1Z7WA

Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Molecular Basis of Cysteine Biosynthesis in Plants: STRUCTURAL AND FUNCTIONAL ANALYSIS OF O-ACETYLSERINE SULFHYDRYLASE FROM ARABIDOPSIS THALIANA.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 121
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7wA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7wA02
1KL7A 5DVZA 4D9FA 5B36A 2RHGB 5IW8A 2GN0A 3R0XA 5IWCA 1QOQB 1K7EB 5B53A 1UBSB 5B1HA 4D9IA 1TDJA 2CLEB 4NU8X 3IQIX 1KFKB 4LI3X 2Q3CA 4D99A 4OREX 2D1FA 1V7CA 2GN1A 2RKBA 4D9NA 3R0ZA 1C29B 5I7WA 2CLMB 2DH6A 2ZPUA 1D6SA 3DWIA 1WDWB 2ECOA 5D85A 4ZQCB 3SPXA 2EFYA 3PC2A 4HPXB 3VC3A 5DBHX 4IL5A 2RH9B 1FCJA 1K8ZB 1K7FB 1WKVA 4AIRA 4HPJB 4L3VA 3DKIA 3PR2B 4JBLA 4L28A 1RQXA 3IQHX 2CLKB 2J9YB 4I1YA 1E5XA 5B55A 1J0DA 4D92A 1P5JA 3SS9X 1KFEB 5E0KB 5D87A 1BKSB 4D8UA 2CLIB 2J9ZB 3BM5A 3TBHA 4HT3B 4ZU1X 1KFJB 2JC3A 3L6BA 4Y6GB 1A50B 1VE5A 4D9GA 1M54A 4H27A 1UIMA 1OASA 5JISA 4D96A 2C2BA 5I7RA 1F2DA 1WBJB 4QYSA 3VSAA 4KKXB 2TYSB 5J43A 5KINB 1UINA 1KFBB 5JJCA 5DBEX 1V8ZA 4L0DA 2ZSJA 1JBQA 5EY5B 2ISQA 3PC3A 4D8WA 1K7XB 3VSDA 1WTCA 1CW2B 1C9DB 2Q3DA 3HMKA 1J0AA 5HBGA 4LMBA 1TZJA 1TTPB 1Z7YA 2EGUA 1FUYB 1TJPB 3FGPA 1C8VB 2O2JA 1Y7LA 3PC4A 4NEGA 2ZR8A 1X1QA 1QOPB 1A5SB 1KFCB 2J9XB 3IAUA 3SS7X 3X43A 4D8TA 5I7HA 4HN4B 4WX2B 5CVCA 3AEXA 1J0BA 1TZKA 2CLFB 2GN2A 3IQGX 5J5VA 1TYZA 2CLOB 1PWEA 3ZEIA 1K8YB 1J0CA 4LMAA 3VBEA 5BW6B 1CX9B 4JBNA 5D86A 4D9CA 3T4PA 1TZ2A 2WSYB 3CEPB 3FCAA 4HO1X 4D9BA 2DH5A 5KZMB 4D9KA 1BEUB 5I7AA 5DW0A 5IXJA 3X44A 1K8XB 1TTQB 1V71A 5C3UA 1Z7WA 3L6RA 1VB3A 5I6DA 4L27A 3DWGA 2ECQA 2BHSA 5CGQB 2O2EA 2TSYB 1K3UB 4ZU6X 2TRSB 1J0EA 3AEYA 2PQMA 2V03A 4PCUA 5T6MA 4F4FA 1PWHA 2C2GA 4OFXA 1A5BB 2CLHB 4AECA 4D9EA 2CLLB 5D84A 5B1IA 4COOA 5I7OA 2Q3BA 4D97A 4D9MA 1A5AB 1VE1A 3VSCA 3V7NA 5B3AA 3RR2A 5DW3A 2BHTA 1TZMA 3L6CA 4XUGB 1O58A
chains in the Genus database with same CATH superfamily
4YP6A 2OXFA 3FETA 1S2MA 1Y4UA 5KX5B 4GSLA 4DCJA 2FMUA 4NY1A 3FHTA 1C1HA 1U1EA 4HNQA 4RPKA 2OWDA 1LI5A 3K72B 3OBIA 3IELA 1RSZA 1CRLA 1Y6QA 3MGGA 4Y1RA 5IJ9A 5T6BA 3GDHA 1TCVA 4PGFA 1NW9B 1WVGA 2G0AA 3PUWA 3ERCA 2ZZKA 5IM4F 2R6DA 2W6PA 3AVVA 1OI7A 2FH5B 1Z8HA 1II8A 4Z54A 1Y9AA 3K1ZA 4LZWA 4M2LA 3TKYA 2HBRA 4BBZA 1KKUA 4GDFA 1JHVA 2C57A 3GFFA 5AESA 3KQTA 1P72A 3B1WA 5ECDA 3HVKA 1IY0A 1LLQA 1YDHA 2X7HA 3BFXA 2VH2A 4MB2A 4YONB 5IHXA 5DDIP 1H9CA 3OEHA 2PZLA 4CU5A 4HFMA 4DSNA 1L7BA 1P18A 1XKQA 3ZY6A 1JAZA 4DA8A 5LM3A 1YCDA 3AUJB 1CJCA 4EA9A 2J9YB 4Z4HA 1K08A 5C3MA 1SM4A 2ZB8A 3JATA 4IJ5A 2XRZA 3WWYA 3JVIA 2IVZA 2QQEA 1DEXA 3PFBA 2QLBA 2ZYDA 4DV5B 2R00A 3PC6A 1YU6A 1YRWA 4GR9A 4MWCA 1T15A 3L7IA 4TLDA 4BKMA 1CZUA 2FPMA 1SXJE 2ZPAA 3EAFA 1OMOA 1Z5WA 3B20A 3BK2A 5FNVF 2BL4A 4LRSB 4TTPA 5T64A 1XQWA 3V8MA 2YHSA 5AVWA 4FBMA 1E6WA 1OFUA 2FLWA 2IZ7A 4LW8A 5BNFA 5F7OA 2VJQA 1Z0DA 2GARA 1R0XA 2GF9A 4XB6B 5EVCA 2PUFA 5LOVB 4DRYA 4IAOA 2XXAA 5HKKA 2X8JB 4EB3A 1W36C 2C2WA 4P3NA 4AXXA 1VE9A 2Q2NA 2ZJ6A 2ZVQX 1KY5A 3D7RA 5CMLA 2NYRA 3KLOA 3IS3A 4WACA 5D00A 5F78A 1NOJA 1CJKC 1GSAA 1YFLA 2CL5A 3KZKA 2O59A 2V7PA 1Q5PA 2MR6A 3N39C 2VPTA 2PSFA 4Q4LA 3ZE0B 5K0LA 3T5BA 4PYJA 3HM9A 4PS0A 4F0JA 3FN4A 1J42A 4M0CA 5CBPA 5COBA 3ZXSA 2WVAA 3BKWA 5LBTA 4TMYA 2FE1A 2B61A 3L92A 5KHAA 1THZA 1E7SA 4ZO6A 3WK5A 1H5NA 2VKQA 4M9QA 3R5KA 5L40A 5F33A 1ULTA 5KYUA 1CQJB 2BOVA 3EUEA 3EXG1 3BSWA 1IN6A 2JZNA 2JANA 3OI7A 2HEIA 4KYIB 3MMNA 1PCXA 3JWJA 4GPEA 3V2HA 5CITA 2C5FA 2YVUA 2UUCB 1U3WA 4K87A 3RK1A 4ED9A 1UKBA 4YUXA 4WFKA 2JBAB 1A71A 4MUYA 4R3UC 3S2EA 3BZBA 3KT8A 1E5DA 1QR2A 3SU8A 1VECA 3ICPA 1NLYA 4PQRA 1VCNA 3F49S 4IOKA 3AEYA 2PY6A 3EJ6A 1T8UA 5F7ZA 1XF9A 3BQMB 3AERA 3LFHA 3UT5A 4PWZA 2YZ2A 4BLOA 3KZCA 3GLHA 3HCCA 2ZJ5A 2TS1A 3P7MA 4LYFA 1OYOA 1Y4DE 4PPYA 4CL8A 2NU8A 3Q0TA 4QUIA 5IVPA 2IBMA 4RXMA 4CUKA 2FFHA 1PKXA 3CKLA 4BP9A 4UW9A 3S55A 2DERA 1SD1A 3QITA 4ZV7A 5EJ5A 1FYWA 1FUIA 3AEUA 4OMDA 4RJIA 2JFQA 3JU3A 3EFEA 4CEJA 1ILWA 1JI3A 4XDZA 3UUWA 1P3JA 1FP2A 1S2OA 3CNEA 4D3YA 3VOTA 2YWHA 2GWHA 3THYA 4K05A 3LVFO 4MRNA 2GDJA 4XPZA 3CF4G 2IP1A 4A8JC 4UPVA 5K8VA 2GEJA 4L8VA 1C14A 3D59A 4OAOA 4WKOA 1W36B 2IEIA 3T9CA 1BFUA 1K06A 1PR6A 2XVMA 2ACVA 4LAFA 4LHZA 1IM8A 1OI2A 1TVKB 3IAS1 2EJWA 3FYTA 2V6IA 3UKJA 2P7IA 1O4WA 2SKDA 4U6NA 2DWPA 3LYUA 2IT1A 4AJOA 4Z4IA 1B76A 3QIAA 2G6TA 4NAHA 3D8NA 2HREA 4W7SA 1N9ZA 4QYTA 4DGSA 1YA8A 3VJRA 4LN1A 2GYYA 1MJGM 1SCJA 2EW1A 2O7VA 3B12A 2AQHA 1FMJA 3HPRA 3IDZA 3CRZA 1WXFA 3PLRA 4WXYB 4YAWA 5GOZA 3L9XA 3ORHA 5JCJD 4N0QA 4GP7A 1Y6GA 2C2XA 3EIQA 2AFVA 1GXSB 2PGDA 2YWBA 3LCUA 1H5UA 2DFDA 3K31A 3LD9A 4H3SA 4ZAXA 4B44A 4Y6SA 3DNMA 1GY8A 2OCBA 3OKPA 3K5IA 2YNMC 3U7JA 3WNQA 1H4SA 3HVUA 3JASB 1NBEA 2Q28A 4ZYUA 3K6SA 2G7ZA 4FHEA 2F1IA 4HAOA 1PR1A 1L5QA 1P5RA 4Q12A 2A33A 1XEXA 3MJDA 4HWGA 1CZNA 1T25A 3IVCA 1U0EA 1PW7A 2JBWA 4LZZA 2Y1OA 3S2UA 4YMLA 3LECA 2II6A 2FPPA 5E1OA 4YJ3B 5I4IA 4K9OA 5H82A 4YWJA 3FM9A 5BURA 2MDTA 2WQZA 2HAEA 1R27A 1Y5MA 3AUAA 4ID9A 2IRWA 2PPVA 3TTTA 1SBIA 4GEGA 2DF8A 1Q7EA 5L9AA 1VG1A 1CY0A 2UZ1A 5ECGC 2IPLA 1KETA 1C0IA 2XRYA 3HNRA 3GVXA 3A6FA 3L0PA 4HGPA 4RHCA 2O8CA 4YROA 1TYAE 3CLKA 2WHPA 3DZDA 2IXEA 1E1RD 4IRMA 4NABA 3UMGA 4KLRA 4EYGA 3E7XA 3KVOA 1XPUA 2BEJA 2V6MA 4FW8A 4OLHA 1DIRA 4ZT2A 4PO3X 5KWSA 3H2YA 3FGZA 3TXYA 1Q1GA 1QAOA 2W43A 3FCAA 4L51A 4MGHA 4TLLB 2HMUA 1Z5GA 3ANLA 1E2DA 1YUNA 3OLCX 5LA6A 5EGNA 1NXTA 4BU1A 5DBIA 4XRGA 1BN7A 2JGLA 3FTPA 3HR8A 5A3RA 3HR7A 3TSCA 3JQ8A 1USKA 4AUNA 1QANA 1VI5A 4YX9A 5J3JA 2RGCA 3QMWA 2IV3A 4ZCPA 3HZOA 4CHGA 1AK1A 1QO7A 2NYUA 4B3SB 2A5DA 5PGMA 1C30A 2OYRA 3K0CC 1J25A 4JJ6A 4R6WA 3IMEA 2WMDA 4PLGA 3WQQA 4PTZA 1YI0A 2QGZA 4MLZA 4WLNA 2J6HA 3OWXA 2B30A 1HDCA 2VPYA 1XTPA 2WD7B 3CSUA 3ZYCA 4B0OA 5E6UB 3G79A 3P0HA 2ZRDA 4QYMA 3K3PA 2Q6VA 3KVVA 2Q6OA 2FEOA 2W48A 3VMMA 4DILA 2BW0A 1TLTA 3DAGA 3AR6A 3K9LA 4I5GA 3I6IA 4JLPA 4QD3A 4QEKA 1I0LA 1UXHA 4FP9A 1DX9A 4QGAA 3OCUA 4D6PA 2IUYA 2FFRA 1VLZA 1W4BA 3QVTA 4ZO7A 1EK5A 5AKLA 4FUQA 5DNWA 3BE8A 2DXIA 1CIPA 1HE5A 4FT2A 5C8DA 5C8YB 3X1MA 3WXMA 3EZ9A 5AI6A 4RKFA 3HJFA 3V8QA 4BV2A 3ZWAA 1LKZA 4DADA 3OU2A 1GWNA 2HNBA 2H1FA 4LCEA 2X1LA 1BQEA 2YWFA 4D8XA 3HB5X 1WMFA 5HRCA 4HK4A 3AM3A 2YN4A 5IJAA 1QP4A 3O4GA 3BMNA 1A8QA 1U8CB 2H06A 4ZQFA 1SXHA 1Y9EA 1B23P 4QUBA 1NF3A 3CBGA 5HQ3A 5C80A 2IYLD 5JMWA 1U0GA 2PUBA 3BHIA 5HPYB 3R9XB 1U6IA 2XF8A 3NORA 4K0RA 4IPTA 4W1SA 3QVGA 5KS2A 3I62A 2C94A 4CMHA 1TX4B 3KXIA 4Y3UA 1EIWA 3RABA 1RI5A 2PX0A 2NUTA 2PRJA 1PGNA 3IJEB 3ICEA 4R0MA 2Q1XA 4O0LA 3ZLUA 1WUHS 2Q7XA 4ZCQA 5FUMA 4JUIA 1J2UA 1N6PA 1TOAA 4WK2B 2NOAA 4ER3A 1B8PA 1GGNA 3GQBB 4MEJA 5AKEA 5JJCA 2QGNA 3VKFA 1C0EA 3OZ7A 5EMJA 1YRAA 3CH7A 3JD4A 4X1YB 3OZWA 2J3EA 1OC2A 2A0XA 3WHKA 1ST3A 3FSJX 1PT7A 3JWIA 4I1OA 4ZVOA 5KEIA 3ZGZA 2O0LA 5HF9A 2WF8A 1CG6A 2X0RA 1VLQA 3JQ9C 2BTQA 3KUXA 1TK2A 1Y1PA 2F1KA 1V3UA 2MTBA 1MRZA 3EFBA 2OG2A 1PT6A 2EWMA 1DQZA 3BGIA 3WKBA 5IFKA 1SC9A 2C61A 3TQRA 3CM0A 3E15A 4CJXA 1T36B 1N0UA 1YBHA 2YMMA 1RU3A 2CVFA 3CBQA 5CNKA 5IAJA 3A58B 3TK1A 2J5BA 1UBJS 3WFZA 3TGLA 3U3JA 4EL5A 3KYIB 3KOUA 4CZ2A 4AY6A 1JWAB 1UDBA 4HDRA 1BEUB 4LQ4A 4NPCA 1V2HE 1VKHA 1E9EA 4FJ0A 4JU8A 4MVYA 3NHZA 1QYDA 1ZQ1A 2WVGA 3I6YA 4UULA 2W2OA 3EGDB 2PUJA 3PXGA 4J75A 2YWRA 3V7YA 1GQSA 1OIXA 3L02A 2V97A 2QPAA 2RH4A 4LJYA 3WGLA 2C3YA 2W8BB 4PTLA 2H2DA 5FADA 5AK6A 2OXCA 1ECCA 3OFND 1UBLS 4MDEA 4D8VA 1UC5B 1NVWQ 4MTCA 1SGWA 4DA4A 2BT4A 3VZPA 4TMKA 3WGTA 1OFGA 4ZYWA 3KETA 4G0UA 1VRVA 4UNSA 1DTEA 2FXVA 3AHFA 3MTIA 3ZIAD 4MIYA 3IXMA 5K0JA 3BD9A 2IUFA 4MXDA 1BKYA 1VG8A 2IY9A 3HS3A 2JAHA 3NBFA 3F8WA 3DFUA 3QU7A 5DTEA 2UYOA 3EC7A 3LHFA 1TYDE 4RHFA 1W5TA 2FK7A 2FMHA 2WI8A 4G8DA 3BS4A 2P1RA 4KYTA 2RGEA 3ORYA 3Q3VA 4RF5A 1OSNA 1UXKA 3FCCA 3DZKA 1PAUA 3C3XA 1C9NA 1ZBQA 5CEEA 4L2IA 3VO9A 4II2A 2JARA 3CUEF 1E3DA 2EHDA 2P8SA 3TQSA 3AHCA 3HUFA 4BEWA 4PX2A 3X1YA 4YDRA 2R6FA 1X9GA 1JIJA 5DBHX 1VCHA 4YT2A 2IY8A 3BC1A 1XQ9A 1IPHA 4AIRA 2VF8A 3KOZA 1JV2B 1RAFA 3OJFA 5G02A 1SOWA 4QOHA 5CFNA 5CD1A 5A7FA 1NR5A 4ZZIA 2H5LA 3DBVO 3N8NA 3ZHRA 4ZOEA 1UBTS 1FP4A 1QVAA 3N1UA 4TT3A 5CNIA 4D57A 2O5EA 4P7GA 3NC1C 4TTTS 3WLLA 1DJQA 1F8GA 1W5EA 5E3JA 5EZYA 2NNWB 2REBA 1NPYA 4Z9YA 3M3DA 2I99A 2C7VA 1FJGB 1BQ4A 3NUQA 2IS4A 3SMVA 1PYOA 3SDSA 1SUAA 1P2TA 4NU6A 3RCBA 3T9BA 3KAPA 3I5XA 3RARA 3UJPA 3FGOA 3X1XA 2VJLA 3IKMB 2G5TA 3DMNA 3EVZA 1VSVA 4OUKX 4WCFA 1KFBB 3CZMA 1MTOA 1XA3A 2XYPA 4F46A 2A94A 3QV1A 3QW4B 4C4PA 1CY2A 1N0VC 1S2GA 2E7ZA 5DYGA 1JEQB 3L7LA 3G1TA 2PZMA 3UN1A 3F96A 3GLFB 1NURA 4G86A 3BK1A 1JG4A 5A04A 1QK5A 5HR5A 4D46A 1CF9A 2O7NA 1L6RA 3DB2A 3DD1A 2BFDB 4IJ6A 1W6UA 3K2IA 4LBZA 1RMQA 3MTDA 4P7FA 3L7CA 3ESQA 2D0OB 1OWMA 3BWVA 3DLTA 5DI3A 1PGOA 1HQCA 5A7HA 4L16A 3RIHA 1ACLA 5BSHA 1L5RA 1JDJA 1T8SA 3RUFA 4BX2A 2G1PA 4LZJA 5K4GA 3VRHA 3JQCA 3WBKA 5LZ2A 3HHPA 2PX6A 1ISSA 1ITZA 2QNRA 2C8LA 4J2OA 3AF4A 3L8HA 1UK8A 1PT5A 3FAKA 5HRUA 1AKRA 2JGDA 4S1OA 2HD4A 2CL6X 1K3UB 1HI9A 4P34A 1MG0A 3WGMA 4PNEA 4Y2GA 8LDHA 2VLBA 1SH7A 1JKJA 3CQ9A 2XITA 1LVHA 1ELOA 5FT9A 4MS4B 4FYPA 3S1AA 1Q77A 3ZDQA 1RPNA 3B3FA 3UUEA 2JL1A 4CIXA 4CQLB 1YDGA 1Z5VA 5EXSA 4TOIA 5HVNA 5L8VA 4G1UC 5FEMA 5TEWA 3RYHB 5LQSA 5H59A 2HU8A 1PKEA 3P94A 3MS7A 1J9ZA 2IIPA 1YAJA 2PSHA 1EDDA 2QUZA 3LUBA 1FJHA 4M9CA 4LUCA 5C5EA 4JT2A 4QVKA 1UAGA 3DEJA 4MUIA 2WY2D 1Y6JA 3DF7A 4V3CA 1YTUA 1YQWA 3ML1A 5EXEA 2WB4A 5ECYA 4R9RA 3UA3A 1AS0A 1KDPA 1SUCA 2CXRA 4ZOQI 1RYBA 4TSFD 2GN1A 4D9NA 2CNKA 3K4PA 4I46A 5H4HA 1DUSA 4XM0A 1W5BA 5CTJA 4UDNA 1QOZA 2Q2WA 5DX1A 3VO2A 2WG0A 2CYAA 4HAWA 2X9VA 4HQOA 2AC2A 4KRXA 1IAQA 1E6CA 1X1RA 1YGPA 2IYYA 1YBMA 4GP9A 2AR7A 2W4MA 3LXUX 2IUSA 3OECA 4GKKB 2BGIA 3HKDB 3WJAA 4JX9A 4V0NA 4Q3NA 3KXKA 4XIYA 3WMFA 2C4KA 4HXFB 5AK5A 5ICMA 1WTAA 2IZ6A 2HRCA 3LG2A 2E6KA 1CUHA 3LGSA 5TY0A 3T8YA 2GO7A 2JLYA 3OM1A 5E0KB 1KSGA 2AOTA 3NEJA 1SBNE 3I8SA 3SXUA 4I1RA 3P9NA 2VZ8A 4GIBA 5L3VA 2X76A 4AUEA 1UKVY 2EZTA 2OMEA 3OT1B 2W6MA 3QU5A 4TKLA 1RI1A 3VI3B 3G2OA 5ALZA 2XZTA 1XJQA 3A2KA 1MJ5A 1N2IA 5IH7A 4RAQA 2XADA 4JS0A 1F2DA 1D1QA 2W6OA 4KV7A 4MWZA 4NOKA 3PC8A 5F5XA 5HCNA 2WVHA 4URUR 4E1VA 2J59A 5KCZA 3JSAA 3RJ9A 5EP4A 3RRNA 4M8NE 4NMMA 4W4TA 3ZK7A 3CFYA 4QJBA 3GFBA 1LSUA 2EU8A 3Q7QA 1B74A 4UBMA 1HG1A 5FB3A 1V45E 1KEPA 2ORED 2Q3DA 3D5TA 1G21E 4NATA 1RNLA 2OCGA 2R5FA 3UAOA 4N5NA 2D54A 1GGJA 2JH9A 2OESA 4KQIA 3EF0A 3OQNA 1GUDA 3HUUA 3GFSA 3NGLA 4L8WB 3TJMA 1EINA 2YHBA 4X61A 1LK7A 2QP9X 4EY3A 4LMRA 5AP9A 4D1YA 4YPOA 3LOUA 4QEDA 4YP7A 2WZDA 4RPHA 1RXEA 3CLTC 3HKBB 3FZEA 5TGTA 1TD1A 2GTHA 1NMXA 4EF5A 3U6BA 2G40A 1KI3A 3FFTA 4EX6A 5IKEA 4F1WA 1QQTA 2CXHA 4NL4H 1Y4SA 4N8SA 4CTNA 4GQIA 1TUIA 1SVLA 3N0XA 3VPXA 4DZRA 3OUUA 5JPCA 4HHEA 4F5DA 1SVNA 2R62A 4INJA 2B0CA 3IEPA 1P5HA 3NHJA 1WM1A 3QRWA 2JGKA 1UFQA 1KH2A 2O2EA 3F8TA 3GMTA 2QPTA 4RORA 3MAAC 3RTBA 1L6IA 4ALNA 2PD3A 5F4BA 3UJCA 2EFGA 1LX6A 1UL1X 1SKAA 2FMXA 2IIBA 5FRDA 4PQEA 3P20A 1ORVA 3R24A 2V7VA 3WYDA 1XXLA 2F67A 2ZKLA 5AM3A 2VPWA 3KKQA 5KJFA 5F3RA 1WKCA 3KO8A 3ZVRA 1WUIS 1AO3A 1LS6A 3NPAA 3RRBA 1QV7A 4C4SA 4JJGA 5EXTA 5JLAA 1MT3A 1V0JA 1J8MF 2WWTA 4O2AF 3ZU2A 2QTZA 3EBPA 1XPJA 4YRMA 1H3EA 5A0VA 2GS9A 3I0NA 4CG1A 4LNUA 4D8YA 5C8VA 4J16C 3KDAA 2VJKA 3WSTA 4O4HF 3U9LA 2VH1A 2IPAB 1L4GA 2VXYA 1K9VF 4O4IB 4YMUA 1X87A 1M67A 4YACA 4C0XA 2ZS8A 1RYMA 3UXHA 3ZWXA 3RVMA 1WUJS 2BFCB 2OENG 4D82A 2X5KO 1G6Q1 2VA9A 2JFHA 4LE1A 2LIPA 3N07A 4PW0A 3HCPA 5EWJB 4A10A 5ELXA 4ALIA 3FVWA 2XCUA 3IPAA 2L82A 3DZFA 4WQMA 5HF5A 2WB2A 3T35A 2RGNA 3GAAA 1U2GA 3F6SA 4ZZ1A 5TV2A 3H1AA 2VCYA 4WMLA 2ZEJA 1QFXA 3DKIA 3KK0A 2C2ZA 4PFQA 4DEYA 3AVXA 3ANTA 4AJEA 1P45A 1A04A 1UEJA 2SHKA 2CK3D 4U3JB 4DCMA 1Q84A 1G6HA 3U4AA 1E2JA 1AO0A 1ZC4A 3KQVA 2HF8A 1XTTA 1NW7A 1AHNA 2JJ1D 3F74A 3F78A 3LOQA 3NP9A 2GCIA 2BSQA 1XTSA 4EGJA 3BM5A 4GMFA 2G80A 2R8ZA 3PQ5A 4L95C 5GONA 4BFUA 1PJTA 1JZQA 4BN0A 1V3TA 6ADHA 3DYIA 1A50B 1PRYA 1YS7A 1DXYA 4MGKR 1E89A 4JJKA 5CB0A 4JNCA 4BMCA 3J81A 4LI0A 4YCSA 1TCBA 3F5DA 3LC2O 1Y7PA 4M0UA 4WW0A 5K05A 4RK4A 1K0FA 5C1OA 1D9ZA 2GVZC 4I6EA 5JADA 2EAUA 1K4KA 2HK7A 1NYRA 4D9JA 1FFCA 4X6XA 1F8YA 1NVKA 2EW8A 1RBYA 2AJ8A 2VZLA 4LRQA 4CM7A 2AG0A 3ZD6A 1LB1B 2MHCA 3VR3D 1NQ5A 1RWWA 2H7YA 2W6IA 4GLOA 1IUNA 1EM8B 3VH2A 3RHFA 1R15A 1Y7LA 1H3FA 5CVUA 5I5GA 2C5AA 1OX4A 3I8XA 4PIPA 3ZDRA 1E32A 1KY2A 2ZRPA 1FMFA 2E21A 3TCKA 3ZCVA 1NXSA 2HM7A 2ZE7A 3A1VA 1F0YA 1DWUA 3VAZA 1YK1A 1PGJA 4E46A 1ZXXA 2LIVA 3HXKA 3Q0IA 4HGNA 1IOWA 1BE0A 1VHWA 5H9WA 3K2BA 1JFLA 3KFXA 1AD2A 2WSBA 4OOFA 1PHRA 1XWWA 2BM9A 4YPFA 1CLUA 2IIQA 4NP6A 5LMNB 2GZAA 4BEJA 1M2EA 5KYWB 3DVRX 4TXJA 4WINA 1HPLA 1AXRA 4FFNA 5EUBA 2RIRA 1NJ2A 2AMVA 1BE1A 1KAQA 3G0GA 3T4EA 3VNBA 2VP2A 3K05A 4IOMA 2H3HA 3CLUD 5TRTA 3BMXA 5J2TB 2J3MA 4ZVVA 1F7UA 1SXIA 3EA4A 4FGLA 4EI2A 1K88A 4FDVA 4M46A 3G9UA 4P4SA 4PFSA 3VU3A 4PGHA 2HHHB 1NOKA 5ALPA 2F4NA 4MQ5A 4QHTA 3C87A 3FUCA 3LX4A 3D6HA 4NCKA 1KK1A 1T4BA 3B5IA 4MPRA 3EE6A 4WZZA 3IIEA 3GDOA 4QC2A 4DCTA 1CYEA 2F7SA 3H9QA 3PWTA 5DBFA 3EXG2 3T9EA 4B84A 3JPYA 2Z9BA 3KZVA 1ZUIA 1M1ZA 1RQPA 2XR1A 1N2HA 1JDPA 4MVJI 4QPPA 4OHFA 2GM4A 3OJWA 2ONYA 1VKOA 1N2EA 3VOSA 1EHCA 1YZKA 2QUIA 2WTXA 3DOFA 2C4NA 3K1YA 4R4JA 1DTWB 2FEPA 2ZGVA 3MTBA 3OPVA 4C7OB 3WWCA 1D4OA 3AR9A 3MJSA 1PVDA 4WHMA 1UEIA 3UATA 1VE6A 4RDXA 1QUEA 3HEMA 1ZM2A 2H1CA 2JH8A 5KWVA 1OXMA 3A9RA 3ACCA 4TKVB 4CTOA 3MTJA 1ULSA 1E1RA 4NBSA 1PU2A 1OXBB 4Z9FA 1O6GA 2NU7B 3TAHA 2WKPA 3TTYA 2OA0A 3U3ZA 2QLJA 1M6WA 3INTA 4II7A 4B3IA 4CM9D 5K8LA 3DF9A 3PT5A 4REQA 4RE6A 1EVIA 3DDHA 5LJLA 4EFLA 4ZKEA 4L57A 4FGWA 4M7OA 5BQFA 3UMJA 4IXMA 4I8IA 1GPKA 2EGGA 4O4JA 3WICA 2HW8A 1ZLXA 1LDYA 5CT8A 4N0DA 1W2WB 1DQRA 2N75A 2ZJFA 2QQGA 4TXLA 1YNSA 2FF7A 3M4XA 1XHLA 3SDBA 4KWIA 3I5YA 3BWBA 5DASA 5I8WA 4G8CA 1DVRA 2DCMA 4R2WA 5D3KA 1QPGA 2PH7A 4L7VA 4QO7A 4KDFA 4L0MA 1DMRA 5LQAA 1ZKMA 3EQ6A 2V3VA 4FTWA 1ZRNA 4H7PA 4ZAYA 5TLSA 1UIRA 2C2OA 1SOUA 3NBKA 2R8PA 5KQMA 2ONZA 2WWFA 4E33A 2WU4A 4IHQA 5AOCA 4B45A 1AB6A 2Y1LA 4B2LA 3ZJ5A 2FB9A 3LUDA 4AY3A 1SZJG 5DN6A 3PRHA 4ICIA 5BUZA 3L7DA 3BGDA 2Z9CA 1Y6RA 3T7TA 1BYUA 4U9IS 1YJAA 1VJDA 2ODBA 1I7LA 1IFXA 1X7GA 2A59A 3G0CA 5DO9A 1VL6A 5E4YA 4OXYA 2CB9A 4XWWA 1AF4A 2M2IA 1K6MA 1ZC3A 4EHNA 3RFFA 4B6JA 4M49A 1AK9A 2E89A 1YB6A 3ESDA 1U65A 3FOEC 5E7MA 3T54A 5JYEA 1T2EA 2AFRA 1T9BA 5I7UA 1ZICA 3G23A 4LV6A 3CRQA 1QUFA 2AI2A 1ZD2P 5AI4A 2BHRA 2ID7A 4HYTA 3TNYA 3UT0A 5JZSA 3ZDEA 1TECE 3Q8KA 4MLPA 3EDMA 2PLNA 3R5SA 3QLUC 1UEXC 4NAVA 5AJTA 4EA6A 3S68A 1LUAA 1CZHA 1Q12A 1DJPA 1QDLB 1WUKS 1RYYA 5EYPA 1OBFO 4QGSA 4DMFA 2C88A 2ZTVA 2V1UA 2Z1NA 3WLNA 4FX2A 3AUKA 1V7PC 4ALLA 2H7CA 4XLTA 5KSOA 4RIHA 3BXPA 3ZU4A 5AMXA 2O9JA 2OQIA 4F6LA 4LJSA 2IK8A 1E94E 4BGUA 3V7WA 4DJTA 1E1YA 2Y0PA 1AE1A 4OQYA 4YAEA 2M6LA 3ISTA 2J3DA 5FLEX 3S2YA 3SSAA 4B48A 3TLGB 1KKMA 5KAMA 2FSVA 4BWVA 3E9CA 3JS5A 4M6WB 4OFZA 1YL7A 2PRYA 3E9YA 3D8HA 3QE4A 1ZG3A 3W6ZA 1FYFA 1EFKA 4QLOA 3LPNA 2JFVA 3SHQA 4ZI2A 1EGHA 3CNLA 2QN2A 4CF6A 4OK5A 1HF3A 3GK3A 3T9DA 1REQA 2KPOA 3NEAA 5BN5B 3NW9A 4CQMA 2HLDD 2VK2A 4D41A 3FX2A 4WBNB 4BO9A 1AKVA 3MBKA 5U1PA 2HOQA 1X8KA 2GJAA 2WVJA 3C45A 1PR0A 3TMYA 3ADCA 4OQMA 4D43A 3CVVA 3GYGA 4JQZA 3FMGA 1H0SA 3HI4A 4YMSA 4JVNA 2BFNA 3D3KA 3V4LA 1Z68A 1I2DA 1MP0A 3HE3A 4ZEMA 4B9EA 4YRNA 1ZD3A 4GUDA 4AKTA 1X7YA 3RV4A 1Q57A 4MH0R 3WL3A 3JQAD 2IYFA 2QUKA 1ZO8A 1PQYA 1W96A 2P3SA 1OR8A 4CU2A 5HJ7A 3FWNA 5B55A 2D2FA 2NQ8A 4GUAA 1LW7A 4O0MA 4PRYA 3C7KA 3Q5GA 3ICOA 3I0ZA 5FF9A 2ZBUA 3JQDA 1TT7A 4OA8A 4WNYA 2P41A 1H2BA 5CDGA 3ZD8A 1KI1A 2WV9A 3AFOA 5KSYA 2W58A 3QFCA 4TLEA 2NUBA 3C41J 1QHHA 4KIWA 4PZDA 4RVSA 2J0UA 1O95D 3FOAA 4QELA 4WLFA 2Y1FA 1DAMA 2FR8A 5C7OO 3UAWA 1GQYA 5BSMA 4CM3A 4MQUA 1XCOA 2ZBRA 3OFNA 2X6QA 3PZBA 4AD8A 2TYSB 3WGNA 3NIGB 1JZSA 1Z6GA 3G13A 4JGIA 2H9IA 3ETLA 3BH7A 5LWQA 2XTNA 4FQ7A 5EY5B 3T52A 3QVWA 1XQYA 4MVWA 3AV0B 3I6BA 1NP3A 3Q3CA 4H59A 1TB4A 2GK7A 2NZYA 1G59A 5BR1A 2AN5A 5HXAA 4RMJA 4DCPA 3WR5A 2PVSA 1XLTA 3AY6A 8ADHA 5HZHA 1N77A 3F6PA 4D0NA 2QWXA 1MV8A 5E95A 2JIQA 2QVYX 4OHVA 1X9IA 2PSSA 4MR8B 4S35A 4D8TA 4KPGA 5K3CA 3U7RA 4PN7A 2VYQA 3ZQUA 5GZ3A 2BFAA 2G63A 2YXBA 2RB4A 3DZGA 1YSCA 2ZWIA 3G7UA 5CFRA 3V1MA 3M81A 4Z99A 3TVYA 1GGKA 1R74A 3G89A 2XE7A 2VSQA 4LWZA 2IV7A 3CW8X 3FOFC 3THXB 1QFMA 4FEAA 2J0VA 4BMNA 4ONEA 4QM6A 5TVKA 1VHDA 3DZIA 4CR7A 4PQYA 1XN4A 1GRVA 1L7PA 3D3QA 2ZCVA 1YONA 3D7SA 3U7HB 2PLFA 2YQ4A 5ECWA 3F3MA 2QRQA 3VR5A 5KJEA 4UEOA 2XB4A 3VVCA 4C5AA 4D9EA 3R6WA 3OE7A 4KSCA 5AW4A 5F1KA 3GGSA 3LZ6A 3USCS 1CB0A 3FUVA 4IVNA 4K9NA 3NHRA 4TQGA 1GA1A 4AO8A 1V8DA 5L7WA 1HEYA 1X80B 2Y1EA 4MQMA 3RR2A 2XKKA 1G3QA 4QQRA 1GKUB 1Z39A 1XKLA 3R74A 3JZMA 2O7QA 3PKJA 5BWMA 4FFRA 1CUSA 3RBVA 3V5NA 2KSQA 4JJ8A 3KRTA 1ESCA 4IDFA 4L7QA 2J0QA 3MS2A 4FS3A 4GBJA 4JYPA 4R01A 3ORFA 2WKRA 3HP7A 2WIKA 4ZVKA 3QLVA 1RJ9B 1PZFA 3M6UA 4PYOA 4OREX 3BCSA 3UGKA 4ND3A 1CU1A 3OG9A 3QKSA 2XQIA 5T3YA 3WYEA 4EPVA 7MDHA 1OGJA 1TTTA 2DH6A 4R8RA 4R8VA 1J5XA 3PDJA 2IBSA 3ZWVA 5AXAA 1RAGA 1M2JA 1DAFA 3HM2A 4O2BA 3PQDA 4LOHA 5JSQA 5KQRA 4PINA 3W77A 4CF5A 1C0PA 1E9AA 1VLLA 2ST1A 5AVOA 1RHUA 2F3QA 1EVQA 2PZJA 2UUPA 4GBMA 1I10A 4RV9A 3M5DA 2AKYA 5G1NA 3KCQA 3RSOA 4BRUA 1H0KA 2O3JA 1JFFB 2XMQA 4YUVA 2ISSD 1WWKA 4RTLA 2SICE 1R7RA 2HQOA 1ECFA 1I6KA 1RRFA 2YJZA 1DKNA 1RAHA 4K6GA 4GW3A 1OAAA 4X8LA 5AJXA 3PFIA 1A77A 3WGZA 5TMPA 3TFOA 2BEVB 4UNPA 3CWZA 1CNMA 1SXJD 1XYYA 1HG0A 3F3YA 2F1OA 4L4SA 4NEHB 4BO5A 1ZJ5A 3BKXA 1NMEA 1DADA 4YJHA 1JR6A 3RIXA 3BMCA 3TR5A 4S1TA 4TUYA 3NMUF 2VATA 2BHNA 1UPAA 2BKXA 1H1DA 2WR8A 4OAQA 4TZKA 1DO2A 2DZDA 3CF2A 3CX3A 4R2IA 3T5DA 4Q37A 5ENVA 1OLOA 1YWGO 4QTZA 2CXQA 1OHHA 1P61B 2C20A 1Q0LA 2Q4DA 5BMVA 5CB4B 4RE5A 1CFJA 1UUFA 3N5KA 1ESNA 1JP7A 4EJ2A 3GN2A 5HHTA 3MGAA 3OBBA 1EYZA 3HXPA 3OT5A 4JA0A 3S99A 4PGGA 4CVNA 1H6AA 1F0KA 2PX8A 3KUUA 3AVTA 3THSA 1MZPA 5IJ0B 2XEXA 4ETMA 1ACMA 4GH5A 1K6EA 2VUHB 4L6IA 1T9AA 2ZYHA 5IC5A 3UY4A 3QK7A 3WL7A 1N5LA 4TSFA 4DIOA 2WHXA 4AZ3B 5JU6A 1P1IA 4F60A 3GLFE 4JUFA 5FI3A 1XFAA 5LDDC 1SULA 1W7AA 1EK2A 1JQ5A 2BZ0A 4K6FA 2JCYA 1Z37A 2QMEA 3OOWA 4JBNA 4F3CA 3QXJA 3PYMA 4P32A 3P9SA 2VHUA 4UKDA 2YC2C 2L2QA 3I53A 3MXOA 3NCHA 4H35A 4K88A 4NH4A 1K5PA 1CUYA 3UNXA 2GDZA 5JZBA 2DULA 2NXNA 3JAWA 4H3VA 2E5WA 3IXQA 3I92A 1ZAYA 1ZU4A 3GP8A 3AR4A 2IODA 3V4ZA 4B1FA 1PWZA 3DS8A 4TLAA 3T7CA 4AYXA 4EM6A 3I05A 3OLYA 2G9UA 1GYRA 1E0JA 2FPIB 2RCYA 1ZCAA 3H1BA 5EN4A 5IF9A 4X6YA 3FDFA 3M4ZA 1GQOA 2R00C 4WDQA 4DREA 4IQ0A 5IT4A 3A4LA 2EQ5A 1VXOA 2JHFA 2X5NA 1ABBA 1VPLA 3EGXA 3LK7A 3P2YA 3IURA 3KLNA 3WWOA 2OT3B 3QF7A 3IH5A 1E20A 4C6SA 2WUGA 3W2FA 2O2XA 4JOSA 1ORIA 1JUDA 2QMHA 4E30A 2IYXA 4RCYA 2ASVA 3L0BA 4BTEA 4FOTA 1KO1A 5JEDA 3JYPA 1BS2A 3OQIA 4P3XA 4F5EA 3LRTA 1C3VA 3L8MA 2BRUA 3ZCQA 4UBJA 1ODTC 3R7SA 1GDHA 1ESZA 4F21A 3SCZA 3KYCA 1COWD 4CDMA 8MHTA 4C05A 1U4OA 1XRPA 5F23A 1U8UA 3D0OA 1E69A 5EQFA 1KFKB 1NI5A 2FZGA 1ZJ4A 3C5VA 4YMIA 1Z0UA 1NF9A 4BDSA 1YQEA 2OSVA 1CUJA 2QRGA 3H5AA 3EEYA 4MYRA 4XYEA 3CRNA 2JLZA 3T5GA 3SSMA 4Y1RB 4EGQA 5IJ9B 5TT0A 1JX6A 3PXEA 3V4FA 1PZHA 3PPVA 1NC3A 1LPMA 3CEAA 3CR8A 2ZYAA 3OPNA 3UYLA 3WGVA 1QSGA 5CH3A 4B3FX 3R2JA 1ZLYA 4ODIA 4CF7A 1IUPA 1II8B 3QWFA 2AQKA 3A37A 3D81A 4JENA 3ZGYA 1G8SA 2CF6A 3KFLA 3T3PB 5DM60 2BI8A 2O20A 1GA6A 2PX2A 3QIVA 3T1OA 1WLYA 1Z83A 3FFBA 3OQ6A 3USES 4JP8A 4AU1A 4DLAA 1LPBB 4MZDA 1MB9A 4RC9A 1P5JA 4UM9B 3OQBA 2EDAA 2PH3A 5JS8A 3AR2A 4H18A 4XIIA 1YT5A 2Y1WA 4MB6A 3SYLA 4I1IA 3C4VA 1NXWA 1HQDA 2AW5A 1YBFA 2K2WA 3WP0A 1ID8A 1CC1S 1KK0A 3IOBA 2Q0XA 2ZSEA 4W9NA 1T4GA 2FXIA 1E3QA 3TBKA 2VHVA 4OHOA 4QGBA 3JATB 3ZY4A 4NCBA 1QMGA 2C97A 5BPFA 3K71B 2NIPA 3H1EA 4LJAA 3DMPA 5KYNA 3K8YA 3ZNQA 3ZTYA 2ZSJA 2BV3A 1U2DA 2QQ0A 2WQ6A 3D3JA 3LZCA 3FGNA 4HJRA 1L2TA 4P36A 4ALKA 4DDMA 3B9RA 3SQXA 4JSRA 2NTVA 3GAFA 3BK7A 3CB2A 1G0NA 5IVDA 2V74B 2XXAB 4HDAA 5B2ZA 2BF4A 3FCYA 1Z7YA 5F52A 4NZOA 3FGPA 3JQRA 1NI4A 1WDTA 1OW3B 5DNVA 3GVIA 5IDQA 2IV2X 5JD4A 3CUTA 4MJLA 5DP1A 4EW3A 1IY2A 1NDQA 1MC1A 3EZ2A 1C80A 2CNNA 4C4TA 1UP7A 4UDXX 4UTRA 1KMIY 3ILSA 1YS2X 3M6XA 3K0KA 1AQJA 3T3NA 2ZB2A 5CBPB 1IVNA 3EGEA 1N6HA 2FPWA 2P1ZA 3G5AA 4HO1X 5BXYA 3KUKA 1ZIPA 3AHIA 5FUWA 5FDFA 4PLWA 1RWKA 2EP7A 3PNSA 4ZICA 3CU5A 2JHCA 3TXAA 3LA8A 5KYUB 1DBWA 2WF9A 1HWYA 3IT0A 3LXMA 5FOUA 4OXKA 2RGGA 2V7XA 5AKYA 3MCUA 4KQXA 5HUJA 2CK3A 3Q5EA 4IJKA 4PC2A 1MGOA 4B74A 4MWDA 1AUPA 1XQVA 3LC1O 2E0IA 1JR3E 1TF5A 2NO9A 4DJAA 2QVZX 1NIJA 5IKOA 4DYVA 9LDTA 2JJ1A 4AP9A 1DLJA 4BWGA 2NZUG 4GXRA 4FSXA 2QX7A 3UAZA 1YBVA 2E82A 2QG9A 2V5UA 3VR2D 1ATIA 4PO9A 1IRXA 2XJ4A 1X8JA 1XHEA 2OHIA 2BLNA 4C43A 1V5EA 1Q3KA 5JFOA 2UVDA 3NC0C 4OK3A 4PLVA 4FNMA 5E1MA 3EIHA 2V55B 1HETA 2Y8EA 1HL3A 3AERB 3SE7A 1IXYA 4XCQA 3GLHB 2NZJA 3LQ4A 3FZYA 1NF8A 2IYWA 2Z6VA 3ZC3A 3OLWA 2A9PA 3ENZA 2NU8B 3A4MA 1KJIA 1QCZA 4Q4DA 3GNLA 4J1TA 3RI3A 4IWNA 2X4IA 4BASA 3AEUB 2CD7A 5I3CA 3QV2A 4EMBA 2FRVA 4PF1A 5E4TA 3CHYA 4OBXA 4QKQA 1H2ZA 2Q46A 4URFA 4I66A 1B6SA 1PV1A 3ODPA 4KN8A 2V1XA 1V5FA 3RWMB 2INGX 1AKUA 1R0WA 3ZBUA 3C8MA 1HH4A 3THYB 5ICGA 4Z4FA 3TECE 1HX7A 1OZAA 3K15A 4Q01A 3WLRA 1QTNA 4EW6A 1K7SN 2PGJA 1ZD4A 3UWPA 1UZLA 1EQUA 1I32A 2C8KA 3C1UA 3UJNA 4B79A 1JF8A 1VYHA 2RHRA 3H5WA 1YVDA 1GPWB 1HLDA 4C0QC 4PN3A 1HURA 3EXEA 1SC6A 2GN8A 2E87A 3U5TA 1I5EA 3B9QA 1V9SA 4RLQA 2Z30A 4GI3A 2HU5A 5EKTA 3TVDA 1NSTA 2BR5A 2QNIA 1H66A 2JIZA 3DVLA 3LBIA 5CXXA 1N34B 1USIA 4NBWA 4OP3A 4ER0A 2QJWA 3OETA 2GEKA 5ESDA 2J5RA 1NLUA 4G4SP 3V4VB 2E4ZA 1YGYA 3OIUA 3E35A 1HV8A 4O4LF 4BQFA 1MEEA 2GAFA 4F84A 5KC8A 1PEYA 5EMLA 4YMWA 4TV9A 2P9CA 3AFMA 2F9LA 3FCSB 4LNHA 4TN1A 5CA0F 4TS9A 3AK4A 2R6ZA 1DG9A 4A0SA 1U1GA 3TM4A 4KPUA 2VYND 3TLMA 2GPTA 5JNUA 1RHRA 2BUAA 3VTFA 4UC0A 4JBIA 3MRXA 1BOFA 4FQ8A 4IKPA 3WHPA 4FHGA 2HN9A 2A1TS 4B2IA 5T5QA 3SX4A 2UVPA 2NG1A 2J45A 3P2JA 1OVMA 3Q87B 4TZTA 4JLMA 3BZWA 2V3WA 4JR1A 3VGPA 3EQ9A 3HLTA 3MJ4A 3NT4A 1XEXB 2O52A 2P5UA 1CY4A 3C70A 5I9NA 3ID6C 3RUIA 5FX2A 2XOXA 3AJ9A 3L4EA 2FPPB 2HNAA 1WXDA 1HT2E 2AXPA 2B99A 3DV9A 3K2EA 2HIGA 1B8VA 4K6CA 4MLCA 3VOBA 2H31A 4IIYA 2NO5A 3AH8A 3FKJA 2YWCA 3HZZA 1WY5A 1TFRA 3MVEA 2P79A 3KJNA 3R5FA 3W5SA 1JDBB 3MXTA 4KC0A 3HPQA 1X7DA 3ZQJA 1ZUWA 2OVBA 2UZ1B 3DMGA 5EJAA 3G5TA 3SVZA 1IWOA 1MAAA 3DO6A 3FZNA 3TI9A 5LP6A 2BD0A 3VBEA 1RHKA 5ADVA 5K99A 2P2LA 3EZ7A 4PYQA 2R7LA 1W88A 1MPXA 4K9SA 2WHPB 1ZD8A 4EDFA 2W90A 1GJRA 1VKNA 3FVRA 3H11B 3P71T 3KQMA 4UAJA 5AK3A 3ZIUA 3ZCTA 5KTRA 3WYNA 5BMOA 4EO7A 4CM9A 4C88A 5I9SA 2RJOA 4WV3A 2G9RA 2VUUA 2VL7A 3FHLA 1ZW6A 4MUBA 4YUYA 3EAQA 4FYIA 3UHFA 2DYKA 1KDRA 3VQTA 4EELA 3KYBA 2QTBA 1XZEA 4OFBA 5LA6B 1ULBA 2RFLA 1KJ9A 5JD6A 1RRGA 3DBHA 4GYWA 3IB6A 2RARA 3BMOA 1BHJA 3JQEA 3K9GA 5ER6A 1P1KA 3BFJA 5IJXA 5DKFA 5LXTF 4A8HA 3DV0A 1WPRA 4BLSA 3BIXA 1C30B 2PKRA 1U3VA 2W2TA 3ILVA 3RF7A 5AW8A 3GAMA 4C03A 4MI1A 4MUGA 5JZOA 1KERA 4S05A 3CT6A 3FH0A 1J09A 4RZSA 4HQ0A 1MQSA 3O6VA 4C5BA 4CE6A 1SVWA 4UHHA 4JYAB 1J9GA 3A4YA 3DOCA 1OH5A 4EHDA 2ZSKA 4JBHA 3CNQS 2O1WA 2WWWA 4GPD1 3QWIA 4Y2TA 4N76A 1J8YF 4G97A 3LTNC 1LBIA 3O9VA 5B2EA 1KYWA 1YS1X 2KMLA 3AGPA 3JXEA 5JEEA 2MINA 4MRRA 2ZSUA 1ATZA 2IQIA 1TAHA 1QH8A 2CL7X 2ZUUA 3DVAA 2K87A 2AI3A 2CNOA 1J2JA 4WCDA 5TPZD 1U0OC 1VJGA 2GTIA 2ZTUA 1K7FB 1UM8A 3QM1A 4FCWA 4B3HA 2AG5A 4BNNA 3K70D 1T29A 2PFSA 2GM5A 3W06A 2XA2A 3CVXA 4ECAA 5E2BA 4EZBA 3F9IA 1XA0A 1B4DA 2N1MA 3L82B 3Q4GA 1YZVA 2XGGA 4MARA 3FI0A 1JDNA 2Q41A 4W8GA 5HFJA 2A0KA 1L9XA 3SFVA 4G09A 3HY4A 1R4MA 1C9KA 1EJBA 2YYAA 2PQ6A 1E64A 3BMNB 5DBOA 4EIWA 4BMSA 4DV2B 3Q3EA 1G7RA 5IARA 3C1TA 1ZIXA 2QZJA 1PYDA 5EHXA 4WJKB 5HQ3B 1ZISA 1H85A 3M1IA 3RODA 4DT1B 1S01A 1XZFA 4AZTA 1QU2A 2G04A 3QVGB 3KG2A 2CCJA 4BNKA 1FDSA 1UKEA 1PR9A 1Y80A 4HLDA 4MVJF 1MIOA 2QJRA 1XK7A 1MAWA 5JY1A 2NUTB 2WLTA 2XCIA 3WLHA 1SCNE 4A92A 5CLHA 3U3MA 2GESA 1XDUA 1P3Y1 4BNHA 5GVSA 1RXYA 5K0FA 1TE2A 1KK3A 3KPUA 4Q3DA 4QXRA 4BP8A 1F5SA 4ZGWA 2YMQA 3NM4A 4JJIA 5IYZF 1TZJA 5A1TA 1A9QA 4IGKA 3GL9A 4MKRA 4Y1EA 4J0CA 4F2WA 1SKUA 2HJSA 4YCDA 1SVKA 3D1LA 2JFBA 4QUGA 4FMDF 3SHVA 3D02A 5I7HA 2PA0A 1KTIA 3JQ7A 5KU1A 2XBUA 3OX1A 1I30A 2MYPA 3H18A 2XGOA 3HP1A 4KNWA 2EX0A 2HCJB 4G81A 2EZ9A 1FYXA 2HLDA 3AKCA 4I5DA 4HDMA 1CXZA 4RD1A 2BTQB 5JS7A 5LKAA 3GDWA 1ZJ6A 4WTOA 5BW5A 1XOIA 1W76A 2P68A 4GR4A 4JYBA 4MV1A 1WMAA 3KJXA 2DU8A 1D8AA 3Q2IA 2ZRMA 4JQSA 4BBAA 5IEJA 2P9YA 1KEWA 2NZ8A 3LMKA 4MKGA 1OXVA 3B2NA 5A3JA 2WKSA 2CCGA 4U5XA 3L8YA 3BZUA 4HDRB 1U2SA 2VRWA 2ZSHA 1VCMA 3EJWA 4Y98A 2JGAA 3FI9A 5K0CA 4X8HA 5A7GA 5SY9A 5A5EA 4OM8A 2GPBA 3VNRA 1RLMA 3CUKA 3QVUA 1M0TA 4WESB 4DCGA 2OV6A 4ILKA 3AGQA 2D1YA 4FOPA 1QZ3A 4H9GA 3OJEA 5HMLA 5FOQA 2QXTA 4NS4A 2IE0A 4KIJA 4DANA 3F3SA 3R8XA 5F77A 1MN6A 1E6UA 4BVFA 2OGSA 1PIWA 3Q85A 3LDFA 4QJ3A 3KWJA 3DGFC 3G8BA 3KT0A 3WMGA 1HR0B 2IX9A 3DE3X 3GT4A 4K46A 1XCPA 3IEUA 2EEPA 4XTRA 4L5YA 5EIOA 3L8DA 1SG0A 1K6XA 3H9GA 1R6BX 2B92A 1E6KA 1NDHA 1B42A 1FQKA 1V7CA 1X7WA 1VJCA 2GXQA 2WK1A 2YN0A 4O1MA 1QPBA 2ZJAA 3SBOA 1F7VA 3NFYA 2R96A 4JNKA 3SKYA 2YINC 3L0YA 4J9UE 4NZZA 1J8QA 1KQ3A 1OA1A 3AINA 2GFIA 4DFDA 2D5BA 4HS9A 4REMA 1PDWA 2YIDA 1TPYA 3CW2A 2Y9MB 3X1DA 1ZP6A 2PS3A 2XNDA 3AR5A 4IZOA 5GADl 3SZMA 2W93A 2QAGA 4L2IB 4BUZA 3JTMA 4I4TB 4WI1A 4BQEA 1Z4LA 4DNXA 3OQOA 1IAVA 1KZ4A 3CIOA 3KKPA 4P4TA 1WUYA 3GOHA 1NLFA 4OX9Y 4PSDA 2H51A 1DX6A 2H3EA 2WTBA 2ZYWX 3DKKA 3O93A 3Q3IA 1RE1A 2I4IA 3AT1A 2XXBA 2G4LA 2YX1A 4LWPA 4C29A 4W6QA 1NXVA 4UEKA 1J9EA 1TT5A 4DRXB 4CKZA 3CX7A 5CLQA 2W0MA 2YZNA 3HZRA 5P21A 3OH8A 1VYVA 3QW2A 3Q6IA 1OYWA 1XNGA 1FP4B 4I1UA 4IDOA 2XKBA 2V4MA 4H6XA 5JXIA 5KOJA 4BVAA 4UXHA 4LDRA 3PUHA 5EZYB 5KINB 1M34E 3BH0A 3HWWA 3W6UA 4U2KA 2FUCA 3UMBA 2K2QB 5COAA 2NAPA 1TM7E 3A05A 4JJAA 2B8EA 2Z3WA 4A27A 2XHEA 4PQFA 2RD2A 2HU7A 4AKGA 4DMHA 4MUXA 4BRWA 1QRTA 3I1JA 3GJ5A 4Z9AA 2BPOA 3PF8A 2R7MA 4WCFB 3L49A 5KDLA 3RC3A 5B7GA 1C81A 4A2CA 1Z28A 3WQBA 3GCGA 3N0TA 1WUTA 3MMSA 3A25A 4P9NA 1NBWB 4PXAA 4ZOLA 5H1YA 5IUNC 4N4AA 4OOEA 5DM0A 4ECEA 4EJ6A 1ZK1A 1MKYA 3C5HA 1JU4A 5J4KA 2E1RA 1C0LA 4LTMA 1EK6A 1J24A 1EE9A 4QQKA 1GZUA 5JSKA 2X8BA 3K1AA 4IVPA 4QFBA 2FEAA 2PR2A 2W2MA 3R7BA 1G60A 4JLWA 5JHHB 3TQHA 3WIUA 1BMTA 4BX0A 3WTBA 2C95A 1Z36A 3DE2X 3JZDA 2VQFB 4FDTA 1K5DA 3WFIA 3C3DA 4J0JA 5ENZA 1RJWA 4J0EA 2R68A 1YZ3A 1DIOB 1R66A 2OBBA 5DI3B 5T3UA 1T6YA 4YQEA 3DQZA 1OAOA 1B2LA 4ML3A 4D4IA 2BTEA 1TF2A 1WPGA 1JEYA 1D4FA 3GN1A 3HHEA 4R1OA 1JFSA 4L0CA 1ZBDA 1WVMA 3B52X 2LNDA 2PX5A 1XU4A 4BFLA 5E9JA 1GAXA 3PEFA 2JGDB 4NMWA 1I7QB 3H1GA 4H6PA 4D97A 5H16A 2Z9DA 2RCNA 3IOMA 3ZK9A 2WTUA 3K9WA 4IXNA 1JKJB 3N2LA 3GRZA 2I3GA 3MJEA 3N8DA 3KXLA 3PC8C 2ZYSA 2I29A 3C3CA 3S1AB 3DZJA 3B1XA 5T8KA 1A1VA 1JJBA 5B3JA 4NBKA 1PFQA 1M7GA 5JBQA 1TAGA 1CY8A 1XD9A 2HQ1A 1PD1A 3B3JA 1XMSA 4RBNA 4PLTA 4XXHA 2JA1A 4TXNA 5AM4A 5IC4A 1JJ7A 1BQ3A 1TM3E 3KJEA 2F1HA 3LRPA 3O74A 4IO0A 4JHXA 4JQYA 1P7VA 4JUBA 3R6DA 2ZI3A 1XQ6A 3B5EA 5LQKA 2OM6A 1VYTA 3ZLVA 1JA1A 1FC0A 3KJGA 4OB6A 1FFAA 6ABPA 2CNDA 1NRWA 4UBKA 4CIVA 2G9VA 3BICA 5H02A 4HTFA 1ZVKA 2UZ4A 1TI7A 1AKYA 2CXTA 1EHYA 2EFYA 1GFSA 3PNQA 4L4RA 4ARBA 3WISA 4R83A 1CIVA 4BC1A 4D26A 3MIZA 2J6CA 5EEGA 3PX2A 1W73A 1KMHA 3NUGA 3C74A 3FJOA 1LQ2A 4G63A 4ID3A 4KAXA 4OPMA 2OZLA 2C4WA 2M6KA 3LYAA 3W5JA 2X5JO 3ZX5A 1JECA 1LPSA 2IXGA 3LCJA 1LFDB 2H9AA 4IUDS 4RZXA 5JPDA 2IU6A 1EIZA 2BAGA 2A9FA 3C8ZA 3N05A 1FF9A 2ZRBA 1U9YA 1QDUA 4F72A 3SLKA 2HNKA 3PD0A 4IHJA 4R1TA 3RAGA 2XWJI 5FWNA 3V1TC 2AOUB 3AILA 4FDLA 3VDNB 1VG9B 2EARA 1UC8A 4G85A 1V7QA 3NEYA 1GG9A 4JP1A 1I2CA 4IP0A 2FP4A 2UKDA 5CJPA 1GCIA 1SAYA 5D51S 4F2DA 3CZPA 1R5JA 1IVYA 2AOTB 4ZZ2A 2Z8ZA 1UIMA 1SA0A 2O2SA 2XHZA 5JXWA 1TC2A 1A5TA 2ZUTA 3SXUB 2QUJA 3U7QB 2Z83A 3NBQA 4UXJA 5DCUA 5K6TA 1NBIA 1OXKB 4B8ZA 1N2BA 3PNKA 3EX7C 4X92A 1C7JA 5AQEA 5KNDH 1CQPA 4UU1A 1L4MA 2K5UA 4CIWA 1ZA1A 4KQ9A 3T61A 4E5PA 3BEDA 2Q27A 1GL7A 5KMGA 3GLGB 1HKHA 1M8GA 3CIFA 3W8FA 2J9XB 4HR7A 4Q3LA 5DNYB 4UPDA 4KSBA 1CYDA 4C89A 1AQNA 3V8VA 1NNEA 4L75A 4NPHA 2Q62A 2G70A 1PQ4A 2D4AA 2YZMA 3RC1A 4WJLA 4Z1MD 1QTIA 2PFKA 1W8IA 4OHWA 2CLOB 1B3BA 1K0UA 3QBVA 4NYIQ 3SFTA 4CEHA 1L4NA 1T0UA 3ADPA 4QPZA 4KUHA 2RGNC 4B82A 1T2NA 1U2GC 5TMEA 3DFIA 2GX6A 1Z38A 1NNI1 1ZD5A 2OORC 2TMGA 3LWZA 2DUUA 3T1QA 5A5VA 3L79A 1JEOA 1GL3A 1M2WA 4WXEA 4AY2A 2CXXA 3FTNA 4WNAA 5JQGB 5JJLA 4YY3B 2ILVA 2C07A 4DQUA 3ZGOA 2PRIA 1VGRA 4OHKA 4ZHQA 5IBCA 3NNDA 3PGJA 4V0KA 1DJLA 1XDSA 1IC6A 3CN7A 2EKQA 4ZMBA 5ESRA 3HEAA 1IUOA 5JROA 2CXSA 4OMFG 2MSLA 3KZOA 2V0GA 1FSPA 3R3ZA 3DL2A 2E2WA 3KPJA 3G1WA 2VHJA 4H60A 4N3NA 4OFWA 4UVDA 3U1BA 1F06A 4XVCA 5PNTA 1PVOA 5KREA 3A4IA 3TKLA 3HDGA 4DC9A 1BOOA 1KRWA 3CXUA 3AUYA 2MSNA 4HQ6A 1GGMA 4CXMA 4L6CA 2VHYA 2DPHA 5K09A 5CM2Z 3V33A 1MJFA 3ENVA 4GRAA 3DFMA 2LKDA 2XRFA 4B34A 4RETA 1WQ1R 2FG7C 4BC0A 5A4FS 2R47A 5K01A 4Z4EA 3GXOA 2YV5A 4G36A 1Y42X 2AX4A 4RSHA 4Q6WA 4KXWA 4F2PA 3IVAA 2A0YA 1P1BA 4LNUB 3KHTA 2C84A 5F5NA 1I6WA 1JYSA 1W36D 3QE9Y 5EAIA 4UNRA 4YCLA 2J4FA 2XJ9A 2EIHA 2BGUA 5LBIA 3JWEA 3SEQA 4RHXA 2X41A 4IDDA 4FKMA 4P4LA 4AMYA 4AKIA 1DOZA 3TWOA 4DVJA 2DR3A 3DBOB 4EDHA 2VQEB 4PGAA 5KX5F 2XNJA 3QGMA 4JL5A 1JFTA 5FUBA 2EZ8A 3Q15C 4RK6A 3GZ4A 5KAPA 4BOYA 4LS3A 2OSBA 3IRVA 5FNVA 1S7CA 1JU9A 4AJLA 1E4EA 1A98A 2W71A 1S9DA 1ZEJA 4WN3A 1P1CA 3ZPXA 1K8QA 2A3RA 3HB1A 1N2CA 4N9QA 5COQA 4QODA 1KQNA 1KFJB 3ZZ0A 3R0JA 3N8HA 3QKTA 2DUJA 3RVJA 4HY3A 4DM4A 4IEEA 3L7AA 1V7ZA 3K0AA 1QG2A 5LYYA 3ZHUA 2ORIA 3KJHA 1V47A 4HGRA 3ZWQA 5GONB 1OFIA 3L1IA 4I08A 5J43A 3O3OB 3LQQA 3RV3A 5FH9A 1LPPA 4U9UA 1BEEA 2ZITA 2G77B 3R76A 1Y63A 2QTCA 3AHHA 1XCJA 1XD8A 4XWTA 1GTL1 4MW5A 1CIJA 2VWGA 5CEFA 1LQTA 4D3ZA 5F7XA 3TX2A 3LP6A 5BUQA 4YCBA 5B58T 4KR2A 4N7BA 1ZAKA 1R6DA 1XVAA 2GCNA 2Q5HA 3K9QO 3H1PA 4WNCA 5AUNB 5G4KA 1FK8A 2IYQA 1WOMA 5AJHA 3UJ9A 2QYHA 4OO3A 4E11A 4XWGA 1G1MA 4F6RA 1EM6A 1G7TA 4RIFA 5HFAA 4M1ZA 4EW1A 4M99A 4R16A 4WFIA 2X1VA 3LT0A 5IPFA 3CLRD 1FS6A 3LUAA 2ZIGA 4Y9TA 1DUIA 3JVUA 5E9WA 1OX4B 1U7XA 1WIWA 3FSGD 1R5OA 3OU6A 2VDWA 2FN8A 4ZVNA 1A76A 2HJRA 2C5EA 3FSEA 3G2NA 5ABPA 5CP8A 4DS3A 5BWNA 3ZHZA 3SR0A 1RYNA 5KVQA 3L7MA 3MOSA 4E4TA 3CKKA 2IX3A 3U7GA 3DEHA 2V0NA 3GU3A 1BD4A 4JV5B 4HDQB 1K6JA 1Q6YA 1KI6A 1XVVA 2FW6A 1Q14A 4WVLA 1YZTA 4AS3A 4LPKA 2C9CA 2B5OA 4H08A 4FI3C 2RHOA 1IULA 3OKCA 4G5QA 4HB2A 4G1FA 4UM7A 5AD1A 4BGIA 3PUXA 4IDPA 1I3NA 1RRKA 2FNAA 3OIWA 4ASUD 4XCXA 4DLWA 3FNIA 4G5RA 1GG2A 2DKOA 4IO1A 4X7PA 4HVAA 3KM0A 3U7FB 2VPPA 2HX1A 3L8GA 4P4SB 3TOCA 1W44A 5FL7D 3IKJA 5EJFA 1MORA 2W4QA 2I80A 4KFTA 4AWBA 4UE6A 1WHTA 2OXTA 2PUDA 1JIVA 3PQCA 4X8MA 3RWOA 3PNVA 4XTCS 5TQVA 3A9WA 3F67A 3G49A 3H9BA 2CLEB 3SQNA 3UB4A 2CFTA 2CJWA 3L1VA 3NIDB 1FRZA 3K73O 4V0QA 4LX0A 4WOKA 3JQ6A 5CVTA 3WDMA 3S40A 2ACEA 4AQYB 3C3AA 2OILA 2J9FA 1NASA 4UVIA 4L5AA 4DIMA 3MWJA 5E2IA 3TUIC 1VPDA 1KE2A 4ZT6A 3VH3A 5AVVA 3AHJA 4Z0NA 4ZGBA 5FBRB 1NW5A 5J4LA 2ZWAA 4M55A 3TR6A 3K8QA 5MN4A 2OECA 3OZXA 1MGPA 3VKUA 1DDOA 3IKVA 4ZZ0A 2B1GA 1YJXA 4FJ1A 4U39A 1AGPA 4BL5A 4KXXA 2ANCA 2EKZA 1YC2A 2HSWA 2RBKA 4K1XA 4AY4A 1E2IA 4RPGA 3ZWBA 4MIOA 3SZRA 2X3UA 3Q5DA 4M9XA 4BTVA 1EDBA 5KYYB 1JHUA 2D5AA 1DHTA 1T2UA 2IHUA 2QXUA 2FETA 2R9VA 4REQB 5E4FA 2ATCA 4IZHA 1EVYA 2FZVA 3I9MA 1MC8A 4H1TA 1XZIA 4X97A 2WTNA 3BXZA 4UUOA 4O4JB 4RD4A 4H27A 1R10A 3UMSA 4RPIA 1R88A 1DAKA 2O6LA 4R7GA 2QI9C 3CKMA 2ZJ0A 3G88A 1V9LA 2Z09A 3TQQA 2BKVA 4CIAA 1JA9A 2LDXA 2Z1MA 4EG6A 3RS8A 5IVKA 4JWKA 4XE5A 4XI9A 3RJTA 4LTNA 4BATA 5BYAA 4A2PA 5K8TA 4O25A 1P9RA 1R12A 3M1YA 2QU8A 5ALTA 4DIUA 4EHJA 2O5CA 4JOCA 4DA7A 1EWQA 4FBGA 4NYIR 2I54A 2VPXA 9GPBA 4OXIA 2HBYA 4H0NA 4JKYA 4CR8A 4CKWA 1YOVA 3BT7A 3MOGA 2ODEA 4HB3A 3GO4A 5K3SA 3N74A 5AKZA 3UHOA 4BNVA 4HN4B 5DZSA 2PU7A 1OLXA 5CVCA 4YUWA 1TU0A 3WRVA 5GGXA 2WTEA 3NJ8A 4L8GA 2CXOA 5AK4A 1KR5A 1Q15A 4ZTBA 2ORYA 3R4CA 2RGAA 2P65A 3DEYX 2R6GA 1BDHA 1Y98A 2JW5A 3PQ4A 1SB8A 5FTLA 3SS8A 2I2AA 4I9GA 3TAXA 3B8EA 1KOLA 4BVHA 1IIRA 2EERA 5IFLA 1A0OA 2Z2JA 4KAFA 4IXWA 4A2WA 3AFIA 2GOYA 5K03A 2GYUA 1RRCA 2Q2OA 2ZXFA 3QHPA 2GPWA 3GFVA 3S3TA 2GCEA 3X1ZA 4KDCA 3DONA 4EAQA 1SKMA 3KEMA 3NAZA 1RKBA 1ECLA 1DC8A 3D7NA 4PZZA 1J21A 3S8EA 3H97A 4K6KA 1JPNA 1L4UA 2QTWB 1G7CA 4UUMA 1NQAO 5K7SA 4LIPD 3FTFA 3NH6A 3R5HA 2YJGA 1A5BB 1MH9A 2HWUA 2RKWA 3EEQA 5HOEA 1Q19A 2V58A 3ZI4A 1Q22A 5ICCA 4OBWA 2IITA 4IX9A 5EYPB 4HZGA 5E8RA 4N82A 3WLTA 2XTMA 3FHCB 1XTJA 2QR2A 1U2PA 4RH3A 4OLFA 1QZXA 5C31A 1FOEB 3ZV7A 1HTTA 2EXXA 3BTUA 4DLVA 1MUUA 4JA2A 3TJRA 1YQ9A 5CD9A 4G5XA 4U1RA 4MVJH 3TOZA 1T5HX 3DLHA 3L8EA 4WY8A 4YALA 1KIFA 1I94B 2I6QA 3NS7A 1NY5A 1XCGB 1R8YA 4WSOA 4KU4A 1R3UA 2B8WA 2WPDD 5C0OE 4CCYA 3WHIA 3AL2A 1YO6A 3DPUA 3FNBA 1P7WA 1XLTC 1JJIA 4XEUA 3Q88A 1QK4A 2FJPA 4R8MA 4LXQA 3LY9A 2VHXA 4DVGA 5JJBA 3BVPA 4RY2A 4G37A 4GPAA 4AS1A 3I1IA 1LJUA 3UBTA 4HSGA 1KJYA 1REQB 3C14C 2WU8A 4CQMB 1X1TA 5IS2A 2FPOA 5D6OA 5F3DA 4DKXA 3PXXA 4DSZA 4BO4A 3A9SA 2I91A 1Y8QA 2JF0A 1TUBA 3OTQA 3INRA 4PO8A 3CE9A 4JY7A 4ZEOA 3COSA 3M2TA 3T38A 3V8PA 4CN9A 4ROTA 1CVRA 3DO8A 4QIHA 2L69A 1S1CA 1X7YB 2Q3HA 3U60B 1E98A 1T0HB 1M3SA 1SEVA 4DIKA 1T3SA 4UNIA 4BUJA 3CEHA 3F6EX 3L0CA 1GNVA 4TYQA 4Z7JA 2DPXA 3RHZA 1TD9A 4OHXA 2GQ0A 4H7HA 4JH0A 1KP9A 1T2VA 1FFEA 4QYSA 3I04M 1AA9A 4CHTA 1AQ6A 1X0VA 4HQRA 2FWMX 1XRLA 5CT5A 1XXHA 4J91A 3MRSA 3FPSA 5AHWA 3MLBA 4WKBA 3SN6A 5KNCH 3P4XA 3HABA 3B78A 1QHHB 5H3HA 2ECFA 5JUWA 2J0UB 3H99A 3RW9A 3UCXA 4LGVA 4NU0A 2IXFA 1UXOA 1IVSA 4KXVA 5CCDA 4DJ5X 1ZH6A 3H1FA 2H11A 3V34A 2SCUA 3OZDA 2C9OA 3MRTA 4DPLA 5DNUA 3MRVA 3I9LA 3SOPA 1K86A 3RK4A 3QLVC 2H1HA 4D80A 4IRXA 5EIAA 1L5WA 4EKNB 5CDFE 4J0KA 4JITA 1AUOA 4C0HA 2VJDA 1LDGA 2OCLA 3HN7A 3AEXA 2N46A 3D5EA 2ZAOA 3Q0EA 2QQ5A 4HH0A 4NJMB 1IQ0A 1WZIA 3D2LA 1NR1A 1GL9B 4ALMA 3NGXA 1QFJA 3OE1A 2ORWA 4F91B 4A36A 1E62A 2C2HA 5CA1A 1MCZA 3NT2A 2WWGA 1NF2A 3DYBA 3W6PA 2B5VA 2VYCA 4AAYA 1JHQA 3K2QA 1GCUA 2I8CA 2HA0A 4EHHA 4NENA 1XRRA 1HT3A 1ZK0A 4JL8A 4DDUA 4Z4QA 1X38A 2UYCA 2RIPA 1KKLA 1ZZEA 2JDIA 1T10A 1Z7WA 1AX9A 2X4DA 2IYPA 4Q3KA 2W98A 5CJ2A 1XGKA 4X41A 2YZKA 5IDYA 3PK0A 4YRJA 1IK4A 4DCUA 1EEHA 1PQPA 1TTHA 5AXDA 5KIAA 2V8OA 5FTKA 5HK9A 4RACA 1E7QA 1T1EA 4FS8A 2FSUA 3SIXA 4XJTA 4PM4A 5K2MA 1PK9A 3MA0A 1MRNA 4MRVA 4XYBA 1SKYB 1FVXA 2P2YA 4Q1EA 1YQTA 2WSMA 3FUXA 4CKEA 2QRHA 1VLMA 3IBCA 1L5MA 3KQNA 4Y1FA 3TLCA 2G0TA 3A7EA 4Q9NA 2XNKA 3CO5A 1D0VA 1RAEA 1TCAA 1UMDA 4OL9A 1NTOA 3WNBA 5DW3A 4PNZA 3ORRA 2ZQ5A 3IMFA 1T13A 4ZJZA 1TF7A 1N6NA 2WKQA 4KO8A 3F73A 3P9ZA 4DARA 3UB3A 1PE0A 1R6VA 3QVVA 4B6SA 5DB4A 4BMXA 2CBZA 4I55B 2O8BA 3A1DA 1LTHR 3AG5A 1IJBA 3F3KA 3GB9A 5DLYA 1M10A 3E9MA 3IQIX 2GUWA 3AF3A 5T41A 3EPLA 4KVAA 1GITA 4O63O 5FUXA 4EB6A 2FEMA 4EMUA 3G2MA 1Z0JA 3LBFA 1Q0HA 3R41A 3ZUPA 1PTJA 3UMYA 4BPBA 1RTKA 2GLXA 3M6FA 3TW0A 5JANA 3PC2A 3KQUA 1WSWA 1RHJA 4ZI7A 4K9LA 5AVXA 1XDGA 1Y8RA 4JKOA 4IL5A 4GKVA 4JELA 1H2YA 3QKSB 1V5WA 2FZCA 3NKLA 3U4QA 2LPMA 3KV3O 1CRPA 2KE5A 2ERXA 4PEVA 3AKEA 2YHIA 5KTMA 2OB1A 1HDGO 2ADMA 5ULLA 1QTRA 3N2KA 3ZY2A 4O2BB 2XQFA 2HHCA 2Q9BA 3E3LA 4HWPA 4I3FA 2P4HX 4WLVA 3BWXA 1KAEA 1U94A 3IOEA 5TXGA 5KHLB 1SUPA 1Z4NA 3KEGA 3FKSD 3QFTA 3ZVLA 4QXAA 1J8VA 2ZIAA 3OZAA 5D87A 3ZEAA 2ZM6B 4P0TA 5J2UF 2J7PD 4INPA 3MINA 4JZYA 2N0SA 1SUEA 5IZCA 3MCTA 3JW8A 4LDJA 2JVKA 1Y5NA 3K7EA 2ON6A 1B8OA 2AUMA 1AXGA 1X2BA 1OX5A 3MJHA 1RXSA 2LUOA 4G5HA 3TNLA 4UBOA 2JEZA 1UBNA 1KOJA 4O33A 1E2EA 2JGJA 3GUZA 2GN6A 2HK6A 4FWBA 4K03A 3TE7A 1H4QA 3JV7A 4J0IA 1FNNA 3PJFA 3VSDA 2VHWA 3BMCB 1LTKA 1T5SA 2BRUC 3HMKA 4TUYB 5JYDA 4ZGGA 1ODSA 1ZIYA 3JYLA 3AY0A 3PFCA 3PI7A 2O8NA 4MV6A 1C7RA 3II6X 1YQXA 5BMVB 1ZN7A 2OAEA 3HNPA 5ALHA 5IXSA 1KFCB 2X4LA 1JA0A 1R6XA 2FX5A 4F56A 3VNAA 5B1EA 2ZZNA 3EZNA 2O57A 1LY1A 2FUEA 1OKKD 3A3KA 4M83A 1SVIA 1KO5A 4HDNB 3MMXA 1XNQB 2Q6LA 3E8MA 5DGTA 1U63A 1W4CA 5GJVC 4D2IA 1N0HA 1SIOA 1G64A 2FSPA 1EB8A 3PUIA 4X8OA 1KDVA 4ZCLA 3H4VA 3D4NA 2Q0QA 4BB9A 3A27A 5DM1A 3VYVA 1KPGA 2I34A 1I1HA 4JC0A 3RVLA 4IG4A 2OV2A 1EE1A 1O03A 3P9CA 2GJ4A 2REQA 4KR9A 2PJRA 4CFZA 4BE4A 3OQVA 4M1TA 4BU0A 1QIFA 1GT91 4NVRA 4ES6A 5C1IA 1NG9A 4MULA 4EJSC 5A2GA 1JR3D 1WDKA 3T94A 2PWYA 3HU3A 5CR9A 2ZIWB 3SKVA 3IHWA 3VX4A 4CM4A 5C46F 1GFIA 3JAWB 4MR9A 1OXTA 4FWIB 2OBNA 1FFWA 2R751 4BVEA 1FP1D 4W9NC 3TRIA 1N2SA 3RSFA 2BFMA 4BB0A 1PFGA 1X7ZA 1DO8A 3QVKA 3RANA 5EJMA 3SZGA 2XQJA 5BR7A 4EVQA 4GHWA 1JSRA 1UBEA 1LNQA 1NSFA 1XZPA 2D5IA 2Y67A 3IB3A 3PR3A 4IXTA 4MQEA 1RWQA 2ZIZA 1JIKA 1EG2A 3ZJYA 4BBJA 2I4RA 4O4IF 3CUSA 1OBHA 4ZV9A 3R7WA 3VSEA 4Q0MA 2FW1A 2QE7D 3ETJA 1H5QA 3PGXA 2QIOA 4H7KA 4QRHA 3WK6A 4DLYA 3VVLA 1ISMA 3OQIB 3SIPA 2G72A 4MCIA 1WZCA 4QJ4A 4ZTUB 2NN3C 4HAIA 4BVLA 5H8WA 1UXIA 2BJWA 5D85A 1LBHA 3H75A 1QR6A 4C2TA 3RTDA 5DN9A 4BFXA 3EDRA 3KPVA 4XJXA 1DP4A 4CM8A 4KMOA 1DBVO 2Z2YA 3O84A 2NO6A 1U3CA 4C4OA 3CRW1 3X3HA 2UXCB 1L7QA 4PS1A 5IAEA 3RSQA 4YMTA 2JGFA 2ETXA 4J76A 4JT4A 1AA6A 2EKDA 4ZVQA 1HDXA 1I1OA 4AJIA 2I4LA 5KJ1A 1QAMA 3BB3A 1FB5A 2DT5A 2P7HA 2NADA 4C6RA 3NHWA 5EJEA 1W5SA 1ZGZA 4GQAA 4IH4A 4S1WA 2ZSAA 4YP1A 2WMOB 4M0EA 4KXLA 3BQ9A 3KFVA 3AEQA 3CURA 1NZDA 1OLUA 2GSWA 4QBGB 4ZT4A 5FOVA 1UPXA 3OZEA 4NFLA 3NVAA 2LWIA 2D3TA 3IAAA 1W94A 3TBFA 4LYJA 4QVGA 1BFDA 1WXHA 3Q1LA 4GSKA 5DIFA 4UCFA 3S6JA 1NLMA 4H3KB 2PL5A 1KPHA 5MHTA 4MS3A 3IOYA 4RQUA 5ICSA 3EDCA 2ZAGA 4N48A 1WB6A 1H6CA 1Y5IA 3UFBA 4DC1A 1Y5LA 5ERYA 1M74A 2GR9A 4MRMA 3OCYA 1UMBA 2IGBA 4J1TC 5TGZA 4OJNA 4E14A 1SFRA 5G3YA 2W83A 2ZTHA 4B7AA 3IQXA 1GZ3A 4LEIA 4RMNA 3LT4A 3IQZA 1U7TA 3LL7A 1N4AA 5J1SB 1QBKC 4FFBB 2ZE6A 3UJBA 4E7OA 2R97A 1JN0A 1TQDA 3CVWA 1YR2A 1LC3A 3AX6A 4Q3BA 3KLBA 4AZVA 3K9NA 1NI4B 1F0NA 3SJZA 2ZYTX 3QTLA 3FXAA 3WOHA 1V3QE 4FONA 1ODIA 1GLVA 4HVCA 3OC0A 1CR6A 2I7CA 3E82A 5I9LA 3D9QX 3UBMA 2CE2X 1JG3A 1Y3CE 2W2XA 2PLWA 2I67A 1TFUA 1CR4A 3I9FA 1E3IA 3C6YA 4FFWA 2QGFA 1PQUA 4IF4A 1Z12A 2BHSA 2CKDA 3SF8A 4XCVA 3TSWA 3U9SA 3P9IA 5BWOA 3KOYA 2AD1A 4HDOB 1BS1A 4LVNA 4ZIRA 4GWGA 3V7UA 2XF2A 4JFAA 2IW3A 2JVIA 1PHPA 2QKYA 1GUAA 3PEEA 4RFVA 4XD7A 2A0WA 3JYOA 1ZN9A 1GP2A 821PA 4D98A 1F4LA 4B7ZA 4KJXA 3VPDA 1OGIA 2MIIA 3CZRA 3IDFA 3DDOA 1DBRA 5JATA 2QX6A 2R4UA 2GRUA 1Z4IA 5AVTA 4MGEA 1XZQA 3GJYA 4US0R 1TIPA 3G2LA 1BMDA 3B6IA 2VTKA 3C3YA 1N36B 3OZUA 4RLSA 1HLPA 4G5YA 5B53A 2IOHA 5AT1A 1EFTA 2AOXA 4ZU3A 4AO6A 1MX3A 1KYZA 3G0HA 3ROKA 3SHTA 4XYGA 2R87A 3P45A 1G4UR 2I9KA 2W6JD 4AJ4A 3ZU5A 2Z8XA 4RTPA 3WB9A 3VZRA 4YRZA 1E96A 1GHTA 1SOAA 2OV8A 4Y7DA 4EYKA 4JDUA 2HIMA 4DYHA 5IWAB 4ESVA 2P6MA 3ADDA 1WOYA 4Y67A 3OIGA 1L7NA 1WKBA 2QTTA 4CKYA 3D2BA 3OIYA 4YRQA 3WIVA 1XLUA 4L8LA 3U49A 3WBJA 2DMRA 3FSGA 1N6OA 3MCWA 4I19A 4OI2A 2PZBA 4F04A 3HKCA 1PZMA 2HPHA 2QHXA 3MJRA 5IKXA 2FMIA 4M0MA 1ZZGA 2IIVA 1O6BA 2HJHA 2J3QA 3EXEB 3UT6A 3O21A 4Y2UA 3OWHA 3KNZA 4BBPA 3M33A 3M49A 5EL0A 1L5HA 1YA4A 4LYEA 3T5TA 3ZLBA 1ECJA 4LDPA 1V11A 1BEZA 2OCKA 2TMDA 1PZGA 4D44A 1HOTA 2TECE 2IL1A 1E2LA 2A5FA 2IHBA 3MLAA 2ZSBA 2P9HA 1A97A 1O9HA 2YDXA 1RT9A 1K66A 1RP7A 4GC9A 3D6TB 1EX1A 5DWDA 3G82C 1G16A 3PGLA 2VDNB 4TV9B 1Z6PA 1DWPA 2FWAA 4IDBA 2ZCUA 3A14A 4MKFA 5C1DA 4M0PA 4KPUB 3VA7A 4O5OA 421PA 3S29A 2OQVA 3QVSA 1VI6A 4KO4S 1MR3F 5DTJA 3ZV3A 5EP1A 2COEA 4OXRA 1B0PA 3B5JA 1I7NA 2G88A 4JVMA 1SHTX 2UVPB 1DKOA 1L4HA 3F46A 4BJ5A 2RH5A 3ODGA 5B64A 3A6DA 4WKNA 4I2VA 2WYVA 2Q1YA 3D7KA 1G66A 1YVRA 3GJ4A 2ZWOA 3HO1A 1BH2A 3KOXA 4F1KA 2PCJA 1HDYA 3LYLA 4L5JA 2CV1A 3MFYA 3O5AA 1UKCA 1WCWA 3I45A 2PXHA 1ZNYA 4R2HA 1HNNA 2HMVA 3KZNA 2KB0A 1CRWG 1D2MA 1KEUA 1PBTA 1R5BA 2Q99A 3LNCA 4I4LA 5H80A 3VU0A 4DLLA 5C3UA 5C7LO 3RVDA 3WZLA 1VB3A 4K0KB 3FPBA 3AESB 2G9QA 3A6KA 1RI3A 4HUQA 1W88B 3NTUA 5CGQB 3UAYA 4GL4A 1NYQA 3CXRA 3W2HA 3BMQA 1D1PA 5IMBA 2V7GA 5EKXA 1F4PA 2O3SA 3MCAA 1MOZA 3BBLA 3IUEA 4LF4B 4S2UA 4U0KA 2YS7A 4KIUA 4NEQA 3B70A 2L17A 4N0PA 4EARA 2FKNA 3IL2A 1F3LA 1IHYA 1O1YA 1C8KA 1W75A 2W2QA 2WOOA 1YKGA 3WRYA 5DWQA 4ZC1A 5AM5A 2PTGA 1N5OX 1AU9A 3GGGA 2C3PA 2Q45A 2FY8A 5CVJA 3BMOB 1KEKA 1T1JA 1T2AA 2NGRA 5ITSA 1A9YA 3ZCUA 3DV0B 1SQ5A 1YR9A 3EMDA 5T4FA 2VDKB 1ZHFA 1FFDA 2QW8A 3JYHA 3Q3JB 5J2TF 1L7EA 1NQWA 2WJAA 3OX2A 4QNMA 4WN9A 5HILA 5NLLA 2AYZA 3WJ1A 2AD5A 4Z8YA 1O5OA 3C3WA 3FSRA 4OMCA 3BL6A 1EGVB 2XUDA 3ZDXB 2V8BA 3QBDA 3JSXA 1JAYA 4G23A 3UWMA 4J07A 1UZMA 2VDQB 3PCTA 4MVJM 5JDIA 4PBTA 3LW8A 2BFFA 4XLZA 1SXQA 3WLOA 4YDQA 4AT1A 4AZ0A 2RI0A 4UZEA 5ED0A 4BQOA 3HUDA 2MINB 2X0IA 4B31A 4B9AA 1QH8B 3VAYA 3IQHX 3ZKAA 5B4VA 3EXHA 4C2BA 1WXIA 3H9EO 1XVLA 3P9KA 5JXHA 2EIXA 2ZJ2A 3AETB 2J85A 1MOSA 2VRNA 3GJZA 3LLVA 4ETNA 4H2DA 3EA5A 3PZRA 1R0BA 3F98A 1AS2A 3R77A 4XD2A 3T1YB 4TQ9A 4TWZA 2FRDC 4Z3DA 3GA5A 3WLEA 3NYWA 5IG2A 3TH5A 3U0VA 1VMAA 1WXWA 4Q03A 5CLJA 2CV2A 1DDIA 5FTJA 1AHHA 1LCIA 3HEBA 3PSAA 3WKCA 5ITZA 1YB2A 1D1TA 4DIDA 3KAJA 2E5FA 5BSEA 2J5QA 4H1WA 5KVSA 2OXEA 2CFSA 4Y2QA 1R4MB 1NJSA 2OFPA 4RV4A 1NONA 1FQWA 1C9MA 1O95C 1NE7A 3HJRA 1ADGA 4L9SA 2VSYA 1CPYA 3A3YA 2Z95A 5BUSA <