1Z7S4

The crystal structure of coxsackievirus a21
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
b'GAQVSTQKTGAHENQNVAANGSTINYTTINYYKDSASNSATRQDLSQDPSKFTEPVKDLMLKTAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human COXSACKIEVIRUS A21
publication title The crystal structure of coxsackievirus a21 and its interaction with icam-1.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1z7s400
1PO14 2RMU4 1COV4 1K5MD 1VRH4 2R044 1RUC4 4Q4W4 1RUJ4 3JD74 4Q4V4 4Q4Y4 1MQTD 1R094 1OOPD 1RUF4 1VBC4 1ASJ4 1EAH4 4GB34 2R064 3JBG4 2RS34 1HRI4 1RUE4 1NCQD 1RUG4 1EV14 2HWC4 2RR14 4RHV4 1BEV4 1AR74 1AR94 1HRV4 1AR84 1NA1D 1RVF4 1AR64 1VBE4 1VBD4 2HWB4 2RM24 1RMU4 2X5ID 1RHI4 1VBB4 2PLV4 4Q4X4 1PO24 1R084 1RUI4 1AL24 1RUD4 1VBA4 2R074 1PVC4 1H8TD 4PDWD 2RS14 1POV0 1HXS4 2RS54 1PIV4 3J8F4 1RUH4 1D4M4 1Z7S4
chains in the Genus database with same CATH superfamily
3SFEA 1COV4 4YTPA 2R044 4Q4V4 1YQ4A 3AEGA 1VBC4 1EAH4 5C2TA 3GQKA 2WP9A 5C3JA 2RS34 1HRI4 1NCQD 1RUG4 1EV14 1NEKA 2HWC4 3AEFA 3AE7A 1BEV4 2PZSA 1AR94 3ABVA 1HRV4 4YTNA 3AEBA 1KFYA 2HWB4 2EX3A 1VBB4 1AL24 2PW9A 3VR8A 3VR9A 1ZOYA 1KF6A 2WDVA 1XHXA 3AEAA 4YXDA 4Q4W4 1K5MD 4Q4Y4 2PYJA 1XI1A 1R094 4YSYA 2WDQA 4RHV4 3VRAA 4KX6A 1AR74 1AR84 1RVF4 1AR64 3CIRA 4YSXA 3P4RA 3AE6A 2B76A 2PLV4 3AECA 1RUD4 1H8TD 2RS14 2ACZA 2H88A 2WS3A 1RUH4 3FI7A 1L0VA 3AEDA 1RUC4 1RUJ4 3GQHA 3JD74 3VRBA 1MQTD 3P4PA 4GB34 2R064 4YSZA 2WU5A 3JBG4 3P4QA 1RUE4 1XHZA 2WQYA 4YTMA 1NENA 3AE8A 2RM24 2X5ID 3AE1A 4Q4X4 1PO24 1R084 1RUI4 1YQ3A 1VBA4 2R7FA 4PDWD 2RS54 3J8F4 1PIV4 3AE2A 1D4M4 2PY5A 1PO14 2H89A 2RMU4 1VRH4 3SUCA 1OOPD 1RUF4 1ZP0A 3AE5A 4YT0A 1ASJ4 3AE9A 3AE3A 2RR14 3SFDA 2PYLA 1NA1D 2FBWA 1VBE4 1VBD4 2WDRA 1RMU4 3P4SA 1RHI4 3AE4A 2R074 1PVC4 1POV0 1HXS4 2WU2A 3AEEA 1Z7S4
chains in the Genus database with same CATH topology
1PO14 2RMU4 1COV4 1K5MD 1VRH4 2R044 1RUC4 4Q4W4 1RUJ4 3JD74 4Q4V4 4Q4Y4 1MQTD 1R094 1OOPD 1RUF4 1VBC4 1ASJ4 1EAH4 4GB34 2R064 3JBG4 2RS34 1HRI4 1RUE4 1NCQD 1RUG4 1EV14 2HWC4 2RR14 4RHV4 1BEV4 1AR74 1AR94 1HRV4 1AR84 1NA1D 1RVF4 1AR64 1VBE4 1VBD4 2HWB4 2RM24 1RMU4 2X5ID 1RHI4 1VBB4 2PLV4 4Q4X4 1PO24 1R084 1RUI4 1AL24 1RUD4 1VBA4 2R074 1PVC4 1H8TD 4PDWD 2RS14 1POV0 1HXS4 2RS54 1PIV4 3J8F4 1RUH4 1D4M4 1Z7S4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PO1 4;  2RMU 4;  1COV 4;  1K5M D;  1VRH 4;  2R04 4;  1RUC 4;  4Q4W 4;  1RUJ 4;  3JD7 4;  4Q4V 4;  4Q4Y 4;  1MQT D;  1R09 4;  1OOP D;  1RUF 4;  1VBC 4;  1ASJ 4;  1EAH 4;  4GB3 4;  2R06 4;  3JBG 4;  2RS3 4;  1HRI 4;  1RUE 4;  1NCQ D;  1RUG 4;  1EV1 4;  2HWC 4;  2RR1 4;  4RHV 4;  1BEV 4;  1AR7 4;  1AR9 4;  1HRV 4;  1AR8 4;  1NA1 D;  1RVF 4;  1AR6 4;  1VBE 4;  1VBD 4;  2HWB 4;  2RM2 4;  1RMU 4;  2X5I D;  1RHI 4;  1VBB 4;  2PLV 4;  4Q4X 4;  1PO2 4;  1R08 4;  1RUI 4;  1AL2 4;  1RUD 4;  1VBA 4;  2R07 4;  1PVC 4;  1H8T D;  4PDW D;  2RS1 4;  1POV 0;  1HXS 4;  2RS5 4;  1PIV 4;  3J8F 4;  1RUH 4;  1D4M 4;  1Z7S 4; 
#chains in the Genus database with same CATH topology
 3SFE A;  1COV 4;  4YTP A;  2R04 4;  4Q4V 4;  1YQ4 A;  3AEG A;  1VBC 4;  1EAH 4;  5C2T A;  3GQK A;  2WP9 A;  5C3J A;  2RS3 4;  1HRI 4;  1NCQ D;  1RUG 4;  1EV1 4;  1NEK A;  2HWC 4;  3AEF A;  3AE7 A;  1BEV 4;  2PZS A;  1AR9 4;  3ABV A;  1HRV 4;  4YTN A;  3AEB A;  1KFY A;  2HWB 4;  2EX3 A;  1VBB 4;  1AL2 4;  2PW9 A;  3VR8 A;  3VR9 A;  1ZOY A;  1KF6 A;  2WDV A;  1XHX A;  3AEA A;  4YXD A;  4Q4W 4;  1K5M D;  4Q4Y 4;  2PYJ A;  1XI1 A;  1R09 4;  4YSY A;  2WDQ A;  4RHV 4;  3VRA A;  4KX6 A;  1AR7 4;  1AR8 4;  1RVF 4;  1AR6 4;  3CIR A;  4YSX A;  3P4R A;  3AE6 A;  2B76 A;  2PLV 4;  3AEC A;  1RUD 4;  1H8T D;  2RS1 4;  2ACZ A;  2H88 A;  2WS3 A;  1RUH 4;  3FI7 A;  1L0V A;  3AED A;  1RUC 4;  1RUJ 4;  3GQH A;  3JD7 4;  3VRB A;  1MQT D;  3P4P A;  4GB3 4;  2R06 4;  4YSZ A;  2WU5 A;  3JBG 4;  3P4Q A;  1RUE 4;  1XHZ A;  2WQY A;  4YTM A;  1NEN A;  3AE8 A;  2RM2 4;  2X5I D;  3AE1 A;  4Q4X 4;  1PO2 4;  1R08 4;  1RUI 4;  1YQ3 A;  1VBA 4;  2R7F A;  4PDW D;  2RS5 4;  3J8F 4;  1PIV 4;  3AE2 A;  1D4M 4;  2PY5 A;  1PO1 4;  2H89 A;  2RMU 4;  1VRH 4;  3SUC A;  1OOP D;  1RUF 4;  1ZP0 A;  3AE5 A;  4YT0 A;  1ASJ 4;  3AE9 A;  3AE3 A;  2RR1 4;  3SFD A;  2PYL A;  1NA1 D;  2FBW A;  1VBE 4;  1VBD 4;  2WDR A;  1RMU 4;  3P4S A;  1RHI 4;  3AE4 A;  2R07 4;  1PVC 4;  1POV 0;  1HXS 4;  2WU2 A;  3AEE A;  1Z7S 4; 
#chains in the Genus database with same CATH homology
 1PO1 4;  2RMU 4;  1COV 4;  1K5M D;  1VRH 4;  2R04 4;  1RUC 4;  4Q4W 4;  1RUJ 4;  3JD7 4;  4Q4V 4;  4Q4Y 4;  1MQT D;  1R09 4;  1OOP D;  1RUF 4;  1VBC 4;  1ASJ 4;  1EAH 4;  4GB3 4;  2R06 4;  3JBG 4;  2RS3 4;  1HRI 4;  1RUE 4;  1NCQ D;  1RUG 4;  1EV1 4;  2HWC 4;  2RR1 4;  4RHV 4;  1BEV 4;  1AR7 4;  1AR9 4;  1HRV 4;  1AR8 4;  1NA1 D;  1RVF 4;  1AR6 4;  1VBE 4;  1VBD 4;  2HWB 4;  2RM2 4;  1RMU 4;  2X5I D;  1RHI 4;  1VBB 4;  2PLV 4;  4Q4X 4;  1PO2 4;  1R08 4;  1RUI 4;  1AL2 4;  1RUD 4;  1VBA 4;  2R07 4;  1PVC 4;  1H8T D;  4PDW D;  2RS1 4;  1POV 0;  1HXS 4;  2RS5 4;  1PIV 4;  3J8F 4;  1RUH 4;  1D4M 4;  1Z7S 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...