1Z8GA

Crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
Knots found
sequence length
369
structure length
366
Chain Sequence
EPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGAAGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine protease hepsin
publication title Hepatocyte growth factor is a preferred in vitro substrate for human hepsin, a membrane-anchored serine protease implicated in prostate and ovarian cancers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 366
sequence length 369
other databases KnotProt 2.0: S -31
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF09272 Hepsin-SRCR Hepsin, SRCR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8gA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8gA03
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 1z8gA01
3ODDA 2QXIA 1P2KA 1XKBC 3MU1A 4X8TH 5DP8A 1CVWH 3RUOA 1S83A 4DVAU 1AY6H 1GHBG 3RM2H 1EAWA 3TGKE 4YOGA 1HIAB 3DUXH 2FTLE 1O3KA 3FZZA 5HGGA 5DP5A 2ZFTA 1GJAB 2GCHF 1VR1H 1KDQB 1C5TA 3MU8A 1HGTH 1FUJA 4DGJA 4O97A 5A8ZA 3BIVH 3UWJH 1TNLA 3SOSA 2FXRA 4RKJB 1FXYA 4KTSA 3GICB 1SQOA 4JZFH 4BAHB 1LMWB 4CH8B 4WH6A 4H6TA 2GZ8A 1GHXH 1Y3UA 1V2ST 3ESTA 3SJ8A 3UFAA 1CHGA 1O3LA 3T27A 1TA6A 1AB9B 1SL3A 2IN2A 2PW8H 4FVBA 1O2NA 1GBEA 4BNRA 1ZSLA 3SUFA 3ATMA 4OS5A 1CT2E 3RXAA 1UK2A 2OC0A 1KLIH 4CRDA 4IC6A 1KY9A 1OP2A 1T7CA 3UQVA 2BLVA 1GCTB 4O3UA 3GY2A 1PFXC 1O5EL 4JZ1A 1YPLH 4AB9A 1QJ6B 2WUCA 1GJ7B 2A5AA 5A0AE 2PUXB 1GDNA 2A2QH 4VGCB 2RG3A 5DO4H 4NCYA 1T31A 2FX6A 1GL0E 2R2WU 4IGDA 2CN0H 4FUFA 1KXCA 2ZGJA 2G00A 1HPGA 4WVPE 1GJ4H 3QUMP 1GMCF 1FPHH 2O9QA 2BD4A 1MKWK 4Q2KA 1EOJA 2VIWA 4CHAB 4H4FA 3GYLB 1OWKA 2PKSB 1OS8A 4O03A 2BX4A 2A5KA 4XBDA 2TIOA 1JRTA 5A8XA 1QCPA 3O8RA 4D9RA 2A4OA 1EX3A 1SGFA 3A7WA 4I8HA 2TBSA 1SSXA 3M5NA 1QY6A 1ZGIA 2OLGA 4DY7B 1V2UT 4E05H 2H5DA 5G4BA 3I77A 1O37A 2WPIS 1UVPA 1IQFA 1TONA 1W7GH 1A5IA 3K2UA 1F0RA 2RDLA 3E6PH 1GPZA 3SI4H 5LPRA 1H8IH 5DGJA 2VGCC 3OTJE 2ZDNA 3A8CA 3BV9B 2Z6BD 1P0SH 5FAHA 1CGJE 3RU4T 1TX7A 4YOIA 3MFJA 3M5OA 1V2KT 1OX1A 3VXFH 1C2KA 4X1RU 1O34A 3FAOA 1ZPZA 1HFDA 1A3EH 1AWFH 1GI8B 4Q7ZA 1MQ5A 2H5CA 4SGAE 5J4QA 4A92A 1O2PA 2Q1JA 2J95A 2F83A 1LVOA 4KTCA 4HTCH 3TGJE 1Y5BT 2BVRH 5TCAA 1O30A 4B2BA 2A31A 2B9LA 1B5GH 1MD8A 1FPCH 4DIHH 1IQEA 3SNDA 1C1WH 5AHGH 2WPJS 1HBTH 3SJ9A 4IMQA 4ABIA 2XNIA 1OPHB 1G32B 3HGPA 4UEHH 1TGTA 1ARCA 2J92A 1MU8B 3FFGA 1L1NA 1TMTH 8KME2 2A7CA 1TNIA 5AFYH 1RTLA 1AVGH 3P17H 2J4IA 2WYGA 3RXFA 1SOTA 1KTSB 2XBVA 5E2PA 2A32A 3SU1A 3VB3A 4KTUA 3UIRA 2AMDA 2STAE 3RXLA 1XM1A 2CHAC 4UFGH 1HCGA 5I46H 1ELBA 3U69H 1MQ6A 4FVDA 3SV6A 3KQDA 4IN1A 2BMGB 4PROA 3F9HA 2Y5GA 3RXHA 3U1IB 3QGNB 1HAVA 3RXUA 2F91A 2FOMB 1GBAA 5F8TA 2V0BA 5EQRA 2FOEA 1A5HA 2FM2A 1SGDE 2Y80A 3EA9A 1EQ9A 5FX6A 3M7TA 1TGSZ 1BBRE 1ZSJA 1BRCE 3B9FH 2ZU4A 1P06A 3OX7U 3EGKH 2NWNA 3ZZ5A 2RA3A 5DPAA 1DX5M 3M5LA 1VCWA 2FMJA 2Z9KA 1SGIB 3SQHE 1DSUA 1HAZB 1NO9H 2XYAA 3BTHE 2HNTE 5BPEA 1FN8A 1OOKB 2FLRH 3DA9B 1C2LA 1ELGA 1EPTA 2OTVA 1ELEE 2P16A 2OUAA 3K6YA 4Q7YA 1SB1H 3S9CA 3SHAH 4ISOA 1TBRH 4MPUA 1QB6A 1BDAA 3E8LA 2F9PA 1IQGA 1HJ8A 1AUJA 1TGNA 2WUBA 3BIUH 4DJZB 1O2KA 3C1KA 1C5XB 2CXVA 1BB0B 4K1SA 5EGMA 1ZR0A 1X7AC 1HDTH 1OYQA 5CE1A 2ANKH 1O2LA 1SLVB 2ZI2H 3RP2A 3UNQA 3AAUA 4INLA 3K65B 2BD5A 1C4V2 3SV7A 4YM9A 2WV5A 1E38B 4JCNA 1BBRK 1FY3A 1O3CA 2XXLA 4QT8C 2CF9H 1BTUA 2ILNA 1WAYB 4X2YA 2QF3A 1MKWH 5C1XA 5FBIA 3LDXH 3GY4A 8LPRA 3QZRA 4O9VA 4JZIA 5LGOA 1S81A 1RGQA 1DE7H 3KQBA 5EXMA 1GHWH 4ABAA 2ZPRA 2DE8A 3E1XB 3MNBA 1P2QA 1BUIA 2VU8E 1CU1A 1O5AB 1TOCB 2F9UA 1C1NA 1HIAA 1Z6EA 2ZGXH 4BTUB 4XBBA 2BXUH 4BXSA 1SI5H 3PO1C 3T2NA 2FS9A 4AFUA 3LGVA 1GVZA 1KDQA 1ZTLA 1P2OA 1WQVH 1W3CA 1QQ4A 4A1VA 2Y7ZA 2BDBA 4Y76A 4K3JA 2XWAA 1C5WB 1GG6B 1ETSH 1FNIA 2P93A 4DG4A 3L3TA 4HZHA 2GD4B 3BTEE 2XC5A 3TK9A 2XBWA 1GCDA 2R3UA 3Q76A 1AIXH 2HRVA 3LU9B 5EOKA 2JOPA 3LONA 2ZQ2A 3MWIU 4ZKNU 4B75A 1EP6A 3Q3KA 3BF6H 4NSVA 3SUDA 1OWEA 5HM9A 6CHAB 1EATA 4NIYA 3U8TH 2ODPA 2P3TB 1RFNA 3RXSA 2OINA 3TH2H 1A0JA 1AVWA 1B0FA 5GXPA 1DWCH 1FDPA 2OTTX 2UUYA 1O2XA 2SGEE 2VIVA 7GCHG 4NWLA 1N8OB 4K5ZA 3BG8A 3SU3A 1PQ5A 3ZYEA 1FY4A 4MNVA 2FODA 3NWUA 2ZDAH 2BLQA 2Z3CA 3MHWU 3PLKA 2PKAB 1CT0E 5CHAB 3S0NA 1P3CA 3GCHC 2G51A 1GI3A 7KMEH 8ESTE 5L2YH 1W0YH 2PWXA 2WV4A 3LPRA 3T5FH 1E35B 3HGNA 2M5TA 1A0LA 2O8LA 2UWPA 1TBZH 3E90B 2V35A 3QZQA 2FI4E 1GGDC 1OP8A 1GI0A 5JPMH 2GX4A 3L6PA 4I8LA 3BN9A 3QO6A 3ZVGA 1P12E 1PPFE 3VPKA 5T6GA 1C5ZB 1DM4B 2YNAA 2ZPSA 1CSOE 1ARBA 2ZC9H 3P95A 3BTGE 2JETB 2NU2E 2O8WA 2BDGA 4X2WA 2A4GA 3ZZ8A 2BTCE 1NS3A 3QWCH 5F03A 1SGTA 2C90B 1K2I1 1O36A 3QN7A 2V6NA 3W95A 3BTDE 1HAIH 2QXHA 1KSNA 1HAYB 3RXPA 3EE0B 1EKBB 3KQCA 1OSSA 1TLDA 1V3XA 1SVPA 4GPGA 4ZXXH 1BJVA 1HXEH 1L1JA 2A4QA 3U8RH 5E0HA 3F9GA 4NIXA 2FS8A 2PHBA 3A88A 4OS7A 4X1NU 4J2YB 3HKJB 1BT7A 3UOUA 3PLPA 1FZZA 1WV7H 2ZHDA 4LZ4B 3A81A 4FUEA 2K1QA 3ITIA 1GI9B 1HLTH 3QTVH 1AGJA 1XX9A 4U32A 1Y5AT 1LHFH 1OXGA 1C1TA 4XOJA 1Z71A 1Z8JB 1SMFE 3LJOA 1BMMH 3OU0A 3URDA 4AORA 1TPSA 4X0WU 1GVLA 3P6ZB 3NPSA 1P01A 1BRBE 1G3DA 2G55A 2I6SA 4D7GA 1ZPCA 1LPZB 2W3KA 1HAVB 1GJ5H 3GDSA 5A09A 3SQEE 1XUKA 2ZHFH 4BTTB 3TJOA 1B7XB 1YYY1 4A1XA 1FONA 1GJCB 4X8UH 3B23B 4B1TA 3F9FA 2ZIQH 3MYWA 3BSQA 1DVAH 2QV1A 1GBIA 3URCA 2BLOA 1SGQE 4GVUA 1NFXA 1ESTA 1UVSH 4GLYA 4ZHLU 5H4IB 1XUHA 3EA7A 1BIOA 1V2NT 1QJ1B 1BTWA 1O2HA 5AVDA 1IQKA 4AOQA 1FJSA 3MU5A 2PUQH 1SLWB 1ZHRA 1DANH 1BBRH 3JZ1B 2RCEA 3R3GB 1XVOA 4UDWH 1W10U 1CBWC 1O3FA 5JBAS 3RMNH 2FEQH 1ESBA 1NTPA 2G81E 4AB8A 3HPTB 4TYDA 1FY5A 4NA7A 3FP8E 2R0KA 5DP6A 4CRAA 1LVYA 5ETXA 4TWWA 1O33A 3BEIB 5F8XA 4D8NA 2QXGA 1NESE 2PGBB 3SJKA 1K1JA 1EAXA 3GDUA 1SQTA 4UFEH 4X6OA 5ESTE 1YPEH 1BTZA 4INKA 1WU1A 2HLCA 1QL7A 1YKTA 5DP7A 5E0JA 1YCPM 4FUCA 1GJ9B 3SJIA 1QL8A 2TGDA 1TQ0B 1OWDA 1LVBA 2GKVE 1GHAF 2ZNKH 4WWYA 2Q6FA 2HPPH 3H5CB 3V12A 1O2WA 2VGCB 2ZHWH 5FXLA 1YP9A 2BVXH 1BHXB 3EQ0H 4ZROA 3TGIE 1K28D 1VGCC 1QHRB 1TPAE 1JIMA 2Y5FA 1LQDB 1N1LA 1VZQH 2GVFA 3UREA 4ZMAH 2NU1E 1AU8A 3FZDA 1NU9A 2XBYA 1MTNC 2ZU2A 1THPB 1ACBE 1GHZA 1GBBA 4D9QA 1FY8E 1QBOA 4X2VA 2QGRA 4AYYB 1A46H 3LC3A 3S69A 3FANA 1ELTA 1GI5A 3M3VA 1UTNA 1PQ8A 2HGTH 3QLPH 1UK3A 1W14U 3BTWE 1W2KH 4IW4E 2PR3A 1BZXE 5IYTA 1HAHH 2AS9A 3U98H 3GISB 1S0RA 1SGYE 5HYOA 2HALA 4JK6A 4ISIH 4JZDH 1VCPA 3NK8A 1LQEA 2BDCA 2AERH 1O5FH 1VCQA 1TGBA 4HI3A 2ZQ1A 4K60A 3A89A 1ABJH 3ATWA 4YT7H 4LZ1H 1GI6A 3MNXA 1FAKH 1FIWA 1AE8H 3EDXB 2D1JA 1S0QA 4FUGA 1EASA 1NY22 2AGIX 3S9AA 2FOFA 2IPHA 2D26C 2SGQE 2SFAA 2VWNA 1FI8A 2P8OC 1BMLA 3BG4C 4X1SU 1C5YB 2BHGA 2WPHS 1GBKA 2ZU3A 4MQAA 3P70B 1QL9A 1THSH 1WSSH 4X8VH 1O3NA 1GHBF 2OD3B 4BAKB 3QDZB 3HATH 1C1OA 3RM0H 5LH8A 1O3OA 2WINI 3LC5A 3BTKE 1LHGH 1GDUA 4ZKSU 1WQSA 3AW1A 4NZLA 4IS5A 1C2MA 3PWCA 4KGAA 4DURA 1G3BA 1G9IE 3STJA 4CR9A 4GSOA 3T26A 1UJ1A 1D4PB 1GBMA 2C8XB 2UWLA 4FUDA 3DFJA 2VIPA 3ZZDA 2HPQH 4I7YH 1TNGA 1DWEH 1DXWA 2VVVA 2ZECA 1A0HB 1O2YA 1C5NH 3VFEA 1NC6A 5TCCA 4WMDA 4JZEH 1GJBB 4CR5A 1ZLRA 2GZ7A 5C3NA 2G4UA 1DLEA 3M61U 2Z3DA 1BMNH 2PKAA 2XC4A 4ABGA 1JBUH 2QC2A 3PROA 3W94A 3QX5H 2BLWA 1O5FL 4U01A 4IC5A 1C1RA 4JYUH 4WJG2 5EXLA 5DP9A 2JH6D 1UVTH 3KEEA 3LGTA 4TY7A 1C5UA 1NU7B 3SU6A 1BITA 1N6YA 1RIWC 2VIQA 6GCHG 2GCTB 1XKAC 4IBLH 2KAIA 1G3EA 2QYIA 3MMGA 4X6MA 3KL6A 4NFEA 2AH4X 4B73A 1AFEH 1T8MA 3MH5A 2P59A 3ZVAA 1E34B 2B0FA 3IITA 1TABE 1UVOA 2LNCA 1NRPH 2BOKA 5K0HA 1O2ZA 1EB2A 1P04A 5E8EH 5AFZH 1O39A 2ZG0H 3Q00A 1EP5A 2AIPA 2Z9GA 2HNTC 4O3TA 1HXFH 1NFUA 4Y0YE 3PTNA 2XTTB 2ZHEH 3TNTA 1IQLA 1T8LA 1CT4E 1E37B 4FUBA 2QCYA 3RC4A 1C2GA 2FIRH 3RLYH 1KXAA 5DG6A 2VWLA 3MU0A 2BD2A 2A1DB 3RXCA 1UCYE 2PV9B 3D23A 1J15A 2FX4A 1V2QT 9ESTA 1AO5A 3PO1B 1S6FA 3MO6A 1AKSB 1CGIE 2A45B 1TNJA 4I8JA 4BANB 3ZZ6A 1Q3XA 2AFQB 2FOCA 1MTVA 2SGDE 6ESTA 2Z7FE 2ALPA 2Q6DA 1GMHG 1HAXB 1WTGH 1ZMJA 2GV6A 1MBQA 2FLBH 1SFIA 1ZSKA 1UTJA 4GCHG 1C2HA 1S5SA 2H9TH 3E91A 1BHXF 4A1TA 3GY7A 1L4ZA 2WYJA 5C67A 4B2AA 4CREA 2CMYA 5C20A 3QGJA 1TBQH 5L6NH 1SGCA 2BD3A 4D76A 2F3CE 2OC1A 1O2RA 1O2SA 5F8ZA 2ZEBA 1JMOH 4R0IA 4R8TB 2GV7A 4YZUA 3MU4A 3LJJA 5BRRE 1SGRE 2A7HA 1THRH 4I8GA 3TJVA 2THFB 6LPRA 1Y3YA 1UCYK 2V3OH 1DDJA 2G5NA 3GCHB 4GAWA 1H8DH 2EI6A 2TGPZ 3KNXA 2Y6TA 3Q3XA 1TNKA 1O5GH 3Q77A 2FWWA 4A7IB 4Y10E 1AE5A 1PQAA 2EI7A 4Y79A 1GGDB 1F7ZA 1E36B 1TMBH 1S85A 4X8SH 3TK6A 4XFQA 2J38A 4YLUA 2PGQB 3A83A 4GCHF 4Y6DA 2GMTC 5HMAA 1Y3WA 1MTUA 2O8MA 2BY7X 9LPRA 1GBHA 1H9LB 4A5TS 2BDIA 1WOFA 3V7TA 3MO3A 3STIA 2C3SA 2FOBA 3RC6A 3WY8A 4BAMB 2VVUA 1RD3B 1P2MA 4K8BA 1ANEA 3SU4A 1G36A 3V3MA 1NRNH 1S82A 1BJUA 1EZUC 1O2IA 2H6MA 1AZ8A 3ATKA 1RXPA 3ATIA 4TWYA 5HXFA 1C9PA 2OC8A 1AZZA 1C2EA 3T62A 1QIXB 1KLTA 1BMAA 1V2VT 1XXDA 3UNSA 3SUEA 2QF0A 3VB5A 1DXPA 1O2JA 3SUGA 3ATLA 3VB4A 1GJDB 3ZZ4A 2BY5X 2F9BH 1C2FA 2ZPQA 4JK5A 4BAOB 1K1LA 1YF4A 1C1SA 3SV8A 3D62A 1A1RA 3M7QA 1DLKB 1ZTJA 2FPZA 5JYIA 1L2EA 3SW2B 4BOHA 1MAXA 1P10A 3SZNA 4Z6AH 2VH0A 1Z6JH 1Z1IA 2C8YB 4ABJA 1ZHMA 1TWXB 3GY6A 2QAAA 5JB9S 3ZZ9A 1SC8U 4Y8ZA 4M7GA 2CGAA 1LCYA 3LGIA 5JDUB 1BTYA 1T8NA 2FESH 1HV7A 1WTHD 1ETTH 4YESB 1PYTC 3U9AH 1D6WA 5DJ7A 1LKAA 5B6OA 1Y59T 1WYKA 3KQEA 1YC0A 3ZZAA 1MZDA 2A2XH 4AYVB 4OGYA 2JP0A 4B76A 5C5OA 3K6ZA 3NKKA 1ANBA 2FOHA 4OGXA 2ZFQH 2VJ1A 1IQJA 5FCKA 3ZV9A 1G2LA 1KLJH 4YLQH 4AFQA 1VJAU 4F4OC 1IHSH 4CBOA 1MH0A 1O3MA 2CV3A 1CBWB 1O2VA 2QY0B 1D3PB 3V13A 2J94A 1AQ7A 1QBVH 1IQNA 1GBCA 1SHHB 3RXEA 1EB1H 1JWTA 1JRSA 2SGPE 4TY6A 3PYHA 1LPGB 1EOLA 1A2CH 5CMXH 3EA8A 4ZH8A 2F9OA 3GDVA 1CO7E 2KAIB 5LPEA 1L4DA 1GWAA 1TOMH 3A85A 2GDEH 1T32A 3RXKA 3HKIB 3T29A 1O5BB 1TYNA 2IOTA 4U2WA 2SGAA 5JB8S 1ELDE 1UTMA 1QRZA 3BTFE 4X6NA 2W26A 4NIWA 2FOGA 2GTBA 3ODFA 5SGAE 1ZJDA 3SJOA 2Z3EA 7GCHF 3H7OA 5DP3A 2OQ5A 2BY9X 2SNWA 1BRAA 4K1EA 4MLFB 3VGCC 3ZZCA 3UNRA 1FAXA 3AAVA 4MDSA 2ZGHA 2AYWA 1MTNB 5GCHG 2ZHQH 1QA7A 1TB6H 5E0GA 1PPBH 3ZZ3A 2FI3E 1V2WT 1TFXA 3RXJA 1GHYH 3SHCH 1DT2A 2B8OH 4YO9A 4DT7B 1Y8TA 1J17T 2GGVB 3A7TA 2P95A 1TRYA 1SGNE 3SN8A 1K1OA 3RXVA 2D2DA 3BEFB 4E7RG 2FYRA 1GMDG 2G52A 1RJXB 4I8KA 1C2JA 1IQMA 2TPIZ 1D3TB 1P9SA 1O3BA 5PTPA 2XCNA 2OXSA 3PMBB 3ZZBA 2QA9E 1T4UH 4LXBH 1KXEA 1QJ7B 1Q2WA 1J16A 4BAQB 1O38A 4CRGA 1K1NA 4ABFA 2BOHB 2IJOB 1IQHA 1A5GH 2P8OB 4CRBA 3TNSA 2QIQA 1SHYA 1D3DB 1O0DH 1NROH 1PPHE 4K69A 1AKSA 3A82A 1EAIA 4I33A 1GG6C 1P57A 4DCDA 1AWHB 1BRUP 3SORA 1UTOA 2XRCA 4U30A 1NFWA 5FX5A 3AW0A 3SI3H 2AMQA 1P02A 3LT3A 1LHDH 4AN7A 3SO3A 1JOUB 1Y3VA 4A6LA 1D9IA 2A0QB 1AFQC 1GMDF 2VVCA 1TX6A 1V2MT 3C27B 1VITH 2D8WA 1C5OH 5C2ZA 1M9UA 1QRXA 1MKXK 1ZZZA 2F9VA 3CP7A 2BB4A 3F1SB 4AFZA 1C9TA 1N8OC 2ZDKA 5A0BA 1F5KU 3SU2A 2HOBA 1CA0C 5EW2H 4WXIA 3RMOH 2EC9H 4MNWA 3A86A 1K21H 1GVKB 2VB0A 5E2OA 3KCGH 3A7ZA 4ZKRU 4AX9H 3A8AA 1L1GA 1A61H 2Z9IA 1G2MA 2BM2A 2ZTXA 5LPFA 3RU4D 4GHQA 2BDYA 4UFDH 2XW9A 4HGCA 1YCPK 3H7TA 1YLCA 1G30B 4ZAEA 1FY1A 3TK5A 1DY8A 1P2NA 8GCHG 1ZRBA 2ZCLP 2SGFE 4UD9H 1LO6A 1SFQB 3E16B 3M3SA 3PTBA 1Z8GA 1ELAA 3BEUA 2VWOA 2G4TA 5T3HA 1Q31A 2ANWA 1RIWB 1LHEH 1OWJA 1FLEE 2BZ6H 2QN5T 3TIUA 2YOLA 1HAGE 1NRQH 2G5VA 1MTSA 1HJAC 1V6DA 3U8OH 1SR5C 1O3AA 3E3TA 1DSTA 4ISNA 1F5LA 2ZTYA 1YPHC 4FU7A 4B74A 3SU0A 1O2UA 2TGTA 1GI4A 4Y7BA 1J9CH 4Y11E 1MCTA 3MH7A 3UWIA 1GHVH 1O3EA 1A4WH 1SOZA 1JIRA 5FPYA 2FYQA 4GHTA 1NM6A 4ZHMU 3MNCA 3P92A 4AZ2B 1JXPA 1GMCG 3G01A 3RXQA 2EEKA 5DK1A 2BDAA 2DE9A 2JH0D 3MO9A 1YPKH 1GBLA 8GCHF 1OP0A 1SQAA 1F0TA 5EXNA 1HAOH 2OQUA 1ANCA 1DY9A 1CGHA 3K9XB 1LHCH 4IMZA 1FV9A 3TJNA 2B5TB 3VB7A 1O3GA 5EPYA 3LKWA 3TH4H 4NFFA 2ZFSA 4TPIZ 5FHTA 1YM0A 5C5NA 3TU7H 2CHAB 2VH6A 4B2CA 1TPOA 4FUIA 5JFBA 4NGAH 2ZDLA 1H4WA 5A8YA 3SGBE 4CRFA 2FO9A 2ZDVH 2PLXA 2BD7A 4FU8A 4OS6A 1W12U 1ETRH 3TJUA 3DD2H 1C5VA 2OC7A 3T25A 4CH2B 1DS2E 1P9UA 3A80A 2AEIH 1V2TT 2V3HH 3S9BA 4XBCA 1C4Y2 4H42U 3PMJA 4JYVH 1QB1A 3F9EA 1U6QA 2HWLB 2HVXA 3GY8A 7LPRA 3RXGA 3PLBA 3M3TA 1D6RA 1YPHE 1GJ6A 2OP9A 3I29A 4NG9H 3UUZA 3DFLA 2BD8A 3BTTE 2TRMA 4RN6A 1EPTC 3GCNA 5EQSA 4X2XA 4E06H 1OWIA 3UTUH 4Y0ZE 1AHTH 1RS0A 1K22H 3A7XA 4WMFA 2NU3E 1YPMH 3OY6U 4MPVA 2STBE 2I6QA 2Y7XA 2BZAA 1O5CB 2FTMA 3ENSB 2Z9JA 2GMTB 1AD8H 2H2ZA 2VWMA 1C4U2 5JBCS 3I78A 4DW2U 3SGAE 7ESTE 4XSKU 4E7NA 1PPZA 1C2DA 1TX8A 1O3JA 1O35A 2OYAA 3GCOA 1DWBH 3P8NA 5GWZA 1AI8H 1PPCE 1V2LT 1O2TA 1QTFA 1XXFA 3MI4A 4ABBA 2AMPA 4KKDA 1HNEE 1UHBA 2A7JA 1F92A 1BTHH 3OYPA 4X6PA 4ISHH 1HJ9A 1QBNA 3MNSA 1C1UH 1P3EA 1Z8RA 1ELCA 2BD9A 1SLUB 3ZZ7A 3O8BA 3O8DA 3UPEA 4NZQA 3PMHB 3U1JB 1EUFA 4KP0A 3RXDA 1CQQA 3KGPA 1VITG 3SV9A 1MKXH 1TGCA 4OS1A 1NN6A 1P05A 3SNEA 5FCRA 3T28A 2PTCE 3V0XA 5AF9H 1DICA 3FP6E 1C5RA 1O31A 2TGAA 1ZJKA 1KXDA 2ZZUH 4DOQA 5FPTA 1ELFA 1FMGA 1XUGA 2EI8A 1C1MA 3GYMA 3S7HB 1P57B 4OS4A 1K1MA 1W11U 5FPSA 3TITA 3IG6B 4GUXA 1KXBA 1AB9C 6GCHF 2OBQA 2ZFRH 1DOJA 4I32A 1YCPH 3ZV8A 2FP7B 1ZHPA 1EJMA 3R0FA 3SNAA 1GJ8B 3HK3B 3VB6A 3ZVCA 2Y82A 2UUJB 2CF8H 1GCTC 5I25A 3RDZA 3RLWH 1BCUH 2GZ9A 2AGEX 3AASA 1ID5H 2Y5HA 4AGJA 4VGCC 4MPXA 4ASHA 4CBNA 3RXIA 2BY6X 2ZCHP 4ZUHA 1TQ7B 5DP4A 3RXBA 4WF8A 4BXWA 1UTLM 1O2QA 1Z7KA 1EZXC 1PPEE 3BTQE 2ANMH 2NU4E 4Y8XA 1MU6B 1UK4A 2ODQA 5K7RA 1VITF 2JA4A 1F5RA 2PTNA 2VIDA 1P11E 1QFKH 1BQYA 1UTQA 1CA8B 2B7DH 4WY3A 1C1PA 2HNTF 5F6MA 5A0CA 1ZMNA 3AVZA 3SU5A 3KIDU 4LOYH 4CHAC 1WBGB 2WPLS 1Y5UT 1S6HA 3DT0H 2PKSC 1D3QB 4NSYA 2R3YA 3O8CA 4FXGH 1GMHF 1EZSC 4ZXYH 2ZGBH 3RXMA 1KYNA 4ZHAA 2ZF0H 2PFEA 4Q80A 2R2MB 4MNYA 2UUKB 1GI1A 4WXVA 1GBFA 1C1QA 5C1UA 2ZFPH 3A8DA 3A7YA 1O2MA 4MPWA 1ABIH 5GPIB 1QGFA 5L2ZH 4FUJA 4TPYA 1HYLA 2C93B 3IWMA 2ZP0H 1SBWA 1HAPH 2ASUB 2BVSH 2BY8X 4K2YA 1UMAH 3LGYA 3SV2H 2ZWLH 1QR3E 3VGCB 1GBJA 2ODYB 3QK1A 2H9EH 1YPJH 1NT1A 1LDTT 1XUFA 1GI2A 1QA0A 3MOCA 2GCTC 1EJAA 1C5LH 3BTME 4THNH 1MCVA 3RXTA 1MZAA 3A87A 1TPPA 1P09A 2H1UA 3P8OA 1NZQH 2J34A 4X1PU 4B71A 3FVFB 4KELA 3ZVEA 1O32A 1P2IA 1SLXB 2O8UA 2W7UA 4OS2A 1G3CA 3MH4A 3LH3A 2ZA5A 3GY3A 4MG3A 2FI5E 1XUJA 2P3FH 5C1YA 4YTAA 5EU8A 2GDDA 2W7SA 1T4VH 1K9OE 1TIOA 1UVUH 1AVXA 1O2GH 5JBBS 1GL1A 1DWDH 1DPOA 3ZVBA 3CS0A 3UQOA 4X1QU 1XUIA 2W5EA 3PMAB 2DUCA 3PB1E 2BQ6B 3PWBA 2P94A 2Q6GA 1GI7B 2JKHA 3EAJA 2ZU5A 1GDQA 1S84A 2A5IA 1QURH 1AMHA 1OYTH 4FUHA 3DHKH 1G37A 2ZFFH 4UFFH 1TRNA 1PPGE 1ZTKA 1OKXA 1SG8B 1QB9A 4K8YA 3EYDA 3OY5U 1ZYOA 1YPGH 5JBTA 1KTTB 3M5MA 1PJPA 1ANDA 2OBOA 1NRSH 2VIOA 1LKBA 5GIBA 1WUNH 3A7VA 1O3HA 1C5PA 1TALA 1RTKA 2AIQA 3LH1A 4RSPA 1MTWA 2OCVB 4MVNA 2OY3A 3UR6A 4Y71A 4XDEA 1IHTH 1AFQB 1C2IA 1YLDA 3UY9A 3ZVFA 3VEQB 4SGBE 1EAUA 1T8OA 4F49A 1V2JT 2BX3A 1XVMA 1BY2A 3KHVA 3NUMA 1SPJA 1EXFA 1Y3XA 1CA0B 1MUEB 4RKOB 5HM2A 1DUEA 4ESTE 2J9NA 1ZMLA 4H6SB 1C5QA 1UTKA 5FBEA 2VINA 2Y81A 2ZO3H 1INCA 1K1PA 2C4FH 3ZYDA 1BTXA 2XBXA 1P03A 3RC5A 1F0SA 1ZPBA 1UHBB 4YOJA 1C5SA 2R9PA 1W8BH 3NCLA 4NA9H 2GT8A 3P8GA 4AFSA 1TE0A 2UUFB 3N7OA 2C8ZB 1KIGH 3SGQE 1NRRH 1VGCB 1RTFB 3QTOH 4Y7AA 3L33A 2H9HA 4IN2A 2BQ7B 3M7UA 1V2OT 1MD7A 1DITH 4ISLA 1QQUA 1ZGVA 1AUTC 4CRCA 1LPKB 1ZRKA 1KXFA 4WMEA 1HJAB 5T6FA 2XWBI 2JH5D 1O2OA 3RMMH 2EA3A 3GCTG 1IOEA 5IDKA 5DKMA 5TJXA 3M36A 3TVJB 3A8BA 5EODA 1TAWA 4FU9A 3SNBA 1ELVA 5L30H 1BOQA 3RXOA 4ABEA 1A3BH 1EZQA 4UE7H 2WPKS 1HUTH 3LGWA 3P8FA 5J4SA 2GT7A 3M37A 2FDAA 2P3UB 1TRMA 1Z8IB 4ZKOU 1UCYH 1H9IE 2BYAX 4BTIB 2ZTZA 1CHOG 2C8WB 1K1IA 2ZKSA 4ABDA 4K1TA 1MAYA 1P2JA 2W3IA 1SGEE 3TH3H 1F0UA 4AGKA 1QRWA 2SNVA 5EG4A 3RMLH 5GJ4B 1PYTD 1OWHA 2XCFA 3TPIZ 3NZIA 1WCZA 2LPRA 3F6UH 4Q7XA 1L0ZA 2WPMS 5ESBA 2Z9LA 3BG4B 3PM3A 2FZZA 1IAUA 2A4RA 3LIWA 3B8JA 3UR9A 2NU0E 3MH6A 3LGUA 3CS7A 2J2UA 2ANYA 5GCHF 1O3PB 1TNHA 1O5DH 2ZDMA 1HRTH 1UTPA 1MMJN 4YT6H 3GCTF 3KN2A 2ZCKP 3ELAH 3D49H 1ZOMA 3D65E 4UONA 1ESAA 4WH8A 4Z0KA 1GHAG 1XMNB 3OSYA 1EJNA 6CHAC 1DFPA 2Z94A 4HFPB 3HK6B 3A84A 1BA8B 2PSXA 1MBMA 3ZVDA 2PSYA 1E0FD 1PQ7A 2ULLA 2R0LA 1C1VH 3SNCA 3M35A 1CHOF 1YBWA 4NIVA 5EQQA 4JMYA 1FIZA 1ORFA 1F2SE 3RU4E 4AG2A 3Q3YA 1B0EA 1Z1JA 3E0NB 1N6XA 2O8TA 1GBTA 4NA8A 1LTOA 1UO6A 3GOVB 1EPTB 1SGPE 2YNBA 3FP7E 2RA0A 1SGFG 1C5MD 1P8VC 3VXEH 1DUAA 5CHAC 1V2RT 4MTBA 2BQWB 1FN6A 3CENA 1TA2A 4AG1A 1NFYA 1TMUH 1J8AA 4MNXA 3F68H 3E0PB 2GCHG 1V2PT 2VNTA 4LK4A 3PV4A 5ABWA 3RXRA 1O5EH 4INHA 2FOAA 2ZU1A 4XE4A 5EPNA 2CJIA 5EW1H 1H1BA 3TLOA 2XC0A 2ALVA 1AN1E 1CE5A 2ESTE 4JYTA 1LVMA 1HB0B 3KF2A 2G8TA 1VJ9U 2BDHA 2UWOA 1IQIA 1H9HE 1W13U 4D7FA 3JZ2B 3SBKA 1BTPA 4I31A 4DIIH 4ABHA 4Y8YA 2QXJA 3GY5A 3NXPA 2AGGX 4NWKA 2GP9B 1O3IA 2JETC 1RRKA 1A7SA 5A2MH 1QNJA 2ZGCA 3MTYA 1YGCH 1W0ZU 5GDSH 1O3DA 2F9NA 1W7XH 2BXTH 4J1YA 1GBDA 1FQ3A 1NPMA 3LOXA 3UOPA 3S7KB 5T6DA 1J14A
chains in the Genus database with same CATH superfamily
3ODDA 2QXIA 1P2KA 1XKBC 3MU1A 3PRBA 4X8TH 1CVWH 5DP8A 3RUOA 1S83A 4DVAU 1AY6H 1GHBG 3RM2H 1EAWA 3TGKE 4YOGA 1HIAB 3DUXH 2FTLE 1O3KA 3FZZA 5HGGA 5DP5A 2ZFTA 1GJAB 2GCHF 1VR1H 1KDQB 1C5TA 3MU8A 1HGTH 1FUJA 4DGJA 4O97A 5A8ZA 3BIVH 3UWJH 1TNLA 3SOSA 2FXRA 2VBCA 4RKJB 1FXYA 4KTSA 3GICB 1SQOA 4JZFH 4BAHB 1LMWB 4CH8B 4WH6A 4H6TA 2GZ8A 1GHXH 1Y3UA 1V2ST 3ESTA 3SJ8A 3UFAA 1CHGA 1O3LA 3T27A 1TA6A 1AB9B 1SL3A 2IN2A 2PW8H 4FVBA 1O2NA 1GBEA 4BNRA 1ZSLA 3SUFA 3ATMA 4OS5A 1CT2E 3RXAA 1UK2A 2OC0A 1KLIH 4CRDA 4IC6A 1KY9A 1OP2A 1T7CA 3UQVA 2BLVA 1GCTB 4O3UA 3GY2A 1PFXC 1O5EL 4JZ1A 1YPLH 4AB9A 1QJ6B 2WUCA 1GJ7B 2A5AA 4FOUC 5A0AE 2PUXB 1GDNA 2A2QH 4VGCB 2RG3A 5DO4H 4NCYA 1T31A 2FX6A 1GL0E 2R2WU 4IGDA 2CN0H 4FUFA 1KXCA 2J5UA 2M2AA 2KCOA 2ZGJA 2G00A 1HPGA 4WVPE 1GJ4H 3QUMP 1W0KD 1GMCF 1FPHH 2O9QA 2BD4A 1MKWK 4Q2KA 1EOJA 2VIWA 4CHAB 4H4FA 3GYLB 1OWKA 2PKSB 1OS8A 3OEED 4O03A 2BX4A 2A5KA 4XBDA 2TIOA 1JRTA 4F55A 1QCPA 5A8XA 3O8RA 4D9RA 2A4OA 2HVYB 1EX3A 1SGFA 3A7WA 4I8HA 2TBSA 1SSXA 3M5NA 1QY6A 1ZGIA 5EJLA 2K0QA 2OLGA 4DY7B 1V2UT 4E05H 2H5DA 5G4BA 3I77A 5HIYA 1O37A 2WPIS 1UVPA 1IQFA 1TONA 1W7GH 1A5IA 3K2UA 1F0RA 2RDLA 3E6PH 1GPZA 3SI4H 5LPRA 1H8IH 5DGJA 2VGCC 3OTJE 2ZDNA 3A8CA 3BV9B 2Z6BD 1P0SH 5FAHA 2J98A 1CGJE 3RU4T 1TX7A 3OTPA 4YOIA 3MFJA 5EJ1A 2W6JD 3M5OA 1V2KT 1OX1A 3VXFH 1FX0B 1C2KA 4X1RU 1O34A 3FAOA 1ZPZA 1HFDA 1A3EH 1AWFH 1GI8B 4Q7ZA 1MQ5A 2H5CA 4SGAE 5J4QA 4A92A 1O2PA 2Q1JA 2J95A 5HIZA 2F83A 1LVOA 4KTCA 4HTCH 3TGJE 1Y5BT 1OHHD 2BVRH 2YMSD 5TCAA 1O30A 4B2BA 2A31A 2B9LA 1B5GH 1MD8A 1FPCH 4DIHH 1IQEA 3SNDA 1C1WH 5AHGH 2WPJS 1HBTH 3SJ9A 4IMQA 4ABIA 2XNIA 4XD7D 1OPHB 1G32B 1E1RD 3HGPA 4UEHH 1TGTA 1ARCA 2J92A 1MU8B 3FFGA 1L1NA 1TMTH 8KME2 2A7CA 1TNIA 5AFYH 3NRLA 1RTLA 1AVGH 2EQNA 3P17H 2J4IA 2WYGA 3RXFA 1SOTA 1KTSB 2XBVA 4I86A 3F2FA 5E2PA 2A32A 3SU1A 3VB3A 4KTUA 3UIRA 2AMDA 2STAE 3RXLA 1XM1A 2CHAC 4UFGH 1HCGA 5I46H 1ELBA 3U69H 1MQ6A 4FVDA 3SV6A 3KQDA 4IN1A 2BMGB 4PROA 3F9HA 2Y5GA 3RXHA 3U1IB 3QGNB 1HAVA 3RXUA 2F91A 2FOMB 1GBAA 5F8TA 2V0BA 5EQRA 4B6EA 2FOEA 1A5HA 2FM2A 1SGDE 2Y80A 3EA9A 1EQ9A 5FX6A 3M7TA 1TGSZ 1BBRE 1ZSJA 1BRCE 3B9FH 2ZU4A 1P06A 3OX7U 3EGKH 2NWNA 3ZZ5A 2RA3A 5DPAA 1DX5M 3M5LA 1VCWA 2FMJA 4YXWD 2Z9KA 1SGIB 3SQHE 1DSUA 1HAZB 1NO9H 2XYAA 3BTHE 2HNTE 5BPEA 1FN8A 1OOKB 2FLRH 3DA9B 1C2LA 1NBMD 1ELGA 1EPTA 2OTVA 1ELEE 2P16A 2OUAA 3K6YA 4Q7YA 1SB1H 3S9CA 3DSGA 3SHAH 4ISOA 1TBRH 4MPUA 1QB6A 1BDAA 3E8LA 2F9PA 1IQGA 4OM9A 1HJ8A 1AUJA 1TGNA 3GS9A 2WUBA 3BIUH 4DJZB 1O2KA 3C1KA 1C5XB 2CXVA 1BB0B 4K1SA 5EGMA 1ZR0A 1X7AC 4Z1MD 1HDTH 1OYQA 5CE1A 2ANKH 1O2LA 1SLVB 2ZI2H 3RP2A 3UNQA 3AAUA 4INLA 3K65B 5C0TA 2BD5A 5DSFA 1C4V2 3SV7A 4YM9A 2WV5A 1E38B 4JCNA 1BBRK 1FY3A 1O3CA 2XXLA 4QT8C 2CF9H 4RT1A 1BTUA 2ILNA 1WAYB 4X2YA 2QF3A 1MKWH 5C1XA 5FBIA 3LDXH 3GY4A 8LPRA 3QZRA 4O9VA 4JZIA 5LGOA 5EIYA 1S81A 1RGQA 1DE7H 3KQBA 5EXMA 1GHWH 4ABAA 1VKYA 2ZPRA 2DE8A 3E1XB 3MNBA 1P2QA 1BUIA 2VU8E 2QE7D 1CU1A 1O5AB 1TOCB 2F9UA 1C1NA 1HIAA 1Z6EA 2ZGXH 4BTUB 4XBBA 2BXUH 4BXSA 1SI5H 3PO1C 3T2NA 2FS9A 4AFUA 3LGVA 1GVZA 1KDQA 1ZTLA 1P2OA 1WQVH 1W3CA 1QQ4A 4A1VA 2Y7ZA 2BDBA 2JIZD 4Y76A 4K3JA 2XWAA 1C5WB 1GG6B 1ETSH 1FNIA 2P93A 4DG4A 3L3TA 4HZHA 2GD4B 3BTEE 2XC5A 3TK9A 2XBWA 1GCDA 2R3UA 3Q76A 1AIXH 2HRVA 3LU9B 5EOKA 2JOPA 3LONA 2ZQ2A 3MWIU 4ZKNU 4B75A 1EP6A 3Q3KA 3BF6H 4NSVA 3SUDA 1OWEA 5HM9A 6CHAB 1EATA 4NIYA 3U8TH 2ODPA 2P3TB 1RFNA 3RXSA 2OINA 3TH2H 1A0JA 1AVWA 1B0FA 5GXPA 1DWCH 1FDPA 2OTTX 2UUYA 1O2XA 2SGEE 2VIVA 3MQKC 7GCHG 4NWLA 1N8OB 4K5ZA 3BG8A 3SU3A 1PQ5A 3ZYEA 1FY4A 4MNVA 2FODA 3NWUA 1COWD 2BLQA 2Z3CA 2ZDAH 3MHWU 3PLKA 2PKAB 1CT0E 5CHAB 3S0NA 1P3CA 3GCHC 2G51A 1GI3A 7KMEH 8ESTE 5L2YH 1W0YH 2PWXA 2WV4A 3LPRA 3T5FH 1H8ED 1E35B 3HGNA 2J98B 2M5TA 1A0LA 2O8LA 2UWPA 1TBZH 3E90B 2V35A 3QZQA 2FI4E 1GGDC 1OP8A 1GI0A 5JPMH 2GX4A 3L6PA 4I8LA 3BN9A 3QO6A 3ZVGA 3WWBA 1P12E 1PPFE 3VPKA 3F0OA 5T6GA 1C5ZB 2KFWA 1DM4B 2YNAA 2ZPSA 1CSOE 1ARBA 2ZC9H 3P95A 3BTGE 3F2GA 2JETB 2NU2E 2O8WA 2BDGA 4X2WA 2A4GA 2KX4A 4TSFD 3ZZ8A 2BTCE 1NS3A 3QWCH 5F03A 1SGTA 2C90B 1K2I1 1O36A 3QN7A 2V6NA 3W95A 3BTDE 1HAIH 2QXHA 1KSNA 1HAYB 3RXPA 3EE0B 1EKBB 3KQCA 1OSSA 1TLDA 1V3XA 1SVPA 4GPGA 4ZXXH 1BJVA 1HXEH 1L1JA 2A4QA 3U8RH 5E0HA 3F9GA 4NIXA 2FS8A 2PHBA 3A88A 4OS7A 4X1NU 4J2YB 3HKJB 1BT7A 3UOUA 3PLPA 1FZZA 1WV7H 2ZHDA 5KECA 4LZ4B 3A81A 4FUEA 2K1QA 3ITIA 1GI9B 1HLTH 3QTVH 1AGJA 1XX9A 4U32A 1Y5AT 3WW7A 1LHFH 1OXGA 1C1TA 4XOJA 4Q63A 1Z71A 1Z8JB 1SMFE 3LJOA 1BMMH 3OU0A 3URDA 4AORA 1TPSA 4X0WU 1GVLA 3P6ZB 3NPSA 1P01A 1BRBE 1G3DA 2G55A 2I6SA 4D7GA 1ZPCA 1LPZB 2W3KA 1HAVB 1GJ5H 3GDSA 5A09A 3SQEE 1XUKA 2ZHFH 4BTTB 3TJOA 1B7XB 1YYY1 4A1XA 1FONA 1GJCB 4X8UH 3B23B 4B1TA 3F9FA 2ZIQH 2CK3D 3MYWA 5HKKD 3BSQA 1DVAH 2QV1A 1GBIA 3URCA 2BLOA 1SGQE 4GVUA 1NFXA 1ESTA 1UVSH 4GLYA 4ZHLU 5H4IB 1XUHA 3EA7A 1BIOA 1V2NT 1QJ1B 1BTWA 1O2HA 5AVDA 1IQKA 4AOQA 1FJSA 3MU5A 2PUQH 1SLWB 1ZHRA 1DANH 1BBRH 3JZ1B 2RCEA 3R3GB 1XVOA 4UDWH 1W10U 3WWFA 1CBWC 1O3FA 5JBAS 3RMNH 2FEQH 1ESBA 1NTPA 2G81E 4AB8A 3HPTB 4TYDA 1FY5A 4NA7A 3FP8E 2R0KA 5DP6A 4CRAA 1LVYA 5ETXA 4TWWA 1O33A 3BEIB 5F8XA 4D8NA 2QXGA 1NESE 2PGBB 3SJKA 1K1JA 1EAXA 3GDUA 1SQTA 4UFEH 4X6OA 5ESTE 1YPEH 1BTZA 4INKA 1WU1A 2HLCA 1QL7A 1YKTA 5DP7A 5E0JA 1YCPM 4FUCA 5KGOA 1GJ9B 3SJIA 1QL8A 2TGDA 1TQ0B 1OWDA 1LVBA 2GKVE 1GHAF 2ZNKH 4WWYA 2Q6FA 2HPPH 3H5CB 3V12A 1O2WA 2VGCB 2ZHWH 5FXLA 1YP9A 2BVXH 1BHXB 3EQ0H 4ZROA 3TGIE 5DN6D 1K28D 1VGCC 1QHRB 1TPAE 1JIMA 2Y5FA 3KYGA 1LQDB 1N1LA 1VZQH 2GVFA 2KCAA 3UREA 4ZMAH 2NU1E 1AU8A 3FZDA 1NU9A 2XBYA 1MTNC 2ZU2A 1THPB 1ACBE 1KMHB 1GHZA 1GBBA 4D9QA 1FY8E 1QBOA 4X2VA 2QGRA 3U28C 4AYYB 1A46H 3LC3A 3S69A 3FANA 1ELTA 1GI5A 3M3VA 1UTNA 1PQ8A 2HGTH 3QLPH 1UK3A 1W14U 3BTWE 1W2KH 4IW4E 2PR3A 1BZXE 5IYTA 2QF5A 1HAHH 2AS9A 3U98H 3GISB 1S0RA 1SGYE 5HYOA 2HALA 4JK6A 4ISIH 4JZDH 1VCPA 3NK8A 1LQEA 2BDCA 2AERH 1O5FH 1VCQA 1TGBA 4HI3A 2ZQ1A 3FN8A 4K60A 3A89A 1ABJH 3ATWA 4YT7H 4LZ1H 1GI6A 3MNXA 1FAKH 1FIWA 1AE8H 3EDXB 2D1JA 1S0QA 4FUGA 1EASA 1NY22 2AGIX 3S9AA 2FOFA 2IPHA 2D26C 2SGQE 2SFAA 2VWNA 1FI8A 2P8OC 1BMLA 3BG4C 4X1SU 1C5YB 2BHGA 2WPHS 3H09A 1GBKA 2ZU3A 4MQAA 3P70B 1QL9A 1THSH 1WSSH 4X8VH 1O3NA 1GHBF 2OD3B 4BAKB 3QDZB 3HATH 1C1OA 3RM0H 5LH8A 1O3OA 2WINI 3LC5A 3BTKE 1LHGH 1GDUA 4ZKSU 1WQSA 3AW1A 4NZLA 4IS5A 1C2MA 3PWCA 4KGAA 4DURA 1G3BA 1G9IE 3STJA 4CR9A 4GSOA 3T26A 1UJ1A 1D4PB 1GBMA 2C8XB 2UWLA 4FUDA 3DFJA 1MABB 2VIPA 3ZZDA 2HPQH 4P02A 4I7YH 1TNGA 1DWEH 1DXWA 2VVVA 2ZECA 1A0HB 1O2YA 1C5NH 3VFEA 1NC6A 5TCCA 4WMDA 4JZEH 1GJBB 1SQRA 4CR5A 1ZLRA 2GZ7A 5C3NA 2G4UA 1DLEA 3M61U 3OE7D 2Z3DA 1BMNH 2PKAA 2XC4A 4ABGA 1JBUH 2QC2A 3PROA 3W94A 3QX5H 2BLWA 1O5FL 4U01A 4IC5A 1C1RA 4JYUH 2V3MA 4WJG2 5EXLA 5DP9A 2JH6D 1UVTH 3KEEA 3LGTA 4TY7A 1C5UA 1NU7B 3SU6A 1BITA 1N6YA 1RIWC 2VIQA 6GCHG 2GCTB 1XKAC 4IBLH 2KAIA 1G3EA 2QYIA 3MMGA 4X6MA 3KL6A 4NFEA 2AH4X 4B73A 1AFEH 1T8MA 3MH5A 2P59A 3ZVAA 1E34B 2B0FA 3IITA 1TABE 1UVOA 2BOKA 1NRPH 2LNCA 5K0HA 1O2ZA 1EB2A 1P04A 5E8EH 5AFZH 1O39A 2ZG0H 3Q00A 1EP5A 4FETA 2AIPA 2Z9GA 2HNTC 4O3TA 1HXFH 1NFUA 4Y0YE 3PTNA 2XTTB 2ZHEH 3TNTA 1IQLA 1T8LA 1CT4E 1E37B 4FUBA 2QCYA 4HG6A 1C2GA 2FIRH 3RC4A 3RLYH 1KXAA 5DG6A 2VWLA 3MU0A 2BD2A 2A1DB 3DSPA 3RXCA 1UCYE 2PV9B 3D23A 1J15A 2FX4A 1V2QT 9ESTA 1AO5A 3PO1B 1S6FA 3MO6A 1AKSB 1CGIE 2A45B 1TNJA 4I8JA 4BANB 3ZZ6A 1Q3XA 2AFQB 2FOCA 1MTVA 2SGDE 6ESTA 2Z7FE 2ALPA 2Q6DA 1GMHG 1HAXB 1WTGH 1ZMJA 2GV6A 1MBQA 2FLBH 1SFIA 1ZSKA 1UTJA 4GCHG 1C2HA 1S5SA 2H9TH 3E91A 1BHXF 4A1TA 3GY7A 1L4ZA 2WYJA 5C67A 4B2AA 4CREA 2CMYA 2J97A 5C20A 3QGJA 1TBQH 5L6NH 1SGCA 2BD3A 4D76A 2F3CE 2OC1A 1O2RA 1O2SA 2AHME 5F8ZA 2ZEBA 1JMOH 4R0IA 4R8TB 2GV7A 4YZUA 3MU4A 3LJJA 5BRRE 1SGRE 2A7HA 1THRH 4I8GA 3TJVA 2THFB 6LPRA 1Y3YA 1UCYK 2V3OH 1DDJA 2G5NA 3GCHB 4GAWA 1H8DH 2EI6A 2TGPZ 3KNXA 2Y6TA 3Q3XA 1TNKA 1O5GH 3Q77A 5T1VA 2FWWA 4A7IB 4Y10E 1AE5A 1PQAA 2EI7A 4Y79A 1GGDB 1F7ZA 1SKYE 1E36B 1TMBH 1S85A 4X8SH 3TK6A 4XFQA 2J38A 4YLUA 2PGQB 3A83A 4GCHF 4Y6DA 2GMTC 5HMAA 1Y3WA 1MTUA 2O8MA 2BY7X 9LPRA 1GBHA 1H9LB 4A5TS 2BDIA 1WOFA 5FL7D 3V7TA 4ACBA 3MO3A 3STIA 2C3SA 2FOBA 3RC6A 3WY8A 4BAMB 2VVUA 1RD3B 1P2MA 4K8BA 1ANEA 3SU4A 1G36A 3V3MA 1NRNH 1S82A 1BJUA 1EZUC 1O2IA 2H6MA 1AZ8A 3ATKA 1RXPA 3ATIA 4TWYA 3AK5A 5HXFA 1C9PA 2OC8A 1AZZA 1C2EA 3T62A 1QIXB 1KLTA 1BMAA 1V2VT 1XXDA 3UNSA 2RDEA 4RI0A 3SUEA 2QF0A 3VB5A 2WZQA 1DXPA 1O2JA 3SUGA 3FOAA 3F3BA 3ATLA 3VB4A 1GJDB 3ZZ4A 2BY5X 2F9BH 1C2FA 3N99A 2ZPQA 4JK5A 4BAOB 1K1LA 1YF4A 1C1SA 3SV8A 3D62A 1A1RA 3M7QA 1DLKB 1ZTJA 2FPZA 5JYIA 1L2EA 3SW2B 4BOHA 1MAXA 1P10A 3SZNA 4Z6AH 2VH0A 1Z6JH 1Z1IA 2C8YB 4ABJA 1ZHMA 1TWXB 3GY6A 2QAAA 5JB9S 3ZZ9A 2L6OA 1SC8U 4Y8ZA 2KM0A 4M7GA 2CGAA 1LCYA 3LGIA 5JDUB 1BTYA 1T8NA 2FESH 1HV7A 1WTHD 1ETTH 4YESB 1PYTC 3U9AH 1D6WA 5DJ7A 1LKAA 5B6OA 5F53A 1Y59T 1WYKA 3KQEA 1YC0A 3ZZAA 1MZDA 2A2XH 4AYVB 4OGYA 2JP0A 4B76A 5C5OA 3K6ZA 3NKKA 5EJZA 1ANBA 2FOHA 4OGXA 2ZFQH 2VJ1A 1IQJA 5FCKA 3ZV9A 1G2LA 1KLJH 4YLQH 4AFQA 1VJAU 4F4OC 1IHSH 4CBOA 1MH0A 1O3MA 2CV3A 1CBWB 1O2VA 2QY0B 1D3PB 3V13A 2J94A 1AQ7A 1QBVH 1H8HD 2V7QD 1IQNA 1GBCA 1SHHB 3RXEA 1EB1H 1JWTA 1JRSA 2SGPE 4TY6A 4ASUD 3PYHA 1LPGB 1EOLA 1A2CH 5CMXH 3EA8A 4ZH8A 2F9OA 3GDVA 1CO7E 2KAIB 2L74A 5LPEA 1L4DA 1GWAA 1TOMH 3A85A 2GDEH 1T32A 3RXKA 3HKIB 3T29A 1O5BB 1TYNA 2IOTA 2KR7A 4U2WA 2SGAA 5JB8S 1ELDE 1UTMA 1QRZA 3BTFE 4X6NA 2W26A 4NIWA 2FOGA 3ZIAD 2GTBA 3ODFA 5SGAE 1ZJDA 3SJOA 2Z3EA 7GCHF 3H7OA 5DP3A 2OQ5A 2BY9X 2SNWA 1BRAA 4K1EA 4MLFB 3VGCC 3ZZCA 2KZ4A 3UNRA 1FAXA 3AAVA 4MDSA 2ZGHA 2AYWA 1MTNB 5GCHG 1YY3A 2ZHQH 5B6LA 3VG8A 1QA7A 1TB6H 3UB0A 5E0GA 1PPBH 3ZZ3A 2FI3E 1V2WT 1TFXA 3RXJA 1GHYH 3SHCH 1DT2A 2B8OH 4YO9A 4DT7B 1Y8TA 1J17T 2GGVB 3A7TA 2P95A 1TRYA 1SGNE 3SN8A 1K1OA 3RXVA 2D2DA 3BEFB 4E7RG 2FYRA 1GMDG 2G52A 1RJXB 4I8KA 1C2JA 1IQMA 2TPIZ 1D3TB 1P9SA 1O3BA 5PTPA 2XCNA 2OXSA 3PMBB 3ZZBA 2QA9E 1T4UH 4LXBH 1KXEA 1QJ7B 1Q2WA 1J16A 4BAQB 1O38A 4CRGA 1K1NA 4ABFA 2BOHB 2IJOB 1IQHA 1A5GH 2P8OB 3PV5A 4CRBA 3TNSA 2W6ID 2QIQA 1SHYA 1D3DB 1O0DH 1NROH 1PPHE 4K69A 1AKSA 3A82A 1EAIA 4I33A 1GG6C 1P57A 4DCDA 1AWHB 1BRUP 3SORA 1UTOA 2XRCA 4U30A 1NFWA 5FX5A 3AW0A 3N7EA 3SI3H 2AMQA 1P02A 3LT3A 1LHDH 4AN7A 3SO3A 1JOUB 1Y3VA 4A6LA 1D9IA 2A0QB 1AFQC 1GMDF 2VVCA 1TX6A 1V2MT 3C27B 1VITH 2D8WA 1C5OH 5C2ZA 1M9UA 1QRXA 1MKXK 1ZZZA 2F9VA 3CP7A 2BB4A 3F1SB 4AFZA 1C9TA 1N8OC 2ZDKA 4Q4LA 5A0BA 1F5KU 3SU2A 2HOBA 1CA0C 5EW2H 4WXIA 3RMOH 2EC9H 4MNWA 3A86A 1K21H 1GVKB 2VB0A 5E2OA 3KCGH 3A7ZA 4ZKRU 4AX9H 3A8AA 1L1GA 1A61H 2Z9IA 1G2MA 2BM2A 2ZTXA 5LPFA 4P00A 3RU4D 4GHQA 2EY4C 2BDYA 1UW7A 4UFDH 2XW9A 4HGCA 1YCPK 3H7TA 1YLCA 1G30B 4ZAEA 1FY1A 3TK5A 1DY8A 1P2NA 8GCHG 1ZRBA 2ZCLP 2SGFE 4UD9H 1LO6A 1SFQB 3E16B 3M3SA 3PTBA 1Z8GA 1ELAA 3BEUA 2VWOA 2G4TA 5T3HA 1Q31A 2ANWA 1RIWB 1LHEH 1OWJA 1FLEE 2BZ6H 2QN5T 3TIUA 2YOLA 2RFKC 1HAGE 1NRQH 2G5VA 1MTSA 1HJAC 1V6DA 3U8OH 1SR5C 1O3AA 2KCPA 3E3TA 1DSTA 4ISNA 1F5LA 2ZTYA 1YPHC 4FU7A 4B74A 3SU0A 1O2UA 2TGTA 1GI4A 4Y7BA 1J9CH 4Y11E 1MCTA 1YWUA 3MH7A 3UWIA 1GHVH 1O3EA 1A4WH 1SOZA 1JIRA 5FPYA 2FYQA 4GHTA 1NM6A 4ZHMU 3MNCA 3P92A 4XRNA 4AZ2B 1JXPA 1GMCG 3G01A 3RXQA 2EEKA 5DK1A 3DSOA 2BDAA 2DE9A 2JH0D 3MO9A 2JJ1D 5KEDA 1YPKH 1E79D 1GBLA 8GCHF 1OP0A 1SQAA 1F0TA 5EXNA 1HAOH 2OQUA 1ANCA 4RT0A 1DY9A 1CGHA 3K9XB 1LHCH 4IMZA 1FV9A 3TJNA 2B5TB 3VB7A 1O3GA 5EPYA 3LKWA 4ACAA 3TH4H 4NFFA 2ZFSA 4TPIZ 5FHTA 1YM0A 4ZCNA 5C5NA 3TU7H 2CHAB 2VH6A 4B2CA 1TPOA 2YMSC 4FUIA 3KQ5A 4NGAH 5JFBA 2ZDLA 1H4WA 5A8YA 3SGBE 4CRFA 2FO9A 2ZDVH 2PLXA 2BD7A 4FU8A 4OS6A 1W12U 1ETRH 3TJUA 3DD2H 1C5VA 2OC7A 3T25A 4CH2B 1DS2E 1P9UA 3A80A 2AEIH 1V2TT 2V3HH 3S9BA 4XBCA 1C4Y2 4F48B 4H42U 3PMJA 4JYVH 1QB1A 3F9EA 1U6QA 2HWLB 2HVXA 3GY8A 7LPRA 3RXGA 3PLBA 3M3TA 1D6RA 1YPHE 1GJ6A 2OP9A 3I29A 4NG9H 3UUZA 3DFLA 2BD8A 3BTTE 2TRMA 4RN6A 1EPTC 3GCNA 5EQSA 4X2XA 4E06H 1OWIA 3UTUH 3KYFA 4Y0ZE 1AHTH 1RS0A 1K22H 3A7XA 4WMFA 2NU3E 1YPMH 3OY6U 4MPVA 2STBE 2WPDD 2I6QA 2Y7XA 2BZAA 1O5CB 2FTMA 3ENSB 2Z9JA 2GMTB 1AD8H 2H2ZA 5C94A 2VWMA 1C4U2 5JBCS 3I78A 5C0UA 4DW2U 3SGAE 7ESTE 4XSKU 4E7NA 1PPZA 1C2DA 1TX8A 1O3JA 1O35A 2OYAA 3GCOA 5CHBA 1DWBH 3P8NA 5GWZA 1AI8H 1PPCE 1V2LT 1O2TA 1QTFA 1XXFA 3MI4A 4ABBA 2AMPA 2XNDD 4KKDA 1HNEE 1UHBA 2A7JA 1F92A 1BTHH 3OYPA 4X6PA 4ISHH 1HJ9A 1QBNA 3MNSA 1C1UH 1P3EA 1Z8RA 1ELCA 2BD9A 1SLUB 3ZZ7A 1BMFD 3O8BA 1S6LA 3O8DA 3UPEA 4NZQA 3PMHB 3U1JB 1EUFA 4KP0A 3RXDA 1CQQA 3KGPA 1VITG 3SV9A 1MKXH 1TGCA 4OS1A 2IPQX 1NN6A 1P05A 3SNEA 5FCRA 3T28A 2PTCE 3V0XA 5AF9H 1DICA 3FP6E 1C5RA 1O31A 2TGAA 1ZJKA 1QZ8A 1KXDA 2ZZUH 4AC9A 4DOQA 5FPTA 2GJGA 1ELFA 1FMGA 1XUGA 2EI8A 1C1MA 3GYMA 2LELA 3S7HB 1P57B 4OS4A 1K1MA 1W11U 5FPSA 3TITA 3IG6B 4GUXA 3FO8D 1KXBA 2OK5A 1AB9C 6GCHF 2OBQA 2ZFRH 1DOJA 4I32A 1YCPH 3ZV8A 2FP7B 1ZHPA 1EJMA 2XOKD 3R0FA 3SNAA 1GJ8B 3HK3B 3VB6A 3ZVCA 2Y82A 2UUJB 3SZEA 2CF8H 1GCTC 5I25A 3RDZA 3F0PA 3RLWH 3OAAD 1BCUH 2GZ9A 2AGEX 3AASA 1ID5H 2Y5HA 4AGJA 2WSSD 4VGCC 4MPXA 4ASHA 4CBNA 3RXIA 2BY6X 2ZCHP 4ZUHA 1TQ7B 5DP4A 3RXBA 4WF8A 4BXWA 1UTLM 1O2QA 1Z7KA 1EZXC 1PPEE 3BTQE 2ANMH 2NU4E 4Y8XA 1MU6B 1UK4A 2ODQA 5K7RA 1VITF 2JA4A 1F5RA 2PTNA 2VIDA 1P11E 1NBME 1QFKH 1BQYA 1W0JD 1UTQA 1CA8B 2B7DH 4WY3A 1C1PA 2HNTF 5F6MA 5A0CA 1ZMNA 3AVZA 3SU5A 3KIDU 4LOYH 4CHAC 1WBGB 3UAIC 2WPLS 1Y5UT 1S6HA 3DT0H 2PKSC 1D3QB 4NSYA 2R3YA 3O8CA 4FXGH 2K8IA 1GMHF 1EZSC 2WHXA 4ZXYH 2ZGBH 3RXMA 1KYNA 4ZHAA 2ZF0H 2PFEA 4Q80A 2R2MB 4MNYA 2UUKB 1GI1A 4WXVA 1GBFA 1C1QA 5C1UA 2ZFPH 3A8DA 5C17A 3A7YA 1O2MA 4MPWA 1ABIH 5GPIB 4DT4A 1QGFA 5L2ZH 4FUJA 4TPYA 1HYLA 2C93B 3IWMA 2ZP0H 1SBWA 1HAPH 1WDIA 2ASUB 2BVSH 2BY8X 4K2YA 1UMAH 3LGYA 3SV2H 2ZWLH 1QR3E 3VGCB 1GBJA 2ODYB 3QK1A 2H9EH 1YPJH 3W1EA 1NT1A 1LDTT 4TT3D 1XUFA 1GI2A 1QA0A 3MOCA 2GCTC 1EJAA 1C5LH 3BTME 4THNH 1MCVA 3RXTA 2PP6A 1MZAA 3A87A 1TPPA 1P09A 2H1UA 3P8OA 1NZQH 2J34A 4X1PU 2KCYA 4B71A 3FVFB 4KELA 3ZVEA 1O32A 1P2IA 1SLXB 2O8UA 2W7UA 4OS2A 1G3CA 3MH4A 3LH3A 2ZA5A 3GY3A 4MG3A 2FI5E 1XUJA 2P3FH 5C1YA 4YTAA 5EU8A 2GDDA 2W7SA 1T4VH 1K9OE 1TIOA 1UVUH 1AVXA 1O2GH 5JBBS 1GL1A 1DWDH 1DPOA 3ZVBA 3CS0A 3N7DA 3UQOA 1EFRD 4X1QU 1XUIA 2W5EA 3PMAB 2DUCA 3PB1E 2BQ6B 3PWBA 2P94A 2Q6GA 1GI7B 2JKHA 3EAJA 2ZU5A 1GDQA 1S84A 2A5IA 1QURH 1AMHA 1OYTH 4FUHA 3DHKH 1G37A 2ZFFH 4UFFH 1TRNA 1PPGE 1ZTKA 1OKXA 1SG8B 1QB9A 2HLDD 4K8YA 3EYDA 3OY5U 1ZYOA 1YPGH 5JBTA 1KTTB 3M5MA 1PJPA 4B6FA 1ANDA 2OBOA 1NRSH 2VIOA 1LKBA 5GIBA 1WUNH 3A7VA 1O3HA 4M9FA 1C5PA 1TALA 1RTKA 2QF4A 2AIQA 3LH1A 4RSPA 1MTWA 2OCVB 3OEHD 4MVNA 2OY3A 3UR6A 4Y71A 4XDEA 1IHTH 1AFQB 1C2IA 3EE7A 1YLDA 3UY9A 3ZVFA 3VEQB 4SGBE 1EAUA 1T8OA 3DCLA 4F49A 1V2JT 2BX3A 1XVMA 1BY2A 3KHVA 3NUMA 1SPJA 1EXFA 1Y3XA 1CA0B 1MUEB 4RKOB 5HM2A 1DUEA 4ESTE 2J9NA 1ZMLA 4H6SB 1C5QA 1UTKA 5FBEA 2VINA 2Y81A 2ZO3H 1INCA 1K1PA 2C4FH 3ZYDA 1BTXA 2XBXA 1P03A 3RC5A 1F0SA 1ZPBA 1UHBB 4YOJA 1C5SA 2R9PA 1W8BH 3NCLA 4NA9H 2GT8A 3P8GA 4AFSA 1TE0A 2UUFB 3N7OA 2C8ZB 1KIGH 3SGQE 1NRRH 1VGCB 1RTFB 3QTOH 4Y7AA 3L33A 5IK2D 2H9HA 4IN2A 2BQ7B 3M7UA 1V2OT 1MD7A 2IJD1 1DITH 4ISLA 1QQUA 1ZGVA 1AUTC 4CRCA 1LPKB 1ZRKA 1KXFA 4WMEA 1HJAB 5T6FA 2XWBI 2JH5D 1O2OA 3RMMH 2EA3A 3GCTG 1IOEA 5IDKA 1WXRA 5DKMA 5TJXA 3M36A 3TVJB 3A8BA 5EODA 1TAWA 4FU9A 3SNBA 1ELVA 5L30H 1BOQA 3RXOA 4ABEA 1A3BH 1EZQA 4UE7H 2WPKS 1HUTH 3LGWA 3P8FA 5J4SA 2GT7A 3M37A 2FDAA 3PRDA 2P3UB 1TRMA 1Z8IB 4ZKOU 1UCYH 1H9IE 2BYAX 4BTIB 2F43B 2ZTZA 1CHOG 2C8WB 1K1IA 2ZKSA 4ABDA 3OFND 4K1TA 1MAYA 1P2JA 2W3IA 1SGEE 3TH3H 1F0UA 4AGKA 1QRWA 2SNVA 5EG4A 3RMLH 5GJ4B 1PYTD 1OWHA 2XCFA 3TPIZ 3NZIA 1WCZA 2LPRA 3F6UH 4Q7XA 1L0ZA 2WPMS 5ESBA 2Z9LA 3SYJA 3BG4B 3PM3A 2FZZA 3F2HA 1IAUA 1K0HA 2A4RA 3LIWA 3B8JA 3UR9A 2NU0E 3MH6A 3LGUA 3CS7A 2J2UA 2ANYA 5GCHF 1O3PB 1TNHA 1O5DH 2YMSB 2ZDMA 1HRTH 1UTPA 1MMJN 4YT6H 3GCTF 1E1QD 3KN2A 3CNRA 2ZCKP 3ELAH 3D49H 1ZOMA 3D65E 4UONA 1ESAA 4WH8A 4Z0KA 1GHAG 1XMNB 3OSYA 1EJNA 6CHAC 1DFPA 2Z94A 4HFPB 3HK6B 3A84A 1BA8B 2PSXA 1MBMA 3ZVDA 2PSYA 1E0FD 1PQ7A 2ULLA 2R0LA 1C1VH 3FKSD 3SNCA 3M35A 1CHOF 1YBWA 2JDID 4NIVA 5EQQA 3PV2A 1FIZA 2F4LA 4JMYA 1ORFA 1F2SE 3RU4E 4AG2A 3Q3YA 1B0EA 1Z1JA 3E0NB 1N6XA 2O8TA 1GBTA 2JJ2D 4NA8A 1LTOA 1UO6A 3GOVB 1EPTB 1SGPE 2YNBA 3FP7E 2RA0A 1SGFG 1C5MD 1P8VC 3VXEH 1DUAA 5CHAC 1V2RT 4MTBA 2BQWB 1FN6A 2LP6A 3CENA 1TA2A 4AG1A 1NFYA 1TMUH 1J8AA 4MNXA 3F68H 3E0PB 2GCHG 1V2PT 2VNTA 4LK4A 3PV4A 5ABWA 3RXRA 1O5EH 4INHA 2FOAA 2ZU1A 4XE4A 5EPNA 2CJIA 5EW1H 1H1BA 3TLOA 2XC0A 2ALVA 1AN1E 1CE5A 2ESTE 4JYTA 5CDFE 1LVMA 1HB0B 3KF2A 2G8TA 1VJ9U 2BDHA 2UWOA 1IQIA 1H9HE 2WV9A 1W13U 4D7FA 3JZ2B 3SBKA 1BTPA 4I31A 4DIIH 1YLNA 4ABHA 4Y8YA 2QXJA 3GY5A 3NXPA 2AGGX 4NWKA 2GP9B 1O3IA 2JETC 1RRKA 1A7SA 5A2MH 5GNDA 1QNJA 2ZGCA 3MTYA 1YGCH 1W0ZU 5GDSH 1O3DA 2F9NA 1W7XH 2BXTH 4J1YA 1GBDA 1FQ3A 1NPMA 3LOXA 3UOPA 3S7KB 5T6DA 1J14A
chains in the Genus database with same CATH topology
3ODDA 2QXIA 1P2KA 1XKBC 3MU1A 4X8TH 5DP8A 1CVWH 3RUOA 1S83A 4DVAU 1AY6H 1GHBG 3RM2H 1EAWA 3TGKE 4YOGA 1HIAB 3DUXH 2FTLE 1O3KA 3FZZA 5HGGA 5DP5A 2ZFTA 1GJAB 2GCHF 1VR1H 1KDQB 1C5TA 3MU8A 1HGTH 1FUJA 4DGJA 4O97A 5A8ZA 3BIVH 3UWJH 1TNLA 3SOSA 2FXRA 4RKJB 1FXYA 4KTSA 3GICB 1SQOA 4JZFH 4BAHB 1LMWB 4CH8B 4WH6A 4H6TA 2GZ8A 1GHXH 1Y3UA 1V2ST 3ESTA 3SJ8A 3UFAA 1CHGA 1O3LA 3T27A 1TA6A 1AB9B 1SL3A 2IN2A 2PW8H 4FVBA 1O2NA 1GBEA 4BNRA 1ZSLA 3SUFA 3ATMA 4OS5A 1CT2E 3RXAA 1UK2A 2OC0A 1KLIH 4CRDA 4IC6A 1KY9A 1OP2A 1T7CA 3UQVA 2BLVA 1GCTB 4O3UA 3GY2A 1PFXC 1O5EL 4JZ1A 1YPLH 4AB9A 1QJ6B 2WUCA 1GJ7B 2A5AA 5A0AE 2PUXB 1GDNA 2A2QH 4VGCB 2RG3A 5DO4H 4NCYA 1T31A 2FX6A 1GL0E 2R2WU 4IGDA 2CN0H 4FUFA 1KXCA 2ZGJA 2G00A 1HPGA 4WVPE 1GJ4H 3QUMP 1GMCF 1FPHH 2O9QA 2BD4A 1MKWK 4Q2KA 1EOJA 2VIWA 4CHAB 4H4FA 3GYLB 1OWKA 2PKSB 1OS8A 4O03A 2BX4A 2A5KA 4XBDA 2TIOA 1JRTA 5A8XA 1QCPA 3O8RA 4D9RA 2A4OA 1EX3A 1SGFA 3A7WA 4I8HA 2TBSA 1SSXA 3M5NA 1QY6A 1ZGIA 2OLGA 4DY7B 1V2UT 4E05H 2H5DA 5G4BA 3I77A 1O37A 2WPIS 1UVPA 1IQFA 1TONA 1W7GH 1A5IA 3K2UA 1F0RA 2RDLA 3E6PH 1GPZA 3SI4H 5LPRA 1H8IH 5DGJA 2VGCC 3OTJE 2ZDNA 3A8CA 3BV9B 2Z6BD 1P0SH 5FAHA 1CGJE 3RU4T 1TX7A 4YOIA 3MFJA 3M5OA 1V2KT 1OX1A 3VXFH 1C2KA 4X1RU 1O34A 3FAOA 1ZPZA 1HFDA 1A3EH 1AWFH 1GI8B 4Q7ZA 1MQ5A 2H5CA 4SGAE 5J4QA 4A92A 1O2PA 2Q1JA 2J95A 2F83A 1LVOA 4KTCA 4HTCH 3TGJE 1Y5BT 2BVRH 5TCAA 1O30A 4B2BA 2A31A 2B9LA 1B5GH 1MD8A 1FPCH 4DIHH 1IQEA 3SNDA 1C1WH 5AHGH 2WPJS 1HBTH 3SJ9A 4IMQA 4ABIA 2XNIA 1OPHB 1G32B 3HGPA 4UEHH 1TGTA 1ARCA 2J92A 1MU8B 3FFGA 1L1NA 1TMTH 8KME2 2A7CA 1TNIA 5AFYH 1RTLA 1AVGH 3P17H 2J4IA 2WYGA 3RXFA 1SOTA 1KTSB 2XBVA 5E2PA 2A32A 3SU1A 3VB3A 4KTUA 3UIRA 2AMDA 2STAE 3RXLA 1XM1A 2CHAC 4UFGH 1HCGA 5I46H 1ELBA 3U69H 1MQ6A 4FVDA 3SV6A 3KQDA 4IN1A 2BMGB 4PROA 3F9HA 2Y5GA 3RXHA 3U1IB 3QGNB 1HAVA 3RXUA 2F91A 2FOMB 1GBAA 5F8TA 2V0BA 5EQRA 2FOEA 1A5HA 2FM2A 1SGDE 2Y80A 3EA9A 1EQ9A 5FX6A 3M7TA 1TGSZ 1BBRE 1ZSJA 1BRCE 3B9FH 2ZU4A 1P06A 3OX7U 3EGKH 2NWNA 3ZZ5A 2RA3A 5DPAA 1DX5M 3M5LA 1VCWA 2FMJA 2Z9KA 1SGIB 3SQHE 1DSUA 1HAZB 1NO9H 2XYAA 3BTHE 2HNTE 5BPEA 1FN8A 1OOKB 2FLRH 3DA9B 1C2LA 1ELGA 1EPTA 2OTVA 1ELEE 2P16A 2OUAA 3K6YA 4Q7YA 1SB1H 3S9CA 3SHAH 4ISOA 1TBRH 4MPUA 1QB6A 1BDAA 3E8LA 2F9PA 1IQGA 1HJ8A 1AUJA 1TGNA 2WUBA 3BIUH 4DJZB 1O2KA 3C1KA 1C5XB 2CXVA 1BB0B 4K1SA 5EGMA 1ZR0A 1X7AC 1HDTH 1OYQA 5CE1A 2ANKH 1O2LA 1SLVB 2ZI2H 3RP2A 3UNQA 3AAUA 4INLA 3K65B 2BD5A 1C4V2 3SV7A 4YM9A 2WV5A 1E38B 4JCNA 1BBRK 1FY3A 1O3CA 2XXLA 4QT8C 2CF9H 1BTUA 2ILNA 1WAYB 4X2YA 2QF3A 1MKWH 5C1XA 5FBIA 3LDXH 3GY4A 8LPRA 3QZRA 4O9VA 4JZIA 5LGOA 1S81A 1RGQA 1DE7H 3KQBA 5EXMA 1GHWH 4ABAA 2ZPRA 2DE8A 3E1XB 3MNBA 1P2QA 1BUIA 2VU8E 1CU1A 1O5AB 1TOCB 2F9UA 1C1NA 1HIAA 1Z6EA 2ZGXH 4BTUB 4XBBA 2BXUH 4BXSA 1SI5H 3PO1C 3T2NA 2FS9A 4AFUA 3LGVA 1GVZA 1KDQA 1ZTLA 1P2OA 1WQVH 1W3CA 1QQ4A 4A1VA 2Y7ZA 2BDBA 4Y76A 4K3JA 2XWAA 1C5WB 1GG6B 1ETSH 1FNIA 2P93A 4DG4A 3L3TA 4HZHA 2GD4B 3BTEE 2XC5A 3TK9A 2XBWA 1GCDA 2R3UA 3Q76A 1AIXH 2HRVA 3LU9B 5EOKA 2JOPA 3LONA 2ZQ2A 3MWIU 4ZKNU 4B75A 1EP6A 3Q3KA 3BF6H 4NSVA 3SUDA 1OWEA 5HM9A 6CHAB 1EATA 4NIYA 3U8TH 2ODPA 2P3TB 1RFNA 3RXSA 2OINA 3TH2H 1A0JA 1AVWA 1B0FA 5GXPA 1DWCH 1FDPA 2OTTX 2UUYA 1O2XA 2SGEE 2VIVA 7GCHG 4NWLA 1N8OB 4K5ZA 3BG8A 3SU3A 1PQ5A 3ZYEA 1FY4A 4MNVA 2FODA 3NWUA 2ZDAH 2BLQA 2Z3CA 3MHWU 3PLKA 2PKAB 1CT0E 5CHAB 3S0NA 1P3CA 3GCHC 2G51A 1GI3A 7KMEH 8ESTE 5L2YH 1W0YH 2PWXA 2WV4A 3LPRA 3T5FH 1E35B 3HGNA 2M5TA 1A0LA 2O8LA 2UWPA 1TBZH 3E90B 2V35A 3QZQA 2FI4E 1GGDC 1OP8A 1GI0A 5JPMH 2GX4A 3L6PA 4I8LA 3BN9A 3QO6A 3ZVGA 1P12E 1PPFE 3VPKA 5T6GA 1C5ZB 1DM4B 2YNAA 2ZPSA 1CSOE 1ARBA 2ZC9H 3P95A 3BTGE 2JETB 2NU2E 2O8WA 2BDGA 4X2WA 2A4GA 3ZZ8A 2BTCE 1NS3A 3QWCH 5F03A 1SGTA 2C90B 1K2I1 1O36A 3QN7A 2V6NA 3W95A 3BTDE 1HAIH 2QXHA 1KSNA 1HAYB 3RXPA 3EE0B 1EKBB 3KQCA 1OSSA 1TLDA 1V3XA 1SVPA 4GPGA 4ZXXH 1BJVA 1HXEH 1L1JA 2A4QA 3U8RH 5E0HA 3F9GA 4NIXA 2FS8A 2PHBA 3A88A 4OS7A 4X1NU 4J2YB 3HKJB 1BT7A 3UOUA 3PLPA 1FZZA 1WV7H 2ZHDA 4LZ4B 3A81A 4FUEA 2K1QA 3ITIA 1GI9B 1HLTH 3QTVH 1AGJA 1XX9A 4U32A 1Y5AT 1LHFH 1OXGA 1C1TA 4XOJA 1Z71A 1Z8JB 1SMFE 3LJOA 1BMMH 3OU0A 3URDA 4AORA 1TPSA 4X0WU 1GVLA 3P6ZB 3NPSA 1P01A 1BRBE 1G3DA 2G55A 2I6SA 4D7GA 1ZPCA 1LPZB 2W3KA 1HAVB 1GJ5H 3GDSA 5A09A 3SQEE 1XUKA 2ZHFH 4BTTB 3TJOA 1B7XB 1YYY1 4A1XA 1FONA 1GJCB 4X8UH 3B23B 4B1TA 3F9FA 2ZIQH 3MYWA 3BSQA 1DVAH 2QV1A 1GBIA 3URCA 2BLOA 1SGQE 4GVUA 1NFXA 1ESTA 1UVSH 4GLYA 4ZHLU 5H4IB 1XUHA 3EA7A 1BIOA 1V2NT 1QJ1B 1BTWA 1O2HA 5AVDA 1IQKA 4AOQA 1FJSA 3MU5A 2PUQH 1SLWB 1ZHRA 1DANH 1BBRH 3JZ1B 2RCEA 3R3GB 1XVOA 4UDWH 1W10U 1CBWC 1O3FA 5JBAS 3RMNH 2FEQH 1ESBA 1NTPA 2G81E 4AB8A 3HPTB 4TYDA 1FY5A 4NA7A 3FP8E 2R0KA 5DP6A 4CRAA 1LVYA 5ETXA 4TWWA 1O33A 3BEIB 5F8XA 4D8NA 2QXGA 1NESE 2PGBB 3SJKA 1K1JA 1EAXA 3GDUA 1SQTA 4UFEH 4X6OA 5ESTE 1YPEH 1BTZA 4INKA 1WU1A 2HLCA 1QL7A 1YKTA 5DP7A 5E0JA 1YCPM 4FUCA 1GJ9B 3SJIA 1QL8A 2TGDA 1TQ0B 1OWDA 1LVBA 2GKVE 1GHAF 2ZNKH 4WWYA 2Q6FA 2HPPH 3H5CB 3V12A 1O2WA 2VGCB 2ZHWH 5FXLA 1YP9A 2BVXH 1BHXB 3EQ0H 4ZROA 3TGIE 1K28D 1VGCC 1QHRB 1TPAE 1JIMA 2Y5FA 1LQDB 1N1LA 1VZQH 2GVFA 3UREA 4ZMAH 2NU1E 1AU8A 3FZDA 1NU9A 2XBYA 1MTNC 2ZU2A 1THPB 1ACBE 1GHZA 1GBBA 4D9QA 1FY8E 1QBOA 4X2VA 2QGRA 4AYYB 1A46H 3LC3A 3S69A 3FANA 1ELTA 1GI5A 3M3VA 1UTNA 1PQ8A 2HGTH 3QLPH 1UK3A 1W14U 3BTWE 1W2KH 4IW4E 2PR3A 1BZXE 5IYTA 1HAHH 2AS9A 3U98H 3GISB 1S0RA 1SGYE 5HYOA 2HALA 4JK6A 4ISIH 4JZDH 1VCPA 3NK8A 1LQEA 2BDCA 2AERH 1O5FH 1VCQA 1TGBA 4HI3A 2ZQ1A 4K60A 3A89A 1ABJH 3ATWA 4YT7H 4LZ1H 1GI6A 3MNXA 1FAKH 1FIWA 1AE8H 3EDXB 2D1JA 1S0QA 4FUGA 1EASA 1NY22 2AGIX 3S9AA 2FOFA 2IPHA 2D26C 2SGQE 2SFAA 2VWNA 1FI8A 2P8OC 1BMLA 3BG4C 4X1SU 1C5YB 2BHGA 2WPHS 1GBKA 2ZU3A 4MQAA 3P70B 1QL9A 1THSH 1WSSH 4X8VH 1O3NA 1GHBF 2OD3B 4BAKB 3QDZB 3HATH 1C1OA 3RM0H 5LH8A 1O3OA 2WINI 3LC5A 3BTKE 1LHGH 1GDUA 4ZKSU 1WQSA 3AW1A 4NZLA 4IS5A 1C2MA 3PWCA 4KGAA 4DURA 1G3BA 1G9IE 3STJA 4CR9A 4GSOA 3T26A 1UJ1A 1D4PB 1GBMA 2C8XB 2UWLA 4FUDA 3DFJA 2VIPA 3ZZDA 2HPQH 4I7YH 1TNGA 1DWEH 1DXWA 2VVVA 2ZECA 1A0HB 1O2YA 1C5NH 3VFEA 1NC6A 5TCCA 4WMDA 4JZEH 1GJBB 4CR5A 1ZLRA 2GZ7A 5C3NA 2G4UA 1DLEA 3M61U 2Z3DA 1BMNH 2PKAA 2XC4A 4ABGA 1JBUH 2QC2A 3PROA 3W94A 3QX5H 2BLWA 1O5FL 4U01A 4IC5A 1C1RA 4JYUH 4WJG2 5EXLA 5DP9A 2JH6D 1UVTH 3KEEA 3LGTA 4TY7A 1C5UA 1NU7B 3SU6A 1BITA 1N6YA 1RIWC 2VIQA 6GCHG 2GCTB 1XKAC 4IBLH 2KAIA 1G3EA 2QYIA 3MMGA 4X6MA 3KL6A 4NFEA 2AH4X 4B73A 1AFEH 1T8MA 3MH5A 2P59A 3ZVAA 1E34B 2B0FA 3IITA 1TABE 1UVOA 2LNCA 1NRPH 2BOKA 5K0HA 1O2ZA 1EB2A 1P04A 5E8EH 5AFZH 1O39A 2ZG0H 3Q00A 1EP5A 2AIPA 2Z9GA 2HNTC 4O3TA 1HXFH 1NFUA 4Y0YE 3PTNA 2XTTB 2ZHEH 3TNTA 1IQLA 1T8LA 1CT4E 1E37B 4FUBA 2QCYA 3RC4A 1C2GA 2FIRH 3RLYH 1KXAA 5DG6A 2VWLA 3MU0A 2BD2A 2A1DB 3RXCA 1UCYE 2PV9B 3D23A 1J15A 2FX4A 1V2QT 9ESTA 1AO5A 3PO1B 1S6FA 3MO6A 1AKSB 1CGIE 2A45B 1TNJA 4I8JA 4BANB 3ZZ6A 1Q3XA 2AFQB 2FOCA 1MTVA 2SGDE 6ESTA 2Z7FE 2ALPA 2Q6DA 1GMHG 1HAXB 1WTGH 1ZMJA 2GV6A 1MBQA 2FLBH 1SFIA 1ZSKA 1UTJA 4GCHG 1C2HA 1S5SA 2H9TH 3E91A 1BHXF 4A1TA 3GY7A 1L4ZA 2WYJA 5C67A 4B2AA 4CREA 2CMYA 5C20A 3QGJA 1TBQH 5L6NH 1SGCA 2BD3A 4D76A 2F3CE 2OC1A 1O2RA 1O2SA 5F8ZA 2ZEBA 1JMOH 4R0IA 4R8TB 2GV7A 4YZUA 3MU4A 3LJJA 5BRRE 1SGRE 2A7HA 1THRH 4I8GA 3TJVA 2THFB 6LPRA 1Y3YA 1UCYK 2V3OH 1DDJA 2G5NA 3GCHB 4GAWA 1H8DH 2EI6A 2TGPZ 3KNXA 2Y6TA 3Q3XA 1TNKA 1O5GH 3Q77A 2FWWA 4A7IB 4Y10E 1AE5A 1PQAA 2EI7A 4Y79A 1GGDB 1F7ZA 1E36B 1TMBH 1S85A 4X8SH 3TK6A 4XFQA 2J38A 4YLUA 2PGQB 3A83A 4GCHF 4Y6DA 2GMTC 5HMAA 1Y3WA 1MTUA 2O8MA 2BY7X 9LPRA 1GBHA 1H9LB 4A5TS 2BDIA 1WOFA 3V7TA 3MO3A 3STIA 2C3SA 2FOBA 3RC6A 3WY8A 4BAMB 2VVUA 1RD3B 1P2MA 4K8BA 1ANEA 3SU4A 1G36A 3V3MA 1NRNH 1S82A 1BJUA 1EZUC 1O2IA 2H6MA 1AZ8A 3ATKA 1RXPA 3ATIA 4TWYA 5HXFA 1C9PA