1Z7S4

The crystal structure of coxsackievirus a21
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
68
Chain Sequence
GAQVSTQKTGAHENQNVAANGSTINYTTINYYKDSASNSATRQDLSQDPSKFTEPVKDLMLKTAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human COXSACKIEVIRUS A21
publication title The crystal structure of coxsackievirus a21 and its interaction with icam-1.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 68
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1z7s400
1EAH4 1HRV4 4Q4V4 2PLV4 4Q4W4 1PVC4 2R044 1EV14 4RHV4 2X5ID 1VBB4 1PIV4 1HXS4 1PO14 4Q4X4 1HRI4 1VBA4 1AR84 1AR64 1AR74 1OOPD 1MQTD 1R084 1RMU4 1VRH4 2RM24 1Z7S4 3J8F4 1PO24 2RS54 4GB34 1R094 1AR94 1RVF4 1RUF4 1VBD4 1RHI4 1VBE4 1BEV4 1AL24 1RUJ4 1ASJ4 1RUH4 2R064 2RMU4 2RS34 1NCQD 1NA1D 1RUI4 1RUG4 2RR14 2RS14 2HWC4 4Q4Y4 1D4M4 2HWB4 1RUE4 3JD74 1VBC4 1H8TD 1K5MD 2R074 1COV4 1POV0 1RUC4 4PDWD 3JBG4 1RUD4
chains in the Genus database with same CATH superfamily
1HRV4 3SUCA 3GQHA 1PVC4 1EV14 4YSZA 3AE4A 3SFDA 1PIV4 1HXS4 1PO14 3P4SA 4Q4X4 2ACZA 1AR84 1MQTD 1RMU4 4YTPA 3AE1A 3J8F4 3FI7A 1NEKA 1R094 4YSYA 2WU2A 1ZP0A 2R064 1ASJ4 1RUI4 1RUG4 4Q4Y4 2HWB4 3JD74 2PY5A 1COV4 1POV0 2WS3A 3AE3A 3SFEA 1EAH4 3AECA 2WDRA 2WP9A 4YT0A 1KF6A 3VR9A 5C2TA 1VBA4 1Z7S4 1AR94 3AE6A 1RUF4 1RHI4 3AEEA 3VRBA 2RS34 2EX3A 2RMU4 1NCQD 1D4M4 1H8TD 1K5MD 3AE5A 2WDVA 1NENA 4PDWD 4Q4V4 4Q4W4 2B76A 2PYJA 1KFYA 2WDQA 3GQKA 4RHV4 1ZOYA 2X5ID 3P4QA 3AEFA 2R7FA 1HRI4 2PYLA 1AR64 1VRH4 3AE9A 2WQYA 3VRAA 2RS54 4GB34 3P4RA 1VBE4 1AL24 1RUJ4 1YQ3A 1NA1D 2RR14 3AE8A 2HWC4 2PW9A 1VBC4 1L0VA 4YSXA 2R074 2RS14 1RUC4 1YQ4A 3P4PA 1RUD4 1XHXA 1XI1A 2R044 4YTMA 3VR8A 3AEDA 1VBB4 3CIRA 1OOPD 1AR74 1R084 2RM24 3AE2A 2H89A 1PO24 2WU5A 4YXDA 4KX6A 1RVF4 1VBD4 5C3JA 4YTNA 1BEV4 1RUH4 1XHZA 2H88A 3AEBA 2PZSA 3AEGA 3AEAA 3ABVA 1RUE4 2FBWA 2PLV4 3JBG4 3AE7A
chains in the Genus database with same CATH topology
1EAH4 1HRV4 4Q4V4 2PLV4 4Q4W4 1PVC4 2R044 1EV14 4RHV4 2X5ID 1VBB4 1PIV4 1HXS4 1PO14 4Q4X4 1HRI4 1VBA4 1AR84 1AR64 1AR74 1OOPD 1MQTD 1R084 1RMU4 1VRH4 2RM24 1Z7S4 3J8F4 1PO24 2RS54 4GB34 1R094 1AR94 1RVF4 1RUF4 1VBD4 1RHI4 1VBE4 1BEV4 1AL24 1RUJ4 1ASJ4 1RUH4 2R064 2RMU4 2RS34 1NCQD 1NA1D 1RUI4 1RUG4 2RR14 2RS14 2HWC4 4Q4Y4 1D4M4 2HWB4 1RUE4 3JD74 1VBC4 1H8TD 1K5MD 2R074 1COV4 1POV0 1RUC4 4PDWD 3JBG4 1RUD4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EAH 4;  1HRV 4;  4Q4V 4;  2PLV 4;  4Q4W 4;  1PVC 4;  2R04 4;  1EV1 4;  4RHV 4;  2X5I D;  1VBB 4;  1PIV 4;  1HXS 4;  1PO1 4;  4Q4X 4;  1HRI 4;  1VBA 4;  1AR8 4;  1AR6 4;  1AR7 4;  1OOP D;  1MQT D;  1R08 4;  1RMU 4;  1VRH 4;  2RM2 4;  1Z7S 4;  3J8F 4;  1PO2 4;  2RS5 4;  4GB3 4;  1R09 4;  1AR9 4;  1RVF 4;  1RUF 4;  1VBD 4;  1RHI 4;  1VBE 4;  1BEV 4;  1AL2 4;  1RUJ 4;  1ASJ 4;  1RUH 4;  2R06 4;  2RMU 4;  2RS3 4;  1NCQ D;  1NA1 D;  1RUI 4;  1RUG 4;  2RR1 4;  2RS1 4;  2HWC 4;  4Q4Y 4;  1D4M 4;  2HWB 4;  1RUE 4;  3JD7 4;  1VBC 4;  1H8T D;  1K5M D;  2R07 4;  1COV 4;  1POV 0;  1RUC 4;  4PDW D;  3JBG 4;  1RUD 4; 
#chains in the Genus database with same CATH topology
 1HRV 4;  3SUC A;  3GQH A;  1PVC 4;  1EV1 4;  4YSZ A;  3AE4 A;  3SFD A;  1PIV 4;  1HXS 4;  1PO1 4;  3P4S A;  4Q4X 4;  2ACZ A;  1AR8 4;  1MQT D;  1RMU 4;  4YTP A;  3AE1 A;  3J8F 4;  3FI7 A;  1NEK A;  1R09 4;  4YSY A;  2WU2 A;  1ZP0 A;  2R06 4;  1ASJ 4;  1RUI 4;  1RUG 4;  4Q4Y 4;  2HWB 4;  3JD7 4;  2PY5 A;  1COV 4;  1POV 0;  2WS3 A;  3AE3 A;  3SFE A;  1EAH 4;  3AEC A;  2WDR A;  2WP9 A;  4YT0 A;  1KF6 A;  3VR9 A;  5C2T A;  1VBA 4;  1Z7S 4;  1AR9 4;  3AE6 A;  1RUF 4;  1RHI 4;  3AEE A;  3VRB A;  2RS3 4;  2EX3 A;  2RMU 4;  1NCQ D;  1D4M 4;  1H8T D;  1K5M D;  3AE5 A;  2WDV A;  1NEN A;  4PDW D;  4Q4V 4;  4Q4W 4;  2B76 A;  2PYJ A;  1KFY A;  2WDQ A;  3GQK A;  4RHV 4;  1ZOY A;  2X5I D;  3P4Q A;  3AEF A;  2R7F A;  1HRI 4;  2PYL A;  1AR6 4;  1VRH 4;  3AE9 A;  2WQY A;  3VRA A;  2RS5 4;  4GB3 4;  3P4R A;  1VBE 4;  1AL2 4;  1RUJ 4;  1YQ3 A;  1NA1 D;  2RR1 4;  3AE8 A;  2HWC 4;  2PW9 A;  1VBC 4;  1L0V A;  4YSX A;  2R07 4;  2RS1 4;  1RUC 4;  1YQ4 A;  3P4P A;  1RUD 4;  1XHX A;  1XI1 A;  2R04 4;  4YTM A;  3VR8 A;  3AED A;  1VBB 4;  3CIR A;  1OOP D;  1AR7 4;  1R08 4;  2RM2 4;  3AE2 A;  2H89 A;  1PO2 4;  2WU5 A;  4YXD A;  4KX6 A;  1RVF 4;  1VBD 4;  5C3J A;  4YTN A;  1BEV 4;  1RUH 4;  1XHZ A;  2H88 A;  3AEB A;  2PZS A;  3AEG A;  3AEA A;  3ABV A;  1RUE 4;  2FBW A;  2PLV 4;  3JBG 4;  3AE7 A; 
#chains in the Genus database with same CATH homology
 1EAH 4;  1HRV 4;  4Q4V 4;  2PLV 4;  4Q4W 4;  1PVC 4;  2R04 4;  1EV1 4;  4RHV 4;  2X5I D;  1VBB 4;  1PIV 4;  1HXS 4;  1PO1 4;  4Q4X 4;  1HRI 4;  1VBA 4;  1AR8 4;  1AR6 4;  1AR7 4;  1OOP D;  1MQT D;  1R08 4;  1RMU 4;  1VRH 4;  2RM2 4;  1Z7S 4;  3J8F 4;  1PO2 4;  2RS5 4;  4GB3 4;  1R09 4;  1AR9 4;  1RVF 4;  1RUF 4;  1VBD 4;  1RHI 4;  1VBE 4;  1BEV 4;  1AL2 4;  1RUJ 4;  1ASJ 4;  1RUH 4;  2R06 4;  2RMU 4;  2RS3 4;  1NCQ D;  1NA1 D;  1RUI 4;  1RUG 4;  2RR1 4;  2RS1 4;  2HWC 4;  4Q4Y 4;  1D4M 4;  2HWB 4;  1RUE 4;  3JD7 4;  1VBC 4;  1H8T D;  1K5M D;  2R07 4;  1COV 4;  1POV 0;  1RUC 4;  4PDW D;  3JBG 4;  1RUD 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...