1Z7WA

Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
320
structure length
320
Chain Sequence
SRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of Cysteine Biosynthesis in Plants: STRUCTURAL AND FUNCTIONAL ANALYSIS OF O-ACETYLSERINE SULFHYDRYLASE FROM ARABIDOPSIS THALIANA.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Cysteine synthase
total genus 121
structure length 320
sequence length 320
ec nomenclature ec 2.5.1.47: Cysteine synthase.
pdb deposition date 2005-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7wA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1z7wA02
4D99A 5IXJA 4PCUA 1Y7LA 1BKSB 5T6MA 3T4PA 1TZJA 5DBEX 3PC3A 1KFBB 4QYSA 3HMKA 5DBHX 2ECQA 3VC3A 1KL7A 5B53A 5CGQB 2BHTA 1C9DB 4JBNA 1VE1A 4D9MA 2EGUA 5I7AA 3VSDA 1TJPB 4HPJB 5B1IA 2WSYB 5I7HA 3IQIX 2CLEB 4L3VA 2JC3A 2D1FA 1WTCA 1V71A 1OASA 2ISQA 3IQGX 4H27A 1P5JA 5B1HA 4ZU1X 4Y6GB 4WX2B 4LI3X 1FUYB 1JBQA 2C2GA 1A5SB 4NEGA 5HBGA 3FGPA 1K7FB 1RQXA 4ZQCB 1K8ZB 4L0DA 5CVCA 5DVZA 4IL5A 2V03A 3FCAA 1KFJB 4JBLA 4D9BA 2RKBA 1E5XA 1KFKB 3R0XA 2J9ZB 2O2JA 3L6BA 5D85A 1PWEA 4XUGB 5BW6B 1QOQB 4HO1X 4ZU6X 3L6CA 3DWIA 2CLOB 2EFYA 4OREX 3AEYA 2Q3CA 2ZR8A 1UIMA 2J9XB 3AEXA 1C8VB 3IQHX 4D9KA 2CLKB 2ZSJA 1KFCB 1FCJA 2BHSA 2PQMA 1BEUB 5DW3A 5I6DA 1F2DA 4HN4B 5I7RA 1TZ2A 1WKVA 1CW2B 4HPXB 3X43A 3ZEIA 3IAUA 5JISA 2O2EA 5B3AA 1TZKA 1TZMA 2RH9B 2DH6A 1A50B 1TTQB 1O58A 3SS9X 5JJCA 1VE5A 2GN0A 5I7WA 4D8TA 3VSCA 1J0AA 1UBSB 1Z7YA 2CLMB 1K7EB 2ZPUA 4D9FA 2TSYB 3DKIA 1TTPB 2CLIB 3L6RA 5D87A 1V7CA 5KINB 1A5AB 1V8ZA 4NU8X 4COOA 1C29B 3V7NA 1K3UB 3PR2B 5C3UA 1TDJA 5D84A 5I7OA 4L28A 3RR2A 1WBJB 1X1QA 2CLFB 5J5VA 1UINA 3TBHA 4D9CA 4AIRA 4D8WA 4D9NA 1K7XB 3PC4A 1D6SA 3BM5A 2TRSB 4KKXB 2ECOA 4OFXA 3SPXA 4D9IA 5IWCA 1Z7WA 5E0KB 4D8UA 5DW0A 1K8YB 4LMBA 1QOPB 5B55A 1J0CA 1K8XB 4D9GA 1J0DA 4I1YA 4D97A 2Q3DA 2J9YB 4L27A 2CLLB 2GN1A 3SS7X 2GN2A 2DH5A 1VB3A 2C2BA 4AECA 4D96A 1KFEB 5D86A 4F4FA 4D9EA 1A5BB 1J0BA 3PC2A 3VBEA 5B36A 1CX9B 3R0ZA 2Q3BA 1TYZA 5IW8A 3X44A 4D92A 4LMAA 2TYSB 1PWHA 2RHGB 1M54A 3DWGA 4HT3B 5EY5B 5KZMB 1J0EA 5J43A 3CEPB 1WDWB 2CLHB 3VSAA
chains in the Genus database with same CATH superfamily
1OX6A 2B4RO 1XP5A 4DNFA 4CL8A 3DAFA 3UJ8A 3WICA 4AP6A 3J81A 1AGRA 2PS1A 5JC8A 4U2FA 4DGSA 2IHVA 4OM8A 4MH0R 3GEHA 2XRYA 4DUYB 4A6DA 3DKRA 1TF7A 3W6UA 5JRDS 2G06A 2WOOA 2IFTA 3KOOA 3TD2A 1NXTA 2YYZA 4L72A 3TL6A 1HQCA 4BMDA 2NUPB 4MS3B 5CGQB 4C87A 5IBQA 4D4MA 3GGDA 2AEJA 3GBSA 4ESHA 2II6A 3A3PA 5HVNA 1WHTA 4JHLA 1E6CA 1Z4PX 2VBIA 4G89A 5CYFA 2VWHA 3PXBA 1G8JA 1XYVA 3DZ8A 2IF2A 2P9YA 1M34E 4B3JA 3I6BA 3OT1B 1SXPA 1KH3A 2ZI5A 1BCRB 4BO9A 4BE4A 1NVUQ 1SULA 1TB4A 4OU4A 2P6RA 2GYVA 4A6EA 2WVJA 3WWZA 1TTHA 1ZUWA 1RLOA 1J24A 1KMMA 3ZW9A 5LL6P 5AKZA 4RA9B 3IMEA 3OP4A 1GL3A 1E7YA 5JD6A 4RS4A 3N2YA 3Q4GA 4A1OA 3KBOA 2HCRA 2R00C 2XH8A 4I1SA 5DHUA 4LAFA 4W63A 5HGJA 3UT0A 4CM4B 1O0BA 3DKKA 4JI7B 1PAUA 3K6JA 2EQBA 4ZVLA 4S04A 4X93A 4R83A 5JI3E 2OLEA 3H8VA 3I0NA 4N3AA 1RABA 3NYWA 4YRKA 5BN4A 1E5VA 4DR5B 3T1YB 1OAKA 4B40A 1QPBA 1W35A 4LDQA 4GSYA 4R7TA 1SA0A 1XMXA 4BNLA 4JJFA 2B69A 1IHXA 4EITA 1RLTA 1A9PA 1W8DA 4O2AA 3FJ1A 4DMRA 6LDHA 3U1BA 3CIFA 3PPXA 2WFLA 2GSWA 4NRDA 5BSFA 5LM3A 3MCVA 2YWDA 3M6FA 3VMFA 4GM1A 4PCAA 3OHSX 1GJRA 4B6EA 3SAJA 4MRRA 5BOVA 4NY1A 2WT8A 1QMGA 2X86A 1VC2A 3BMOA 1P4SA 4YRRA 1W6RA 2W5UA 1XMPA 3LCMA 3HDGA 4FUQA 5BYJA 2PSFA 2O9JA 1D1SA 2G67A 3NYIA 3S27A 5AW6A 3EG9B 3GP8A 4MUEA 4LNAA 4Q6BA 5HILA 2VQFB 1Z0ZA 4UUAA 4V0RA 1OR8A 1UR5A 2AHOA 2A9RA 2I7TA 3CUYA 3IVGA 1KDVA 1UDRA 3R09A 4E5MA 2QTCA 2G5TA 3NO4A 4I8XA 4G8DA 4MV3A 2DT5A 2OUKA 2E4UA 3C24A 4TKUA 1LW7A 5EKUA 2TMDA 3C6QA 4KREA 1FP4A 1X42A 2NOAA 4RHTA 4DTIA 2GK3A 1ZD2P 3KHUA 221PA 3BL8A 1CULC 1CWUA 4ZCLA 4GAEA 4X3PA 5DO9A 4TKUB 4WCFA 4HFRA 4YP5A 1CZKA 4XM0A 4BU1A 4Z86A 1OFUX 1NLZA 4GUDA 3DOOA 5B55A 5EIFA 1USWA 3X1XA 4IV5A 4OHWA 4ZYVA 4HZGA 5AW3A 3ITDA 3X0DA 3PKZA 1XRNA 2VSYA 3RVLA 3O47A 4QODA 1H6DA 5IKPA 1JHMA 4Q18A 4Z4IA 4F4FA 2QX8A 2ETVA 4K6GA 1AQYA 1PL0A 2SICE 3ONNA 1CEQA 3BMNA 3SDSA 2INGX 4HQKA 4QFMA 3FLMA 2VK4A 1E6MA 4NARA 1XO1A 5BXQC 4P7GA 5LXTF 1E9DA 4BKMA 1W75A 3DTYA 3VTFA 3FTDA 3E2IA 4I50A 5BNZA 2OD7A 2GSDA 5DMHA 1YVRA 5B2FA 1EVZA 4L74A 2BI7A 1BD3A 4RBNA 4GKAA 1U80A 1IRIA 2HBRA 5FLYA 3R40A 4G85A 2GPWA 2VTDA 3BHJA 3EXFB 2M6RA 3DBRB 2YBDA 4O25A 4ESVA 1S8AA 3G6KA 3KPVA 1DGQA 1F8YA 3CZAA 3WGOA 2GPAA 3MSXA 1D2GA 1MEOA 3T94A 4BAUA 3HV2A 4BP1A 4CV3A 2SNIE 4IPTA 5KX5B 3THYB 2XAUA 3N2ZB 2F3PA 2ZYAA 1S2MA 4KYIB 1YB4A 4R5HA 1P7WA 4YP1A 1UJ6A 2ZKIA 5ALZA 2Q3HA 4B3CA 5SYAA 4P4NA 1D7OA 2GAFA 4IIUA 1I4OA 3CEJA 4BLQA 1HZJA 3IQGX 3GEGA 3GNTA 2P11A 1XTRA 4J3JA 1K8RA 1NX6A 3CJQA 2NADA 3CNLA 5EIBC 3UBMA 3QGMA 3V2IA 3BIXA 1WMSA 4U5XA 5JDCA 3LMKA 4S35A 4K9LA 2HIGA 3VDQA 2J3IA 4YYZA 1QHNA 1RWOA 4OI2A 4DABA 5JLJA 3FCXA 3I9MA 3L4BC 3IO5A 4LOKA 4A0FA 2WFZA 2H1RA 2ENWA 3HBJA 3GRFA 4IICA 4EG4A 1YDEA 1WXQA 2BGKA 4HQRA 5KVQA 2FRDA 2GF0A 3AHIA 2PJDA 3RS4A 4A0GA 4R8MA 1V47A 2L19A 2WKRA 3BZWA 2GI4A 3OQVA 2J5KA 4GLLA 4JEIA 4N5IX 2C4UA 4XDYA 5D7NA 1NW3A 5J59A 1E3MA 3NWJA 1VMEA 4MVJE 2J8ZA 1SCNE 1B14A 4HB0A 4WK6A 3GI1A 1FDRA 2EL9A 3GFRA 2OWDA 4GGOA 1E3WB 2VJOA 4IFBA 4HPXB 2B3TA 3LDAA 3L6OO 4WN9B 3GDWA 2IIBA 3KYBA 3L4BA 4RORA 2FEKA 5E2IA 1XVIA 1CUZA 2GX6A 1NDUA 7ADHA 2VWPA 2ZWIA 5K3CA 4TQGA 2EW8A 3QUTA 4TLBA 5FPKA 2XVMA 3E7PA 3WO1A 1V6CA 1JFFB 3VO2A 3GT0A 4B32A 2JGKA 3B3AA 1FXWF 2XAAA 5EFOA 5FH9A 4UM5A 1A4UA 4NCXA 2VDRB 4ZXPA 3ZCRA 2X4GA 1C3EA 2AZ4A 3FA2A 5DOZA 3DXZA 1GSOA 5JJIA 3P2MA 4B44A 1CS0A 2G82A 4OFBA 1VLJA 4AZTA 4B6SA 3BS4A 3OQOA 2BDEA 1TAGA 4DHWA 1TDJA 3I3SR 2BFBB 4NZZA 3PVZA 3ESYA 3KJFA 2VP0A 4L4UA 1Z4JA 4L75A 4DA9A 4ZYLA 3PRKE 5E4FA 1KGSA 2P91A 2TRSB 1IJKA 4J0CA 4OFXA 4P9NA 4M1TA 2Z57A 5E0KB 5JZ9A 1S01A 4OQMA 4Y2VA 2K4MA 1IVYA 4OMCA 5HZKA 2XZPA 3H9CA 1HDCA 4KE7A 3WLAA 1D2HA 2JD1A 2P2LA 5CFNA 1YFJA 2K6GA 5C8YA 3WYFA 2C2BA 1SBZA 4NBLA 3UB4A 1YOVB 5H3HA 3WDSA 2Q41A 2L0XA 5DP2A 1H2WA 2R65A 4Y2YA 4X8HA 4LXYA 1U1EA 3LUGA 2JB9A 4Q21A 2H06A 4IKPA 1TYZA 2X6TA 4F4UA 3ZVRA 4DQDA 2I71A 3OEHA 4F1WA 4MV7A 4LXXA 4JOQA 3BMQB 3EFHA 4Z9YA 3VX3A 4CGYA 2BGGA 4B3TB 2CHQA 4BEWA 3HVHA 3C43A 1IZ0A 3OHMA 3VNBA 3BCHA 1JJIA 4ZO4A 5JW6A 1K6IA 3MIZA 1AMUA 2OB1A 1O87A 4HDRA 1C1DA 2PJUA 3ZE9A 4IDGA 3FNGA 5ALRA 4KUHA 3TSZA 1NVXQ 4D4KA 2O0LA 1BGWA 3KPYA 1O5IA 3L1IA 4OFWA 1XHFA 3AB7A 3G2QA 4N65A 2ECQA 2ZT6A 4ZJUA 3DDNA 1TZBA 1R4MA 3MTIA 5CH5A 4OYLA 1G3UA 2WP8J 5EJ6A 4X64B 3LHIA 2KE5A 5HE8A 1T9GS 3MAJA 4U1RA 2WBLC 3GBPA 3L7YA 2H59A 5LWQA 4C78A 4LISA 1O4VA 1PGOA 2FP4A 2GZ2A 5CMLA 5E1DA 3SFTA 5B1SA 1AKUA 2NPOA 1XKLA 3TLBA 5DM70 2EKBA 1WEHA 3H2KA 4F4HA 1V8FA 2FRDC 1Y5IA 4K9OA 4XQCA 5JNWA 1XGKA 3DBVO 2BUBA 3HFGA 2AR9A 4QHYA 1NJFA 2VHZA 3QZUA 1BHO1 1DJMA 1LF0A 3FHCB 4OV6B 4ZEVA 4GOND 2CJFA 5CT8A 3KR0A 1D09A 4UZEA 4XLTA 1W19A 3QFFA 4PZCA 1LPBB 2WD7B 2ZJFA 2ZTSA 4C7VA 3FPHA 4RMHA 4XJTA 1U7DA 3KTFA 5L4SA 3A9SA 4JYCA 4KRXA 2JJ8A 4DHEA 1PG0A 2OD9A 3JQRA 2WKWA 4PRZA 3AIIA 4IIGA 4RAOA 5AOCA 3T5AA 5I4BA 1CKEA 3GH1A 3CZPA 1JHRA 2O05A 3OF5A 4RCZA 4KQFA 4CUZA 4YA6A 2XUGA 1WAMA 4JP3A 4RM3A 3RTEA 3VNQA 5J23A 5HCNA 1MC5A 1WR8A 3NETA 4YJ3B 1PGPA 5KYWA 3H42B 1GPYA 1KU0A 2JCVA 3BH6A 3DW3X 2AW5A 2XYVA 1XE3A 2ZUDA 2YX1A 1BAPA 3ONFA 3GLVA 1XAHA 1WEKA 1YE3A 4HZUA 5GMOA 4ETIA 4QOIA 3SC2B 3U7EB 2GERA 3QI7A 2DSNA 1Y4ZA 3IEUA 1M7BA 2KPOA 2CCJA 3K2BA 3PG5A 4QQNA 4ERXA 3KSAC 1GN9A 4B6PA 1T43A 1M73E 4AKGA 1XXHB 1JA1A 1YBVA 2YMLA 2QVYX 3PIRA 1QGZA 4QWMA 4F1JA 5FOQA 1D6MA 4C4ZA 3N2IA 2H0AA 2RHJA 1ODKA 1IN1A 2E4YA 4NCKA 2AJ8A 2Q50A 1SEPA 3D4OA 4EYQA 3DH0A 3AP3A 5B7NA 2BGWA 1E8MA 2E4XA 3H5VA 4HWSA 5F4BA 3K20A 3M6AA 1XTZA 3O3NB 5K6AC 1NP3A 1E2LA 3NKFA 1E96A 3K2EA 2PRYA 5JAZA 5DFAA 3O8CA 4ZV9A 3ZH9B 2HB6A 2QGNA 2L42A 3R0ZA 4QOHA 1UOQA 4UAVA 5EP2A 4QXQA 2AEEA 3Q8KA 1IWPB 3ZBQA 3HJAA 4DV2B 3I0MA 3K0CC 2NZ8A 5KSOA 2EU8A 4RTOA 2JGMA 1Q2XA 3DJYA 3UW1A 3PE3A 4KIWA 1DAIA 4M7OA 1TQHA 1YS2X 1IXSB 2DLCX 4I9GA 3ICVA 3BK2A 4IGFA 4YVFA 1QH9A 1JXAA 3OX4A 3MD0A 3L4KA 5F9FA 1WHTB 2PSDA 1WB5A 3A6JA 5DBHX 5LQMA 3I4CA 3OPXA 4B76A 2PN1A 1SU8A 3LHSA 5HKKA 5JEEA 3HPRA 3FMGA 3PGKA 3SLRA 3U4GA 1L5HA 5JO9A 5EWJB 1G2OA 4MYDA 1UJNA 3D6NB 4I66A 4EHFA 1L4KA 4X41A 1H93A 1P7CA 1QUFA 3ABIA 3RQIA 2PZKA 1IK6A 3N39C 4Y6PA 1NMQA 5AVVA 3F4KA 5IJWA 3VYUB 4CLRA 2RH5A 4BLWA 1TM1E 1YCDA 2RMKA 3GT7A 4M8KA 4OSEA 5E9WA 4C3ZA 5CCBA 1MO4A 3WWDA 1SOUA 2IOHA 3SJUA 4YCLA 2VHWA 4B3SB 1SCIA 1HE3A 1U8TA 2HJHA 4GX1A 4BV2A 4KSBA 1U5AA 1HNNA 2MOKA 3CPSA 5AK3A 2RIRA 4K7JA 1XN4A 2GN4A 1XZQA 2P3QA 3WLSA 2EHJA 4FYIA 4DUPA 4X24A 1CY7A 1P5HA 2AX3A 5KJFA 4E31A 2A0WA 5BP7A 1NBME 1Y3FE 4JWTA 3NVAA 3ECAA 4RC9A 4X6LA 1AZWA 4KO3S 5DHTA 5IP5A 1EFVB 1C8VB 1E1KA 1GNPA 3LC2O 4HC4A 3RTGA 1G8YA 5FA6A 1KF0A 2H3HA 3WKAA 5AVUA 2YWHA 1CJMA 3HA7A 2Q2NA 1I0ZA 1NDHA 4JB2A 3JALB 3R7LA 4GKBA 2XCUA 5JISA 3QPDA 1VIDA 3OZIA 3KB6A 4TMXA 5F1PA 1T3GA 2XD4A 4M8NE 5C1BA 4ZANA 1JECA 4W8HA 3PQ3A 4DDUA 3CB2A 2PD3A 3SS9X 3G2JA 4OYHA 1C4OA 1QAMA 3FLEA 1RKVA 4G0PA 4ZVKA 5F51A 1WY5A 3WIBA 5CU7A 4BMYA 3DLBA 2DHCA 5IZCA 1JKFA 1XZAA 4NG5A 1FLAA 3CUWA 1KDYA 4B3MB 2OR3A 4D5GA 5FXMA 4CL0A 3ZV4A 4HGQA 4O4LF 5C4IA 1Q7TA 3OFNA 1P81A 1H85A 1IAVA 4WADA 1K2VN 1WPXA 1OFUA 1VKZA 4NU5A 3G9QA 4LJSA 3WGYA 1HE8B 1T91A 1FP7A 1YRQA 3D54D 1ZL0A 1OPXA 1W4RA 4D9NA 1IJEA 3N2KA 3MJCA 1ULTA 4R1NA 1TIPA 4EO7A 2CNWA 4Y0AA 2B5WA 3GEEA 1G8PA 2DX7A 3QLVA 4N3CA 5EPEA 1WSBA 4DSZA 3DGFC 3F6SA 4DSUA 2P7HA 3A70A 4PYIA 3TGLA 1FJGB 2QG6A 2J59A 2XMPA 4D3FA 4ZCPA 2RK6A 1R5BA 3AOGA 1U0HC 3HYTA 1X94A 1IHUA 3UOGA 5KTKA 1LZKA 4X7BA 4IG4A 3T9AA 5BMVA 4BNUA 1R8QA 2OORC 1V26A 1Y7PA 3QBVA 3ANXA 1FFXA 2IU6A 2E18A 1OFVA 4ZK6A 4A8JB 2BZ0A 1Q50A 1QH1B 3GG9A 1P9LA 1U3VA 4FD2A 2PYDA 4R0NA 2PUAA 1RHKA 2C9OA 1VRWA 2DUMA 5ALIA 1R66A 5E0OA 3HJNA 4JVMA 2MSCB 3F8TA 4UD6A 2NX2A 1GGNA 3BBLA 3O84A 3RSCA 3AETB 3AHEA 3ZNQA 5G4KB 3T5PA 1XVUA 1ZQ1A 5BW5A 3B38A 4XYBA 2DF8A 1YUMA 2EKZA 1XQ6A 3IDFA 1RMYA 1PBTA 1P29A 3EISA 3OZXA 4Q4DA 1Z16A 4LTMA 2FZLA 5KHLB 2ISQA 4L0CA 1O94D 3GLQA 4N76A 3M33A 3GFPA 2PLAA 4CETA 2VG8A 5TEVA 1ZD1A 1XCPA 2VQ6A 5CT6A 3A25A 3E7DA 1M6WA 4WX2B 3ZV6A 5BSVA 1EG2A 4TV8F 2EYQA 4WIAA 4ZYUA 1EX1A 4YT2A 1GUBA 4JOBA 5CVCA 1T6ZA 5F1YA 3TQSA 1LFDB 1L5VA 3RV3A 3PQ2A 2PTHA 5GP1A 3UXMA 1QBKC 3WXMA 4EI7A 3NRJA 3SC4A 2JVJA 4EO4A 5FNZA 4F72A 2V7WA 4M37A 3UTDA 2YY7A 3VBCA 5FWDA 1QAQA 1QFZA 1S8NA 3JWEA 3N86A 3T1OA 3BTUA 3RK1A 3RIXA 3BKXA 3SYKA 2EWVA 2HNBA 3QUBA 1U9IC 5JYEA 2NAPA 2J9XB 2GBCA 2QQGA 1VRCA 1TA9A 4IDBA 2WILA 1OZFA 1TAQA 5FUVA 5HJ2A 3RS5A 3SS8A 1GNTA 5D5PA 3HZRA 2OCBA 2O54A 2BEUB 4GU5A 1ELOA 2ZB4A 1KR5A 1IYZA 2OAEA 3BXHA 3HBAA 4GPBA 4J6FA 2WIGA 2AG6A 1NBHA 1A71A 2PR7A 2IK8A 2QL5A 2DFVA 3QEOA 4B4DA 2H1VA 4K6OA 3QH4A 2HA4A 2F3RA 4NNJA 3W5SA 4CMAA 4DEYA 5FBKA 1WMDA 4U2EA 1X9HA 5ES4B 1N1MA 1Z7YA 2JEZA 1T6XA 3FDZB 4M0KA 4NZPA 4PSKA 4YRDA 4PG8A 1AOXA 1ZICA 2Z95A 3DKIA 2HIMA 2O8BA 2IKQA 4UFNA 3FNBA 3H18A 3OCXA 3O8QA 1P2BA 2GEKA 3NKVA 2OCYC 1LLUA 3PWTA 1E9RA 4FNOA 3AQ4A 4YMGA 3ENKA 2Y1FA 4CNBA 1Z15A 2ECKA 4U7JA 5FBLB 1GOTA 4WV3A 4ANFA 1QGED 1VLVA 3D43A 3I5XA 4JYMA 3TBHA 3LXRA 1T0IA 1NATA 3MWEB 4FCCA 3RDPA 3D8NA 1GV1A 3ELBA 1QUEA 4MIYA 4LGYA 1DARA 1MPTA 1ZHHA 3BC1A 3QELA 4PFQA 2DPMA 3SHWA 2BEWA 2J0UB 2AV6A 4LS3A 3GMSA 2ZM5A 1II9A 3IUYA 2A30A 1RE1A 4QPJC 3FUCA 1BX3A 4DYHA 4HHEA 1VB3A 3MD9A 2X8BA 1LPPA 2EFDB 3DUFB 1GZ4A 3MSCA 1LSUA 1GUZA 2PMFA 4I1RA 2CFSA 2QM3A 1BMTA 3W1VA 4KE9A 2O8EB 2Q5EA 4DDWA 1EA7A 4YRFA 2O3UA 3PLNA 2J3QA 5JBNA 2JDID 1NOIA 2JZOA 2FLKA 3T1TA 4YCBA 5DM2A 3EY4A 4G25A 1AKYA 4MA0A 3SP1A 3LPDA 4TSFA 3G0IA 2JGAA 5HW0A 2QD3A 1EJ0A 1GEEA 4GW3A 4EHIA 3M82A 5A6SB 1SOAA 1G18A 2HSWA 3ZH2A 5DXJA 2PANA 5KNDA 3THWA 4I81A 4NSNA 5E6UA 1JDUA 4BMNA 5IJZA 5IJXA 1II8B 1L9KA 1NSTA 3MCAA 4Y0NA 2YHIA 4RXMA 3U7GA 3Q3EA 1JYFA 2HBZA 4TT3A 5FDFA 1Q3KA 1P3Y1 4CCYA 3VNRA 4QYIA 2VDOB 4ILEA 4DWJA 4GT1A 1P7VA 1MD9A 2NVBA 2OHFA 1DFGA 4DDHA 3OZEA 5C34B 3PD0A 1FU7A 1R0WA 4DUGA 3IQIX 1N2XA 4JYBA 1NFQA 3AM3A 2NPFA 4JL6A 4LXGA 3NI2A 2YHBA 4TXHA 4UPEA 5C81A 3BDIA 4LXIA 5AW9A 1B43A 3ADOA 4U2CA 4AL4A 5CDUA 3VRHA 5GTDA 2IW3A 2ZB2A 3EMKA 1XQYA 4M9SA 3MJTA 1YMQA 1YBHA 2NZJA 4UJ5A 3DE4X 4EJ6A 2WU1A 5L3QA 3C5WP 5ALLA 3DCJA 2V7VA 3SXJA 3RVBA 2F3SA 4HLNA 3DULA 4LJLA 3BMCB 3A0RB 2Q5LA 2QZJA 3AFNA 3KQVA 3ZVNA 2BC9A 2QMZA 4FN5A 3P97A 1IH8A 2YMPA 4RYLA 4CM3A 3FPGA 1EINA 1LSJA 2JEYA 3GLFB 4KXUA 1EI9A 4QVGA 4LDRA 3OEED 4UDNA 13PKA 3NTXA 1CS4C 1FXUA 2E4AA 4M0PA 3UNXA 4DPKA 1MG0A 4YDRA 2XCSB 1EVQA 3EW7A 1HC7A 4GP6A 1R7RA 4BC1A 1XTVA 3G49A 4E32A 1Y6GA 4AXXA 4QTYA 5I7RA 5THXA 2ODEA 3E3LA 3X43A 1G8FA 5J2UA 3STYA 4RVHA 2ZIXA 1F3LA 2OCLA 4Q9HA 2RGXA 4PLYA 2HSJA 1C9JA 4FUTA 3MTDA 3T9FA 5TIIA 2OT3B 2GEBA 2Q0SA 1C41A 4O1HA 4G0WA 1NBEA 1GGMA 1NLFA 5D1NA 2IELA 2ZTVA 1FYEA 1KETA 1L5HB 1BWRA 3L6RA 1P4RA 4NH4A 2VNJA 1PWYE 3DE7X 3H2YA 2YWXA 3K2QA 3OJCA 2WF8A 3MOGA 3NTOA 3PFBA 4RTQA 3EOZA 3KSBC 1B8NA 2L18A 1Z2AA 2JHAA 1RLUA 4M9UA 4N54A 1MRNA 5K0SA 1B00A 1HMYA 1E2PA 2HH9A 1YFZA 3NBKA 4KQMA 3UQYS 2BUCA 3UHOA 3JZDA 3RK0A 3ZZUA 3U44A 4L2IB 3O4IA 1NE2A 3OY7A 3AOEC 2JGFA 2R1TA 2R8EA 3EEFA 3Q6NA 1H9BA 1QYXA 4YGYA 4AQYB 4IH4A 2JFPA 5FTWA 3W8FA 3ESCA 5KAPA 4EYSA 4HYTA 2A5DA 3RFXA 3OQ1A 5ISMA 1E2BA 2Y0BA 1M34B 1PNQA 1BX1A 3FTEA 3JQ6A 3KQPA 4S0ZA 1ZC4A 3H3JA 4INPA 2YXBA 5FAKA 5FUMA 3G68A 2J6HA 1CDZA 5PGMA 2GBPA 1C2TA 2J3JA 3MQ4A 4QDKA 5F35A 3DV0A 4B6RA 4JYAB 1Z06A 2ZFUA 1EQ2A 3BFXA 5ALWA 5IAKA 1G21B 5DK4A 5F9MA 5THKA 3EOBI 5CFOA 1C9DB 5JXWA 3BFVA 3TCXB 3F5DA 3ISTA 4AUNA 3F5FA 4R8VA 3DPSA 1ZI9A 3ZLUA 2EX4A 4RAQA 2CXNA 5FYDA 2DBVO 4NYIQ 5BYKA 1H65A 5BURA 3T9BA 2CV1A 5BW8A 1MJNA 3R24A 1QANA 3MFQA 5FP0A 2WY2D 1IY0A 1U28C 2AFIB 3C5VA 4D3YA 1DO2A 2AQ8A 3SEFA 2QW1A 5CG2A 4IIEA 2QRHA 4BVBA 1UZUA 2Q7XA 4KQ2A 5ELLA 4YRNA 1VPVA 1TLFA 2MYUA 4DCGA 2WK1A 5C37A 1NL3A 4GZLA 1ACMA 1LS1A 4Q01A 2LBPA 1MOSA 2OEPA 3G2NA 3EEOA 1GU1A 1GP2A 1XELA 3FOCA 1U7OA 1U7TA 2UVQA 2P0AA 3V3TA 1X7GA 1H0SA 3HB9A 2EARA 2VKTA 1CR2A 1U98A 2OAP1 4BFCA 1XI2A 1ZOIA 3A9RA 3AJDA 5CA1F 3RVNA 3TUJC 3BRCA 2HK8A 3WJ7A 4WKOA 3U4IA 3OTHA 3TRDA 3LDHA 3DHWC 3MAAC 5TY0A 4LVUA 3UG7A 5CEJA 3E61A 3CW2A 3WLFA 4UU0A 5ALXA 3ZWWA 4CUKA 4GGMX 2YJNA 3C3WA 5ALDA 4Y9TA 3QMPA 2GUWA 3Q88A 4PYNA 1RWQA 4U63A 5ITZA 1U0FA 1SC6A 1WABA 4U6SA 2AI1A 2ZBRA 4WESB 4Z2AA 2FGKA 4IG9A 1Z6XA 5BRAA 1OCEA 5DW3A 1K5PA 3FHLA 3NEJA 5I3ZA 4NAUA 3T9CA 4CNQA 1C4KA 2VJCA 4TS3A 3Q7SA 1X8KA 3HJGA 4X44A 1VKHA 2Q2QA 3A9TA 3LA8A 4QHSA 1NOJA 3GAZA 3BWBA 3D3KA 5A3SA 4ZPJA 4GSLA 4E09A 4CQJA 1QGOA 1GEGA 4UCFA 1RFLA 1JH9A 2CV2A 4CMHA 1JQLB 5HK9A 1CYDA 3D0KA 1QO9A 4MUHA 2F17A 2UVDA 1O8BA 1PQWA 3MMSA 2VXOA 1SUIA 4MHOA 2AXPA 1E3LA 2Y3IA 1LBQA 1V11B 2VQDA 4HATA 4ML3A 4LHZA 1KPIA 3SZRA 3GB9A 4CM6A 2G1UA 2HU8A 1VHQA 3OMLA 1USGA 2YNMA 3DLHA 3FWYA 3II6X 3MILA 1FFBA 3DEZA 1YBFA 3RAEC 3NHRA 1Q0ZA 4MW5A 5ALEA 1I3OA 3IT1A 1L5YA 2Q46A 2XUQA 2CKDA 1JEDA 2DTXA 3LQRA 4G24A 4PANA 5KPJA 5CXUA 5TQ2B 3BAZA 1DKOA 2AIRA 4Q1AA 2J87A 1J0DA 4NE2A 1RRGA 2ZU6A 3PD7A 4D97A 1X6VA 2QN6A 2VHQA 1DPGA 3TTXA 4PFSA 3UB3A 3FCOA 4TSRA 3IJRA 3QPCA 3C1OA 4X7MA 5ER9A 1WW2A 4ITVA 1K27A 3AY0A 3P71T 3HZOA 4K1LA 3W5BA 3N6RA 5E7IA 4BP8A 4ZALA 4CMEA 1DHTA 3GRRA 3Q3VA 2BUAA 4X85A 5LYJA 2Q8PA 4C5BA 3QOXA 1XZKA 2HX1A 4N0DA 1ULZA 3THXA 3EMDA 3EAQA 2GEVA 3TXAA 3V1KA 4E1VA 2NV0A 4H77A 4F9TA 6GPBA 1WUYA 2R85A 1VKRA 1JB9A 1UP4A 3HN2A 3KOZA 1H4VB 1V37A 5FI1B 2JC3A 3COPA 4MYUA 2MSKA 4KQ9A 4D81A 2H4XA 4DJDC 5TMEA 4U4AA 5JFGA 5DWDA 4EGFA 3PFKA 5K03A 2GAIA 4HS4A 1M8FA 1PW5A 1YJXA 2IEYA 4IDQA 2BCJQ 3EWAA 1E1RA 4D6YA 1KQFA 1TK3A 2B0CA 3TF5A 2W2LD 1K08A 2X7HA 5H9VA 1IN7A 3LQKA 4AJ2A 4LRQA 5C5IA 1YC5A 3TJZA 2P77A 3O95A 1JIIA 3EUWA 3OFVA 4DBZA 2XVZA 2XNHA 3KKKA 4FJ1A 2AYZA 3DNPA 2ZWMA 4Q7EA 1IQPA 2LCQA 3RS2A 1WDTA 3I8XA 5CDGA 1F8XA 1OY1A 1PJQA 2FKAA 4GI7A 3H8JA 2O7RA 4URWR 1NJ1A 2CN1A 4NEGA 4E11A 1JALA 3LG2A 4J7UA 3HO8A 3H6GA 2A59A 3HUEA 3RQSA 1WETA 2HXYA 4YCDA 5AVQA 4OXYA 5EZ6B 1ZNWA 3W5IA 1AKRA 2P8SA 1CUAA 2WT9A 4CDNA 5FPHA 2YJTD 4IOLA 1H9AA 3HKCA 3UXYA 1W36B 3QVUA 5ECWA 4M8IA 4OGLA 3H65A 2H00A 4K5QA 1P44A 5K3DA 2OCKA 2ALJA 4US2R 4F9GA 1XC7A 2AG1A 4OREX 1NLMA 1XNHA 5IKOA 2I1WA 1GPWB 3SZOA 1G7TA 1Y9JA 1AS2A 2RG7A 3QX8A 1PR3A 2F43A 1CZLA 1M10A 1XSEA 5HP4A 3VKGA 1ABBA 3OUZA 1FNBA 3R5JA 1E9AA 2JDIA 4UUQA 2PQMA 2O7QA 1H2XA 5GONA 1SOWA 3TQCA 1CZUA 4DLNA 1BXGA 3TX2A 1IY8A 5LSAA 2FQYA 1CUUA 2HRZA 4I4TB 4TVKA 1NQTA 1XA4A 2B3DA 4JL8A 1X14A 4PTLA 3C7KA 1SUPA 2XOEA 5KDLA 5D5QA 2PUHA 1BRTA 2QU8A 4LDAA 1CY4A 4DY6A 2XVXA 4E07A 4M1QA 3JVEA 3BWMA 3BSFA 2QJRA 1JYEA 4ZP1A 2DB3A 5KJ6A 4O4JF 3ET5A 1S8FA 3GA0A 3OT1A 3R0QA 1TTPB 1Q21A 4P5PA 4QOFA 2JAWA 2JCBA 3E22A 1I1OA 1V7CA 3AJAA 3B60A 5F5NA 4LJ4A 1D6JA 4Z49A 4EVSA 5K6RA 4O02B 5DM4A 3QE2A 3IT0A 4G5RA 4YONB 4JCOA 1ZK2A 3CN7A 5J5VA 2HMWA 3CLSD 4Z7NB 1XZNA 4GR5A 4M9CA 4CCWA 4DC9A 3O4FA 3LL7A 5CB4B 4KPEC 3TK1A 1V41E 1FEZA 2FFBA 2YDYA 1IL0A 1YVDA 1Q1AA 3AFGA 1ISFA 2B92A 4QECA 4KX3A 1P6UA 4X1YB 4YY3B 2RC6A 5CLGA 1EJBA 2NU9B 3HJUA 4ZJPA 1P8JA 4WY2A 2H07A 3DOJA 4BFWA 2QJWA 5J9FA 3H9UA 3H05A 4KNWA 4C76A 2VKQA 3OUUA 2PHZA 3CNOA 5AKEA 2JAPA 5KVCA 1EX7A 4KTVE 2OHJA 1DV1A 4C5CA 2D3WA 1PGQA 3P4YA 3VI4B 1SCDA 1QK5A 1CUYA 2JGIA 3IDSA 4EHAA 1Q0LA 5I9LA 3MBIA 5FO0A 4G65A 3A0UA 4AKSA 4DA4A 4X1IB 2QDXA 1B0UA 2BZ1A 3AI1A 4KOAA 4H35A 3V97A 3BULA 4UMFA 5DOVA 5FNVB 2NNLD 1OZGA 4FILA 3VVBA 2IYOA 3GZNA 1NIPA 2V6BA 1DCMA 3Q9UA 4MUYA 3E15A 4PGAA 4WTOA 1XIVA 3B6MA 3PTZA 1GU7A 1QX3A 2H5EA 4N39A 1RW4A 2B94A 3VISA 2HCBA 3DT6A 2HQOA 3HFJA 2YZNA 4LNUB 1QVWA 3ZQJA 1VLMA 3L8DA 3UUEA 3BWEA 4RNDB 5FEUA 1CRQA 4IGIA 4OOEA 3O91A 4HQFA 1XZFA 5TLSA 1KRHA 1LC3A 4J2HA 3UWDA 1XV5A 3RKRA 1XLVA 1CCWA 5DNCA 4R2MA 2Q5QA 4Q7LA 4BIIA 1WSDA 3LOUA 4MQFB 4EFKA 4MOWA 4P38A 4ROTA 1KJIA 2C2XA 2R00A 3GEIA 3LX8A 1R6BX 3C48A 2FEOA 2FX3A 3THOA 4BLTA 4ZCMA 5CDYA 821PA 2JK0A 4HGRA 3UCFA 3R9WA 1C9YA 1JVSA 1AC5A 2IW1A 3L05A 3O75A 1XTQA 1HUQA 1VMIA 2ZI7A 1C7EA 4HLUC 3AHDA 4P4LA 4ER5A 2E7ZA 2UVPA 4FHGA 3WGTA 5F98A 3LOQA 2Q4BA 3TLJA 2C2WA 5LYJB 2Q3LA 2C03A 1P5FA 2WWRA 2VDLB 1EAYA 4RCVA 4XARA 5E6UB 3H1BA 421PA 5J2TA 1Q7GA 4JITA 4TT8A 4DNOA 3I5YA 3M6VA 4YI5A 5ETJA 3S2EA 1IUPA 1RIIA 1PYGA 1I7PA 4QUGA 3CNEA 2HA3A 3S68A 1DC8A 4M86A 2PRKA 2QSZA 4QO7A 3F6BX 3RBVA 3ULKA 2GNOA 4RPKA 2LNDA 3HDVA 4HBGA 4KPGA 3BSWA 1AT1A 1L4MA 4S2UA 1XNGA 2ZT5A 4Y6LA 1M83A 3IBSA 4QLAA 2XB9A 1AH2A 1HNWB 1SBCA 4K03A 5JPIA 1JEYA 4NFSA 4TTTS 3DA8A 4NBUA 5LUAA 5L8VA 3O90A 4EJSA 4CKWA 5G53C 2OXEA 4U39A 2B1JA 4LRSB 3AZPA 4H15A 5U1PA 1L4UA 5DHAA 3O9MA 4E6PA 2POCA 5L3VA 2KLBA 1S2GA 4Z7JA 4M22A 1E1MA 4NDZA 1TCVA 2O5RA 1DWOA 2HYIC 4R6WA 1O9GA 4YEDA 2V0NA 2RB5A 5AK4A 1XZDA 2QL6A 5D87A 5IAGA 4ERNA 3U4QB 2ZYSA 1ESMA 1UT8A 3ZE1B 2PX4A 2PZGA 3G1UA 2PVSA 1GRNA 5D3KA 3FMPB 1SBTA 2UKDA 4DY4A 3KKLA 4TYWA 1HA3A 2QJFA 4G01B 2XKJE 4PLCA 3ITKA 3DQPA 4TUYB 5DI9A 3I39X 3URKA 1SCBA 1GZVA 5H1YA 4DR1B 2QG9A 2XMQA 3EAGA 1FZTA 4BQRA 1YTLA 1BKYA 1B1CA 4R0MA 4JGGA 3Q12A 3B85A 1C0IA 1YU9A 2GPBA 2V5UA 3X1MA 3H04A 3CRRA 3D0RA 4ZJYA 1IZ7A 2CJXA 2HA2A 5E8RA 3G6WA 3CIOA 3RKUA 3OEWA 1N6LA 5F1OA 3TDMA 2K5UA 1P0MA 1A5BB 5IF3A 4P0QB 5KNDD 4J1TA 3VC2A 4ZYWA 3A1FA 3O1JC 3FJOA 3V1NA 3WK6A 5AI5A 1DDOA 2QZSA 3IIMA 2PFSA 5HEKA 2ZOSA 3KV1A 3G0DA 1TK2A 2OXRA 2RHRA 1EM8B 1A2OA 4UBLA 4ZOLA 3RJ9A 4IDCA 4LZWA 2ZJ0A 4XAQA 4I2VA 1JS1X 1WDLA 2PGIA 3IAHA 2L2QA 3LCCA 4N7MA 3UF0A 1Z62A 4FZJA 3R3JA 3Q9SA 2H57A 4ON9A 1RZ3A 3JY6A 3BGDA 4NMXB 1DXQA 5EQJB 4JI5B 2BJHA 2ZK7A 3NGXA 5BWLA 3CS3A 4F9EA 1VHWA 1G5HA 4GMDA 4Q15A 3G0HA 1BN6A 1DQZA 1PT9A 4QREA 1YE8A 4F7WA 1NVVR 4FOLA 1ZONA 1W7AA 3NDRA 4FM9A 4LX0A 1NAHA 1ZN8A 2NU6A 1JDNA 4MV4A 2HPZA 2GN6A 4PLHA 1QRDA 4PBRA 4X6YA 1YUNA 3RIEA 3T0FA 4GL2A 1D1QA 3EARA 3KU4A 3O0DA 4Y2TA 3K1AA 1JLHA 1UC5B 3W77A 3P9KA 3RPEA 1YI8A 3KJIA 1ZW1A 2GF2A 3G2KA 1M1YB 4G9EA 3UT5B 4ZDIA 1USIA 4KMRA 2M6LA 1YA4A 4MPPA 3U7RA 4E88A 1GPMA 2B1QA 4RJLA 3KAPA 4CM7A 4J7CA 4WOJA 1VFNA 5F3DA 2PBZA 3V8NA 2CE2X 1FF9A 1OFGA 5I9SA 4QATA 5K0GA 3EWSA 5JAIA 1VA4A 2FUEA 4GYWA 4R9VA 4WCVA 4IVPA 3UWKA 2QAGB 4LRTB 3L5KA 1KO8A 2F64A 1K6MA 1M34A 3DWIA 4ZDJA 2IHZA 1D03A 3H2SA 1I1HA 4L3WA 2XXBA 1NQAO 4PBSA 3ZD7A 1N5RA 3IQXA 4PFKA 4AO6A 3CUVA 3QQ5A 4M9QA 4K9KA 4RJJA 4ZOAA 1CUHA 3ZYZA 1O95C 4NABA 5K7SA 3NTLA 1LI7A 2ZRNA 4DRXA 1JPNA 2DWOA 2W0SA 4FFBA 1W96A 5KDDA 2XHZA 1XK7A 2FWIA 1SM4A 2V74B 2Y93A 2GPJA 5I4KA 4IJMA 1JHAA 2B7CA 3ETLA 3N76A 2PUDA 3MEQA 1S96A 4GP9A 4FSHA 3BJMA 4RVSA 1J6UA 3K4PA 1MC4A 3V00A 3F71A 1Y4SA 1QIEA 2QLTA 2WTMA 3B9QA 4FJ0A 1TCBA 1U3DA 1ZNYA 4RMIA 4UU8A 5ALGA 4U02A 1H1LA 5F2OA 5U4QA 3TSOA 5CJJA 4Q47A 2AJTA 1QFSA 1NX9A 2YXDA 3DSRA 3EDOA 3P9NA 5LP6B 4EKGA 2EYUA 3K0KA 2EW1A 3GLKA 1GPAA 4GH5A 1T1JA 1Z0KA 3ENNA 1ZMXA 1GNVA 3TR0A 2A78A 2HF8A 3DEAA 1WU8A 1KIFA 1EVJA 1PS0A 3PQEA 1RCTE 4LYYA 1M0EA 2X3UA 1ZQ9A 1E1CB 1S2DA 3X2SA 2LWIA 4J0FA 2OZVA 4OUDA 1CNFA 4IAOA 2WJPA 5CDFE 1Z6GA 2HADA 4C7MA 2XRZA 2AI2A 1VBNA 1IPEA 3VXKA 3PHCA 3WL3A 3ZJTA 5IWAB 2W2TA 3DB2A 1E3QA 1NAIA 3C3XA 1YBAA 2APJA 3IBGA 4B7ZA 1G63A 2HJWA 3RUPA 3VZBA 1B26A 2ZBEA 1Z7BA 5JQWA 3IEXA 5BWOA 1YA8A 1ZS9A 2C4MA 3L7IA 4DJ5X 5D6OA 2J46A 1GCAA 621PA 1CP2A 3FF4A 1WDWB 1X19A 3IRVA 1UMKA 5KOJB 1N5IA 3ORYA 1N2HA 1DKPA 2IEBA 1ZDMA 5KQLA 1JR3E 1NW5A 2ONJA 1BS1A 4TTAA 3FHJA 3R7DA 1M2WA 1ZIOA 4N1AA 3H5WA 3IEKA 4GDMA 3K9QO 2UYHA 1HNXB 2VC2B 1LDNA 1NLUA 3E4DA 1ESDA 3PFCA 4MULA 4LC1A 2VWQA 4R8SA 4RKRA 3UC9A 4EW6A 4F5ZA 1E0DA 2QPTA 3I5AA 4PS1A 1K4MA 2OV8A 2OCIA 2ZRLA 2J0VA 1N33B 2D13A 5CG1A 4AIIA 1AHHA 1BWSA 1ORWA 1H1LB 4OQYA 1G20E 1KAOA 1MNAA 2A2ZA 3THWB 2CLDX 2ZB3A 2GLTA 1CRWG 2I87A 2IU4A 3AJEA 4J76A 4KHZA 2R7MA 2ZJ3A 3SY8A 4UE2A 2FSHA 3ANYB 4F12A 2X7JA 3VH2A 2C96A 4BNDA 3OU7A 2ES4A 5BXYA 2BTOA 5BR1A 3K31A 1RHQA 3QKTA 1FJXA 4MVJA 4RPIA 3U7IA 1U5BA 5JDIA 3C4JA 3GN2A 4HQOA 5LMZA 1EZ4A 1QMPA 5HUHA 3ILSA 1HH4A 4IO0A 1LCIA 3PT5A 2H4YA 4NCJA 3WWPA 4MQLA 3DP9A 4UU1A 1FX0A 1E7WA 1TK9A 3CPEA 1T8YA 1PUJA 3P2JA 4XOIA 4MVCA 3GLFE 2GCPA 3D8BA 3FGZA 3S99A 3LWZA 1OGYA 4J4HA 5AW2A 4BUZA 4QL3A 4H4EA 4N49A 4PBTA 4Q03A 4TUYF 2FZVA 1GZDA 2CYCA 3DOIA 3ENQA 2AXEA 2YC2C 3CX6A 1N5DA 2EZ4A 3QHAA 4NULA 3LQYA 3W2FA 3BXGA 3VYVA 1QH8A 3KRTA 4BLSA 3LOPA 2ZRPA 2ZVJA 3A6ZA 4B82A 3B9BA 1EIZA 1GGHA 4OEHA 3KXKA 3EASA 1FPQA 4OQEA 1TQ4A 2C7GA 2ZYTX 4ZI3A 2PKYX 1QP8A 1P1RA 2X8AA 3EJ6A 3MS4A 4J16A 4ZIRA 2IIQA 2IZ5A 5A4FS 3L2OB 1YZUA 4GI1A 4HVAA 4AK9A 1YGYA 2BFFA 2V65A 3W8DA 4DC1A 5CEEA 4QUJA 4OYYA 4MW1A 5IRCD 1K6EA 1L8LA 3Q0IA 5LYYA 3TRJA 3UMFA 4DZTA 3PJRA 3RH0A 5K8IA 3FSGD 1JZQA 3I42A 3FW1A 2ZIEA 1P1JA 5A5GA 2J6BA 2DUNA 4HNAB 3G9ZA 5FOSA 4AMZA 4BOYA 4YP7A 1Y33E 3JQAA 1YB7A 4N47A 4IJWA 4LQDA 3QX3A 2FNAA 1KQOA 4JLOA 1RRVA 3KKMA 2CC2A 2X4IA 3KDPA 1DAFA 1VMDA 1UFRA 4OHBA 4A92A 3KQHA 3IAS1 3P0RA 2GDJA 1P39A 2ZAMA 1TT7A 3CU5A 1SHKA 1YHYA 1DAKA 2XVYA 1ZNXA 4DMUB 4P7BA 5FPPA 1FL9A 4MV8A 4ZI7A 4CEHB 3UAVA 4E03A 2O0JA 4DE5A 2G9UA 2PIDA 4JUCA 1G8GA 2DJIA 3WLOA 3O83A 4IINA 2AUTA 3USCS 3TJMA 1KVQA 4XPZA 1KR2A 1T5HX 3IE0A 1KAQA 1VYUA 4IZHA 1NVKA 5DTRA 1XRRA 5BSHA 5AM4A 4FZ3A 2FDRA 1Z47A 1JNXX 4ZHQF 3QE9Y 1QTIA 4PS0A 1RU3A 4EH1A 2D7DA 1OWPA 1XEFA 4OP1A 1GCUA 1CR4A 2ZIVB 2ZRMA 4HAOA 4WLFA 1ZEJA 3E9NA 2C5LA 3RSLA 3EQZA 3AZQA 2R751 1SVKA 3VAYA 4D02A 3TG8A 3L6EA 1L5RA 2VPWA 2EF0A 3TPZA 4BQNA 4DCTA 1ADCA 4G84A 4NATA 3TIXB 3I9LA 3W4JA 4AJ4A 4DA7A 1ODCA 1WSAA 1DHRA 2JFGA 5KHAA 4DL9A 1JQJC 5C52B 4BNVA 1KO5A 3KAKA 1OXVA 5F1KA 1L5OA 5JAQA 4UHEA 4HWTA 2CEAA 1SR8A 1FMCA 1OBHA 1XZEA 2X0KA 5J2TF 2JBWA 4L15A 1Z0SA 5F7OA 1ICEA 3KPJA 3TLGA 3TMAA 5C51B 4G1CA 3LYHA 5JXHA 1EXDA 1IOZA 1WMAA 3W2EA 4TMVA 2O2HA 4LUCA 2FFJA 1VE9A 1T1GA 3QFHA 1ZG3A 3GEBA 2OGZA 4CMEC 1CG6A 2O2SA 1H9CA 4EPRA 4LJRA 1Z5NA 5CW2A 4H7PA 5IJ9B 5DP1A 4MRVA 5IT9A 1VP9A 2RGNA 3MGBA 5BVHA 5DN9A 3SQDA 2Q62A 4HQ6A 3WK9A 1PSWA 3FBWA 4FFMA 4V39A 4AAYA 4L4XA 3Q7QA 1DJLA 3GWZA 5KTMA 4FR0A 1QQ7A 5K8UA 5HIIA 1RKBA 3AR4A 3JQDA 4KMOA 2ZS8A 1W46A 4GYJA 4MKFA 3GYBA 3KKEA 4UCWA 4P83A 3NFYA 1NRXA 1IHDA 1RS0A 3AIKA 4L57A 3FYUC 4KI0A 1VHDA 1KNQA 2FZKA 3OLVA 2MYTA 4K88A 4AG5A 4Y67A 2A33A 4DV4B 3ZBUA 2X2FA 3RR2A 1ZOSA 5H81A 5DBFA 1M1YE 1FUIA 2W6MA 4TSFD 4V0KA 4AD8A 4MDEA 2DWQA 4LOIA 1Z4KA 2VK2A 4FFSA 4A8JC 4CMIA 2VJKA 4FI3C 4X60A 2HTEA 2YWFA 3RC1A 2VF2A 3CUUA 3UT6A 2EX0A 3FRHA 4ZAZA 1U4SA 3KDSE 4KK4A 4TN1A 1UBNA 4LBWA 4W9NC 4ZI5A 3OC6A 3TOSA 4G0MA 4HY3A 5EXTA 3RHTA 3MJVA 2VJNA 2ZJ8A 4HGZA 5EIXA 3AR6A 3OECA 1R4NA 2SKCA 1G7SA 1UK9A 1DXOA 4X6UA 5E9QA 4XWKA 3T3NA 3B6ZA 5G1NA 1Z39A 3R0JA 1PEYA 2RHBA 2FA9A 3ES9A 3Q8MA 2WKSA 4ZOLF 1ZZEA 4X8MA 2GA8A 2EDAA 1LK5A 4RY8A 2VA9A 2YWCA 4QIHA 1ZRSA 4Z6KA 5ADHA 5JVDB 3ZHCA 1BKSB 3AERA 3G8YA 2GPTA 3QBJA 5ALYA 3ZDYB 6PFKA 1D7AA 2IYAA 2HMYB 4Z7OB 3VDXA 5CNKA 2AZMA 1C1DB 1OXXK 1HI9A 3FYDA 5CDFA 1NQ5A 4ZAGA 1L0BA 4E2WA 4PZ9A 1HT0A 2QI9C 3QYFA 5HG0A 3CR7A 1E5DA 4Z9BA 3AF6A 2YY6A 4WKNA 1A9XB 1VKOA 1N32B 1D0IA 4B2YA 3TNFA 2ANBA 3EVGA 5IM4F 2F90A 4PC3A 1U0RA 3NIDB 3LT1A 2HJSA 1NUTA 2REQB 1CJBA 1EP2B 1DC7A 3PA6A 3THRA 4A73A 1EUDA 4OLAA 2BLNA 1IOWA 3THYA 2XPCA 1YRHA 4G4SP 1O89A 1QDLB 1M6EX 4PO3X 4LV8B 3BIJA 1H8HA 1U8FO 2IOQA 1SY7A 2MYPA 1F5SA 2B37A 1A9OA 2QTGA 1U02A 2FMHA 2JLVA 4FEEA 2C61A 1RXUA 1KTIA 3QY9A 1R15A 4M0LA 3L1HA 5KUTA 4XJXA 1OA0A 3T5CA 2BSXA 3OZ7A 2X58A 3KXPA 1QR6A 2E3JA 3PUVA 4O29A 1ATIA 3UMYA 5KNLA 3L8EA 2NXWA 3FAZA 4IIJF 1W44A 4PONA 2HA0A 1NY6A 2WSSD 5AQEA 3H5RA 3B36A 3QY0A 5SY4A 1JFFA 3H86A 1DRUA 2O50A 3HZHA 3T12A 5DLPA 3H1PA 2LP4Y 3SEAA 3EXHB 3AILA 1SRRA 3BHIA 4U9UA 1X7WA 4OXXA 3QHPA 1Z37A 3CLTD 1WCIB 4KDRA 5HK8A 1WX1A 2TSYB 3MERA 3VR3D 2BGJA 4ZCTA 1PS8A 1IXKA 4Q1FA 2JF0A 3FDFA 5GM2A 1IN8A 2I7VA 1TA4A 5DYWA 5LB4A 4COOA 3G5MA 4FINA 1KPGA 2IEZA 1GZSA 1ZJYA 1DUSA 3KJEA 5HJ7A 4RJTA 2O5EA 4OMDA 1RQPA 2A9KA 3WB9A 3T0IA 2L82A 3ZHXA 1LTQA 4E2XA 3LFTA 3PKIA 2GK6A 4DYDA 2AOUB 3IO3A 4M6WB 5HHTA 5AKLA 5LQNA 1UDCA 3FRIA 1AVTA 1XZGA 3BM5A 3IYLW 2ACWA 3B70A 3EC7A 4UVIA 5I7SA 4YQYA 4G5FA 2R8RA 1QAOA 4RDHA 3TGWA 1DC3A 2DETA 4X1IA 3DBLA 4CE6A 2ABWA 5BQ3A 1DWUA 1YL7A 3C3JA 4QGAA 1BMFD 4IS3A 4Q3CA 5EZYB 1JLMA 2IV3A 5CUQA 3ZZ0A 2HIHA 4WCDA 2ZXUA 1G9SA 2FOIA 3WGNA 1KHTA 4LZLA 1O95D 5JWHA 2JFHA 4QJ3A 3F2IA 4MIKA 1XRPA 1ZGBA 2GXQA 1E89A 3PGXA 3BD9A 3ZDRA 4D98A 4DCSA 3P26A 1L4LA 4L9RA 1MXHA 1C0LA 2R4UA 4Q9IA 1PWHA 4GI3A 4DLPA 4NJEB 1CNEA 1YRLA 1PT7A 2P3SA 2RI0A 4LHXA 3V3KA 2HY7A 2CZGA 2QYHA 1GAWA 2Y92A 2KI5A 4M83A 2Z1MA 1YZVA 4PNHA 4BPBA 4B43A 2GXSA 3DAGA 2IOYA 4HG2A 3FR7A 4NHEA 3HNPA 3BHNA 2CMGA 3B2EA 1KDRA 4UM9D 1H4QA 1G21E 3COYA 1N7IA 1BC5A 4QU0A 1JQKA 1C30B 1N57A 1YQUA 3M4XA 4JLDA 1AK9A 1H5UA 1Z5PA 5ARBA 721PA 4L4SA 4RLSA 4K2AA 1N6HA 4HRVA 4EKNB 1I6MA 1UDWA 3GUCA 5J2TB 1VA5A 2EFEB 1AZSC 2IYLD 3PP8A 4IMIB 1FFAA 3BILA 4TQUS 5B1HA 2WKQA 5ITVA 5AIBA 1GCGA 3MVEA 2O5CA 4GG1A 1OLXA 4KI7A 1TVCA 1D4OA 1A96A 2YN2A 3GD7A 1YK0A 4DXAA 2E4ZA 3HMQA 4RK5A 3TW8B 1MQ8B 2P9TA 3IVAA 1T5DX 1DKNA 3G8BA 5I8PA 4ZZ0A 4JBWA 4TLMB 1U8XX 1FLDA 3IKMB 3UB2A 1MVOA 5CYGA 5JIBA 3HL4A 5EZYA 1N0HA 2VO1A 4IZIA 1LZLA 3FPCA 3ZQUA 1Z8DA 1U2DC 3FVVA 3ZGVA 4TROA 3TZBA 1W5BA 5AM2A 1AGNA 3RKSA 3OX3A 1N36B 4DMFA 3RLFA 4F93B 1F17A 3NDJA 1ISSA 4IH1A 1DOHA 4JJZA 2R1VA 3KB8A 4H1HA 4NE9A 3OTOB 3ZNPA 2ADOA 4KO4S 1X7XA 4AYXA 1W88B 4GX5A 4G8CA 4YFVA 4YT5A 2DEUA 1VG1A 1RYFA 2J41A 5CB6A 3D4BA 1Y7HA 4Y2QA 1KEPA 1NYTA 5AJYA 1I36A 1ISHA 2XRFA 4D82A 4F11A 1QF7A 2PVCA 1TPZA 1NQWA 1U6JA 2OE2A 4QJIA 4R8LA 5F12A 3E3NA 1JSCA 3FPBA 4G1FA 3Q72A 2QN1A 3ELDA 3ORQA 3WNCA 2AVNA 2I9PA 2W4MA 4AZVA 4CEIA 1SQ6A 1NMYA 1N34B 2PX3A 1KDOA 2IPXA 3CZRA 4Q1CA 2EZ9A 4ZQGA 1LJ8A 2ZLBA 2PUWA 3D5TA 3RVRA 1RC8A 3F1LA 2LIPA 3HWWA 5C3UA 3G5LA 3GGPA 1O97C 1RCUA 4I3GA 4GLJA 2ZE5A 4L28A 2W2OA 2AB0A 1ZD5A 3A10A 2NU9A 3BAFA 3K9WA 4CLHA 3ZDQA 5JTUA 2GM4A 1DC6A 2I7CA 2Z04A 3JASB 4WFJA 3DZFA 3S2UA 3VTAA 4BJHB 2ECOA 2HEGA 3VC7A 2JIZD 2RHLA 4PR0A 3ML1A 4R84A 2W43A 4TZ6A 1M5TA 2JFOA 1QKKA 2JPDA 5AM5A 5G3YA 2XCRB 1Z8FA 2IXTA 3FROA 3K7EA 1Z0UA 5JU6A 2ZR9A 2WJIA 4PQGA 3M6LA 4OL9A 3W2HA 8ATCA 2FWNA 2ZYWX 3FHOA 4TZTA 2GD0A 3LU1A 1H66A 3ED1A 1EFDN 2IS4A 2MSLA 4JU8A 4NDAA 3FETA 1WA5A 4YDHB 5K8LA 4LWPA 3HDQA 4AM8A 1Y8RB 2EJCA 4MLDA 2AMFA 4F3TA 2BONA 4TOIA 4A82A 1A8UA 4B83A 1YQXA 5GOZA 1N92A 4JB3A 2WD8A 3L6CA 1D1TA 3ICEA 2DQKA 3L06A 4RSHA 5IUJC 1STOA 3SMVA 1FTNA 1P9RA 3CVJA 2YIDA 4QSMA 3L43A 5BUCA 3BRWA 1CRPA 4ASUA 4C7JA 3AGPA 3EY9A 5BQ5A 2HLDA 4NI5A 4WECA 4E1BA 3PR1A 1FRNA 4KV9A 1B6GA 3LTEA 3QEKA 2BL4A 3CRZA 3IJEB 3D3EA 1MABB 1CQXA 1RFGE 4G6ZA 1WZUA 3BFPA 3OX1A 1WOYA 1ZI8A 2XQKA 2GCEA 1LV8A 4ZRDA 1DL5A 3FPSA 1I5RA 4PU0A 1MNQA 4YV2A 5KKNB 1I7LA 4HEHA 4DOMA 2E5FA 3RG8A 1A1VA 1PVOA 5CA1A 1MQ9A 3ZHUA 1ABFA 4Q6WA 4RL6A 1KRWA 2OAGA 4HZIA 1AXRA 3AUJB 4I6JA 4JJEA 3NEPX 1NOKA 3AW8A 2FOLA 4WZAE 5LBUA 4ME6A 1L4BA 4EO9A 4WXPA 1KMHA 3ITEA 4XPIA 3I9JA 1SQGA 3TLEA 2X41A 3RU9A 4N6GA 4PN3A 2PGAA 3L8GA 3LY9A 3RM3A 2QUAA 5FWXA 3FNFA 1JJVA 5AM0A 4LSGA 4LBYA 3TRKA 4J0KA 2IUTA 3KZVA 1V4NA 1YDWA 2F6RA 1GNLA 4EKYA 1DQNA 1I1QB 3JQCA 1G4HA 3LP6A 4HXEB 4Y1EA 1BKDR 1EVIA 3QPBA 5KWJA 2Y1KA 4JENA 3QU7A 1YB1A 4Q02A 5KU7A 4KXFB 3LX4A 1RXSA 1IPHA 5I9TA 3UK2A 2N75A 3C6ZA 3NUZA 3UAXA 5BSGA 5JJBA 3A8TA 5M04A 2DQ4A 2FU5C 3CRW1 4BB9A 7AT1A 2QYSA 1CY0A 3F6CA 3SI7A 5J4HA 4YREA 5KNDH 3L7OA 4MINA 3FMIA 3K4HA 4DUZB 4JI8B 4FOTA 4AU1A 1ECFA 3KPWA 2AEMA 4ZT2A 3RFUA 4K05A 1M66A 1RRPA 2GLUA 1KYQA 3H0EA 1BVRA 1YIAA 3N2GB 4ZVQA 5L3QB 1CF4A 3T54A 2IQIA 4IFTA 4RZXA 5AK5A 5LDGA 4CKYA 4EL0A 1JT2A 1DIOB 1KO1A 2Q4OA 1U9JA 2VRCA 1SVMA 2Z9BA 2PZLA 3VVLA 1ARZA 1S3FA 1K7SN 2JGRA 3EXHA 1SKAA 1CQJB 2OGTA 2WHPA 3DVLA 1UJ2A 3QXJA 4QJBA 1M7GA 5BV0A 3RUFA 4P5EA 4J0DA 3BD6A 3HEMA 4DNXA 4JV5B 5DZSA 2NVOA 5K3BA 3N8DA 2JAOA 2ADMA 1E2DA 1JA0A 5T6BA 5IUNC 1LTKA 1VGVA 4RHCA 3OTQA 5TPWB 1QPGA 5TQ2A 3IL2A 2H4JA 3TQFA 2YHIB 3QXCA 5IAJA 3O0TA 1BH2A 3NANA 3WGLA 3RFFA 3TGPA 3NALA 2W6OA 4DDMA 4RV5A 4LDPA 4NCBA 5DIZA 2ZWPA 1T3LA 1YVUA 2HDOA 4UTPA 2C7QA 2ZBPA 4NS4A 3K0FB 4P35A 1P9NA 3QKRB 3DNFA 1LRKA 1V7PC 1E1RD 2FSSA 3MGCA 5CAEB 2H16A 5I9IA 3FTFA 5KJCA 1SO8A 4RA9A 4BCBA 3NHSA 4KCGA 1FQJA 1G3RA 4UHKA 1G4UR 2ERXA 4MVXA 2FUCA 3VSBA 4DLKA 1ZRHA 5KTTA 1X7ZB 1NXPA 4Z3OA 3FDIA 2AKEA 4NAVA 2A9VA 2I2CA 5LFAA 3HJTA 1W2GA 2JASA 4UHCA 3U44B 1P2VA 4HNTA 3HB4X 4P3XA 5HCUA 4G0VA 3A6EA 1YDHA 1W5AA 2G17A 1HE1C 3A05A 3LQ4A 3Q3IA 4EGQA 2CVPA 3L7BA 4F9FA 4WVFA 2QX4A 1N3YA 1BE8A 2W2LA 1Z5GA 1LPAB 2XOXA 4FDTA 1MO2A 3OE1A 1N7JA 4MS3A 5JQGB 4RTSA 3QKSB 3LLVA 2XB8A 3V4OA 4URFA 1YQWA 3OM1A 1T9KA 1TMOA 3QHQA 3OFSA 4NBNA 2J1LA 4D6XA 1P75A 3EGDA 1YS4A 4Q4HB 2ZIGA 3MTBA 4M99A 4F6RA 3MRXA 5GY7A 3TRFA 1OYWA 1E61A 3F7TA 4D44A 4Z3KA 5K3EA 4R68A 1FJHA 2D3TA 2IPMA 1UPCA 1VE6A 3C7TA 3N2LA 2OOSA 5JD5A 1T1EA 3EPPA 3JQAB 4MB2A 3Q7IA 3STVA 4E4RA 1R0LA 4O4LB 2FP3A 2P2GA 1JKJB 2H9IA 4S1NA 2OKGA 3I0ZA 1DG3A 3HQ4O 2WINI 3PLRA 2I4RA 2PSEA 1I0IA 2YWRA 1T5IA 3R3HA 1G0OA 2IP2A 4EMTA 5K4GA 2BFFB 4KRYA 2QE7A 3JS5A 1CQIA 3FZQA 3W3AH 2D5IA 4WBXC 2Z9DA 4RE6A 1CEXA 3SF0A 1IEVA 2VCYA 5EKDA 2ODBA 3E3AA 2ENUA 3UG6A 4B84A 4TTVA 4QYXA 4ENPA 5IASA 2TS1A 4V02A 1F2DA 3ZC3A 3N2NA 4JT2A 4F3NA 2AUNA 3ZDZB 3EGVA 3GCDA 3VM6A 1U4NA 4ECAA 3Q7RA 2RH9B 1NVDA 1GTZA 4XB1A 4G23A 3C3KA 3CE6A 5REQB 2JK1A 1AMNA 1ZOPA 4IF4A 2RAVA 1XMJA 4GR9A 1PDWA 1Q7BA 2R7AA 5H5JA 4B6OA 5I01A 1ZGAA 5EHQA 1W85B 3ZWXA 4DB2A 2GCOA 3ZE2B 2I6XA 2P90A 1E9SA 2QS9A 1Z6AA 4MJLA 2M9MA 2FSVC 1IPFA 3D0QA 3FIJA 3NORA 1AY0A 2V3WA 3O8OB 4CM9D 4KN8A 2JIMA 1WBJB 3E2MA 3PRJA 1JAXA 2PKCA 2RGAA 2OYSA 5HJ5A 2MSEB 1THMA 1UH5A 2AE2A 2COEA 2NZYA 4RIIA 1HLPA 3AEUA 4C2BA 2OBBA 2Q29A 1SVIA 3OKFA 1Z33A 5FV7A 4X62B 3ZGYA 5ABPA 1CZOA 5BR7A 4LSMA 4MV0A 4C0KA 4ZT4A 1DAEA 4O2BB 5IAOA 4J29A 4N7JA 2HV9A 2WD9A 1CR0A 4F4IA 4Z2YA 4MW2A 1YV9A 4RF2A 2V97A 2O8EA 3PFFA 4EG1A 3R3YA 4OLBA 1TD1A 3CPHA 3NC4A 4HRYA 3ZD9A 3PDIB 4IZ6A 3ZXIA 3HFRA 3OU2A 3JRXA 2F1KA 2C4WA 4FPXA 1H2YA 5CT5A 1Z8NA 3ZBTA 3LDFA 3GLGA 3A2LA 2FN7A 1RJ9B 2O06A 4IOJA 4ZEOA 3D4IA 4IY1A 1EUZA 1PE0A 3FPJA 5DSTA 4EABA 2X8JA 2Z6UA 2G5CA 2X5NA 1TYDE 3QJ5A 3OKPA 3ZIUA 1EXVA 2RBEA 2XUPA 2W6QA 3MJFA 3CEHA 5L51A 4ER3A 2RGNC 5I8WA 5GGXA 1BD4A 4R5MA 2ZR0A 1PGJA 1ISIA 4U00A 1ORDA 3H9JA 4FGKA 1G5IA 2YINC 5ALVA 2ZRHA 1KMQA 3HXKA 1JLLA 3UFBA 3UT5A 3WK5A 3IH5A 3A6FA 3K9NA 4S3MA 4L8VA 2Z08A 4QULA 2DZDA 3ENWA 1DB3A 1V1RA 3BTOA 5JXGA 3JQ7B 1HNZB 3RYTC 3RVQA 1QWOA 3RCBA 4J3NA 3TFWA 3CG0A 4HTFB 3OCVA 1SCAA 4Q3OA 2VN8A 3ZE6A 3KWMA 1L3BA 1QLHA 1Y6QA 3F8WA 3SDZA 3M9XA 3DM5A 1A9SA 3CSUA 2BI8A 2O7NA 3E0XA 4QZVA 3W6OA 5AHWA 2CHEA 1KVRA 1MXFA 2DOKA 3PE6A 4AQDA 3H5AA 4OUDB 3GT4A 1F9EA 1ZRMA 1HEYA 2IEIA 4J0IA 5AH0A 3VHRA 4HFJA 4HAUA 3HHPA 2QUIA 1VIMA 1XAGA 3SJCA 3RYHA 1DWQA 1KOJA 3ABOB 1SG6A 3DZHA 4EMSA 4CQLB 5DYIA 4C5AA 1FUKA 2QE7D 2R8PA 4JI6B 5JECA 5KVSA 2FAXA 2V5AA 1JF8A 3B1XA 2AZTA 3QE4A 3L7LA 4B34A 1KOLA 2FGJA 2H65A 5B58C 1VJTA 2O14A 1TGYA 3RVKA 8OHMA 4R1LA 3ROXA 2CXTA 1LB1B 3QVVA 4XSVA 4DZRA 1CW2B 1M6HA 1VI6A 3KCNA 4JP2A 3LX5A 1P2UA 3U7FB 1HX7A 4K6CA 1RXVA 1JKJA 2GD2A 4BNGA 3SR4A 3I04M 4HYQA 1ID8A 1EE1A 2XTZA 1PTJC 4G09A 4FJ2A 1SKYB 2ZRFA 3M4NA 3IV6A 4V0ME 2QRVA 4A16A 2ZSBA 1I7QB 3TKAA 4WJKB 1DTWA 2ROQA 1K92A 4LXHA 1EVKA 2YDXA 4I1OA 4BIMA 1DIGA 2C54A 4OYRA 2XW6A 2WWXA 2GJAA 4LQ4A 3B5EA 4AZ3B 3VR4H 4GYKA 3GELA 4FGUA 1AKTA 2CJYA 4R40A 4RFSA 2ZYGA 1Q1GA 1PR6A 3QKSA 4GBED 4I7EA 2FW7A 5DHSA 1I4LD 3WX0A 5AM3A 2CNLA 4LSZA 2GWRA 2W71A 1L5KA 1YZ3A 1FSGA 2QAGA 5DW0A 4D9JA 4S05A 1XP8A 1CRZA 2K87A 1CZHA 4E0BA 2DJ5A 5IK2A 3KAJA 2FVYA 1CE8B 3JD0A 5FCDA 4JJ7A 3AXTA 3E23A 3M2TA 4A3SA 3VUFA 2WFMA 4LZOA 4DJJA 1YQDA 3WLPA 4UXHA 1KYYA 4OXQA 2JATA 1YT5A 5BV1A 1YA6A 1JKMA 3EGEA 5B36A 2QZZA 2VBGA 1ZWKA 5A0TA 3OZWA 3S28A 4M9RA 1T1RA 3MA0A 4LJ6A 5BMVF 4MMYB 4O3MA 1R64A 1KORA 2IL1A 3FDZA 5KTYA 1Z74A 4L3OA 2Q9BA 4OJKA 3FOWA 521PA 4ZICA 3F49S 3AU9A 4OQ4A 2FMKA 2IU3A 2IVZA 2C92A 3IP7A 2WTUA 1A8PA 3CUSA 3QVGA 2W6JA 5L7YA 4KB5A 4WOBA 2VT2A 4CG0A 4YDQA 2D1YA 3KQWA 1OB5A 4JT8A 4OVKA 3TLKA 3AP2A 4BBJA 4DR7B 3I2IA 3OQJA 1Y7LA 4UD2A 4PZ0A 2IXBA 2W2KA 3SG0A 4FFDA 5FB3A 3PEEA 4RGVA 1NDQA 1G41A 1NI4B 1Q92A 2HHLA 3B7PA 1KL7A 3QQPA 4I46A 4Y6QA 1U1FA 3HYNA 3QW2A 3V9PA 3HXLA 2P6MA 1TT5A 1GRVA 1EM8A 2X9LA 3PGVA 4Q24A 4E5PA 1E3SA 3AX6A 4JSRA 4PXSA 3OTWA 4S1WA 4Y2XA 3ZXSA 1IZYA 1VSVA 4ZYZA 1CQIB 1V6SA 4B74A 1FNNA 1UXIA 1J8DA 2ZYHA 3DAHA 4RF4A 3T7SA 3ZWCA 2PNFA 4CGZA 5DM0A 3E8MA 1PL6A 1MDBA 3M3DA 4ID3A 3UHPA 3WLJA 4F4CA 5HKLA 3K0AB 1YCFA 5IH3A 4H3KB 3BSYA 2R1ZA 4AROA 5KVAA 3HVJA 4IOKA 1Q2UA 4AJIA 3C3YA 2YC4C 5DCYA 5TS3A 4BGVA 3VR4A 2OGUA 3DP7A 3LT4A 3BWYA 4KH0A 1VE3A 4HSGA 1U7HA 3MLBA 3PXGA 2CLOB 4L95C 3DV9A 2HQRA 3ZQKA 3PSHA 1RJFA 2P6OA 4J0GA 4POOA 3X1ZA 3HRKA 1MCZA 4GHWA 4XSHA 2V3CC 1KJZA 2CK3D 4NCHA 4RXTA 3H0KA 5IPFA 1E63A 3EDCA 1U0GA 3HKEB 1F2TA 4FS8A 1TYCA 3AUKA 4JC0A 2OXIA 4BNYA 1FRQA 2Z8YM 3A3YA 2JFXA 5L7WA 1SZJG 4J2TA 4XEUA 4Q3EA 3IBTA 3PITA 5JJLA 4BVGA 4PTZA 4UVDA 4KXLA 1JHUA 1XRLA 4C2AA 4UATA 3OG9A 2G9NA 1N2BA 4LOHA 4INAA 3ZS9A 1DRVA 3ZI0A 4C21A 2HV8A 3V4ZA 4D4LA 1NNUA 1Y7TA 1R8JA 1T4CA 2VJDA 2H4HA 3H2BA 3OQMA 1BQ3A 1F2UA 4HL6A 3FUWA 4DM7A 1TU4A 1LF5A 3PRYA 2DQZA 5C7IO 2R7NA 2VF5X 1Y9AA 1NU6A 2Y1XA 1AHPA 2J9GA 3KKPA 4O3FA 1VL1A 3NBYC 4F71A 2A0KA 2WVGA 2ZJZA 4I5IA 4QRDA 2Q5IA 3UH0A 4HQ0A 5BSKA 4A9AA 1QRRA 1J2JA 4QEKA 3L1JA 5EWLA 3WKEA 2NPIA 5LMCA 1HKUA 1S8OA 2PFKA 3SPXA 1P7ZA 3QLUA 1YL5A 4BBPA 3TVTA 5DHRA 2ZVPX 1SD2A 2VHTA 1TIBA 5JNRA 4Y9UA 5KMGB 4G41A 2HJGA 3OOWA 4OK3A 3TPCA 2C59A 3OOJA 5C46F 2HM7A 3LBIA 2WYUA 1ZU4A 2VBFA 2AMLA 5IAEA 3EEYA 1I2DA 1CHDA 4KUGA 1QGDA 2I3DA 4MWDA 4UAUA 5AHXA 4BFUA 3TR6A 1F7UA 4BBZA 1QJ4A 1T2DA 2NT3A 3Q3GE 3TZQA 3X44A 2BYTA 1MO6A 4KIGA 2ZIUB 3LWBA 4A91A 1JVBA 4DLSA 5K9ZA 3CF0A 4ZJZA 4MR8A 1JWLA 1J0EA 1K2WA 1WZEA 3RJTA 5KOJA 5LU8A 3FY4A 4FQ5A 2V98A 3C3DA 4YAGA 3KB2A 2AFVA 3VDMA 1PKEA 2ZIWB 5JLAA 4QFBA 2QD5A 1U11A 3SVLA 4BP9A 2PUEA 1Z4QA 4L9SA 1R3UA 1D04A 2ANCA 4A4DA 1C7JA 1X9GA 3A1UA 2EFJA 1CIJA 1US8A 1KWGA 3ZJUA 2JIRA 4BNMA 5LZ9A 3B13B 3I32A 4KDFA 1W5SA 3FYTA 2XEXA 2YBEA 5JS6A 3JWHA 4K9NA 3U80A 2EEPA 5JT1A 1GM5A 2CXHA 3NP9A 1WXFA 4KBFA 2DT8A 1A4XA 1ADFA 3DE1X 4HB4A 1AKVA 3WK4A 3ZLVA 5C1PA 1N0VC 1K3TA 3I6MA 1M2NA 2E9SA 4FHZA 1PJ4A 2BKUA 1Y1RA 4M21A 5DDIP 3VNAA 3ZDDA 4UUNA 5BNTA 2AG0A 1SXJB 3MJ4A 2OXFA 1PG2A 2Z2ZA 3GY0A 3H8WA 5CLIA 5EP3A 4Z0TA 4BEJA 4DPLA 1H4TA 3IP1A 1CT9A 1SWVA 2EBFX 3C15C 2L69A 3WQRA 4Q4HA 3GC6A 1Y6JA 2Q0XA 1U2QA 3SD7A 2QU7A 4N9WA 1OFHA 2XNCA 4KDEA 1BJKA 1N9GB 4I9HA 4B7CA 1KIMA 4HB3A 2Z83A 2UZ0A 5FD8A 1T10A 5AUQA 1U0SY 4WBSA 1RM0A 1T5LA 1FVFA 2BV3A 2Q3CA 3ELYA 4GP7A 5CNMA 4LRWA 2H2IA 1PR2A 1A69A 3AI3A 2WD7A 4MW7A 4R01A 3RIYA 5GOTA 3G8DA 2Z4RA 3OKAA 5JDIC 5DT9A 1F0YA 1QZ3A 4Q4AA 3D2AA 1AZTA 4TUYA 4Y2HA 5LNK6 5AOBA 4D45A 3VPFA 1FFCA 4CU5A 1Z25A 4BXOA 1P4HA 1ZN2A 3WAKA 2O48X 3JD2A 3WMXA 3AKZA 4I1UA 2IDMA 2PT5A 4H1WA 4P93A 2GAOA 4ZT7A 1CIPA 4A26A 4H6PA 1PL7A 5LWHA 2QPOA 4ZO9A 4J0EA 3O92A 2FZ5A 2VJPA 3FDXA 3AP1A 1PI3A 1RD4A 1RXIA 3FKSA 3CEMA 1WDKA 3QVKA 4JK3A 3W2TA 1P60A 2DFDA 3VR6H 5EE3A 3R23A 4MYTA 5D3ZA 2I4TA 3EVFA 1F4VA 1UPXA 2QLMA 1J0XO 4DWOA 3UMJA 1DO0A 3GBVA 3MS2A 3IKJA 1GRRA 1OBCA 3OOHA 4CEJB 2JLCA 2MINA 1CLUA 1UAAA 2RE8A 1E0SA 1VL0A 2P2DA 5A71A 4PSDA 4EA9A 3IQZA 1EBBA 4KHPB 3OZBA 3I5MA 1E6LA 3QRWA 4NXNB 3F8SA 4GO1A 1EDBA 4MMZB 5CBKA 5LB2A 1Y8AA 5B4UA 1XXHA 3MGGA 2GN1A 4DMHA 3SWWA 4P3NA 2WIBA 4I5EA 4LRUA 4E4TA 1JA9A 3N2EA 1HO3A 4NJEA 4ZYXA 3AMVA 1Z2CA 2VDVE 1QX4A 2ZTLA 3U9LA 3KXDA 4HZUB 3E18A 1E5LA 2GARA 4YRQA 4RZQA 4RTJA 4LVNA 3KFLA 4HMOA 4QBHA 3OCWA 2C31A 3D6AA 2W93A 4X8OA 1YRWA 4DW8A 3VYWA 1ILWA 2R6FA 4UNSA 3KU1A 3LECA 2NSLA 1NLYA 1G64A 1OE0A 3WGGA 2YFQA 1PSDA 3KX2A 5A7GA 3JQ8A 1KQPA 2X2PA 2Y0EA 2AOXA 1UMDB 1XPUA 5DCLA 3CJTA 4J1NA 1UPBA 3LHFA 1RXEA 3WL6A 2BFBA 2WNHA 3HEBA 4F5WA 5HKKD 3BOSA 3FDJA 3RUEA 2R2AA 3THSA 3GJ7A 2BAGA 4JJ6A 1EFAA 2C2KA 4O5AA 1SBHA 2W2XA 1WVMA 2Y2UA 3IOYA 2AN9A 5ALFA 1U0LA 4PRYA 2CCGA 4JUBA 3HJFA 1MVNA 1B76A 2JCYA 3D8HA 2Z2KA 3IXMA 4H3VA 2OHIA 4IZOA 1DAOA 5CH3A 5BN5B 3SOZA 4E21A 1JLRA 4DILA 1Z4NA 1J07A 3DCNA 2F9MA 3AHHA 3M4ZA 1KJYA 5BORA 1XZCA 4FZRA 3N8GA 4BLPA 3IP8A 1EX6A 3KZXA 3C14C 2BFDA 3MJSA 3H7AA 5DX8A 3KVOA 1RI3A 2QX6A 4ZHQA 5KTOA 1WQ3A 2VR1A 3FFBA 2QY9A 1F3OA 2Z98A 1ZK4A 1OILA 2LZ0A 4EKDA 1WJGA 1MKYA 2AUMA 3L4EA 4HLUA 1PFUA 4OHOA 5DEOA 3GFTA 3BXFA 4M60A 3U1VA 4B1FA 4KAXA 4BO5A 2ZSEA 2PH3A 4Z3DA 2QF7A 2JAUA 4YJ2B 2DQSA 3TW8A 3U7JA 4DIMA 3OAAD 2ZDGA 2XB6A 3FSEA 1YR1A 1ZGJA 2PAFA 5DNWA 4GLFA 1RACA 1P91A 1I3NA 1KY4A 2WQZA 1CY1A 5HE9A 1U7UA 3PD1A 1BIFA 1XNRB 1DKUA 2H5JA 5JYCA 2WLTA 3RT7A 3TX6A 5AVWA 3KIPA 2IYXA 4WUTA 3IAM1 1Z0IA 2A4MA 2BJVA 1SVUA 2YZ7A 2ZBUA 4YRPA 3K6SB 4DSTA 5SV2A 2FMFA 3V32A 2Q3FA 4IGAA 4EY6A 4BWVA 1V3VA 3ROEA 3ZIAD 1GZ7A 3STHA 4DBLC 5HRUA 3TECE 3LT2A 3IMKA 2WHEA 5DBGA 5FL7D 1KSGA 1E60A 3FHTA 3CH5A 4TYQA 2CFOA 1SD1A 2J0QA 4A8TA 4WDRA 2B34A 2FW9A 5IU6A 1IB6A 3AHGA 5KQPA 2FDCA 2G08A 3BUSA 4LXQA 3OJWA 3EGXA 3SJZA 2PMCA 1ACJA 2CFIA 3OD5A 2V6IA 3AFHA 4B3XA 4J4TA 4S24A 3E3OA 2QTAA 1YOVA 2B35A 3KK0A 5BRNA 1WWKA 2UXBB 3WBKA 5F9HA 3DVAA 4KXWA 1PCXA 1NG1A 1ZUIA 1QGAA 2XR1A 1NVWQ 4KGDA 4XR4A 2GBFA 1PFGA 3VYSB 1VQ1A 3IALA 5EZ5A 1XCGB 2I2FA 3U48A 1RNLA 5DE3A 3RT9A 4JI0B 2A5YB 3TSCA 4U9IS 3E7FA 1Z7GA 4TS9A 4O4IF 3K8OE 4AICA 4XSGA 1K8XB 1KP3A 3EH2A 1PO7A 4F8YA 1TVEA 1CTQA 1RCFA 1YB2A 3NW9A 1ONPA 3N8HA 1C4WA 1ZD4A 4LA4A 5CHEA 3WGHA 3B12A 1NM5C 3OQ6A 2HPHA 1J0BA 1GA4A 2BBOA 1SUEA 2B5OA 1EFLA 4REQA 4OK5A 2VQEB 3GARA 3WV4A 1RPNA 4RK6A 1EUCB 3MINB 1B1AA 4WFKA 2QBYA 3OP1A 1G1AA 2Q6LA 3SJ7A 1KYWA 1L4EA 1RYZA 1TI7A 2J6CA 3KL2A 3OA2A 4KX5A 5HF6A 6AT1A 3R3VA 2W42A 4PX5A 2Q2OA 1QQAA 5CRIA 1Y9ZA 3RYCB 2WHQA 5DV9A 5GJBA 3F6PA 2FW6A 4WNCA 3T3MB 2GA9A 2BGTA 2Z2YA 2JBAB 3GF4A 3OWXA 3GP5A 1H0RA 2A0FA 2JLSA 4PZEA 4WNAA 4TZ0A 1P17A 1JHVA 1LXCA 4XXHA 1E9FA 3ZLBA 2IKSA 3OPYA 2I54A 3QUCA 2PKEA 1GXSA 4NLLA 4FZVA 4CF7A 4P0PB 1X38A 4AKTA 2OCXA 1W94A 3AVYA 4Q3LA 2YMQA 1TM5E 1GU0A 3PGA1 4A5OA 3A4NA 4CG3A 3DOHA 5SZIA 1EG7A 5JH7A 3P2OA 2FK7A 3ZS8A 1F6WA 2CYAA 4RFLA 1K5HA 3UYLA 3Q98A 2P8JA 2Q6TA 3LV8A 1VYTA 2KLHA 1U99A 1OGJA 2VSNA 4LYAA 4IIXA 3FCAA 2X19A 1XOIA 4X7PA 4L5BA 1A76A 1ZMOA 4CT5A 1UXJA 2AR7A 4NP6A 5EE1A 2WYIA 5MFPA 3JW8A 2C7PA 2VCEA 3ZTYA 1QOQB 5KOYA 3ABZA 1C80A 2F67A 4IJVA 3AYXB 2CSUA 3ED5A 2VTBA 4DV7B 3C39A 4ENWA 3ZVKA 2KBFA 1A9XA 5F3WB 4B87A 3C6KA 4WBNF 4D0RA 3MPUA 3NAGA 4JSTA 1ENZA 4TRRA 4JDPA 3RVJA 4QBIA 2XMSA 3DCYA 4PW0A 1GDTA 4C4YA 1XYGA 1QZTA 2QI9F 2WUGA 3G3EA 3IURA 4IV0A 4NZOA 4Q3BA 4GDFA 2YS6A 1CR1A 1GZ3A 4MR7A 5BN1A 4KEAA 1QTRA 4QEDA 5JAPA 2NW6A 2HSEA 4JA2A 4ZVSA 3VO8A 1Z45A 1P7YA 2F43B 3ZHTA 4C7BA 4EUNA 5AQ1A 3HI4A 5T3YA 2ID7A 1R16A 2CXRA 1JFLA 3FSGA 3ZXUB 4CKEA 2R97A 5AKHA 3AUUA 1Y34E 4TMWA 4CLXA 2FWJA 4CLOB 5KVVA 2ILTA 3IB3A 4O4JA 3FRJA 4YT8A 3PNPA 1WOMA 2REXB 4IDFA 2WE7A 1PJ3A 5ER6A 5J4VA 2D5BA 5I7OA 1H69A