1Z7WA

Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine synthase
publication title Molecular Basis of Cysteine Biosynthesis in Plants: STRUCTURAL AND FUNCTIONAL ANALYSIS OF O-ACETYLSERINE SULFHYDRYLASE FROM ARABIDOPSIS THALIANA.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 121
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7wA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7wA02
2TYSB 4D8WA 2Q3DA 5JJCA 1KFEB 3PC3A 5D84A 4D9GA 4IL5A 1D6SA 1OASA 1KFCB 1V8ZA 2CLKB 2EGUA 4HPJB 4D99A 2PQMA 3T4PA 5C3UA 3FGPA 1VE1A 1A5AB 4OREX 5I7WA 1J0BA 4I1YA 5D87A 1J0EA 1VE5A 5B1IA 1WBJB 5T6MA 3L6BA 4D9EA 5KINB 1M54A 4L28A 2TRSB 3VSCA 4D97A 1JBQA 1WTCA 1V7CA 4QYSA 1WDWB 4D9IA 2RKBA 3IQIX 5DW0A 1KFKB 1X1QA 4Y6GB 1TJPB 4D9NA 1BKSB 4COOA 3SPXA 1K7XB 1RQXA 2WSYB 5D86A 4D8UA 5DVZA 5HBGA 1BEUB 1A5BB 4XUGB 5EY5B 4D9FA 1F2DA 5B55A 2J9ZB 4HO1X 1PWEA 1KFBB 2Q3CA 3DWGA 4JBNA 4JBLA 1VB3A 4AIRA 2JC3A 1Z7YA 1TZ2A 4NEGA 5B3AA 5I7HA 4AECA 1TTQB 4HT3B 3L6RA 2Q3BA 5I7OA 2GN1A 4F4FA 1TTPB 2BHTA 2O2EA 3R0ZA 1K7EB 5CVCA 2RH9B 1K3UB 2ZSJA 2J9YB 5KZMB 3DKIA 3ZEIA 2ISQA 2DH5A 3RR2A 1UIMA 3DWIA 4KKXB 5I7RA 4LI3X 4WX2B 5BW6B 1V71A 4L3VA 4D96A 1P5JA 1WKVA 2CLIB 1A50B 3R0XA 1J0CA 5I6DA 4HPXB 3L6CA 5D85A 1FUYB 1TDJA 3SS9X 5B1HA 4D9KA 5IWCA 5E0KB 3V7NA 2O2JA 1J0AA 1CX9B 2CLMB 4HN4B 2DH6A 4L27A 1TZJA 3FCAA 3SS7X 3CEPB 2D1FA 2RHGB 1A5SB 3PR2B 1K7FB 1Z7WA 3VSDA 1K8ZB 4ZQCB 4ZU6X 3TBHA 3PC4A 2CLHB 1TYZA 3VBEA 1E5XA 5DBHX 3VSAA 3VC3A 5J5VA 2ECOA 1QOQB 2TSYB 1C8VB 5I7AA 2BHSA 3BM5A 4LMAA 5B36A 4L0DA 4NU8X 3X44A 2ZR8A 2J9XB 1KL7A 2GN2A 3IQGX 5DW3A 2CLEB 2EFYA 1PWHA 3AEYA 1O58A 1K8YB 5CGQB 1TZMA 2GN0A 4OFXA 5DBEX 4ZU1X 5IW8A 1C9DB 2V03A 2CLLB 2CLFB 3AEXA 3IQHX 1QOPB 1Y7LA 1KFJB 1FCJA 5JISA 3PC2A 2CLOB 5B53A 3X43A 2ZPUA 2C2BA 3IAUA 4D92A 3HMKA 1K8XB 1J0DA 4D9BA 2C2GA 4D9MA 1CW2B 4PCUA 5J43A 4H27A 4D9CA 1TZKA 1UBSB 5IXJA 2ECQA 1C29B 4D8TA 4LMBA 1UINA
chains in the Genus database with same CATH superfamily
5JWRA 1LQUA 4Q4JA 5DN6D 1G42A 1KRXA 4FOSA 3F78A 1QJ4A 4D99A 2VYND 4J8PA 1JIXA 3BXZA 2A92A 1PL8A 4TVOA 1CY2A 2C2XA 3WQRA 4D80A 4D56A 1NW5A 3BE6A 2X1LA 4M6WB 2IZ5A 4GNKA 1EFPB 4MEJA 1ZMRA 1T0BA 3HBAA 5H59A 4L28A 1JIUA 1BCRB 2WFLA 3BDVA 4Y6OA 5AK4A 4WN3A 1YI1A 3UAXA 2Y1FA 4JV5B 2XRZA 4LZZA 2Q9BA 4UUBA 2FMIA 5K3AA 3OI7A 3P9NA 1M2GA 3REQA 3KUUA 1WZCA 4D8UA 1ITZA 4FGLA 3OZTA 4M37A 3ZYZA 4YRAA 3TNFA 4ZOLA 2ES4A 1SUWA 1HYHA 2XDYA 1PWEA 4I1VA 2QDKA 4F1KA 3GVHA 2A0UA 2P0YA 2IYTA 3GMIA 2OHVA 2C0PA 1I24A 1RE0A 5EFOA 3JVDA 3MMNA 3SI7A 4OJMX 1CJSA 2VWPA 2AD1A 1V16B 4GM0A 4HLDA 4AS2A 1EG2A 3AJRA 3EPPA 1NLYA 2AOTA 2XOXA 4Y6RA 1T8WA 1K7SN 5F1YA 1PSWA 1XZ8A 1UMKA 3OKAA 2IUSA 4HMOA 2D00A 2LKCA 2OGUA 2I4NA 3BRCA 5I4BA 4I81A 3DE0X 3W4JA 2C7GA 4TWRA 3R74A 4Z4IA 1KMHA 4QLBA 1TL7C 4Q7QA 4A91A 4IWXA 1AE1A 2WWVD 2I4IA 1WXIA 3GFPA 4HUTA 1L4MA 2VC2B 2WUWE 3DE2X 1G16A 1BQ4A 4NMHA 3OE7D 4RZXA 5K20A 2AI1A 1UP4A 2V55B 2Q4RA 2ODWA 2XXJA 3HSSA 3BVPA 1ZNXA 3A1CA 1M67A 5LBTA 1SH7A 5TQVA 2WC1A 4EYQA 4IX1A 1C3EA 1NMZA 4A26A 4RKYA 1OFUA 5AKGA 4XM0A 2JZOA 3NUGA 4W4TA 1SXJC 5K4HA 1JEEA 3TINA 4AY5A 1E94E 1DOHA 2BHSA 3D7LA 3PFFA 1ZAYA 2MYUA 1R5OA 2QN9A 4LFCB 3FNEA 1TIKA 1QYCA 2ZB7A 1U4OA 3N7UA 4L4ZA 4UM8B 3ZHYA 3ONVA 2JAOA 1PSZA 1ZLXA 5EKDA 1LFDB 1MVNA 4C7OA 4MLCA 3SQWA 2QN6A 1O58A 3LYLA 3S55A 1KNQA 1CQZA 1PEYA 4AIIA 5EE5B 1DTWA 2WFMA 1HYGA 4PG4A 4NBNA 2O8CA 3A1WA 1V8FA 4B6GA 2QN8A 3Q40A 1HNXB 2PMFA 4O2LA 4ES6A 3U48A 2QTZA 5HKKA 3UA3A 2VF5X 2UZ4A 2HZBA 5C18A 4D25A 2GEKA 1YFZA 1YC2A 2NO6A 3ZJTA 1PJ2A 5C8YB 3WLMA 4IVPA 4GSLA 1X9IA 3NTOA 1NPDA 1G3UA 1K6XA 2BTQA 4QFDA 3PNBA 1RBMA 1V0JA 3AI3A 3DT9A 1U7UA 1D07A 3GFBA 2VHEA 4DBLC 3M4ZA 3UY4A 1RWKA 5C5IA 3OCXA 4LGCA 1EZZA 3HYNA 3NOQA 4OQEA 2H08A 4ZYXA 2FSIA 3DYBA 4FLEA 3RK1A 5IULC 1NXSA 1XEFA 5EJEA 4BO3A 1LDMA 1JHRA 4DLRA 1FDVA 2YWBA 3JQDA 4NMLA 3A4IA 3VM6A 4ENRA 1RRMA 2EWWA 5L9AA 3ND5A 1INLA 1WB5A 3P5BA 1X7DA 4FONA 2CWWA 1IE3A 2BGNA 1RCUA 2E7ZA 3EAGA 1S2OA 4M3NA 3DHWC 5G0UA 4YMIA 1PVOA 2CCKA 1MOSA 2B9VA 5HFNA 3EA4A 2ZSFA 1P3JA 3DEZA 3NNDA 4XUDA 2QYHA 3KSUA 3E15A 4XE5A 3DUFA 2PUEA 2RKBA 2OR3A 3CNNA 3JQ6A 1P5RA 3CVXA 3ZGZA 2LTAA 3FYUB 3I1YA 2PO7A 5I8PA 4Y6GB 5AD1A 2P3SA 3OEHD 4CLXA 2P6MA 2O8BA 2Q6KA 3I28A 3T5TA 5H83A 5BUZA 1E2JA 2Z2YA 1ZL0A 3LX8A 4RDXA 1F0NA 4D9FA 1T36B 3DV2A 5F1OA 2XKKA 2WIKA 3ETJA 2XUQA 4DLKA 2PNFA 3I6QA 4B32A 1U1CA 1CJMA 4ZAXA 1VIVA 3JD4A 1M8JA 3MZ0A 4A0SA 4RZQA 1XTKA 2DGDA 1QHHA 2O52A 1Z6QA 4X7BA 4BFVA 3WIBA 5KHOC 2IIBA 3AR4A 1UMCA 4F4JA 4F4FA 2O2EA 4ALNA 1EAMA 3PCXA 2VJLA 2CFIA 2RH9B 5B5SA 1SZCA 1ORIA 1FYVA 3GEBA 3RR2A 2GRJA 1KYYA 2HLNA 1IVYA 1IAQA 3IX7A 3MRVA 1W49A 3C3CA 5EP3A 4PY2A 3V2HA 3WRYC 1TVEA 1RXIA 4NDNE 1GARA 1HKUA 3MC1A 3DOEA 1XK7A 2BH2A 5EXDA 5FF9A 2CMKA 2FWPA 2ONZA 4MGIR 2O05A 2D1YA 3KK0A 2HADA 3EE6A 4HN4B 3PKJA 3AETB 3LJKA 5ICMA 3KKOA 3GJ8A 4AZ0B 2G70A 2VWHA 4WOBA 1ISPA 2Q1XA 3ZDQA 5E95A 1IRIA 1T2AA 1W73A 1SXJD 2AWOA 2VT3A 5E8RA 2WHEA 2Z56A 4IG4A 3MILA 3VI3B 2J30A 2RK6A 3IEMA 2WWXA 3Q0IA 4CM8B 2VNAA 2IW1A 3VBEA 2VDQB 1M8PA 4J9VA 1C3XA 4JKIA 1K7CA 4Y6PA 1LNQA 1T10A 5IHPA 2FP4A 3KB1A 3MJDA 4I36A 4YFYA 4YUZA 1I2ZA 5JY1A 5FPHA 1RKXA 4ZCMA 2AQ8A 4PLYA 3KB8A 1HO3A 1W29A 3L4SO 1Q20A 2X0EA 2D5IA 3MB8A 1IXYA 3DAFA 4RO0A 1KNXA 5KKCA 3W2TA 3SX0A 3CN7A 1LPOA 2C3OA 4IIHA 1XZAA 4FCWA 4O1HA 5ALJA 2X1VA 5I48A 2XV1A 4NTZA 1X1DA 3M0EA 1Q1EA 1JH8A 1M6VB 3AR8A 1MB0A 2PT9A 1UT6A 1QYWA 3ZHSA 5IKPA 3VNVA 2C96A 1OWLA 3O03A 1ZQ9A 3MBKA 2QMQA 1O6GA 2R87A 2GZ1A 3G0DA 3OIVA 1MX5A 4ZZ1A 1KY2A 4I50F 4G1EB 3ZJ5A 3C8MA 5LR6A 1SC6A 2EJBA 3AZOA 1B8PA 1RM5A 2AVDA 2AI2A 3MJEA 4HFJA 1VSBA 4QOJA 3W5JA 3WNCA 3RYIB 1Y6FA 3RRMA 1GUZA 3IP8A 5KJ1A 1IYZA 1TIPA 2V0GA 4G0ZA 4JD5A 2ECQA 4KWEA 3U0BA 5K0EA 4ZMRA 4KJZA 3OAAD 1ZD4A 5DEOA 4R5MA 1C1XB 4K03A 5J4LA 3E3NA 4DJFC 2G4VA 3T0FA 3M6VA 4MQEA 2Y71A 1YD7A 2ID9A 3DAOA 3M83A 1A1VA 3DCNA 2XAAA 3ZX5A 1QVAA 3RHSA 1WVIA 5DTQA 2IZOA 1UOPA 3NP7A 3R4CA 4Q02A 1FMJA 2B82A 3HY4A 1VG1A 2B25A 1L4LA 1VLZA 3L8CA 1XNGA 2JH9A 4TV9A 1T8PA 5DXJA 3D6AA 1WTCA 4O2BF 1M7BA 3LC7O 1DIAA 1KS2A 4MV3A 5BQ5A 1E1DA 4IIJF 3NM4A 1LY1A 2VYFA 2R1TA 1RJGA 5DF1A 5FUWA 3LQRA 1XDSA 2PYZA 3IQFA 1M9NA 2FHPA 2HREA 3COWA 3LUKA 3DMTA 3WDKA 4AY4A 2QLLA 2Y68A 4AXXA 3N2GB 4GX0A 3UB2A 1Z45A 3TXYA 3CR7A 3JD2A 3QWIA 1AJEA 2VJAA 4FZ3A 1AU9A 1S1CA 3TLMA 3MJ4A 1SVUA 4B9EA 2HDWA 2OL4A 1JPJA 1XD8A 6Q21A 3BEDA 4IKEA 2ODNA 1I7PA 3UHPA 4PZZA 2XXAA 2Q3MA 3ON5A 2C3UA 2JS7A 5CLQA 4HNHA 3IXMA 1QCYA 1NQTA 1QG4A 1F6BA 5FTJA 4BU1A 2BHTA 2WAYA 4ZOCA 4EB6A 3KZMA 4JUBA 5DX1A 4BXOA 4PR3A 5K5EA 4M0PA 3CMMA 4J0GA 4O4IF 2RI6A 2FW9A 2W58A 4PNZA 5K3CA 1J99A 3OWXA 2DWQA 1TO6A 5BW6B 5IF3A 1JEAA 4EQ6A 2JIZA 3A2NA 3SZGA 4CV2A 1TFUA 3ZWDA 1A2KC 3QXJA 3WYEA 4J2HA 1R88A 1RQ7A 4IZ6A 1ELOA 2AHRA 3IE1A 4YHHB 3QPBA 4X44A 2QTBA 5JZ9A 2VYQA 2GXSA 4KHPB 2WRZA 3CEPB 4K9OA 4UHBA 1E3TA 1HDGO 1WZEA 2NU6B 3MTJA 3GCWA 4QGGA 2XNCA 2I4OA 2PZJA 4UUOA 3GAZA 3VZRA 1MT0A 3QNWA 2J87A 3N8DA 4ASUA 1W5FA 1FFEA 3A2MA 2OCGA 1EP2B 3H5NA 5EKSA 1WM1A 1B0UA 1RYDA 2RIPA 3BZBA 4J2OA 2Z30A 4UNSA 2FMXA 2QV7A 3IIMA 2YVKA 4LV5B 4ND5A 1MZPA 4UNIA 4O4JF 4FKZA 1QIMA 2PJZA 4QSMA 2R3SA 3EFOB 1UXIA 3HA2A 3ZNQA 1O1YA 1PJTA 4TTPA 3FPEA 3PRYA 4KCGA 5TPZA 1NN5A 3SY8A 5KQMA 4W5WA 3DZIA 4GYJA 1ORWA 3OJWA 4BNFA 2PNJA 4WVLA 1K8YB 1J07A 3K9GA 1RHJA 1ZKMA 1BXGA 2D4AA 5A0FA 1QX3A 2LGJA 1PK8A 5T4HA 1XNQB 1M7GA 3R5JA 5FPSA 5GV8A 1P61B 4GECA 4MK4A 3SSMA 1EE9A 3LXUX 2JLYA 2BFBA 1YI0A 3CZ5A 1GG5A 2AT1A 1Y5IA 2YW2A 3NX4A 4DSOA 3TCXB 1VMDA 1WV1A 2GAJA 1B6RA 4RESA 1KE1A 4I4TB 4BTLA 4RYLA 2NW6A 1E8NA 2HA7A 4YONB 2W2TA 1JFVA 4RFVA 2QNBA 4RH1A 1XU7A 4UAGA 1G66A 4TT3A 1JDJA 1NBEA 5MN5A 4OX9B 1Z33A 3DD1A 3RT1A 3BJEA 4U9IS 5CH8A 1X9GA 5HIAA 5JS8A 2X6RA 1QIKA 1CUDA 2I7CA 3D59A 4RDCA 3K1AA 3PUWA 3QLUC 4X1YB 5FTWA 3I9KA 4C4XA 2NXWA 1LS6A 2PIAA 3A3PA 3IRVA 5H5JA 1W94A 3C3MA 4BVLA 3CUUA 3HGQA 2XMGA 5KX5B 1JEJA 2IUTA 3JS5A 3LHSA 3LQ1A 4IW3B 3ZV5A 7MHTA 2GPTA 4XFKA 3D8NA 1GTJ1 1P60A 1GWNA 3PD0A 4Y2UA 2JAPA 2IP1A 1O9GA 2EGGA 2D2FA 3FDFA 1BW9B 4MVJD 4Q1CA 4QEDA 4JIGA 4L8WB 2JGDB 4KQXA 1PW5A 2HB6A 3OPQA 4KYTA 2ZIFA 4N39A 5CRIA 5KYNA 4HQ0A 1AUXA 3K6RA 5LDGA 3U3RA 3ZDEA 4E31A 1G3MA 1D09A 2CL7X 1PKEA 5AM5A 4YEDA 5I3CA 5KTMA 1N2ZA 4OUDA 4A8JA 4KR2A 4MDFA 4NZZA 4RGVA 2V7QA 1CQJB 4KR7A 1YQTA 3JAMA 4AP9A 1RYZA 2WEKA 1RPZA 4IV5A 2Y27A 4RQAA 4QTYA 2AE1A 4EF5A 2H16A 3EXFA 3FVTA 2A9OA 4JMLA 3PNKA 3DGEC 4R7GA 1TLTA 2AFIA 1MD9A 3AMVA 4LSMA 4WBNF 2XDAA 5IMSA 1N36B 5D3MA 2VDVE 3W7AA 4EHJA 3R0ZA 4J0KA 1XLTC 2P4UA 2H59A 2WWWA 1M1XB 3ZQUA 3EVBA 4Q4HA 5GOZA 3HCBA 4E70A 1OXMA 3VH4A 4XB1A 4ENWA 1F9EA 1ISHA 2C5HA 5M29A 5C2JB 3U44A 1H4SA 2X8JB 4JROA 5CYPA 3GQBB 1HQDA 1QV9A 2A0FA 3NEJA 4G4IA 3IHKA 1TDJA 1BU8A 3K2QA 4TMWA 5B7NA 4I9UA 4EK9A 4KPEC 4GGMX 3GB9A 4ALKA 5F7JA 2A0YA 4BN0A 5KYXB 1T3HA 1T91A 1P9OA 2B2XA 2CUZA 1BYIA 2P7HA 2WG1A 1P1HA 2XNHA 2P0AA 2XNDD 3DKPA 4KUHA 1PQYA 2G40A 2J9FB 4WY5A 3U4HA 3VSDA 3F98A 3VDRA 3ZCVA 3HA7A 2C5SA 3EG9A 4OX9Y 3EIQA 4EYSA 4HDRA 5JVDF 3W77A 4BFSA 5CXXA 1X42A 4BUZA 1A0OA 4IWNA 2F8MA 1DTEA 1LI7A 2IU6A 3M5DA 3O2SB 3KVYA 4FCVA 4JLNA 4O4JB 4ZOBA 3S2IA 2VQSA 4NU8X 1WBDA 2IQIA 5G3ZA 1UWLA 3W4KA 1VTKA 4AICA 2A94A 3IPLA 4IJ5A 5FYDA 5M04A 1E32A 4EABA 3PFCA 1LC3A 3TM4A 5DLQC 4HB4A 4NCNA 4DSTA 4UM9B 1G60A 1KO5A 3WYNA 2B4AA 1JEYB 2WD9A 4JBWA 5KOHB 5DCYA 2VQFB 5SYNA 1BDMA 1CWUA 2YIDA 1X38A 4WJLA 2PS1A 4MVJP 4ZYTA 3GWZA 3PQ5A 3BMNB 1PVVA 1M2KA 1ZK1A 3R6GA 2XAUA 5COAA 3W9YA 4F5YA 3T7EA 3ILVA 2PM8A 4FMDF 3LD9A 3RS8A 1NSFA 3CEMA 3DYIA 4M1OA 3ZDRA 2NSJA 5BMVA 1EX1A 2FYTA 4GICA 1TCCA 2JGNA 2GCEA 3AFMA 1LJ8A 3QFRA 4QDXA 3S2FA 3VYUB 3RFVA 1HURA 4HGYA 5IDWA 1S6YA 5CTJA 1GSIA 3STHA 4ZCIA 4DV5B 2F8LA 1PP4A 1I2BA 2XITA 1BSVA 2WMOB 1B41A 2YBEA 3CPHA 5IK2A 1F7VA 4BCBA 1ZXBA 3BC1A 3EGIA 1XMXA 2HNAA 2VHWA 5I51A 2XR1A 5F2KA 3HZZA 3OQVA 1N2CB 4HTFA 1WD5A 5JYEA 2F43B 3FZGA 4Q21A 2LZ0A 3NUZA 5JPIA 3BCRA 3OURA 4Q01A 2BFPA 3MFYA 3HBNA 4N82A 4RFSA 2DUJA 1GILA 3T4UA 1SKYB 2XNSA 2EEZA 3MOIA 4G4SO 2ZYIA 1PFQA 3BD7A 4ID3A 3EW9A 5JMOA 3F2IA 4TUYF 3LI2A 2NAPA 3KO8A 5EZQA 2QL9A 3WLIA 1ATIA 4WXPA 1E2UA 3OHSX 5T67A 1JAZA 2GN9A 4AMBA 1LBQA 2YIJA 5AUOB 1FRFS 5LP6C 4ZANA 5DBGA 4JP5A 1B1AA 1GKKA 3T1VA 1XD2B 2EW1A 2X0IA 2QQ5A 2WW8A 4HGOA 1E61A 2P0EA 1VB3A 1XXLA 5CFQA 4JJAA 3H97A 1MAWA 2B0CA 2EKBA 2EKQA 1U6IA 2WA2A 1N33B 4Q9DA 3KKQA 2ECPA 2LVBA 4DMFA 4WBNB 3K5HA 4NBKA 4E4YA 4CM5A 3GLFE 3QMMA 4JLUA 4YDSA 1QG0A 1P9WA 2R8OA 2XCQA 2BT4A 2YWHA 2JJ2D 3WWPA 2DH5A 3K96A 1JVSA 3VU3A 2ZBPA 3A11A 2PTHA 4NV0A 3Q15C 2BGJA 2X2FA 4UPDA 3GN1A 3PC8C 2ZBDA 4TV8A 5C52B 3LG2A 1T3LA 2VZ0A 4ZQIA 3WLAA 2G04A 3AGQA 3G85A 2R4TA 3ZD7A 1GTMA 2YICA 3ZWWA 3JQRA 4Y0AA 4DADA 1NVAA 2C1EA 3ADKA 3SS7X 3W3ZB 4GD3Q 2ZG6A 3IUPA 1RXVA 3WGLA 3OQHA 1Z7GA 3NKVA 1Q95A 1AHIA 1E0JA 3LA8A 5BV8A 3KWFA 1T4DA 4XWTA 3SJ7A 4Q3DA 1KI1A 3AB7A 3HQ4O 4MRAA 4QUKA 5F1PA 4YLEA 3NRJA 1MT3A 1NXTA 2ZS7A 2AUMA 5EHXA 1UFOA 2WKPA 5REQA 2I76A 3ZGYA 1LW6E 2A9FA 4NS4A 1W44A 1Q1BA 2ZDGA 3K2BA 2EJWA 2PUHA 1LDBA 3BGVA 4M1YA 1QHYA 4LQDA 3ABIA 5HZMA 3FPKA 3LIPA 2Q4DA 3PQEA 1GPBA 3RVBA 3CVUA 4F6RA 1AKMA 4A6XA 4YJ3F 4IUBS 2JVIA 5LPNA 3PPXA 3OZAA 5ALSA 4MB2A 3L43A 2C7VA 2W2XA 3GG2A 2QNIA 2NSYA 3OICA 4X91A 1YR6A 2FCRA 2ZWAA 5AVSA 4XIFA 2NV6A 2YZ7A 3D8UA 4DV1B 1GCUA 2XBUA 4LJRA 3ANMA 2NVOA 5EZSA 3PQ6A 4OLAA 1K8XB 1XRNA 2NO7A 3RSFA 4MKXA 3U3OA 1YACA 4FMDB 2B1GA 3LCCA 3CUEF 1I9CA 1JE0A 1KEVA 2QEQA 5CA1B 4LXHA 4D1YA 4K9NA 3ASZA 2C5GA 5AK3A 3V4PB 4B74A 3MJFA 3DA8A 4IQ8A 2X2OA 1LK5A 5IVIA 3C15C 3STXA 3G9QA 4RMHA 3D7MA 3T9DA 2HT1A 3I04M 3TVDA 2GLUA 3AJDA 4FZRA 2UXCB 1IFXA 2FWRA 2O4CA 3IP1A 3A4TA 3ELDA 3PNOA 4L16A 3U40A 3ZXSA 2IFTA 4RZ2A 5D87A 3S29A 4DIEA 5KWIA 2O5EA 2BEUB 2OVFA 4IQGA 4LXXA 2PKYX 3S1AA 5A4KA 4F5EA 3K8OE 3KD2A 3O8RA 1OSNA 1YAJA 2CCGA 2EJTA 4ND6A 5F9FA 4LXGA 8LDHA 3VH3A 3JQPA 2WIAA 5LXTB 2HRQA 5F9MA 4GWGA 4WFJA 1H66A 4ZV9A 1Q0SA 4HFNA 5K3EA 4YP7A 3STYA 3QPDA 1CUAA 5CNJA 3JQEA 4YP1A 1NU8A 3T1YB 3KTOA 3DDCA 2XB8A 2PZ8A 3NHWA 4B7AA 1EWKA 2PQ6A 1IPHA 1X8KA 4EJ0A 1RQNA 3GJ3A 2YWGA 4S1NA 1NLUA 1P1RA 4KXUA 4K2HA 1AKWA 4E3ZA 4LDZA 3MWJA 3CU5A 1XZLA 2ZI4A 3EWAA 2PD4A 1LXCA 2WIBA 4WLFA 5KTSA 4RELA 2OXEA 4FR0A 4LYEA 4IIGA 5ERXA 1IOLA 1ONNA 5BSTA 5AKHA 4X41A 2FZGA 3W90A 2GBLA 3JWHA 2QSUA 5LZ9A 4JCCA 2NQ8A 1T8TA 2H0AA 2IZ1A 3KVOA 3ZU2A 3HKEB 4MS3A 5BSGA 2FN9A 2NACA 4PYJA 2A5FA 3GJXC 4IDPA 5CB4A 1NQVA 2I6XA 4KRYA 9LDTA 5K0BA 1G5RA 2AG0A 2XZOA 1KYVA 5HP4A 3HB0A 1U8XX 2OGTA 3FLBA 3VYRB 3ZKAA 3ITEA 3T5GA 2X4DA 3H3JA 5D5HA 3LUJA 5LOVB 4DJAA 4WINA 3JD1A 4U6QA 2QVGA 2WTBA 3ORHA 4GI7A 4YCAA 3B6KA 3LT4A 5C5DA 4PG6A 5DNEA 4OYRA 2VBCA 2AX4A 3VGPA 4WERA 1JKIA 3PX2A 5EMHA 1P2DA 1YNSA 4AJ9A 1LRJA 3P9KA 4TMTA 1KYZA 7AT1A 5FT9A 3PITA 1ONBA 5H3LA 1NHWA 3JRNA 3IVCA 1BCSA 4QRDA 4QPCA 4LF8B 3OMLA 1CRQA 2I33A 4H6PA 1T3TA 2I8CA 3OT1A 4F71A 1ENPA 1AKYA 2V6IA 1FUKA 4N54A 4MP6A 4KXQA 5C1IA 3E5MA 2GNPA 3AR6A 5D51S 3I04A 4S05A 3SLGA 2GXAA 3RC2A 5E6SB 2Q0HA 3FM9A 2QJWA 4WZBA 1WCIA 4YJ3B 2O50A 1UXOA 4Y2YA 2NUBA 3O8QB 4GWKA 5AVOA 1U98A 1WB6A 3TE6A 3EX7C 1ZD1A 2IXTA 1VJDA 3K8ZA 4CF7A 4HYYA 3VC1A 1CT9A 3F2VA 2IZZA 2VNKA 4LEIA 1PR1A 5FP0A 4OMDA 3U39A 1D0VA 4BKOA 4EPWA 4HRAA 1PFUA 1EUDB 2EBUA 2WKWA 3F6PA 1IN4A 3LDFA 3LIIA 2P30A 4Q37A 3UK1A 4AUKA 4YV1A 2GLXA 2D2IA 3MGGA 2X0NA 3LPCA 3BBPA 1IPFA 4WN9A 4JX9A 1PJ3A 2KW5A 1OI3A 1B14A 2DSNA 1T5BA 4JLSA 4NJEB 4BL5A 1TRKA 4NQZA 5KAMA 1JEQA 1J06A 4WKCA 4C87A 3AKYA 1VYHA 3GLUA 2I9PA 2XJ4A 1RWBA 1YQGA 1ZZGA 4X8OA 2EGUA 5IAGA 2XVMA 3K72B 5CBPB 5L40A 1NWCA 4U7TB 5FL3A 1Z6YA 2PWZA 4JVSB 5I5GA 3KPUA 1T5HX 1IN1A 1WW8A 1J2JA 2WVAA 3QIVA 4O1IA 5JHHB 1I13A 4LTMA 1QF6A 3PNVA 3TZLA 1KAMA 2X2EA 2XMDA 1EM8B 3BXXA 4KO1S 5K01A 2V9PA 3QUAA 1QC5A 3N0VA 3K92A 2J6BA 2P11A 4OM7A 3KHSA 1XRRA 3GF4A 2ZWOA 3HPQA 1YL5A 2FWJA 4JGGA 4LJ6A 5BRAA 3N8NA 4QXMA 2HOQA 1M8GA 4QUDA 2H7YA 4MV8A 1CR2A 1YR3A 2NVWA 1WXEA 1Q91A 3LBIA 1OWPA 5IM5A 1MAAA 3FIJA 2E4YA 2LD4A 4U7DA 1DRKA 1C9MA 4G65A 2ZSKA 3HYLA 1QP7A 2RGRA 2HXSA 4TLCA 2X8WA 2GQ0A 3OE5A 4OJNA 1IB6A 2ZRQA 1LPAB 4JHXA 1G5HA 4AQDA 4F9EA 2Z6VA 1TOAA 1YR7A 3EDMA 1IH8A 3FWPA 2X7JA 1EJ2A 1XAGA 1UJMA 1P9NA 1XYYA 4NK4A 4GOJA 4J0IA 1CZNA 2H17A 4G01B 1O77A 1UOEA 2VJYA 2X41A 1QRRA 1V11B 4QBHA 1NZJA 1NVBA 1E3IA 3BCUA 2QUBA 3I53A 5DJ5A 2P91A 3VPDA 4EHIA 3WGOA 2HDHA 1PR4A 1NFQA 1JKMA 1NIPA 1QLHA 1RRKA 1LSSA 3DE6X 3E23A 3H4VA 3PNYA 1Z15A 1OREA 1Z4IA 2BFFA 3QK7A 3DOOA 3LP6A 3OFVA 4JQYA 4N5HX 3KXLA 4GGOA 3WISA 1ZIOA 4DLYA 5F7OA 4PR0A 3STTA 5JC1A 2RFLA 1B42A 1FXWF 3AEKA 4DQLA 1RZUA 1L5GB 3GUZA 5INTA 5CNIA 1VXOA 3D8BA 5DI9A 3SQNA 3TL2A 4G1VA 4B3SB 2RBEA 3CRZA 1MABA 5B6IA 3HH8A 5D3KA 3RD5A 3QX8A 1N5LA 1P2BA 3HK2A 3B6MA 1ZK0A 3FKSD 2YVQA 3T1NA 4B44A 4CEHB 3LQ4A 4MVJI 1XEWX 1E5XA 5H1YA 2OFPA 2IOFK 1DNPA 2B4RO 3L06A 5JAQA 3AV3A 4P7KA 1EKXA 4MVJH 3WYFA 3W0LB 4A82A 5B7PA 2OG1A 2H2FA 2IC5A 1U8AA 4ZZ2A 1PR0A 2IH2A 5CYFA 3E81A 3MFQA 3EZGA 4R0VA 4F3NA 3EZ9A 3URKA 1UDAA 1WXQA 4PYOA 5BMOA 1Y8QA 1YJAA 4H7IA 1PT8A 4JR0A 3GEIA 2QLTA 1V48A 4LHWA 1I6LA 5KWEA 3ICOA 5KPDA 2AW3A 4FN4A 3THYB 5A3VA 4XB6B 1SD5A 1XMIA 2C84A 2QE7A 3LCMA 2PSSA 3NASA 4IIXA 4O5AA 4Q1VA 2WFZA 3L49A 4WOJA 2P2YA 5IXYA 1NW8A 5KTNA 1I1HA 1XFAA 4TVKA 2YJTD 3B2NA 5DHPA 1ZC3A 3G17A 4QNRA 5CH3A 1NX9A 3BJIC 1EMDA 2E1PA 2VHYA 3VHLB 1Q1QA 3D6VA 2IZ7A 2QTFA 1N7JA 1IOWA 2H11A 3L2OB 3O47A 2ZJ5A 1HKHA 2ZRFA 1K75A 3AFNA 3M2TA 3RYHA 1EG7A 4ZEMA 3CN9A 1BWQA 1T0IA 4CF6A 5FJJA 1VQ1A 1E2IA 2P1DA 3L6DA 5KVCA 3CLSC 2V7TA 2QL5A 1FYXA 1OU0A 4EUNA 5M2QA 4PF1A 3RF6A 1GPDG 2MSNA 3JXEA 3P2KA 4HAOA 5K9ZA 1RXYA 3S99A 2V97A 3WNBA 1DC3A 4A03A 1D04A 3OC6A 1G8MA 3SG0A 1M3SA 4Q1DA 2VN8A 1HF3A 1KK2A 4NQRA 4GPIB 4CT0A 5AI8A 4F3KA 5B30A 4F5WA 3WNQA 4KXMA 4ACBA 2WB2A 2J09A 1E6CA 4O29A 3FRJA 3RSLA 3GLIA 1DVRA 1J00A 5LLDA 5H8WA 1OTYA 1EP1B 1L8OA 1OFGA 4ZAWA 3DVLA 1GGVA 5TQ2B 4QOGA 2NSHA 1U2QA 3DMTC 4DDUA 3GGJA 1W4CA 5FHRA 4FDVA 1KQFA 1NBHA 2FAXA 2O3TA 1TT5A 3NWPA 4RCYA 1LS1A 1TQHA 4IUCS 4TSKA 1JHAA 1T9ZA 4YRNA 1ESNA 3LF1A 1Z38A 4D82A 4A6EA 3GPCA 1YZLA 3WGUA 3IVXA 4DR1B 4I50A 5E6UA 4OJTA 5FD8A 5BR7A 2ZETA 4LV8B 2Q5FA 4BWGA 5L95A 3IR7A 4ERXA 1L4FA 2W8BB 4QUIA 3H5WA 1RJWA 4DL9A 4I2VA 1ANKA 2DPHA 4LCEA 1NN3A 5JZSA 3A1EA 3KUXA 3PZRA 5JLAA 3CRVA 2WNIA 5KNBD 2DTXA 3OQIA 1KTVA 3SEQA 3CZCA 4AM8A 4HAUA 1OI7A 4YB8A 3TW6A 7REQA 2ZBQA 2XB2A 1RRVA 2C4WA 4G1FA 4M7RA 2BP7B 2WMYA 2I66A 2JFUA 5GVRA 1WHTB 3PGKA 3ER8A 5EJ7A 5AI0A 1U4NA 4YJ2A 4FS8A 5CT5A 1TUBB 2VYVD 1T1GA 2CN1A 4AJEA 3KPYA 1E64A 2Y2UA 2DT5A 1VL8A 3AL2A 4YIHA 2W22A 3QE9Y 3ZWXA 2QU7A 1G7CA 1FMCA 1T9DA 4O2BA 1A7KA 3EOZA 3W1VA 3O8OB 3HU1A 4Y6SA 1QF9A 2ODTX 2AB0A 2Y1WA 3DC7A 1NXOA 1PR5A 3E8XA 4IIVA 2RIRA 4IXWA 4U3JB 4IIJA 5BSMA 3C1AA 2R44A 4K26A 1ZJZA 5DRTA 2JLXA 1BH6A 1RTKA 4BBZA 4EEZA 1RI5A 4QO7A 3JVIA 3LWBA 4EYGA 1SCIA 1TUIA 4OBEA 2VSOA 1ODSA 1QIGA 1J70A 2J5KA 2XSZD 3G9ZA 4JU8A 4US0R 5C4MA 1FMLA 2NU7A 5DV9A 5A05A 2OZEA 4G5YA 5G40A 4CXMA 4TYWA 1AHHA 2BMJA 4B2IA 3JYHA 4E14A 4RQTA 3IUYA 4B3FX 2DBZA 2Y8EA 2ZJZA 1GGFA 1O96A 3DAHA 2Q99A 3DFIA 4MICA 3W3AD 3M1IA 3WSWA 5C34B 3V7YA 4E5YA 1P6UA 3IBSA 5KJCA 4DUZB 2PUDA 2D7CA 3PUHA 3GP8A 1V1MB 2W98A 4XH9B 1XTJA 1CXZA 1CVRA 2E87A 2GM3A 3BOSA 3OSZA 2VT2A 1PX2A 1TYDE 2NT3A 3CUYA 2GFQA 4RL4A 4UDYX 4N6GA 4HZIA 4O4IA 4BJ1A 3KSMA 1WWKA 2EYUA 3CVYA 2HN9A 5BWCA 3JW8A 3QNUA 1TQ8A 3FBWA 2V7EA 1DTSA 3LVFO 1AUQA 1U6KA 3ZBTA 1UAAA 1YTUA 1E5DA 5IKMA 1VI6A 1RAIA 2FEKA 2RK3A 1X7YA 4OVKA 1UP6A 3T38A 4AG3A 3L0BA 4CCYA 3HZRA 4JLJA 1J39A 4DNQA 1U0HC 4UQLA 1AGXA 1XTSA 2EF1A 3H8VA 4XVHA 2ZUCA 3TEMA 1YCHA 4FMCF 5IG2A 2WSIA 4P7FA 1AS3A 3NOXA 2HJSA 1XA0A 3NBFA 4FJ2A 4IIUA 3LY8A 1QZXA 4NCHA 4YRQA 5DBFA 5K0FA 2OHGA 3RRJA 2HA3A 4M9ZA 5IAAA 4FUQA 5IJWA 1TIBA 3AUJB 1CYDA 5AM1A 2YCLA 3TRIA 2CNKA 3ZHRA 4GOKA 3I45A 2WSBA 3A1UA 4QGHA 4CCAA 2H5IA 3ZQ4A 4DCCA 4MUXA 1KJIA 3KZVA 2CZQA 4MVCA 2DY1A 5BNWA 4GYWA 1H2YA 5SZIA 3BJRA 4GP9A 3COJA 4LNHA 1Z17A 3O90A 4HFMA 3DHVA 1RABA 2HEIA 2NPIA 4J29A 1JSRA 1NRWA 2H8GA 1QTIA 3ABRB 1SBTA 3D6FA 2H65A 3GRUA 4HNRA 5GM1A 1DC4A 1A71A 1FUIA 5GQSA 4YV0A 4A8JC 3IKTA 5EGNA 2BKLA 1TPZA 1L3IA 4DSAA 1HLDA 5A5GA 2CJFA 1B16A 4ARBA 2GWHA 3UFBA 4E4RA 4L15A 1YCFA 2VEOA 1HDRA 1VE7A 3CZ9A 1R8SA 2I91A 3U31A 3FPFA 3REFA 2G76A 4WEOA 1W88B 2XMSA 2FZCA 1SXJE 3ZPXA 3KYIB 1W4LA 1W36C 2OQRA 1E4EA 3M6IA 3R7AA 2GZSA 3T7AA 4J2TA 3RIXA 1TF7A 3WAGA 4YJFB 2IS4A 2PLRA 4D45A 1JZQA 1CP2A 3KAPA 1L5HB 1TU3A 2JIZD 3FPLA 5FORA 4BX2A 3DMPA 2ECKA 5D5PA 1WKVA 1O0SA 2Y1CA 1RXSA 4YBZA 5BPFA 1XZDA 2XMPA 1WLSA 3EPLA 5AHWA 3DDWA 4DCTA 4Z1OA 1GYQA 2Q5CA 4JP3A 1AGYA 5M5BA 4HYQA 4NCAA 3VVBA 4PZYA 1MW9X 1X1RA 1MQ8B 4MW2A 3EPJA 2RD2A 1H5NA 3IHWA 1CD5A 3ADOA 2O8DB 5MF6A 1NP7A 4LF7B 4XYLA 1SUCA 1T1SA 2AHOA 2EOAA 3HDQA 4NL4H 3I5MA 2WE8A 2BF7A 2FN3A 2BE9A 3FHCB 3ZC3A 2E4ZA 3ND9A 3T61A 3C3JA 4L0DA 1Z9BA 1ZGCA 2A1TR 3CNQS 4NNPA 2H3EA 2G1AA 1DQZA 3HKBB 1HETA 3SJZA 3EPKA 4UJ5A 3RW9A 2SICE 2QUHA 1UC5B 1AOXA 3DD5A 3CNHA 2Z2ZA 3FZNA 1KA9H 4OHCA 2BSXA 2Y0CA 1V9LA 5HRUA 4WBNA 2LXNA 1L7DA 1WUKS 1Q0LA 1JR2A 3ABOB 3BYZA 3FXAA 3EXEA 3HWSA 3O8DA 4Y2RA 3B60A 1M34B 2WPDA 3QMWA 2IEGA 2NUPA 1Z68A 4GKAA 1XZCA 5E3HA 3FSGA 2A1TS 4OJQA 4Z9FA 5LUBA 2XB9A 1Y5NA 1II8A 1RHKA 3KKLA 5BW8A 1TMOA 2G5GX 4AQYB 5K3FB 4HG2A 4TT3D 2R8BA 3L41A 1LC0A 2MU1A 3PI7A 3VPFA 1VSUA 2IYOA 4GX5A 4KDEA 2YY5A 1IZ7A 2ILVA 1OZ0A 5ALOA 3VBCA 3W2IA 1I9GA 1H2FA 1DQYA 1DKUA 1F0KA 2C04A 2DPMA 4A0FA 1T6BY 2AXNA 4EG3A 1YZNA 1Y1PA 5TJHA 1T5IA 4DV3B 4HR7A 1N5RA 3DVAA 1HORA 5D1NA 5AO9A 3UJ6A 3UGJA 1CLEA 2BDTA 2BF4A 4G56A 4DN6A 1UZAA 2MYTA 2FPLA 3WRXC 1UPUA 2CMFA 2X86A 4CL0A 1X74A 5HM8A 1BS1A 5EEGA 2OXCA 2GCIA 3NEYA 4MJLA 2XGMA 2JJYA 1NY6A 4XOUA 5IFKA 2ZR7A 1X7WA 2PFSA 2PWAA 1G8KA 2BAGA 2PCLA 4RWZA 4YC7A 4Q1EA 5DASA 4PLFA 4B3DA 4REMA 1XCGB 1IPEA 3MLBA 5EPUA 2H63A 4N48A 5D86A 4RTRA 3LFHA 2JB9A 2V7QD 5BYKA 4BKMA 3N07A 3ZOZA 3FMFA 3LXRA 2P6PA 2LRHA 4HQFA 3DG9A 2WWFA 1JQKA 2Q0SA 5KC9A 4OSOA 3T4XA 5L8VA 1QXSA 3BCHA 3BD8A 4R3UC 3IVAA 1T2FA 2HQBA 1A9QA 2JBWA 3LQYA 3JWGA 4R9SA 5IYZF 1SBCA 3ANSA 1CVLA 1EP9A 1BHO1 1K5HA 2V9ZA 3H1GA 4GMHA 4KQCA 1K0FA 4J9UE 3VKFA 4B80A 3LS2A 3GRRA 2H00A 4IO1A 5EE0A 4NCIA 3U3XA 2WZDA 1JJFA 3A25A 1CPYA 1FLNA 3A26A 3SMQA 4MHTA 2CJPA 1UC8A 2DQ4A 3HJNA 2H1HA 4OH1A 1NW3A 3U3MA 4Z9AA 2PXCA 2YV4A 4S0XA 2XE6A 4KYIB 4R5HA 4TXLA 3K4PA 5EP1A 4KODA 4ALLA 1FX0B 1QQTA 4DEYA 4DLAA 5A04A 2NYRA 1MDFA 2H1SA 1BVRA 1DMRA 4L5CA 1WCYA 4Q7MB 2FZVA 2GYUA 2JFQA 3VOSA 2CLDX 1KO8A 1MG5A 2FCAA 4F86A 4JNCA 4ZT7A 1SCUA 2J31A 3BPSA 1BS2A 1R4ZA 2P6NA 2FPRA 1AZSC 2A0XA 1E9BA 3D6NB 3RJZA 2NVUB 1VCOA 2CJXA 4JC0A 2D2EA 1A98A 4TUYA 4HATA 4KN5A 4E88A 3N2EA 4ZYVA 1WEKA 4V0NA 2IPOA 3B6IA 3VUFA 5A5EA 1JG2A 1GA1A 1JE1A 1QHGA 2VHVA 1GQYA 4DQDA 2IHUA 3OPXA 5EZ5A 2G8LA 2YY7A 4PC7A 1Z4NA 3MWDA 4N65A 5JJBA 3C6YA 4W1QA 2R25B 4WMLA 2CLEB 2EFYA 5MGNA 1Q12A 2J0UB 5AOCA 5HS4A 3R9XB 3DV0A 1P1BA 5JRDS 1TZMA 2A67A 1MUUA 1P7YA 1XQ1A 2B7CA 4KFRA 3M82A 3P2JA 4K9LA 2ZRNA 4OA8A 4PTYA 5EINA 3T3IA 1E8MA 1JKXA 3UG7A 5JCZA 3ELWA 2GF0A 1B0ZA 2IX9A 2A9QA 3ESAA 1LI4A 2B3TA 4ZJZA 5T7BA 4QLOA 1I8TA 5BVHA 4OBBA 3W05A 4ZPXA 1G2OA 3SF8A 3LC0A 2QLBA 3QVUA 1VG9B 4AX4A 2RH5A 1ZH8A 4NBSA 3IYLW 4R81A 1VPEA 3TNDA 1O2DA 4MVJE 1XVIA 4DT1B 1C3JA 3Q8MA 4B79A 3THXB 2WDPA 1Y1LA 1XCLA 1SVIA 3KLPX 5K8TA 5CCDA 1BQ3A 1W0KD 2IU4A 2QVXX 2VPZA 2X3FA 4LVOA 2TS1A 1VCMA 4GGPA 1QFZA 3NZEA 1XA4A 3FPJA 4NOJA 5DISB 1J8FA 2Y99A 4MA0A 2NSDA 3MTBA 3KAQA 3PCTA 1FW8A 3BH0A 1CQIB 4IKOA 2Y3IA 3A3NA 4BX8A 4JLKA 2NZWA 2QJRA 4TQGA 3K73O 3B2EA 3RU2A 4BVEA 4BP9A 4DCOA 1QE5A 3GEMA 4RPCA 1GY8A 1IAVA 3CXRA 3VYSB 5IX8A 5AHRA 3EBLA 2E6KA 2XX3A 4N0MA 1ECBA 2AV6A 4IX9A 2X77A 3EVEA 4HUQA 1XYGA 2Z0MA 1YASA 3SHOA 1ARZA 1QIEA 4AMYA 5K45A 2XBMA 4ENSA 5G0WA 5E6SA 4TTTS 3QFHA 1GPNA 4TZTA 2BEWA 5CDUA 2VWGA 2WP8J 1VIDA 3DYVA 1JVBA 1QF7A 3MGBA 3QVOA 3TECE 4BFTA 5BQPA 5JD6A 4M8IA 1CSEE 2ZVPX 2SCUB 3AYZB 1HE1C 3N39C 4LVCA 2YV3A 5K2MA 5KTOA 4QQNA 2YHIB 4W9NA 3AZQA 3D5EA 5ENDA 3TLJA 2DKOA 1DAFA 4C2BA 4DW8A 3QI2A 5IYZB 5TMBA 1PL7A 2R60A 2BGUA 1EGQA 1SFRA 2EKLA 2AWNA 1IZZA 1CS0B 4QECA 3HBJA 3TXXA 4A9AA 2VSXA 3MT8A 3ORRA 4IV8A 4YT8A 4RORA 5A7HA 1GEGA 1M2OA 1X39A 2CXSA 2XOKA 4XA8A 1GNVA 4PM4A 5E7JA 1M66A 5DCUA 3INYA 2WMNB 1Y5MA 2GBLC 3BK7A 3LY7A 4Q3LA 4MR9B 4WUTA 3SP1A 1CUCA 1TCUA 2PBFA 3IBCA 3HCDA 5KPJA 3H05A 2QAGA 2QMEA 2D3WA 5DI3B 5KOJB 1SKMA 1WHSB 3CSSA 5AR1A 2IH4A 3ADDA 1US8A 2CKMA 4CG3A 2JLWA 1W85A 4FTWA 1C7JA 4PXAA 1Z8HA 3OIDA 3OSUA 3TB4A 3V5NA 2ASEA 5I9NA 1Z13A 3H5IA 3KYBA 1USWA 3E2MA 3VHXB 2UUBB 5J4YA 4HVTA 3G89A 1FDOA 2UV8A 2EGHA 1N9GA 1E2NA 1EX7A 3QPWA 4JQSA 4GLFA 4JL8A 3UMMA 1GOTA 1E3LA 4TRRA 3RUPA 4E30A 2QRQA 3CRNA 4NC9A 4ER3A 4BJ6A 2GNOA 4OHPA 4RZHA 5EHIA 1EVYA 5AVQA 1QP8A 3MTAA 1YZ3A 5JAOA 1XSEA 1T0UA 4ZYWA 1GHTA 2AEJA 3GW8A 3DDNA 4EEXA 2NU9A 1JHXA 4FHEA 1QTRA 1P9RA 2I6FA 3ZWNA 2JLBA 1N2CE 3EVAA 3RC3A 5JG7A 1FJXA 3A9VA 5EKUA 2XUAA 4LWZA 2XRMA 2EP7A 5ALUA 3FOEC 3MS2A 3LLUA 4YRDA 3L18A 4UU0A 4ZDWA 2BKUA 3O4HA 1W9HA 4YCJA 3GVCA 1OBVA 1W0JD 3U9TA 1E96A 3HDTA 1UCFA 2K7FA 3FVRA 3I62A 1S96A 3H2KA 3J7TA 3V4FA 2HCJB 3UMVA 2GK6A 3IAUA 4GIBA 1EPUA 1PJLA 1GNRA 4D4HA 2CMGA 3QVTA 2J3DA 4R1UA 4DLBA 2N42A 2NV0A 3L0ZA 4HFRA 4ILKA 3SXUA 5KNBH 1QFMA 3W8FA 3NGLA 2PE5A 1E98A 3FFTA 4QU8A 2ZRIA 1HL3A 4JJ6A 4BNDB 5ALNA 3FCCA 4WVFA 4ESVA 4M54A 1PR3A 4KQ6A 2DHRA 1NY5A 5SYMA 3TTUA 3ZBQA 4UNNA 1MHTA 1JECA 1H6DA 2WHXA 3P5SA 1S9DA 4NVRA 1KDZA 3GC6A 2IGBA 2P9CA 1GZHB 2Z58A 5I7WA 4UZFA 3E5HA 1N6OA 3L8DA 4I4NA 4ZKDA 2O0LA 4H18A 4BQOA 2CV0A 5KQLA 3SN6A 3JAKA 5A9TA 2X9NA 5EWLA 3C6ZA 2HI0A 3AUTA 1Q92A 3NWBA 4X85A 2CNWD 4IEIA 2BKAA 4W8OA 4GKKB 3K7EA 4HXEB 3L7NA 2J8ZA 2PRKA 3IP9A 1W4RA 4B6SA 1UMDB 1Z2CA 2NO9A 4HWTA 5AVJA 3TFQA 1B8OA 2ZXUA 3WYBA 1T2CA 5AI6A 3QX7A 4C30A 2DR0A 3FBGA 5C31A 4XWKA 5AXBA 4LJYA 3M4YA 1FL9A 3ELBA 4ZTZB 3ZZUA 1CQWA 1Y9EA 4II2A 4Q7KA 4TVBA 2HAEA 2DCUA 4V39A 4MITA 3W3AH 2P67A 5FNVF 2R5FA 4I1SA 3ML1A 2IS2A 3L6RA 5JH7B 4NCBA 4YDHB 4FW8A 3IHLA 1W59A 3KS9A 1DFGA 2F64A 2I6TA 1Z2OX 3Q8WA 5CK5A 2WUDA 2HA4A 3PNPA 1GCGA 4AB1A 3CB4A 2FKAA 1W6RA 2QX6A 3VR3D 2WWYA 1C0LA 1Z88A 2W90A 2YV1A 3OD5A 3T3PB 5JDIC 4BOYA 2FEPA 2HBYA 2ISQA 3FYCA 4DABA 4DA4A 4OAPA 4XDZA 4RTLA 5MHTA 2WABA 1V26A 2VUIB 3D54D 1O03A 2NADA 4BFWA 5FWXB 3RS0A 1EA7A 3EUAA 2Q6TA 5JO9A 1G7SA 3PDIA 2VQ3A 3JARA 3L4EA 1T6XA 3DBVO 2KLHA 4E1AA 1U90A 2IY8A 4BJ5A 5E1OA 4IXTA 2DH6A 2GCGA 1GL7A 3IVGA 3R3JA 4BZWA 5CDSA 3BF8A 3D7NA 3KKKA 3HV2A 2HCFA 3CYFA 3ESZA 3IIIA 4Z4CA 3F74A 5SYAA 3PD1A 1GNQA 3MWKA 4UTRA 3G82C 2FN8A 3M6LA 2QM0A 4L75A 5HCIA 3TOZA 1OIWA 1P0PA 4C0LA 4UAUA 1AZWA 4XRRA 1TD9A 2WB4A 2CVOA 4R3WA 2B98A 1LZKA 1Q19A 3JQAA 4GPBA 1MO5A 1BTOA 5FTLA 1WL8A 2EZUA 2PLFA 3NBYC 3U7EB 3CUVA 5JR3A 3X1MA 4YIKA 2P78A 3HU2A 4UTOA 3S27A 3BWBA 3R40A 1C30A 1R16A 2YZMA 1XF9A 4M9SA 3WGNA 3CEHA 3LPAA 1Q7EA 2PUTA 4FMBB 5LYYA 1KY3A 4R1QA 3UAYA 4DXDA 3I5XA 1RLTA 2JFZA 3GJYA 3CJTA 4L85A 4R4JA 3RT7A 1OLUB 3ZWMA 4KEAA 5BQ3A 2CWDA 5GGYA 2RBKA 4P58A 3VU9A 3FMOB 3IHTA 4DF3A 1GUDA 3PE6A 1ODLA 2W2KB 4WQMA 4UVDA 1UPBA 1VJ1A 2QY6A 5JZVA 4H4EA 1RAHA 3ME5A 2PZMA 4EF4A 3F5QA 2HZ7A 3OOWA 1C29B 3H4MA 4FXOA 1P29A 1IN6A 3JTMA 2YZNA 3TMKA 5AM4A 5BSRA 3GEPA 1FLAA 3NANA 3IGFA 3LDAA 1Y81A 4LDQA 2A0WA 1GFWA 2Q49A 3B13B 3DEJA 4KAJA 2M1XA 2VYCA 2PO5A 3ET5A 1X7XB 1Y1RA 1RE1A 1ADGA 4OREX 3TKAA 6ABPA 1AQ6A 4EPVA 4POOA 4I1YA 2ATXA 3DTVA 4MYTA 3KQSA 4KSYA 2PKRA 2EKPA 4MS4A 1G20A 1FVXA 2C2YA 2X3YA 1KOGA 3DBOB 3A27A 1L7AA 3DO6A 4W7IA 3PUJA 1WUHS 5CPFA 3HVKA 2A5LA 1SCNE 3A9WA 3LKVA 3PFBA 4Q39A 1HR0B 1A4RA 2OLKA 4YO8A 1YHNA 4W1PA 4MWZA 4LBYA 1LX6A 1Y7TA 1NN1A 5HBGA 1KDTA 4XUGB 4DNFA 3OZEA 4B73A 2ZJ0A 5HYVA 2VSQA 4DTCA 3FOCA 1MH1A 3EGCA 3LZ6A 2BGWA 5FNVB 2KWIA 2EFHB 3WGGA 1QYVA 1EFLA 4TMVA 4XSVA 4RW0A 3EMVA 3NC4A 4NIMA 3UAVA 3KJZA 1KIMA 3I1FA 3QX9A 1AD2A 4I5FA 4YQYA 5KMGA 5KZMB 4FB4A 1Y4UA 3RHZA 4C14A 1GGHA 2OCIA 3U80A 1C7ZA 2O8VA 4FZVA 2EFGA 4RX1A 5FRDA 1VLLA 3B82A 2ORWA 3ESRA 4TM7A 4Y30A 1XT6A 1QRUA 1ND6A 2ZANA 3FE2A 5HQ3B 4L3OA 5BNFA 6REQA 4WJKB 4B17A 2GN4A 1RWXA 2QX7A 1E9AA 3U7HB 3ZH9B 3KFLA 3BSSA 1H2WA 1PJZA 3DZJA 1ZL2A 3LDHA 3UH0A 1V5EA 4KIGA 4OQLA 4ZI7B 5BQFA 1UQRA 3ZHBA 2E82A 5JADA 3A04A 5TS2A 4HTAA 1XTVA 1H8HD 4LRTB 4CYMA 3OOEA 1R8YA 1EGHA 3BM5A 1KERA 1ZOOA 4M9XA 4RTMA 2FLVA 1KDRA 1J8MF 3C4QA 4W9RA 5EPOA 1E3WB 2G0TA 4CNBA 3RFUA 3UHAA 1EHYA 4Z3OA 1HYQA 2WWHA 5IANA 4PFSA 4G63A 2QE7D 2Z1MA 3R9KA 3V7UA 1EESA 4Q7JB 2ZRPA 3P9CA 4MARA 3F4BA 3MWLA 1J33A 3PT9A 4QOSA 1MJFA 3RFXA 3WNDA 3IB6A 1QDUA 3FSJX 1RXUA 3IBGA 2GAFA 4UVEA 1E1CA 2C9BA 4WA7A 2G67A 4MWSA 5T3YA 3T7IA 2QM7A 3IQHX 5BUCA 2NGRA 1KJ8A 3M4JA 1KVUA 4RHUA 4O4LB 2V54A 2CLOB 3THRA 3VPAA 2D8MA 1RYEA 4WZAB 3L0OA 4E5SA 2XQGA 1G8AA 4U7PB 1C14A 2F6RA 2ORVA 3ZQKA 4AKHA 1GPYA 2I6GA 3FYTA 1VSVA 4LE2A 3VKVA 1J0DA 4TZKA 3SHQA 4EMTA 5FBVB 2VLBA 4J0CA 3GUYA 1HPLA 3W6OA 5CDTA 2Q0QA 5E4FA 3KKEA 1N4AA 3THOA 1YVPA 2JH3A 4FLMA 1SPBS 2YJ6A 1YOVA 3N8GA 3RV4A 3VSBA 2IPAB 1DC8A 3N58A 2ZJBA 1Q7CA 4ZJYA 3GLHB 1VYUA 5GTDA 4I5IA 1M1YA 1V8ZA 3N0RA 4BQQA 2CJWA 3NCTA 4EZIA 1CETA 2XDQB 3HA5A 3UHFA 1RQLA 5IVDA 2P2CA 2MR6A 2WQZA 4G5XA 3E7PA 4UFOA 3RRFA 2VNJA 1JHOA 4L8YA 3VR6A 2CBGA 1IUKA 1SIUA 1IM8A 1NDHA 3P19A 5GGXA 2IOQA 1XZMA 4HS4A 2D5BA 2VT6A 3I01M 4ZVUA 3SJUA 3KB2A 2VK4A 3I0NA 2C78A 2PYDA 3WP0A 3L84A 3SBDA 2H4XA 2DQKA 1U3WA 1B8NA 3HKBA 5EJGA 1OIVA 1U7TA 1MQ9A 2FWMX 1KF0A 1AVTA 4MP8A 3SNHA 4LKOA 4DIUA 3FPSA 1KPIA 3A28A 1HK7A 2ZU6A 4EJMA 2HRDA 5HZGA 3TLBA 1P4HA 2BMAA 3LBYA 1TYCA 4BJHB 4GOXA 1ZCBA 2PKQO 3EQ7A 4TT8A 5I9TA 4EKNB 2UUPA 4GLOA 1XU9A 1DJLA 2AFHA 2WAMA 4NI5A 1ES9A 3SX4A 3QELB 5CDFA 1JJBA 3U7JA 2OO3A 1N1MA 1TTQB 3WDLA 3DDHA 3NYWA 4F7DA 3KIPA 2XXBA 5KVQA 3ZE2B 4XRGA 2RGAA 3O6VA 4A0QA 3PBKA 3MPUA 4L50A 5EJ5A 4OGKA 2CYAA 3ZR4B 4ECEA 3P9RA 4Q3EA 2W9XA 3TNJA 1GXSB 3IKJA 3PNSA 3R7WA 3T3DA 1UMBA 3DZGA 3FY4A 4FSDA 3GGDA 2X9VA 5IFLA 1UOQA 1RJ9B 2VAPA 1ZGAA 1ZDMA 3FTEA 2R5WA 2XLBA 1MN6A 4YCBA 1DRVA 3IT2A 3NAMA 2XD4A 4HDMA 4IR7A 2WM2A 4KE7A 4L95C 4DEXA 2J59A 5I6DA 5KQRA 3BSYA 3TS1A 4Y1RA 3ZW9A 1EB8A 3GT4A 1AX9A 1DV2A 2HCRA 1C80A 1C2YA 3U2QA 3OJLA 4XPZA 1P72A 5I01A 1IBKB 3CE9A 3Q4GA 1K2WA 3SZOA 1RI1A 1KR2A 1JU3A 4UCQA 2GT1A 1P4RA 1ZJ5A 4PAMA 1Y0BA 3GA0A 1DE0A 5DHRA 2H1LA 1VSTA 2PGXA 1TM4E 3I92A 2IHNA 3V33A 3IOYA 4KUEA 1QAQA 4LMRA 4WCFA 3SM9A 4C0KA 3Q1LA 1I0IA 4JUAA 1LUAA 2ZS9A 3GFVA 3X44A 3HLKA 2QZ4A 2IE0A 2OY0A 3A3YA 3C0KA 4TWIA 4IOLA 3AI7A 2VPPA 1Z0KA 2BJHA 3IUNA 3LGSA 4G86A 1DWOA 4LJ8A 5IKOA 4K0KB 4GPZA 3Q72A 4Z4EA 4I1RA 2NTJA 2BGLA 2FUEA 5EQDA 5T57A 5K0ZA 3LCUA 4I1UA 3I01A 2WICA 3BFKA 4OGLA 5K4AA 4TKVA 1E6LA 1IDN1 4ILEA 4AJIA 1JZTA 3EEFA 1B74A 3PT5A 1L1RA 1VE9A 2PUCA 1NVXQ 4U9HS 4FJ0A 5H9WA 4GI3A 1AKVA 2DPYA 4LTDA 4AMGA 3S81A 3FB4A 2J3LA 4MVWA 2GA8A 1O6FA 4E7PA 3NBMA 1EK0A 4GUAA 1L5LA 2VBIA 2ZUSA 3R7DA 2X6QA 4JYAB 4YCLA 2GK3A 4EWLA 3ZEAA 3D0QA 1YGYA 4GC5A 1VGRA 2IE8A 4HLNA 4O8ZA 5SY4A 3MSXA 4N3AA 1TEXA 2ZSIA 1W1UA 4EHAA 3N70A 3DQQA 4NULA 3K1ZA 4YAGA 2B5OA 2HKIA 3G1UA 4UASA 2WJ6A 2ZDQA 1GQSA 2HSDA 1EFKA 1PUJA 1U2PA 2WG2A 3PIRA 4OB8A 4BNWA 3KOXA 4BASA 3PJDA 4KQKA 4BGIA 4WK6A 1G64A 1XALA 1PNTA 5T6MA 5GP1A 1GDTA 1GV0A 1SQ6A 2G8NA 4IXNA 1VMIA 1YR1A 5DYGA 3TFOA 1E7YA 1DRJA 5H70A 3ZHTA 3MOGA 1SVOA 1FVFA 1ZK2A 2AG1A 1LWNA 2HT6A 3BL6A 1K9VF 3VNQA 4G4SP 1ZYUA 1GT91 4UDNA 1H8EA 4E5UA 2P4HX 3JWPA 1OJ7A 4P3XA 1SK9A 5DX8A 3TQOA 2DFPA 2EW2A 2PCJA 4N9QA 1DHTA 5IAEA 2IDZA 3QBTA 5CXSA 1A3CA 5B55A 3FROA 3P2OA 3JR3A 1YZKA 4HNUA 2DLNA 1RJEA 1Z08A 3LCVB 3G13A 2V7VA 5GZ1A 1PR2A 3HSYA 3SVLA 1COZA 2PU7A 1HEUA 1VIMA 2YVUA 3AG5A 3N3BC 3OCYA 3EZYA 1X2EA 1A7UA 1XJQA 2IOYA 2MINA 2HQRA 2XUIA 1YHZA 1TFRA 3O4GA 3WIEA 3HGTA 4F11A 2BM8A 1LDNA 3OQPA 5CVCA 5IASA 1FS6A 2H48A 1SUSA 2ZTUA 3ANYB 2ZIGA 3TW4A 1R4NA 1A72A 1E2GA 1CUJA 4ICIA 4B7ZA 2P62A 1TI7A 5JS1A 1PTJA 2WVHA 3FPHA 4IGIA 1N0WA 4BNGA 4RIHA 2REQB 1MQSA 1SHJA 1PHRA 3UYLA 3ZCPA 5IJ9A 5E7QA 3CURA 5BSUA 3TIXB 5BRNA 3QRWA 1CX9B 1K6IA 3G6KA 3FMPB 3LLVA 3E1GA 5BWOA 4XCQA 2R11A 4GX2A 1AKTA 3CH4B 4KI7A 1YZFA 3GPLA 3P26A 2NPOA 2RHOA 3HB9A 3AVXA 3A14A 2PLAA 2XE7A 5FL7D 5JY6A 1WMBA 1JDBB 1OWOA 2OCAA 4ODIA 4RPLA 5KQPA 2VO1A 1EX9A 3QBJA 4GPTA 4TM8A 2Z83A 4Z9YA 3R3UA 4FFSA 1GTG1 3LYAA 3H9QA 4BRSA 2N9UA 3BG5A 2H9YA 1RC0A 2WYIA 3HPRA 3W1EA 3MGKA 2G9UA 4XQ0A 5HIMA 3JYNA 4YV7A 1ESEA 2EEPA 2R8RA 3ETDA 2WE7A 3IMKA 4HXFB 1LDEA 4KDFA 2BTEA 3ZGXA 2O8NA 2EF0A 2ZTLA 2WPDD 3IA2A 4BYGA 1Q1ZA 3GA5A 3GGCA 1QRTA 1XFDA 4S0ZA 1NG1A 2DPLA 1Y7LA 2MSWA 3AX6A 1Y9ZA 3W1WA 3JY6A 3Q0EA 3IV7A 3HBFA 2JVJA 1ZI8A 4H2DA 2WYWA 4BZXA 3TW0A 1GU1A 1CZLA 5ARDA 3R6TA 2ZK7A 1Z5NA 1XE3A 3I3OA 1NUQA 1L4GA 4TKLA 4BZPA 1IQRA 1NT2A 4BP3A 5AUNB 1NQOA 3ZVMA 3PUVA 3JWEA 3R7SA 1W52X 2QTVB 4ND4A 1ULHA 1X13A 4Q7LA 3ZLTA 5EZYF 2QRZA 3ED5A 4U7WA 3U1VA 3U09A 1C0KA 2PAAA 1LLFA 2J9GA 5B37A 2WHQA 4CI9A 1JR3A 4GMDA 4D9GA 1CB7A 1ZNQO 3R5KA 3T7JA 1KI7A 2RMKA 4BLTA 3RK4A 3RFFA 3NGMA 3P9PA 2F3TA 4W5TA 3O7WA 1JAYA 5I9BA 4C7OB 1ISSA 2JFFA 2Z2IA 4LSGA 4RS4A 5KVAA 4S35A 5IC4A 3TZKA 3ZU6A 3CNEA 2EU8A 5JCPA 1UBMS 4X71A 3WZLA 5GONF 3E5NA 4TQUS 3V4RA 3U4GA 1U0JA 2JZNA 1YZHA 4KVFA 4LMPA 1KHHA 1UXHA 1KR5A 1A9RA 4RVDA 1RRCA 1DS6A 4KLRA 2JCBA 3AF3A 4MUFA 4P86A 4S1OA 3MYYA 2IHTA 2P9EA 2V7XA 1VHQA 2RAVA 1CK4A 1B4DA 4M4SA 3W7BA 1Z4QA 1ZMXA 1OE0A 1ZD8A 2DX7A 5ICSA 1LKZA 3E22A 5EESA 1EUCB 1MENA 2WM3A 4MZDA 5L7YA 2XT9A 1Q16A 2JFNA 2Q28A 3LHDA 4W9NC 4G0NA 1ZN2A 2IK8A 5DP1A 2PH5A 5BN4B 1L5ZA 1L5VA 2IQ5A 2KSQA 5K3BA 3VFDA 3L7LA 1CY8A 3WLPA 1K7EB 1RFLA 2XMCA 4GDFA 2CYCA 4MUKA 2J9YB 4C04A 1NASA 3BMXA 1B6GA 5FOXA 4TMKA 1SRRA 1OVGA 4RF3A 4CIXA 3M49A 3U9LA 1YS9A 2C4VA 2BIFA 2C1ZA 2QAGC 3GDOA 2FQQA 3DVQX 2ZSUA 3OFNA 1M34E 3A1SA 5HIKA 5ADHA 4JUDX 2G17A 2XCIA 4BCDA 2QRUA 4OK5A 2XMQA 5F5LA 3SHFA 1IUPA 4CTJA 2HJVA 3B5EA 2QRLA 2VJDA 3JZAA 4HEHA 5E3IA 2Q1WA 3T7KA 3UXYA 1BU5A 3FVQA 4QNMA 1GZ6A 1N4DA 5FPYA 3G0IA 1RYNA 1LRLA 4LQCA 3SQLA 1V8OA 5G0TA 4ARUA 2FF5A 1MB9A 3EXHA 3HVUA 3PYLA 2TSYB 4RF4A 2X9LA 4DGQA 2CNLA 3MXOA 5G1OA 2BC9A 1U2TA 4MV7A 4OQDA 4A5SA 2RGBA 2I8LA 3IQGX 1ZWLA 2GHIA 2HY7A 2OKGA 2IXEA 3C41J 4L0QA 4NFSA 3AC0A 1P91A 2AXEA 4DXHA 1ZH0A 4RJTA 4BNYA 2O3UA 3N8HA 1GYPA 3DZ8A 3N7AA 4OKIA 4GS5A 1RP1A 4MYSA 1ZONA 3C1UA 2PSJA 2VRWA 4XPIB 1H22A 4NJMB 2WSMA 2FA9A 2G63A 3RU9A 4CDGA 1TU4A 1Z4MA 4MRMA 1QRAA 4TTAA 2X9GA 5BOVA 1ZXLA 3GG9A 4FI3F 2IYQA 2RH4A 1I1OA 3AVWA 4MR8A 5ERYA 1RCFA 2I2CA 3JPWA 3O2NA 4OK3A 4R2XA 4ZT3A 3ZE6A 2XCRB 4QUGA 5FFFA 5KTTA 1E77A 2VTVA 1T34A 1V1RA 1ZVKA 4OA5A 1QBGA 2AQKA 3DEAA 3EWIA 4DNPA 3OQNA 1QM5A 4TS3A 2PPVA 1Q0RA 2V6MA 2AJCA 3ZHXA 2IBTA 4JWTA 1S7GA 2OYCA 1JJIA 4DBZA 4DSNA 1R0XA 4J07A 1NYLA 2A3RA 2VRCA 3FHOA 1MH9A 4AX8A 1OFHA 3OLZA 2DHDA 2BUCA 4C4ZA 3I05A 3CPEA 1YA8A 1WQ4A 3DOIA 4DQ0A 1FDRA 2UVPA 3EFHA 5GONB 2QUAA 4CM9D 2X58A 4D9IA 1XMOB 3K9QO 2DC1A 1DQPA 1C7IA 4QBTA 1M2FA 3KB6A 4QGAA 1H2ZA 1ZESA 1VFNA 4C6TA 1L4UA 1LFAA 1SC3A 5B2FA 1NE2A 3KKZA 3PFNA 3V4LA 2R66A 1EQ2A 1CEXA 1UKBA 3GL9A 5BO5A 5HUJA 2DPXA 3WS7A 1E2KA 1HT0A 3JCZA 4FOLA 2B1QA 3OF5A 3M34A 3ZVKA 221PA 5LBUA 2I87A 5JPCA 2G72A 3FKQA 2XUPA 2Z08A 4GP7A 1NOJA 1IIBA 1FTNA 4REQB 2RHRA 1NRJB 4IZOA 4CEJA 2WJAA 2N46A 4H4CA 3B48A 4Q4AB 1FFCA 3Q87B 4V24A 3EVGA 1RZRA 4UHCA 2XOKD 3DXFA 3H9CA 4YV2A 4UU8A 5KSPA 2O14A 4UFPA 5MFZA 1HYEA 4DNOA 2V4UA 4LZPA 4JJ8A 2QD3A 2XUGA 3BMCA 3TZBA 3RODA 1F6WA 1ZVQA 1REQA 4ETMA 4JU9A 1YZTA 4BQEA 1XJCA 1OD6A 2JAUA 3DBRB 3HRKA 1S9HA 4HBGA 3ZUGA 3PA8A 1NBMA 3F9CA 4PHGA 1KEEB 1E7QA 1VZ3A 1KMCA 2B4TO 2IF2A 1Q7RA 3DPSA 3HUDA 4K9PA 1DAEA 4GPAA 3AUYA 4OEHA 5HZHA 1Y42X 4RTSA 3LBNA 1DEKA 5E8JA 1TW2A 1LK7A 4LXUA 3OHPA 3QLVA 4JI3B 2X15A 3AH8A 1Z7WA 4QYXA 5AXDA 1K8ZB 1V6CA 2R4UA 3BRWA 1ULTA 3G2LA 2J33A 2R6DA 4XWAA 5CCBA 4IJMA 1JF8A 4Q4LA 1N2SA 1L7VC 1A97A 1WF3A 2QX9A 1RM4A 3I9OA 1QH0A 4H3VA 3K70C 2DR2A 1SHLA 4L9SA 5CVTA 2IYYA 3PDJA 1PL0A 4QULA 2Q7OE 1GQ2A 2PQ2A 1XZFA 3AI2A 3CVJA 4HQRA 1OIXA 1W6UA 2HFKA 2WIFA 4I7EA 2FSGA 2WUFA 2UUOA 3EBOA 3LUPA 4TL7A 4RBNA 4YAFA 3NHUA 1NZDA 3ANTA 5C1PA 1N3IA 3MGCA 1VJ5A 1PDVA 3GRKA 2AN4A 1M6NA 1R3DA 4MGEA 1CJBA 3EC1A 1WW3A 4UM7A 1WCV1 5DBEX 4MUIA 3WLLA 3NGXA 2OBBA 3NG1A 3KC2A 3L9XA 2QW1A 4U2BA 4EAAA 4B8YA 3G59A 2XMZA 3L4BA 5WRFA 2H4WA 5E1DA 3PEYA 1XDWA 1Z0AA 4Y2SA 1WSWA 2ZYVX 4P6VF 1PT9A 3WR5A 1CZUA 2MSDB 4QDZA 5JNUA 3PFIA 1EINA 1JXQA 1WU7A 3QF4B 4IH4A 4OLHA 2Z9CA 5GAJA 5GINE 1NW6A 4XB2A 2QRGA 2VT7A 2AZTA 1QWOA 1U9JA 2FPIB 4EL0A 3U17A 3H1FA 3JZIA 2FPGA 1CG6A 1BE8A 1NQWA 2MR5A 4M8KA 4WGFA 1BE1A 2JEOA 3SBEA 3QQ5A 2I9KA 2OUIA 1WA5A 5AQ1A 2WLTA 4S3MA 5ED4A 3OTIA 2R8PA 1RYYA 1XQWA 4FN5A 4X54A 5JYDA 2DFVA 2I1QA 4C0BA 3WWEA 1ENOA 2YVLA 3ZY2A 1S5PA 2QG9A 3K8YA 5EUBA 1OLXA 3DT6A 5A3RA 1SUBA 3TVTA 2C9DA 1N2OA 2HV9A 3AFHA 4EGAA 2ZZNA 1ACJA 3RVNA 2I0FA 1X7ZB 3C7AA 4DLUA 4ZAGA 2HK6A 4TKZA 4IDNA 2VH1A 2YJNA 4HPWA 3LNCA 4YVFA 2DT8A 4PPNA 2VJPA 4E51A 4KXFB 4URVR 1ECGA 4ER0A 2IEYA 3IQEA 3Q7TA 1WO8A 2QVYX 4LA4A 1XNRB 2OCDA 3SSAA 3AEUA 2V7BA 2HPZA 3G5UA 3ORQA 3SHWA 4D7AA 3GOQA 1WDTA 5FOSA 2PYIA 3RB8A 1QLJA 2G09A 5EY5B 1TM7E 2W8ZA 5A3SA 1LJLA 4CR6A 3AR2A 2FPPA 5ESRA 4U2DA 4KE8A 2I34A 3MJTA 2OYSA 4AIRA 4EJ2A 2ZSHA 1N5JA 2G88A 3OM1A 1NMXA 4BV3A 4OHUA 4B8WA 3ERCA 1PGPA 1KBOA 3R1IA 4MUHA 3MJVA 4NHEA 4KC0A 3ICPA 2G83A 2JJMA 1U5BB 1XMVA 1WPQA 3IP7A 3WFIA 5JPDA 1JQEA 4FSXA 8ABPA 1OB2A 3ITKA 1K3UB 4Z0HO 4A0HA 3UFXB 4BO0A 2GAOA 4IHAA 1TQ2A 4XVQA 3WL5A 2Q5OA 1O57A 4WL0A 4ARVA 2IBSA 4C2TA 2O8FA 4EY6A 1CY4A 1LRKA 2FLWA 4Q9NA 3S8YA 1PZHA 2ATIA 1NLFA 3I23A 4GUDA 5IDXA 1AV6A 3HN2A 1N3LA 2XDQA 4NZYA 4OBXA 2HSZA 4UTXA 2J67A 2FY8A 4INJA 5AK5A 3QKSA 4TRMA 3RTAA 3UMRA 5HZKA 2AS0A 3MM4A 3DLAA 3KR9A 2VK1A 1XWWA 4MA5A 4G3XA 4QPDA 5EG5A 1PFKA 1BGVA 3G2NA 3PDCA 2R9VA 4OU5A 4MV5A 1JLLB 5TEWA 1KI6B 2I78A 2BMDA 4L72A 5CW2A 3O92A 3ET4A 5DSTA 5AXAA 4YRKA 2YOFA 5BN3B 2QYOA 2XVAA 2GJ4A 1NLMA 3K0AB 3UXEA 4FFPA 9ATCA 5CYOA 1GG8A 1Z4OA 4CODB 4RYDA 2X5NA 2XNJA 3L1IA 1P7WA 5JVDA 2JASA 1Z75A 1W46A 4A10A 4Z2AA 1CJVC 4RXTA 3CGWA 3TW8B 4EFKA 4CKCA 1PS9A 5DOZA 4QM6A 4BAUA 2X42A 2JCSA 3B1KA 5CFZA 4RK7A 3JYOA 3RROA 1XPJA 3LRPA 1PV1A 3IUQA 1N8SA 4YHBA 1YT5A 2FRVA 2IYSA 2IHJA 2DQZA 3P1JA 4RJLA 5CT4A 4D4GA 4YRPA 2OZLB 3FNBA 4AYWA 1AO0A 1MRSA 3I61A 4CWAA 1R6UA 4DUGA 2FEAA 3OTOB 1VYVA 1RQGA 1NUAA 1JJVA 4O02B 2OHFA 5JCOA 1YA6A 4YJDA 5CLFA 1XEAA 1EUZA 3BE8A 3SHVA 5HTOA 1M0WA 4RSMA 4PN3A 2G9ZA 4BFYA 4ZEXA 4Q7EA 1PSDA 2AOXA 3L7BA 1C7EA 1TZKA 5DNCA 2WJIA 2JPDA 4ARCA 4XJXA 4LJSA 2A0KA 1JQBA 2GVZC 2HMSA 2OAEA 1BG6A 3GPBA 4J90A 3HDGA 1S8OA 1MIOA 4X64B 1DRWA 2FK7A 1QRSA 1BEZA 1QCDA 2WF5A 1T1EA 1FBTA 1KAEA 1N8NA 4ITUA 4G9GA 5DLDA 3A10A 2HMWA 1OZAA 5GJCA 4EPXA 4FHFA 1E2HA 1I1NA 2I7DA 4GL4A 3V32A 1XO1A 3WTCA 1Q7TA 2DJ5A 3P32A 4WXMA 4OLFA 5DO9A 1RACA 2QXUA 2IVZA 4KI0A 5IM4F 5AUPB 1ZC4A 2BFEB 1WPRA 2WAAA 4U7GA 4US1R 4XYEA 2NZUG 1RQ2A 2A4KA 1XA3A 3RYCA 3T15A 1PZGA 1OJLA 3VZQA 3IXLA 5HCNA 5HF5A 2O07A 3B2QA 2WNSA 2PRIA 3A6HA 4QIHA 4B3TB 3KT8A 4KVGA 3LF2A 1G3RA 4NPHA 3J7AC 2YINC 3J81A 3KVVA 2V59A 5AOVA 1IUNA 4YRCA 3GVXA 1KFBB 3I42A 1HGXA 4ZO6A 1P0IA 3VZPA 5I4CA 3HKCA 1IB0A 1XXHB 4I55B 5EWMA 3H5TA 5TV2A 2C0QA 3K0EA 4FX2A 2VTBA 3WGIA 2OB1A 4DG5A 1ZMBA 2A1UA 2UYHA 1JSLA 4QQFA 1OYVA 2WV9A 5BSKA 1KI2A 3Q10A 1RVV1 3T0GA 2YQ4A 3TK1A 4QO8A 5ABPA 4K28A 3RM3A 1FZTA 1PG0A 1QNFA 4MUNA 3ILYA 4UPVA 4XCVA 5JFOA 3ONNA 1T6ZA 2Q3EA 4PN7A 1UDRA 4NRDA 2PSDA 4YAOA 5L3ZA 5HX7A 3K30A 5CJJA 3BK2A 5F35A 3H6HA 2UYGA 2ZB3A 2WD7A 2RHCA 4W7SA 3RTBA 4FFDA 1W34A 2P6RA 4C7JA 4IZIA 4H7JA 3CX8A 3E03A 3E4CA 4DM3A 1ZIDA 1II0A 1Q15A 4F85A 4FDLA 3KTAB 2HK7A 3OTGA 5EJ2A 5TQ0A 5FAKA 3UMCA 1QYDA 4GZLA 1JALA 1KKUA 2EP5A 1T9GR 1HM5A 1UK9A 1D8TA 1M72A 3ILXA 3NJRA 5KQSA 1IVSA 1DINA 2YHAA 3SC3A 2IZ6A 1ISJA 1JJ7A 1RWPA 2FHSA 5TVKA 1CY1A 3VR5A 3ZS9A 2GD0A 2VHTA 3TUIC 2YJ4A 4ED9A 5CAEA 5EMMA 2A8YA 3PZBA 1H1LB 4QUHA 3LV8A 1T9AA 1GAWA 1WF6A 2YWCA 2X8BA 5J40A 4E13A 4WCFC 2O3QA 4M1SA 1HLPA 2ZT8A 2F3SA 3OF3A 4AF6A 4NPCA 1E62A 1GKIA 1H9BA 1N8KA 1T9GS 1XLWA 3PVCA 2H2GA 4P84A 2FEOA 2OD7A 1Z5OA 3GH1A 3OLYA 1GLNA 4IGAA 4L6IA 5JSUA 2XUZA 3U7FB 4RA9A 3EDYA 2NPFA 3RFTA 1XD9A 1TZCA 3OX3A 5BR8B 5GZ3A 2GJKA 2ZYTX 4ZAFA 2NU8B 5DBIA 1Y3HA 4IAOA 1F2TA 2DULA 5D6OA 3V4OA 3WNVA 4C0AC 1JDTA 5JQGF 2G5CA 5L6MB 1I80A 1R10A 2Z6UA 1IEWA 4P36A 2V0CA 3LC1O 4BPBA 4TPKA 3V1YA 4YLGA 1U80A 4HQKA 5CIWA 2C4MA 4KRXA 2Q4BA 4N03A 2GDZA 4YRBA 2YUIA 3RTEA 1O5IA 4CT5A 4DQVA 4DDTA 1DDOA 2IBMA 3O93A 5IS2A 3WLRA 4OV6B 4P5DA 2YBDA 1JKJA 2O0MA 2AC4A 4DYHA 3ZKWB 4M7OA 4Q9HA 3DL0A 3EEIA 1G6Q1 3VR6D 1V3TA 5JOQA 4DR7B 5IN4A 3T1OA 3AVPA 4X1KB 4XX0A 1I4WA 5EIAA 4HNGA 1QR6A 2D1QA 1OLSA 3Q41A 4K6CA 4X00A 3EZFA 3KJHA 1CEQA 2F59A 1AMUA 1PGNA 1E0AA 3AFIA 4XVUA 3PGLA 5P8WA 5JFGA 3MT0A 4HAYA 2VJMB 1UIRA 4KXNA 1PCXA 2H7VA 4IOMA 4WV3A 3EMBA 1GPMA 2HHCA 5JAPA 3C6QA 2XQKA 4PSCA 1GN9A 4C4TA 3GYGA 3T7CA 5J2TB 4X0EA 2H1IA 3B9PA 4HYEA 3RVLA 2IW3A 5AK0A 1CDOA 1JYEA 1YQDA 2ZR9A 3OBIA 2RC6A 4YA6A 1R0WA 5EQFA 4IY1A 3HWRA 1XTTA 5A9SA 1FFGA 3QPUA 5BSVA 4F1JA 1OFVA 1NYQA 4NABA 5K1ZA 1MCZA 1XMPA 1OPRA 1VSQA 1PBNA 1KTIA 4JDPA 1AGNA 2VHXA 4F7WA 3EHEA 3TF5A 4LWPA 4Z99A 1ZHOA 4YXWA 1QIDA 3HHPA 4LBWA 1GTL1 2QL7A 4QYIB 4R8SA 3RRYA 3TCNA 4M49A 1ECCA 2BFAA 5K3SA 3HCCA 2LE0A 3DZFA 3W8DA 1B6TA 3MLEA 1E1KA 4EY5A 3RSOA 4LVUA 3UT5A 4D0SA 4CIWA 3L6CA 1PTJC 4EHFA 1LSOA 5BYAA 1PW7A 2NWQA 5CNKA 4ZMSA 2YRXA 4YP6A 4KV9A 2AUNA 4J4HA 1P5FA 1IRXA 2CKDA 1S89A 3BKWA 1HT3A 1Z2PX 3ULKA 1GR1A 1N2BA 2CDAA 3E7FA 3JVUA 4E2FA 1E63A 3QW2A 3ZCTA 1POXA 1U0TA 1ZO8A 1KO4A 2LNDA 1XRQA 1ZH2A 4C7BA 4KPUB 3M5WA 4R7ZA 1TYZA 4HEA1 3WV5A 2XVZA 5J2UF 3VC3A 5C0OE 1EFDN 1QQ7A 1J5XA 3B89A 3OECA 1JP7A 1NRIA 4HWOA 1EDZA 4OM8A 2XIQA 3GLHE 3LVQE 1N75A 3OT4A 5EN4A 3D2BA 5AM2A 4O0MA 1ODJA 4KAAA 5ADVA 4R2WA 3UTCA 1ESDA 4CLOA 3GZNA 2O1WA 3MT9A 2E5WA 1BXKA 1D6NA 1KC1A 2X19A 2Y92A 3ZIDA 2IYEA 4EJFA 4NR0A 2LV8A 1UFKA 2RJNA 5CU7A 2PGJA 4FXPA 3CA8A 2WSSA 4PFQA 1G3IA 3AEXA 13PKA 1U1FA 3AHCA 3WZ2A 4CM4B 1F5NA 4Q12A 1EUQA 3DMRA 3WL6A 2V3CC 1VE6A 2M9MA 2PTGA 3KL4A 1O9BA 4QUEA 4RDHA 3VH2A 1KAGA 2GA9A 2V6JA 1VKZA 3D8SA 3HMKA 1CV2A 2HBQA 2W6QA 4KQIA 3DDZX 1NL3A 4MI1A 4PCUA 2X23A 5JXIA 3GLIE 3QVMA 1YB2A 2W4IA 1JDSA 1B00A 1SNYA 1S8FA 2O3SA 3O26A 1BNCA 1OA1A 3RJ9A 1FFXB 1ZN7A 3ZTWA 2GF9A 3MRXA 2ZXFA 2NUAA 1X1SA 1ABFA 1LSUA 1P33A 3BE5A 3MTDA 4PRKA 4UBLA 1EK1A 5DZSA 3CH6A 3FNHA 2YFHA 2YY6A 3H18A 1YIAA 1FP1D 4DA6A 4B6OA 4DJEC 4B3MB 4Y0NA 4B3GA 5G53C 1E69A 4L76A 4B7CA 3N3AC 3O4VA 2DUMA 4HHEA 1RAAA 5C4IA 5HNKA 5FTKA 5A4FS 1JHYA 1ORDA 5B6PA 3D8TA 2PV7A 3RK0A 5JNWA 4CNQA 2Q62A 2W4QA 3ZBUA 1H8ED 2CXPA 2Q7XA 2QLMA 2AKYA 3BD9A 3BJZA 3ITNA 4EPTA 3HJAA 5C8DA 4JLVA 1Y5LA <