;  2H75 A;  1EWX A;  1K0C A;  3GNJ A;  1T4Z A;  3J7Y k;  5DQY A;  4JR4 A;  2V6K A;  2NPB A;  2VD1 A;  3D22 A;  1GSF A;  4F2I A;  2X99 A;  3O76 A;  3G7Y A;  2CV4 A;  2HZE A;  4CY8 A;  3VI7 A;  2LV3 A;  2YP6 A;  2OE3 A;  4Q5N A;  3UIW A;  1PN0 A;  2JU5 A;  4IHU A;  4YAV A;  4G9H A;  2FHE A;  2HXK A;  2FWE A;  3UOM A;  1SJ6 A;  2HSM A;  3EYT A;  5H5R A;  2AHE A;  2I9H A;  1YJ6 A;  17GS A;  4HJM A;  1TW9 A;  1A24 A;  3O3T A;  1TTZ A;  2H73 A;  1U87 A;  1GL8 A;  3ZMK A;  5DAK B;  4MJE A;  3TJB A;  4EIP A;  4DSS B;  5L71 A;  3RBT A;  1GTU A;  2OJL A;  2RM6 A;  5CO3 A;  3GMF A;  1FB0 A;  3VLN A;  2I4A A;  3GKK A;  1XBS A;  2ZUP A;  1XCC A;  4JED A;  3CTF A;  4OO5 A;  1BAY A;  3ZML A;  5ECR B;  4LA1 A;  3FMW A;  1GSQ A;  3CSH A;  1MEK A;  2R0G A;  1M3J A;  2Z9S A;  3DEX A;  1EOH A;  4YKG A;  3F6D A;  3A5W A;  4FYU A;  1XOB A;  2VM1 A;  3DVW A;  3GTU B;  4JZQ A;  1X9M B;  3P7X A;  4EO3 A;  1SKW B;  3M0F A;  4MH3 A;  1FVK A;  1GP1 A;  3APS A;  1MDJ A;  3KZQ A;  3BCK A;  4XIH A;  3IK7 A;  4DEJ A;  4MJC A;  1B9Y C;  3HVV A;  2NDO A;  3ZFL A;  4IP1 A;  3DVX A;  1SK2 A;  1FO5 A;  1BJX A;  2YWN A;  4EC0 A;  1LU4 A;  1VGL A;  4MP4 A;  3CSI A;  1A0R P;  5G5E A;  2ON5 A;  5KN0 A;  4MDC A;  2C80 A;  5J9B A;  3RHB A;  5DBQ A;  2L6C A;  3HCZ A;  2KP2 A;  5KN3 A;  3TKS C;  2RLI A;  1YZX A;  5ECK B;  4E8E A;  3L9U A;  2IL3 A;  3HA9 A;  4BPY A;  5B8B A;  2IJY A;  3H79 A;  2H6X A;  2B1L A;  4MJA A;  3O6T A;  3GFK A;  4K8M A;  4XRD A;  5B6M A;  5ECL B;  5JCU A;  1OVN A;  4EKZ A;  1OYJ A;  1HD2 A;  1TDI A;  4MCU A;  3UBL A;  4O5R A;  1HQO A;  2YWM A;  3GKM A;  1T3B A;  2WGR A;  3FHK A;  2DKH A;  4TOP A;  1EP8 A;  4NPB A;  3A2W A;  2L4Q A;  3WT1 A;  5JWR B;  1THO A;  4NHZ A;  2M46 A;  3GRX A;  2PER A;  3A2V A;  3LXT A;  1T7P B;  4K6X A;  5IMV A;  3G9B A;  1EOG A;  4GSS A;  2G2Q A;  5AIX A;  2I1U A;  3A2X A;  1B9X C;  4N10 A;  4MH2 A;  1AQX A;  4E8H A;  3TKS E;  1SJI A;  5IIZ A;  1LJR A;  4HQZ A;  3FK8 A;  4MF7 A;  1EV9 A;  5GZZ B;  2AJQ B;  4GSN A;  2H01 A;  2XBQ A;  2RUF A;  3IBH A;  1OKD A;  5E59 A;  2IME A;  3M8N A;  4IBP A;  4Z7X A;  3HYP A;  2H6Y A;  1TRV A;  1GSY A;  1M99 A;  1TP9 A;  3CYN A;  1V58 A;  4J57 E;  1YEP A;  1SU9 A;  6GSV A;  4QL7 A;  5FT3 A;  4NXI A;  2H70 A;  3TUE A;  4GXZ A;  1TU8 A;  4X0X A;  3K8N A;  2AB6 A;  5ECN B;  3L9S A;  1CQG A;  1EV4 A;  4LLR A;  1HNA A;  3HVS A;  2CVD A;  3WYW A;  1Z3E A;  3UAR A;  1AIU A;  1QFN A;  2LJA A;  3G7J A;  2YV7 A;  4HUA A;  4IQA A;  1M3I A;  4FQU A;  2LS5 A;  2OAC A;  1R7H A;  1BED A;  3TDG A;  2WRT A;  2A2S A;  2GQL A;  2V41 A;  3LGC A;  2VL9 A;  1Q98 A;  1JFU A;  5FWG A;  1USB A;  3L0H A;  2C3Q A;  1ZYN A;  4WF5 A;  3ZIT A;  5CRE A;  1IYI A;  5HR2 A;  4HU7 A;  4MZW A;  1K3O A;  5CRH A;  4OCE A;  2JL4 A;  1WP0 A;  5LCZ A;  1ON4 A;  1B4P A;  1S3A A;  1M9B A;  4KX4 A;  4J2F A;  2VUP A;  1PN9 A;  3C73 A;  2KOK A;  4MNN A;  4N0Z A;  3D5J A;  5G31 A;  3ED3 A;  1NHY A;  3EWL A;  3IPZ A;  5ECQ B;  4ACS A;  1UVZ A;  2LTK A;  3RPP A;  2FGX A;  2CQ9 A;  1N2A A;  4MZB A;  1W4V A;  2PUK C;  1R4W A;  1NM3 A;  2GTU A;  6GSW A;  4PUA A;  5AGY A;  3E0U A;  3ZVJ D;  4F03 A;  3M1G A;  2V2G A;  4AF2 A;  4Q5R A;  2C0F A;  3HD5 A;  1SKR B;  3BJ5 A;  4IP6 A;  4BWS A;  3EUR A;  2QA2 A;  1YF0 A;  2H76 A;  1XVW A;  3HZ8 A;  3GA4 A;  6GSU A;  4G0L A;  4TR1 A;  5G1K A;  2DJ0 A;  5JWO B;  2A4V A;  2C8U A;  2H0G A;  2OA7 A;  5F05 A;  1Z7R A;  9GSS A;  3TJF A;  1F37 A;  2YJ7 A;  4KSM A;  5DJL A;  4CDO A;  3ERG A;  3GUR A;  3TKQ A;  4IJI A;  4O32 A;  2CX4 A;  1E2Y A;  1GSE A;  2MBS A;  4CHS A;  3MAK A;  2L57 A;  3IRA A;  4GCI A;  1VRS D;  5G1L A;  1S3D A;  2EIR A;  4PQ1 A;  2K6V A;  3WGX A;  1B48 A;  1PX6 A;  3F4T A;  1HNB A;  5ID2 B;  4X1U A;  1QUW A;  3UVH A;  1GUM A;  5J9C A;  5F07 A;  1TJD A;  1Z6M A;  1JZO A;  4BVX B;  5DAK A;  4EF0 A;  1OE7 A;  1ERW A;  4ECI A;  5KOW A;  4O7H A;  3RPN A;  3LSZ A;  1PKZ A;  5CP1 A;  5GAN D;  1PFO A;  3E3E A;  1SJZ A;  3QMX A;  1MD4 A;  1DSB A;  2VCQ A;  5A5K A;  1DUG A;  2OE0 A;  1GUK A;  1EGR A;  3IAS 2;  1XIY A;  4NWY A;  5KEJ A;  2LJK A;  5KN2 A;  3UBK A;  3TB2 A;  1SL0 B;  5B8A A;  3ERW A;  2AAW A;  5LD0 A;  1TXX A;  4GRF A;  1SK1 A;  3VI5 A;  5C04 A;  5KN1 A;  5ECM B;  1FAA A;  1QGV A;  1I9D A;  3GTU A;  3CXG A;  5F06 A;  2ON7 A;  3JCM L;  2N5B A;  5DCG A;  5EY6 A;  2H8L A;  3FR9 A;  4V2N A;  3FW2 A;  2N5F A;  5IMZ A;  4FO5 A;  3TJK A;  1EP7 A;  3RHC A;  1CQH A;  12GS A;  3GH6 A;  3ISO A;  3VWW A;  3IR4 A;  3ZLP A;  4HOJ A;  2HSY A;  4KCA A;  3LEF A;  2E7P A;  3DWV A;  4Q5F A;  2DMM A;  3U6V A;  3VWX A;  1MDI A;  1GRX A;  2IFQ A;  3TOT A;  2O7K A;  5EVO A;  2YAN A;  2FA8 A;  4POK A;  5E4W A;  2GDR A;  3UL3 A;  5DQS A;  3W8J A;  4TVE A;  1JZR A;  4KCE A;  5GSS A;  1GTI A;  3V1W A;  5IQY A;  4F9Z A;  4IW9 A;  1G0T A;  2FWH A;  1V40 A;  4ID0 A;  1UA5 A;  2IMK A;  4QQ7 A;  4Z2U A;  4XS4 B;  1ACV A;  2GLR A;  1YDK A;  1XWK A;  2BTO T;  5COH A;  5AIS A;  3L78 A;  1SK0 A;  2GST A;  2HLS A;  4IJ3 A;  4KND A;  4NHW A;  2O89 A;  3IHG A;  2XHF A;  3R3E A;  3TRQ A;  5G30 A;  2HT9 A;  3C8E A;  4TXO B;  3IV4 A;  1TKD B;  2VO4 A;  3DIE A;  1KBN A;  2K8V A;  3QDN A;  1URM A;  2UZ8 A;  1PMT A;  2PGT A;  5G5F A;  8GSS A;  2FLS A;  2ZCT A;  1DBY A;  2C3T A;  1XWB A;  4IKH A;  3DRN A;  1X9W B;  2L5O A;  3L9V A;  2B3S A;  2O87 A;  6GSY A;  4NAX A;  2LNT A;  2NTO A;  3IK9 A;  4JE1 A;  2VOC A;  1XWC A;  2BJX A;  4Z2T A;  3LG6 A;  4K0N A;  2JZT A;  3UVT A;  2I81 A;  4PUR A;  3EC3 A;  1W89 A;  3UJ1 A;  2P0G A;  4ZB8 A;  1PL2 A;  1XVQ A;  5HFG A;  1K0N A;  3QCP A;  1PRX A;  2VIM A;  3TJG A;  4BVY B;  3Q6O A;  2H30 A;  5HQP A;  2VL3 A;  3VPT A;  5IMF A;  4WR4 A;  1Y25 A;  3A5I A;  4PNG A;  1RK4 A;  2C3N A;  1QMV A;  1E6B A;  1M2B A;  2MMZ A;  4KW6 A;  3CRU A;  1FOH A;  4IN0 A;  3QAG A;  2WUL A;  3GKX A;  3LJR A;  1XW9 A;  3W6G A;  1PGT A;  4XS1 A;  1J0F A;  3LXZ A;  3QR6 A;  1WMJ A;  4I97 A;  3EVI A;  1THX A;  2CVK A;  2IMF A;  5ELG A;  1TRW A;  5JWQ B;  1RW1 A;  5ECS A;  1XXU A;  3I6A A;  2IN3 A;  1FW1 A;  2A4H A;  3LQ7 A;  4KGI A;  5B6N A;  2H6Z A;  4K2D A;  1TRU A;  2OKA A;  2LQQ A;  3D21 A;  4ISD A;  3C71 A;  1G6W A;  3FRC A;  3ZZX A;  2R0C A;  1F3B A;  4MF5 A;  2H0I A;  5ECO B;  4DSQ A;  3ZFB A;  4WEY A;  2WB9 A;  1PX7 A;  3KMO A;  2HRK A;  4HEA 2;  2JAC A;  3ERF A;  1NW2 A;  3KCM A;  3KH7 A;  3EPT A;  1U88 A;  4XS6 A;  2K9F A;  2GZP A;  4USS A;  3ME7 A;  3KD0 A;  2NVL A;  3D6I A;  4AJ8 A;  5IOX A;  5G2Z A;  2JAD A;  1JZD A;  4EE0 A;  5IOW A;  4K7N A;  4POL A;  2R6K A;  4K9Z A;  1BQ7 A;  3TKP A;  2P5R A;  2YZU A;  3DD3 A;  1Z6N A;  1M2D A;  1XW5 A;  1SL2 B;  2F8F A;  3FZ5 A;  4MAB A;  2L6D A;  4KDU A;  4TR4 A;  3H4K A;  4L0U A;  2MBT A;  1U6T A;  5H5S A;  1EEM A;  1SL1 B;  4LMW A;  4X43 A;  4PQH A;  3M3M A;  4POB A;  4WBJ A;  4ECJ A;  1LBK A;  2X49 A;  1V57 A;  2P5Q A;  2PVQ A;  2HRA A;  1FVJ A;  3D4T A;  2HE3 A;  1AXD A;  5ID2 A;  1GSD A;  1XW6 A;  2O85 A;  4X4J A;  4RI6 A;  2HRF A;  4RQX A;  3H1N A;  1Z7P A;  4YQU A;  3QPM A;  4KSO A;  2PPT A;  4MA9 A;  4BVX A;  4I2T A;  2VCZ A;  1T00 A;  2F8A A;  3UMA A;  4OCF A;  2PVO C;  3HJP A;  3M9K A;  2OAD A;  2WFC A;  2R4V A;  1PQN A;  4EUY A;  3SBC A;  1TU7 A;  2XBI A;  4KA0 A;  1Q4J A;  2X8H A;  2VCW A;  3SWL A;  1SD9 A;  3ZIV A;  2A2P A;  2CVB A;  4YAP A;  2AV4 A;  5HR1 A;  2OBK A;  2V6O A;  1PD2 1;  1X5C A;  3LYP A;  3GUS A;  1H75 A;  3N9J A;  3DXB A;  4K5S A;  2HZF A;  2BMX A;  4CY6 A;  4POM A;  14GS A;  2JZS A;  2ALB A;  5DDL A;  2VCV A;  4XTS A;  1M0U A;  2LST A;  4L5O A;  2QGV A;  1O6J A;  2X4A A;  5CRD A;  2PN8 A;  1V2A A;  3GHA A;  1OC9 B;  1T1V A;  3Q19 A;  4D73 B;  5D9T A;  2LUS A;  3C1R A;  1JLW A;  1PKW A;  3UEM A;  1S3C A;  6GSX A;  3GL5 A;  1GLQ A;  3HVN A;  1PL1 A;  1OE8 A;  3WD6 A;  1QXH A;  4RI7 A;  2DIZ A;  3MNG A;  1ZOF A;  3DKS A;  3CSJ A;  5D9W A;  1XOA A;  2VLU A;  2X8C A;  2F51 A;  2FD3 A;  4FYC A;  4Z2R A;  4I6X A;  2H74 A;  2LRT A;  2YJH A;  3IA1 A;  1GSU A;  3KP8 A;  2D2Z A;  4MPF A;  4K1F A;  2YCD A;  3FZ9 A;  4YQV A;  3NZN A;  4RUV A;  5DVB A;  1EGO A;  1WRY A;  2V32 A;  1SKS B;  2GT6 A;  3ZVJ A;  1OC3 A;  3HZ4 A;  4XS4 A;  5IM9 A;  5DAL B;  3TKR A;  4KDY A;  2ZNM A;  1WOU A;  2IIY A;  1ILO A;  2GS3 A;  2IMD A;  4ZIJ A;  4MPG A;  2VAF A;  1GNW A;  1A2J A;  4L5L A;  22GS A;  2N5A A;  2YWO A;  2YPM A;  1TI3 A;  1O7U A;  4TXO A;  1PA3 A;  3LOR A;  1TK8 B;  4BL7 B;  3MSZ A;  3GX8 A;  3ZRD A;  20GS A;  2ES7 A;  3OR5 A;  2GT5 A;  1T8E B;  5FHI A;  4ML1 A;  2L59 A;  5DCH A;  5IMC A;  3TOU A;  2OBI A;  3W8S A;  4AJ6 A;  2L4C A;  3HJO A;  3EMX A;  2YV9 A; 
#chains in the Genus database with same CATH homology
 1AQV A;  4DSS A;  1TOF A;  1SD8 A;  4PQI A;  4IS0 A;  4WF4 A;  4OFM A;  1R5P A;  3VWU A;  16GS A;  1TI1 A;  1G6Y A;  4ILF A;  4OFT A;  3GKN A;  3HDC A;  13GS A;  1K3L A;  3GV1 A;  2P31 A;  4HU9 A;  1YF1 A;  2DBC A;  2WZ9 A;  4YH2 A;  1ZL9 A;  4KUN A;  2J23 A;  2HSH A;  3DML A;  4PNF A;  4ZBB A;  4JR6 A;  2V1M A;  5J41 A;  4GQF A;  4BVY A;  3VWV A;  4F0B A;  1ERU A;  4OFN A;  2R37 A;  3EU3 A;  1T4Y A;  4L0W A;  4F82 A;  2AUV A;  5D9X A;  2DJJ A;  1Z5Y E;  4N11 A;  4KB3 A;  2EIO A;  4IQ1 A;  5D8I A;  2C0G A;  2VD0 A;  4LMV A;  5HR0 A;  1M2A A;  3F6F A;  2VL2 C;  4O5Q A;  4K0G A;  4WBR D;  1X5E A;  1MTC A;  1ZMA A;  4DVC A;  1K0O A;  1GNE A;  1F2E A;  4OO4 A;  4PXO A;  2LEG A;  1FHE A;  5EL8 A;  4G0I A;  2M80 A;  19GS A;  2KHP A;  2RII A;  5INY A;  4N30 A;  1VF4 A;  2VCT A;  4I8B A;  5ECI B;  3WT2 A;  3DYR A;  2QKE A;  2B5X A;  3FR6 A;  4K7I A;  3H93 A;  1A0F A;  2E0Q A;  2QC7 A;  1FB6 A;  4G19 A;  2TRX A;  5A4W A;  4V1A p;  1X0R A;  1G7E A;  3IHQ A;  2GZY A;  3GN3 A;  1O85 A;  3ZL5 A;  3KIJ A;  3PH9 A;  2WS2 A;  2X8G A;  1A8L A;  1XPV A;  1F3A A;  4EVM A;  4ZL9 A;  4IGJ A;  3VPQ A;  1TRS A;  4ECC A;  4ULX A;  3C1S A;  2I3Y A;  3S9F A;  2X64 A;  2WJU A;  5ENU A;  4ZB9 A;  4PTS A;  3PR8 A;  1K0A A;  5CRW A;  1A8Y A;  4WR5 A;  2C0E A;  4OD7 A;  4A5P A;  3CBU A;  4OWY A;  2GSQ A;  4JRR A;  3U5R E;  2IWT A;  2PWJ A;  3PGT A;  3KEB A;  5CRG A;  1ML6 A;  2DIY A;  2MYG A;  3KGK A;  1XFL A;  5F8B A;  3KTL A;  2JSZ A;  3F9U A;  3VK9 A;  2H1B A;  2YZH A;  3N5O A;  3P8W A;  3M9J A;  4K2X A;  2KUC A;  1HYU A;  1FOV A;  3MDK A;  4WET A;  3ZTL A;  1J08 A;  3I69 A;  5JCW A;  1A23 A;  1ERT A;  1K3Y A;  4PX1 A;  2H71 A;  3G7I A;  2VM2 A;  4G0K A;  2FWG A;  4TN8 A;  1M9A A;  4KAE A;  4V2M A;  2OE1 A;  3ZRE A;  4BWQ A;  5D73 A;  4XRA A;  2C1Y A;  1TK0 B;  5BMU A;  3FY7 A;  1KNG A;  3WGE A;  1KTE A;  3BOA A;  2WDU A;  3F8U A;  2WCI A;  2H72 A;  3KJY A;  1WIK A;  3CMI A;  3EU4 A;  4LL1 B;  3KP9 A;  2K18 A;  2B7J A;  2YOI A;  3Q18 A;  3HKR A;  5GAP D;  3FZA A;  3D4M A;  1SYX A;  3LWA A;  3TKS A;  4P3Y B;  4MK3 A;  4O92 A;  1OAZ A;  4JU5 A;  1DE1 A;  2PMT A;  2LJR A;  4I2U A;  1N8J A;  3A3T A;  3F3R A;  3NOF A;  4Q5Q A;  3I43 A;  1JHB A;  1YEX A;  2VLV A;  1ERV A;  5D96 A;  1OC9 A;  2GQK A;  4EL1 A;  4ZIL A;  1MD3 A;  4D73 A;  5IPH A;  4YQM A;  1YKA A;  3I9V 2;  1OC8 A;  2GSS A;  1G7O A;  3MWH A;  2GGT A;  2HFD A;  2IPA A;  5CNW A;  1M7T A;  2VCX A;  1OKT A;  4TR3 A;  1AUC A;  3CRT A;  1U3I A;  1XWG A;  1U3A A;  3MIX A;  2CAQ A;  5ECP B;  3BCI A;  5D9V A;  2IFQ B;  1UN2 A;  2MMA A;  1J9B A;  2H19 A;  3KMN A;  4YKF A;  4EDZ A;  5CAX A;  3GIX A;  1A2L A;  5BRT A;  5EPF A;  4HQS A;  3VFI A;  4KE3 A;  1WE0 A;  4IEL A;  4K5R A;  2CT6 A;  2QA1 A;  5AIV A;  3RAZ A;  4NMU A;  2R2J A;  1A2M A;  1K0M A;  4HS1 A;  1C72 A;  1ZYP A;  4ZL7 A;  4H86 A;  1VF2 A;  4J56 E;  2IMI A;  4RQR A;  4TW5 A;  3HXS A;  1O8W A;  3GL3 A;  4XCS A;  2MMN A;  3UAP A;  1I5G A;  5DAL A;  1SEN A;  2VLT A;  2TRC P;  3FR3 A;  2HZE B;  2CA8 A;  5IO2 A;  2YNX A;  1GSS A;  5A4U A;  3GX0 A;  4ECB A;  3DGQ A;  3LFL A;  3IDV A;  5KOX A;  2O8V B;  4BL7 A;  5F0G A;  2DLX A;  5GST A;  2JSY A;  3HVX A;  1VF1 A;  2HRN A;  1ZZY A;  4HDE A;  4TXV A;  1KEB A;  3FEU A;  4TR0 A;  1F9M A;  2FUG 2;  1GWC A;  5H5Q A;  4JBB A;  1FG4 A;  2B5E A;  4CW9 A;  4ML6 A;  2YN1 A;  3E9J B;  2F3M A;  1ZYE A;  3QD9 A;  3KM6 A;  4XHM A;  4FIW A;  5IO0 A;  3PIN A;  5D93 A;  4HJ2 A;  2FNO A;  3FYG A;  3AY8 A;  1X5D A;  1UC7 A;  2CZ2 A;  3QAW A;  2F9S A;  3WGD A;  2CZ3 A;  3TGZ A;  1YY7 A;  2DJK A;  2LNS A;  1H4O A;  5ELA A;  2YWI A;  4O5U A;  2LQO A;  3ZYW A;  5IMA A;  4MJB A;  4ICY A;  1JLV A;  5HFK A;  1VF3 A;  6GSS A;  11GS A;  3KH9 A;  4QL9 A;  1ZYQ B;  3HHV A;  1WJK A;  1V98 A;  3ME8 A;  4V1A g;  3NIV A;  4OMV A;  4WKW A;  1WWJ A;  1F6M C;  3EIN A;  4ZB6 A;  4GTU A;  1GUL A;  3FZ4 A;  2HYX A;  4ZXG A;  4I5Q A;  1GUH A;  4GWR A;  2EIQ A;  4L8E A;  2FWF A;  2LRN A;  1ZGN A;  4FH8 A;  2XC2 A;  5HFI A;  3BD2 A;  1RQM A;  4HI7 A;  3H8Q A;  1AC1 A;  2GQM A;  1DE2 A;  4GF0 A;  1JZW A;  2MMO A;  3GH9 A;  2CX3 A;  3IC8 A;  4MMM A;  1YQ1 A;  3IOS A;  5AN1 A;  1GH2 A;  2GSR A;  1NSW A;  4GLT A;  1GTB A;  2R0P A;  4ZBA A;  4PUF C;  1AW9 A;  1GTA A;  2R3X A;  1K0B A;  5ABR A;  3QAV A;  2RM5 A;  3P90 A;  2J9H A;  2DKI A;  3FKF A;  5J4U A;  2KLX A;  3MYD A;  3HY2 A;  1PSQ A;  2LRC A;  2C0D A;  4EXJ A;  3QFB C;  1R5A A;  3TRP A;  2AYT A;  1AAZ A;  2E2M A;  2GVP A;  1BX9 A;  1TK5 B;  3F4R A;  4HZ4 A;  1WPI A;  1BG5 A;  1K0D A;  2DJ3 A;  4AGS A;  4BA7 A;  2CAI A;  3IXR A;  4WXT A;  1AQW A;  2B5Y A;  3RDW A;  2FY6 A;  1ZCP A;  3LW9 A;  4PGT A;  3R2Q A;  4FYB A;  1V9W A;  1B4Q A;  3Q74 A;  3IE3 A;  4MZC A;  3TRX A;  5IMD A;  2M72 A;  2REM A;  4EDY A;  3GST A;  3EMP A;  1QQ2 A;  1ABA A;  2NBS A;  4KH7 A;  2FA4 A;  5LNK e;  3C7M A;  5B7C A;  10GS A;  3KXO A;  3QFA C;  1EEJ A;  2B6M A;  3F4S A;  4DSR A;  7GSS A;  2E2G A;  3EE2 A;  3F0I A;  4G10 A;  4NV2 A;  2DSA A;  1MDK A;  3L4N A;  1HNC A;  2VL2 A;  2DJ1 A;  1EZK A;  2A2R A;  2H0H A;  3F63 A;  2MZC A;  1XWA A;  1BYE A;  5C00 A;  2B7K A;  5J5N A;  3QOU A;  4F0C A;  4MF6 A;  4LL4 B;  4ZBD A;  2QSI A;  5CYY A;  3APO A;  4NV5 A;  18GS A;  1NHO A;  3APQ A;  2DML A;  5JCG A;  1YKC A;  2LKU A;  3BBY A;  1GLP A;  4TKY A;  3LYK A;  2H1G A;  1XZO A;  2K8S A;  3ZIJ A;  1X9S B;  2H1D A;  3TJJ A;  2PU9 C;  4EIQ A;  4GQC A;  1IYH A;  2DJ2 A;  5DJM A;  1O73 A;  5HR3 A;  1B8X A;  1O8X A;  2B1K A;  4HZ2 A;  4TRX A;  3J7Y b;  2EC4 A;  3PPU A;  2RUE A;  4AJ7 A;  5IPG A;  2HI7 A;  3VUR A;  1QK8 A;  3GYK A;  2C4J A;  1SYR A;  4K7O A;  1O81 A;  3P2A A;  3F3Q A;  3GSS A;  3US3 A;  3D0Z A;  4KF9 A;  4N0V A;  6GST A;  2FCH A;  1Y6E A;  5A4V A;  3KTB A;  4KDX A;  3CTG A;  2DC5 A;  4V2L A;  2JZR A;  4MLY A;  1ST9 A;  1Z9H A;  2PBJ A;  3HJM A;  2GZZ A;  4IVF A;  5J3R A;  3IAM 2;  2L5L A;  4GST A;  5ECH B;  4G2E A;  4ZL8 A;  3IC4 A;  2H66 A;  2XPD A;  2TIR A;  2XPE A;  2R5G A;  4TR1 B;  2H1A A;  2HNL A;  1R26 A;  3TCO A;  2G0F A;  2KP1 A;  2H75 A;  1EWX A;  1K0C A;  3GNJ A;  1T4Z A;  3J7Y k;  5DQY A;  4JR4 A;  2V6K A;  2NPB A;  2VD1 A;  3D22 A;  1GSF A;  4F2I A;  2X99 A;  3O76 A;  3G7Y A;  2CV4 A;  2HZE A;  4CY8 A;  3VI7 A;  2LV3 A;  2YP6 A;  2OE3 A;  4Q5N A;  3UIW A;  1PN0 A;  2JU5 A;  4IHU A;  4YAV A;  4G9H A;  2FHE A;  2HXK A;  2FWE A;  3UOM A;  1SJ6 A;  2HSM A;  3EYT A;  5H5R A;  2AHE A;  2I9H A;  1YJ6 A;  17GS A;  4HJM A;  1TW9 A;  1A24 A;  3O3T A;  1TTZ A;  2H73 A;  1U87 A;  1GL8 A;  3ZMK A;  5DAK B;  4MJE A;  3TJB A;  4EIP A;  4DSS B;  5L71 A;  3RBT A;  1GTU A;  2OJL A;  2RM6 A;  5CO3 A;  3GMF A;  1FB0 A;  3VLN A;  2I4A A;  3GKK A;  1XBS A;  2ZUP A;  1XCC A;  4JED A;  3CTF A;  4OO5 A;  1BAY A;  3ZML A;  5ECR B;  4LA1 A;  3FMW A;  1GSQ A;  3CSH A;  1MEK A;  2R0G A;  2Z9S A;  3DEX A;  1EOH A;  4YKG A;  3F6D A;  3A5W A;  4FYU A;  1XOB A;  2VM1 A;  3DVW A;  3GTU B;  4JZQ A;  1X9M B;  3P7X A;  4EO3 A;  1SKW B;  3M0F A;  4MH3 A;  1FVK A;  1GP1 A;  3APS A;  1MDJ A;  3KZQ A;  3BCK A;  4XIH A;  3IK7 A;  4DEJ A;  4MJC A;  1B9Y C;  3HVV A;  2NDO A;  3ZFL A;  4IP1 A;  3DVX A;  1SK2 A;  1FO5 A;  1BJX A;  2YWN A;  4EC0 A;  1LU4 A;  1VGL A;  4MP4 A;  3CSI A;  1A0R P;  5G5E A;  2ON5 A;  5KN0 A;  4MDC A;  2C80 A;  5J9B A;  3RHB A;  5DBQ A;  2L6C A;  3HCZ A;  2KP2 A;  5KN3 A;  3TKS C;  2RLI A;  1YZX A;  5ECK B;  4E8E A;  3L9U A;  2IL3 A;  3HA9 A;  4BPY A;  5B8B A;  2IJY A;  3H79 A;  2H6X A;  2B1L A;  4MJA A;  3O6T A;  3GFK A;  4K8M A;  4XRD A;  5B6M A;  5ECL B;  5JCU A;  1OVN A;  4EKZ A;  1OYJ A;  1HD2 A;  1TDI A;  4MCU A;  3UBL A;  4O5R A;  1HQO A;  2YWM A;  3GKM A;  1T3B A;  2WGR A;  3FHK A;  2DKH A;  4TOP A;  1EP8 A;  4NPB A;  3A2W A;  2L4Q A;  3WT1 A;  5JWR B;  1THO A;  4NHZ A;  2M46 A;  3GRX A;  2PER A;  3A2V A;  3LXT A;  1T7P B;  4K6X A;  5IMV A;  3G9B A;  1EOG A;  4GSS A;  2G2Q A;  5AIX A;  2I1U A;  3A2X A;  1B9X C;  4N10 A;  4MH2 A;  1AQX A;  4E8H A;  3TKS E;  1SJI A;  5IIZ A;  1LJR A;  4HQZ A;  3FK8 A;  4MF7 A;  1EV9 A;  5GZZ B;  2AJQ B;  4GSN A;  2H01 A;  2XBQ A;  2RUF A;  3IBH A;  1OKD A;  5E59 A;  2IME A;  3M8N A;  4IBP A;  4Z7X A;  3HYP A;  2H6Y A;  1TRV A;  1GSY A;  1M99 A;  1TP9 A;  3CYN A;  1V58 A;  4J57 E;  1YEP A;  1SU9 A;  6GSV A;  4QL7 A;  5FT3 A;  4NXI A;  2H70 A;  3TUE A;  4GXZ A;  1TU8 A;  4X0X A;  3K8N A;  2AB6 A;  5ECN B;  3L9S A;  1CQG A;  1EV4 A;  4LLR A;  1HNA A;  3HVS A;  2CVD A;  3WYW A;  1Z3E A;  3UAR A;  1AIU A;  1QFN A;  2LJA A;  3G7J A;  2YV7 A;  4HUA A;  4IQA A;  4FQU A;  2LS5 A;  2OAC A;  1R7H A;  1BED A;  3TDG A;  2WRT A;  2A2S A;  2GQL A;  2V41 A;  3LGC A;  2VL9 A;  1Q98 A;  1JFU A;  5FWG A;  1USB A;  3L0H A;  2C3Q A;  1ZYN A;  4WF5 A;  3ZIT A;  5CRE A;  1IYI A;  5HR2 A;  4HU7 A;  4MZW A;  1K3O A;  5CRH A;  4OCE A;  2JL4 A;  1WP0 A;  5LCZ A;  1ON4 A;  1B4P A;  1S3A A;  1M9B A;  4KX4 A;  4J2F A;  2VUP A;  1PN9 A;  3C73 A;  2KOK A;  4MNN A;  4N0Z A;  3D5J A;  5G31 A;  3ED3 A;  1NHY A;  3EWL A;  3IPZ A;  5ECQ B;  4ACS A;  1UVZ A;  2LTK A;  3RPP A;  2FGX A;  2CQ9 A;  1N2A A;  4MZB A;  1W4V A;  2PUK C;  1R4W A;  1NM3 A;  2GTU A;  6GSW A;  4PUA A;  5AGY A;  3E0U A;  3ZVJ D;  4F03 A;  3M1G A;  2V2G A;  4AF2 A;  4Q5R A;  2C0F A;  3HD5 A;  1SKR B;  3BJ5 A;  4IP6 A;  4BWS A;  3EUR A;  2QA2 A;  1YF0 A;  2H76 A;  1XVW A;  3HZ8 A;  3GA4 A;  6GSU A;  4G0L A;  4TR1 A;  5G1K A;  2DJ0 A;  5JWO B;  2A4V A;  2C8U A;  2H0G A;  2OA7 A;  5F05 A;  1Z7R A;  9GSS A;  3TJF A;  1F37 A;  2YJ7 A;  4KSM A;  5DJL A;  4CDO A;  3ERG A;  3GUR A;  3TKQ A;  4IJI A;  4O32 A;  2CX4 A;  1E2Y A;  1GSE A;  2MBS A;  4CHS A;  3MAK A;  2L57 A;  3IRA A;  4GCI A;  1VRS D;  5G1L A;  1S3D A;  2EIR A;  4PQ1 A;  2K6V A;  3WGX A;  1B48 A;  1PX6 A;  3F4T A;  1HNB A;  5ID2 B;  4X1U A;  1QUW A;  3UVH A;  1GUM A;  5J9C A;  5F07 A;  1TJD A;  1Z6M A;  1JZO A;  4BVX B;  5DAK A;  4EF0 A;  1OE7 A;  1ERW A;  4ECI A;  5KOW A;  4O7H A;  3RPN A;  3LSZ A;  1PKZ A;  5CP1 A;  5GAN D;  3E3E A;  1SJZ A;  3QMX A;  1MD4 A;  1DSB A;  2VCQ A;  5A5K A;  1DUG A;  2OE0 A;  1GUK A;  1EGR A;  3IAS 2;  1XIY A;  4NWY A;  5KEJ A;  2LJK A;  5KN2 A;  3UBK A;  3TB2 A;  1SL0 B;  5B8A A;  3ERW A;  2AAW A;  5LD0 A;  1TXX A;  4GRF A;  1SK1 A;  3VI5 A;  5C04 A;  5KN1 A;  5ECM B;  1FAA A;  1QGV A;  1I9D A;  3GTU A;  3CXG A;  5F06 A;  2ON7 A;  3JCM L;  2N5B A;  5DCG A;  5EY6 A;  2H8L A;  3FR9 A;  4V2N A;  3FW2 A;  2N5F A;  5IMZ A;  4FO5 A;  3TJK A;  1EP7 A;  3RHC A;  1CQH A;  12GS A;  3GH6 A;  3ISO A;  3VWW A;  3IR4 A;  3ZLP A;  4HOJ A;  2HSY A;  4KCA A;  3LEF A;  2E7P A;  3DWV A;  4Q5F A;  2DMM A;  3U6V A;  3VWX A;  1MDI A;  1GRX A;  2IFQ A;  3TOT A;  2O7K A;  5EVO A;  2YAN A;  2FA8 A;  4POK A;  5E4W A;  2GDR A;  3UL3 A;  5DQS A;  3W8J A;  4TVE A;  1JZR A;  4KCE A;  5GSS A;  1GTI A;  3V1W A;  5IQY A;  4F9Z A;  4IW9 A;  1G0T A;  2FWH A;  1V40 A;  4ID0 A;  1UA5 A;  2IMK A;  4QQ7 A;  4Z2U A;  4XS4 B;  1ACV A;  2GLR A;  1YDK A;  1XWK A;  2BTO T;  5COH A;  5AIS A;  3L78 A;  1SK0 A;  2GST A;  2HLS A;  4IJ3 A;  4KND A;  4NHW A;  2O89 A;  3IHG A;  2XHF A;  3R3E A;  3TRQ A;  5G30 A;  2HT9 A;  3C8E A;  4TXO B;  3IV4 A;  1TKD B;  2VO4 A;  3DIE A;  1KBN A;  2K8V A;  3QDN A;  1URM A;  2UZ8 A;  1PMT A;  2PGT A;  5G5F A;  8GSS A;  2FLS A;  2ZCT A;  1DBY A;  2C3T A;  1XWB A;  4IKH A;  3DRN A;  1X9W B;  2L5O A;  3L9V A;  2B3S A;  2O87 A;  6GSY A;  4NAX A;  2LNT A;  2NTO A;  3IK9 A;  4JE1 A;  2VOC A;  1XWC A;  2BJX A;  4Z2T A;  3LG6 A;  4K0N A;  2JZT A;  3UVT A;  2I81 A;  4PUR A;  3EC3 A;  1W89 A;  3UJ1 A;  2P0G A;  4ZB8 A;  1PL2 A;  1XVQ A;  5HFG A;  1K0N A;  3QCP A;  1PRX A;  2VIM A;  3TJG A;  4BVY B;  3Q6O A;  2H30 A;  5HQP A;  2VL3 A;  3VPT A;  5IMF A;  4WR4 A;  1Y25 A;  3A5I A;  4PNG A;  1RK4 A;  2C3N A;  1QMV A;  1E6B A;  1M2B A;  2MMZ A;  4KW6 A;  3CRU A;  1FOH A;  4IN0 A;  3QAG A;  2WUL A;  3GKX A;  3LJR A;  1XW9 A;  3W6G A;  1PGT A;  4XS1 A;  1J0F A;  3LXZ A;  3QR6 A;  1WMJ A;  4I97 A;  3EVI A;  1THX A;  2CVK A;  2IMF A;  5ELG A;  1TRW A;  5JWQ B;  1RW1 A;  5ECS A;  1XXU A;  3I6A A;  2IN3 A;  1FW1 A;  2A4H A;  3LQ7 A;  4KGI A;  5B6N A;  2H6Z A;  4K2D A;  1TRU A;  2OKA A;  2LQQ A;  3D21 A;  4ISD A;  3C71 A;  1G6W A;  3FRC A;  3ZZX A;  2R0C A;  1F3B A;  4MF5 A;  2H0I A;  5ECO B;  4DSQ A;  3ZFB A;  4WEY A;  2WB9 A;  1PX7 A;  3KMO A;  2HRK A;  4HEA 2;  2JAC A;  3ERF A;  1NW2 A;  3KCM A;  3KH7 A;  3EPT A;  1U88 A;  4XS6 A;  2K9F A;  2GZP A;  4USS A;  3ME7 A;  3KD0 A;  2NVL A;  3D6I A;  4AJ8 A;  5IOX A;  5G2Z A;  2JAD A;  1JZD A;  4EE0 A;  5IOW A;  4K7N A;  4POL A;  2R6K A;  4K9Z A;  1BQ7 A;  3TKP A;  2P5R A;  2YZU A;  3DD3 A;  1Z6N A;  1M2D A;  1XW5 A;  1SL2 B;  2F8F A;  3FZ5 A;  4MAB A;  2L6D A;  4KDU A;  4TR4 A;  3H4K A;  4L0U A;  2MBT A;  1U6T A;  5H5S A;  1EEM A;  1SL1 B;  4LMW A;  4X43 A;  4PQH A;  3M3M A;  4POB A;  4WBJ A;  4ECJ A;  1LBK A;  2X49 A;  1V57 A;  2P5Q A;  2PVQ A;  2HRA A;  1FVJ A;  3D4T A;  2HE3 A;  1AXD A;  5ID2 A;  1GSD A;  1XW6 A;  2O85 A;  4X4J A;  4RI6 A;  2HRF A;  4RQX A;  3H1N A;  1Z7P A;  4YQU A;  3QPM A;  4KSO A;  2PPT A;  4MA9 A;  4BVX A;  4I2T A;  2VCZ A;  1T00 A;  2F8A A;  3UMA A;  4OCF A;  2PVO C;  3HJP A;  3M9K A;  2OAD A;  2WFC A;  2R4V A;  1PQN A;  4EUY A;  3SBC A;  1TU7 A;  2XBI A;  4KA0 A;  1Q4J A;  2X8H A;  2VCW A;  3SWL A;  1SD9 A;  3ZIV A;  2A2P A;  2CVB A;  4YAP A;  2AV4 A;  5HR1 A;  2OBK A;  2V6O A;  1PD2 1;  1X5C A;  3LYP A;  3GUS A;  1H75 A;  3N9J A;  3DXB A;  4K5S A;  2HZF A;  2BMX A;  4CY6 A;  4POM A;  14GS A;  2JZS A;  2ALB A;  5DDL A;  2VCV A;  4XTS A;  1M0U A;  2LST A;  4L5O A;  2QGV A;  1O6J A;  2X4A A;  5CRD A;  2PN8 A;  1V2A A;  3GHA A;  1OC9 B;  1T1V A;  3Q19 A;  4D73 B;  5D9T A;  2LUS A;  3C1R A;  1JLW A;  1PKW A;  3UEM A;  1S3C A;  6GSX A;  3GL5 A;  1GLQ A;  1PL1 A;  1OE8 A;  3WD6 A;  1QXH A;  4RI7 A;  2DIZ A;  3MNG A;  1ZOF A;  3DKS A;  3CSJ A;  5D9W A;  1XOA A;  2VLU A;  2X8C A;  2F51 A;  2FD3 A;  4FYC A;  4Z2R A;  4I6X A;  2H74 A;  2LRT A;  2YJH A;  3IA1 A;  1GSU A;  3KP8 A;  2D2Z A;  4MPF A;  4K1F A;  2YCD A;  3FZ9 A;  4YQV A;  3NZN A;  4RUV A;  5DVB A;  1EGO A;  1WRY A;  2V32 A;  1SKS B;  2GT6 A;  3ZVJ A;  1OC3 A;  3HZ4 A;  4XS4 A;  5IM9 A;  5DAL B;  3TKR A;  4KDY A;  2ZNM A;  1WOU A;  2IIY A;  1ILO A;  2GS3 A;  2IMD A;  4ZIJ A;  4MPG A;  2VAF A;  1GNW A;  1A2J A;  4L5L A;  22GS A;  2N5A A;  2YWO A;  2YPM A;  1TI3 A;  1O7U A;  4TXO A;  1PA3 A;  3LOR A;  1TK8 B;  4BL7 B;  3MSZ A;  3GX8 A;  3ZRD A;  20GS A;  2ES7 A;  3OR5 A;  2GT5 A;  1T8E B;  5FHI A;  4ML1 A;  2L59 A;  5DCH A;  5IMC A;  3TOU A;  2OBI A;  3W8S A;  4AJ6 A;  2L4C A;  3HJO A;  3EMX A;  2YV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...