1Z8GA

Crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
Knots found
sequence length
369
structure length
366
Chain Sequence
EPLYPVQVSSADARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGAAGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine protease hepsin
publication title Hepatocyte growth factor is a preferred in vitro substrate for human hepsin, a membrane-anchored serine protease implicated in prostate and ovarian cancers
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 366
sequence length 369
other databases KnotProt 2.0: S -31
ec nomenclature ec 3.4.21.106: Hepsin.
pdb deposition date 2005-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF09272 Hepsin-SRCR Hepsin, SRCR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8gA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1z8gA03
3.10.250.10 Alpha Beta Roll Mac-2 Binding Protein SRCR-like domain 1z8gA01
2W5EA 1AY6H 1TNIA 1G2MA 2XCFA 5J4SA 4IGDA 3BEUA 1BUIA 2SGEE 5GCHF 3FAOA 2GDDA 3NXPA 1U6QA 1AIXH 2Y80A 1MKXK 3Q3KA 1Y3YA 1CE5A 2Q1JA 1QRWA 3P70B 1GJ8B 1LVMA 4GSOA 5DP7A 9LPRA 4UE7H 1EOJA 3A82A 1TGBA 1HAHH 3MO6A 2OBOA 3P8OA 1KXDA 1EX3A 4ABDA 1TLDA 2FZZA 1O3AA 1Z6JH 3F9EA 3ZVFA 1EJMA 2NU2E 2JP0A 2WPHS 2ZHWH 1S81A 3U8RH 3SNBA 5J4QA 2QAAA 1MTSA 3MU5A 1VZQH 1HAGE 1G3EA 2R0KA 5EOKA 2OP9A 3SU5A 2A0QB 3VB7A 3R3GB 1W7GH 1DXWA 2D2DA 2ZDLA 3RXUA 1ZPZA 2P59A 5L2ZH 3GDVA 5DG6A 4VGCC 2BDAA 3GY2A 2P8OC 3PROA 3TK9A 4DGJA 3A85A 3E0PB 2XC5A 1FONA 3FP6E 1GBDA 1Y3VA 2BDYA 2QA9E 1IQEA 1YLDA 1ZYOA 4ZH8A 2PR3A 3H7OA 1QY6A 1DWDH 3RM2H 3STIA 3K2UA 1DLEA 1O3HA 2PW8H 2GV7A 3UTUH 1GWAA 3ZYEA 2Y81A 3RUOA 3MYWA 1FY5A 1V2MT 2QXIA 1O37A 1TNGA 1UMAH 1NM6A 4NIWA 4XBDA 3GYLB 1BMAA 1EPTB 4ZHLU 3VB6A 1GMDG 4AG1A 2AGGX 3K65B 1L4DA 3SV2H 1O36A 1UTMA 3Q3XA 4D7GA 4K1SA 1DWEH 4ABAA 3TGKE 3HGNA 4X6MA 4Y76A 1XMNB 2ZO3H 3ENSB 3RC4A 2C8WB 4ISHH 2GDEH 4J2YB 4YOIA 3SHCH 2ODQA 2VIVA 2HLCA 3QDZB 1BZXE 2FESH 1XVOA 4IBLH 3ZVCA 2PWXA 1ZSJA 3HPTB 3UNRA 2FWWA 1MTNC 3SV8A 4BAKB 2WPJS 2XNIA 2H6MA 2C8YB 4GHTA 3C27B 3RLYH 1EB1H 2OC1A 1W7XH 1PYTC 1JWTA 2XRCA 3AW1A 1LVYA 3I29A 1UCYH 3ZV8A 3U69H 3SORA 1W0YH 5ABWA 1QTFA 1RGQA 3SI3H 1MCVA 1SBWA 3A80A 1CSOE 5BPEA 3BTEE 3MWIU 3P95A 3KIDU 1OWDA 4ZXXH 1O35A 4DY7B 1TGSZ 3T27A 2ZFSA 4A1TA 1V2ST 1N6YA 3BIVH 2ZFFH 3GOVB 3LGYA 4JZIA 5GJ4B 2R3UA 3TITA 1OWHA 3P17H 3BTHE 4FU7A 1BMMH 1AZZA 2OC7A 3U8OH 1B0EA 4AN7A 1O3BA 3UWJH 5SGAE 4K1TA 5E0HA 2PTNA 2FI4E 1F92A 3V3MA 2QF0A 4Q7ZA 5DK1A 1ELAA 1O5DH 1V2UT 4DW2U 2HVXA 2NU0E 3AVZA 1G9IE 1KXFA 1OXGA 1DUEA 2CMYA 1T7CA 3SV6A 1LMWB 3F68H 4ABGA 4AORA 4IW4E 2GX4A 3HKJB 5DP6A 2ODPA 1MKXH 4RKJB 3TH2H 2PFEA 5FHTA 4WXIA 2A7HA 1K1JA 1SR5C 2ZA5A 1HXEH 3I78A 1MQ6A 3LC5A 1O5EH 1MQ5A 2ZWLH 3EGKH 5E2PA 2R9PA 1WTGH 2PSXA 1C1NA 3SNCA 2G4TA 3OY5U 3UREA 1F5RA 3E1XB 5DJ7A 2SGQE 5E0JA 8GCHF 1FN8A 2GCTC 1FIZA 3UY9A 1O2JA 1Y3WA 1KLTA 3D65E 5F8ZA 1G32B 1L2EA 1P57A 2W3KA 1QURH 4RSPA 1QB1A 2ZPQA 3RXVA 1BTUA 2FXRA 1YPEH 3A7TA 2B5TB 3NUMA 3SI4H 1SI5H 2FO9A 1BQYA 1EUFA 2G81E 2ZQ1A 2HWLB 1NT1A 1B5GH 1K28D 3KQBA 4YLUA 2XXLA 1VITF 1QL8A 3AASA 3OSYA 2QXJA 2ZHQH 1C2KA 4GUXA 2VNTA 2ZDAH 1NRRH 2GVFA 1CA0C 5HM9A 1K22H 1NU7B 2V0BA 3SNEA 5T6GA 1AWHB 1LKAA 2BD2A 1H8DH 1VJAU 1ZRBA 3KQCA 5A8YA 1FI8A 3HATH 3LGTA 5C5OA 4BAHB 2BLOA 4NIVA 4F4OC 3Q77A 3EAJA 2G51A 3NKKA 3TGIE 1SFQB 1FLEE 1PPBH 3RC6A 1DICA 3SJ8A 2Y5FA 1AKSA 1ANEA 1H4WA 4CHAC 1MTUA 2IJOB 1SGTA 2GTBA 1TFXA 1XXFA 2BLWA 1ESBA 2Y82A 5JFBA 3SU2A 8LPRA 1EB2A 1Z8GA 1UK2A 4JZ1A 4ABEA 1HIAB 4INKA 1GCTC 1AB9C 2BQWB 2A45B 4B2CA 5T6FA 3M5MA 1BJVA 1CT4E 2F3CE 4Y71A 1OYTH 1KIGH 1MU8B 1C5VA 3QZQA 1E38B 3RU4D 3BG4B 1NN6A 1V2NT 2M5TA 1C5MD 2P3TB 1O30A 1F5KU 4TYDA 2F9BH 2O8LA 2P8OB 3PV4A 3RXAA 4YM9A 1PPGE 4I33A 2ANKH 2ANMH 4ISLA 4WJG2 5FCRA 1LQDB 3M61U 3ZZ7A 1UTLM 2A5IA 2I6QA 2FOEA 4U30A 1DWBH 3BSQA 4Z6AH 4Q80A 1UJ1A 4FUCA 1C4Y2 1C4U2 5GCHG 1DY9A 2VIQA 1G36A 1HJ9A 1F0UA 1TE0A 4NWKA 2ZI2H 1GJCB 1GHXH 1F2SE 2ZU5A 2A5KA 1FPHH 1BTPA 1C2GA 1FDPA 3RLWH 3TH3H 5LH8A 1ZMLA 3E0NB 1OX1A 2ZIQH 2P3UB 2UWLA 2XBXA 2A7JA 1ELDE 3NPSA 1TALA 4IMZA 3RMMH 1ANDA 3HGPA 1C2MA 3MNCA 3RXJA 1XKBC 4CRDA 5AFZH 2C4FH 1UHBA 2G4UA 4MG3A 3GYMA 1EZXC 1ZGVA 3ZZAA 1A46H 2OUAA 4YESB 5AF9H 1GVKB 2OC0A 4MVNA 5E2OA 1AD8H 4FUFA 3SJKA 1A1RA 2V6NA 1P04A 4Y7AA 1LPZB 1ACBE 1LHCH 1EAWA 1SPJA 1RTKA 5C1UA 5LGOA 2RA0A 2H9HA 5FX6A 3PLBA 1D6RA 3O8RA 2DE9A 1QB9A 1O3OA 1Z8IB 1ABJH 2EA3A 1T8NA 3MU4A 3QTOH 3ZVDA 1BBRH 5TJXA 2Y5GA 4GCHF 2HALA 1GI4A 1WTHD 2G8TA 3T62A 1Y5UT 4ZUHA 3ITIA 1C5TA 8KME2 1P57B 1O3LA 1TX6A 2WPIS 3VXFH 3EA8A 2ZFRH 3C1KA 1J9CH 1N8OB 3TH4H 1EXFA 1LKBA 1RIWC 1V2OT 2G52A 1GHYH 1OS8A 2FI5E 3QUMP 2FODA 2BDHA 2WV5A 2BZ6H 3OU0A 3WY8A 3KGPA 1A5HA 3TNTA 1AGJA 3QWCH 1GI9B 2A7CA 5L2YH 1CQQA 3AAUA 1O3JA 2ZECA 3PB1E 1B7XB 1HAVB 1AU8A 2VIPA 2O8MA 1MMJN 1UO6A 1XX9A 1DVAH 1GVLA 3MO3A 1KXEA 2FOBA 2H9TH 2QXGA 3V12A 4B73A 1UTQA 2Z7FE 3P8NA 2RA3A 1TPAE 1S0QA 2Y7ZA 2ZKSA 2W7SA 4OS2A 1RJXB 4MQAA 3E3TA 3BTDE 1BTWA 3E16B 1TX8A 4NA7A 5LPFA 1GI0A 3SU1A 1F5LA 3RU4E 2EC9H 3D49H 4JMYA 3LPRA 3URCA 1Z7KA 1AHTH 3UUZA 1ZPCA 3A7ZA 4GPGA 1O33A 1EP6A 3F9FA 3GCNA 1SGFG 1NY22 3A7YA 2SGPE 2THFB 4FXGH 1QL7A 3SV9A 2FS8A 4K60A 1F7ZA 2H2ZA 1BRBE 2XCNA 3TLOA 5LPEA 3GCHC 3V7TA 3BN9A 1NRQH 4Y8ZA 1G3CA 1HUTH 2FLRH 4R8TB 2VVUA 1C4V2 1OOKB 2Z6BD 4NWLA 1GBEA 1RTFB 1YKTA 3PLKA 4OGXA 1O2WA 1SQAA 4E7NA 1AFEH 2RG3A 1ESTA 3QO6A 5EXNA 5E8EH 2VWNA 2OINA 3M36A 3OY6U 3FFGA 1CA0B 1WUNH 2XBVA 1O2OA 1L0ZA 4B75A 3SU3A 1EPTA 4UFGH 4ZAEA 2J95A 1KLJH 3ATKA 4BANB 2BY6X 2C90B 4AX9H 7ESTE 1O3EA 1HBTH 2VU8E 5H4IB 2Z9JA 5A09A 1GMCF 1E37B 1C2EA 1TMBH 3D62A 1TMUH 4ZXYH 3MI4A 4CHAB 1BJUA 1HAZB 1G3DA 3SNAA 1SLXB 1T4UH 3GY3A 3RXMA 1P10A 1W3CA 1EAXA 2VIWA 2BTCE 5JBBS 3RXOA 4DIHH 1MBQA 2CHAC 1GCTB 1AB9B 4U32A 1TRNA 2OBQA 3RMLH 4FUGA 1P2KA 1ZRKA 2B8OH 2V3HH 1RS0A 8GCHG 1UCYK 2ZHFH 2FIRH 1TGNA 2CGAA 4X1PU 3U1IB 3W95A 1P12E 5CE1A 1W14U 1HDTH 5PTPA 4ABBA 2ZTYA 1P2MA 1LPKB 4A1VA 3ZZDA 1QIXB 2O9QA 1J16A 1S82A 1SGCA 1J15A 4YTAA 1O2XA 3UR6A 4E7RG 2CN0H 3MU0A 2GZ8A 4MTBA 4UFEH 1C1WH 3SJIA 3SUDA 2VWMA 4WH6A 5T3HA 1VITG 1XUKA 5EODA 3VFEA 1O2RA 3KQDA 1BMLA 2DUCA 3RXBA 4NFEA 3ATIA 1EZUC 2WPMS 1Z1IA 3SNDA 4UONA 1L1NA 2GV6A 4FU8A 3LDXH 4MPWA 1D3DB 2P94A 4JZDH 5JBTA 2JH0D 1THPB 2BD4A 1C5RA 1TPOA 2BVRH 3SQHE 3S9CA 1KTSB 2VIOA 3TK5A 1C5YB 1SGEE 1VCQA 3AW0A 2TBSA 2OYAA 1SB1H 1A3BH 1DY8A 3BTFE 1S0RA 3M5LA 3SO3A 1SL3A 3ZZ5A 1DXPA 5FBEA 5A2MH 3GISB 1MTWA 3N7OA 2ZTZA 2FMJA 1LHGH 3UWIA 7KMEH 3HK3B 4K1EA 1O2LA 1QJ6B 4YT6H 2ILNA 1GJ7B 3LGWA 1AN1E 3ATMA 6GCHF 2GKVE 2CF9H 3DFLA 1KXBA 4Y8YA 1Z6EA 2TGTA 4A92A 1FMGA 1TGCA 1UTJA 4WF8A 3SUEA 1FY3A 3QN7A 2ZGJA 1ARCA 5DP5A 1NFYA 2PV9B 4A1XA 1PQAA 2PTCE 2A32A 1ORFA 1RIWB 4MPUA 4NSYA 1GL1A 7GCHF 5EQRA 1SQTA 2AYWA 1SLUB 1YF4A 4NIXA 1YPMH 2JH5D 2CF8H 3ZZCA 5EXLA 2UUJB 1P05A 3A7VA 1GI5A 1GJAB 4ZMAH 2JETC 3UNSA 1SC8U 1YLCA 3IITA 3TJOA 1GVZA 1H9LB 4TWYA 1EP5A 1HPGA 3LJOA 1QJ1B 2YNAA 1GHWH 4FVDA 1QR3E 1NESE 3P8GA 5FPSA 4X8SH 5CHAC 1MU6B 1SSXA 2FLBH 3E8LA 1DSTA 1K1OA 3BIUH 4Y10E 1YM0A 1SFIA 2K1QA 3TPIZ 1GHBF 1W10U 5GWZA 5FPTA 1DITH 1XUGA 2H5DA 3EA7A 4JYUH 1PPCE 2Q6FA 2AIPA 1DWCH 1HIAA 4JZEH 5A8XA 6CHAC 4WVPE 4Q7YA 2F9VA 1AFQC 1BRCE 1Z8JB 3MH4A 1L1GA 1VITH 1ZJKA 2ZHDA 3GCHB 4GCHG 4INLA 3RXEA 1G3BA 3M35A 2EI6A 1CU1A 2ALVA 3UFAA 3ZVEA 1BB0B 1FPCH 1RD3B 2BXUH 1BIOA 2WYGA 1FIWA 3IG6B 1SHHB 3BG8A 2J4IA 1P0SH 1GJDB 4KGAA 1EKBB 1IHTH 1P2JA 1HJAB 1RRKA 1NTPA 1YPKH 3A89A 1P8VC 1HAOH 4HZHA 2PKSC 3K9XB 5EQSA 1VR1H 1YPGH 3EE0B 4QT8C 1OP8A 1ZTJA 3NZIA 3BV9B 1DE7H 2AERH 4KTUA 2YOLA 1S6HA 1TNHA 1PPZA 1GMHF 3M5NA 4AYVB 2C93B 1C1RA 1ZMNA 1O2HA 1LVOA 1GG6C 1DUAA 2IPHA 1O3KA 1TNKA 4B2AA 1SGIB 3A7WA 1HXFH 1Y59T 2BXTH 1ID5H 4BNRA 5L6NH 1IOEA 1XUJA 1ESAA 1JBUH 3U98H 2A4RA 5C67A 2CHAB 2V3OH 3LJJA 3RXSA 4J1YA 2ZDVH 1ANCA 2ZU1A 4AGKA 1JIRA 4DJZB 3KEEA 1RXPA 1OYQA 1FQ3A 4TPIZ 4NZLA 1SQOA 4K69A 4ISOA 3D23A 3GY6A 2Z9LA 1WQVH 5AFYH 1AE5A 1O5FL 3LGUA 3MTYA 4D7FA 4IC5A 5ETXA 2AMDA 5TCAA 1PQ8A 2EI7A 5G4BA 3F9GA 1BBRK 3ZV9A 3BTTE 3KQEA 4ABHA 1Z1JA 2XW9A 4RKOB 1FJSA 1YP9A 2F9PA 4SGBE 1P2OA 4DVAU 4O3TA 4AG2A 2O8UA 3KHVA 2Z9KA 1O2PA 1KYNA 2OQUA 1TYNA 1W12U 3E6PH 4NG9H 1UVTH 4AFZA 2A5AA 4Z0KA 2GT8A 1C2JA 1K1PA 1V6DA 2AS9A 2FTMA 1Z8RA 1A5GH 4X8VH 3P8FA 3A7XA 1O5AB 1O38A 4D76A 1VGCC 4R0IA 5E0GA 2G5VA 2FPZA 4X0WU 3QGJA 2D8WA 3EQ0H 1LCYA 1ZGIA 3PMJA 2ZDMA 2ZU2A 1GHVH 1GMCG 4HTCH 1HAVA 5C3NA 3QLPH 1C5PA 1OWEA 1Q3XA 3GCTF 1HAPH 2FP7B 3I77A 3TK6A 4THNH 1A2CH 2NU1E 1CGJE 1HFDA 2ZFPH 3S9AA 1FAKH 2I6SA 2BM2A 4XE4A 4FUEA 3VB4A 4GHQA 2PUXB 1AVGH 2FOGA 1K1LA 1KLIH 2BVSH 2QN5T 2ZCHP 1HAXB 4IN1A 1O2IA 3FANA 3UOUA 1BOQA 2J92A 4NCYA 1ZJDA 2HGTH 3A86A 1UVOA 1AO5A 1UK3A 2ZGCA 5C20A 2TGDA 4BOHA 3ATWA 4UFFH 1P03A 3R0FA 1IQFA 2FOAA 1HLTH 1E36B 2F9OA 1W11U 4ZKSU 1PJPA 1QQUA 4VGCB 3URDA 1GBIA 1K21H 3H7TA 3KNXA 1V2JT 1SGDE 4UFDH 2VVCA 1EJAA 4MDSA 1TPPA 2RDLA 1O3FA 5ESBA 4YT7H 5DPAA 1GBKA 3M37A 1SGFA 2JETB 1SGQE 3ELAH 1KSNA 4BAQB 2ESTE 3MH7A 2UWOA 5EPNA 1IAUA 3JZ2B 1GDNA 1ZR0A 1HAYB 4MPXA 1T8OA 4Y8XA 2Q6DA 5CHAB 1TNJA 5K0HA 2J34A 1OSSA 1BT7A 1IQHA 2BX4A 1C5NH 3MNSA 4BTIB 3DD2H 1WOFA 1UTOA 2HPPH 4X6OA 1MTNB 6ESTA 1TGTA 3FVFB 2BD7A 2IN2A 2ZTXA 3M7QA 2ZZUH 2W3IA 5DP8A 4TY6A 6GCHG 1SMFE 1AFQB 2ZP0H 3FP8E 1WSSH 2OC8A 1D9IA 4ABFA 2G00A 1GJ6A 1GCDA 3VGCC 1QFKH 4YO9A 4ESTE 3SUFA 3TGJE 1L4ZA 2FYRA 3MU8A 1W13U 2ZPRA 4BXWA 2QIQA 4AZ2B 4FUIA 3RDZA 1O2YA 1GBAA 4A7IB 3LH1A 1BHXF 1MUEB 3TJVA 2LNCA 4UDWH 7GCHG 1TBRH 4MNYA 4DT7B 1PQ5A 4SGAE 2BVXH 3H5CB 1QL9A 2Y5HA 1QQ4A 3QK1A 4X1RU 1GL0E 3A81A 3T2NA 2ZC9H 4DIIH 1TX7A 1THRH 3SN8A 1KXCA 1L1JA 1CGIE 3SU6A 1FXYA 5B6OA 3SU0A 2C8ZB 5ESTE 1TBQH 2A4OA 4JYVH 1O5CB 1QBOA 1F0TA 2SNVA 1GG6B 4I8GA 2B0FA 3ZYDA 1YCPM 2ZCLP 2B9LA 2GZ7A 2BDCA 4H6TA 1GHBG 4DOQA 1WQSA 1TOMH 3CS7A 1OP2A 3S69A 4KTSA 2BOKA 1OWJA 1ARBA 3MOCA 1P2IA 1O5EL 1O3DA 3RM0H 1GI8B 1A4WH 1GDQA 4CRGA 1HGTH 3BTQE 2WPLS 4Q2KA 3RMNH 1ZHMA 1O32A 1ELBA 3QTVH 1GDUA 5GDSH 4IN2A 4X2XA 3MNXA 4X8TH 2FOCA 3TIUA 1SGPE 2GCTB 5FPYA 1O2VA 1D4PB 2QGRA 3OX7U 1LHDH 3RMOH 4AYYB 1HCGA 2VWOA 2GMTC 2A2QH 3A8DA 2J2UA 1ZMJA 1AUJA 4ISIH 3T25A 1GBMA 3PMBB 2BYAX 2BLQA 1V2LT 4X1NU 1KXAA 1AI8H 1V3XA 3MH5A 3HK6B 1F0RA 2PGBB 4TPYA 1N1LA 5BRRE 5C1YA 1VGCB 5AVDA 1JRSA 1PPEE 1YPLH 2CJIA 2QYIA 2WYJA 3RXLA 4A6LA 3TU7H 1O3NA 1C1VH 4B71A 1CGHA 3RP2A 1BTZA 3GDSA 3PTBA 3SGAE 1E35B 3L3TA 1YPHC 3BTME 1GMHG 2A4QA 3ZZ9A 1DSUA 2NU3E 2BMGB 2KAIB 2HNTE 1XKAC 1O0DH 4F49A 1C9PA 4HGCA 1YC0A 2BHGA 4X2YA 1MBMA 2ZGBH 1TPSA 2TRMA 4FU9A 1A0LA 1V2KT 1GGDC 3GY4A 3JZ1B 3G01A 3SZNA 3EDXB 5HMAA 3SJOA 1FV9A 4XBCA 1TA2A 5A0BA 1GBBA 1P06A 1FY4A 3KN2A 4XSKU 1VCWA 1CT2E 1SHYA 4X1QU 1GHAF 4XOJA 2PLXA 4LK4A 3ZZ8A 1GJBB 3M7TA 3LT3A 4AOQA 1F0SA 3E91A 2GZ9A 3MO9A 2BX3A 1TA6A 1V2PT 3ODDA 4KELA 3T28A 3QZRA 1Q2WA 3MMGA 2PHBA 3UNQA 4B76A 2R2MB 1HJ8A 1YBWA 3OYPA 3RXDA 3GY7A 1H9HE 1O3IA 2TPIZ 1PFXC 3K6ZA 3SJ9A 1ETTH 2ZU3A 3MH6A 3S0NA 4H42U 1V2TT 1AQ7A 2ZCKP 4CR9A 4AFUA 5JBCS 1O3CA 3PLPA 1ZLRA 4D9RA 1P9UA 4CRCA 1MCTA 5EQQA 2PKAB 1PPFE 1BDAA 2XBWA 4WWYA 1SOZA 1K1MA 1RFNA 3HKIB 3TJNA 3GCTG 1GBCA 1QRXA 2WUCA 4GVUA 1NRPH 2P93A 1AE8H 1XVMA 1Z71A 1THSH 1TRYA 2STBE 3BTWE 1BTHH 2GP9B 2SFAA 3V0XA 1LHEH 1SOTA 1C5XB 5JYIA 3QGNB 1IQNA 3M3SA 4I31A 5HXFA 3L6PA 1TABE 1TQ7B 1AWFH 1FN6A 4LZ1H 1C5SA 4I8JA 4MNXA 1FUJA 4NA8A 1TAWA 2BY5X 3VGCB 1DM4B 2H5CA 2XC4A 3F6UH 2ANWA 3RXQA 3LKWA 1YYY1 3M3VA 3UQVA 1O2QA 2Z3DA 4UD9H 5JB9S 1QJ7B 2TGAA 2FEQH 2UWPA 1GBTA 3B9FH 1TNLA 2H9EH 3UIRA 3DUXH 1WU1A 5DKMA 4D8NA 2BY9X 3A8BA 1NFWA 1ZSKA 2ANYA 4NFFA 3O8DA 1LO6A 2CXVA 2VJ1A 3SV7A 2AEIH 4DCDA 4FVBA 1WYKA 4MPVA 4X8UH 1ZSLA 2FTLE 3S7HB 5EPYA 2YNBA 1O2ZA 2ZHEH 4ZKRU 1HB0B 4GLYA 3A87A 4E06H 4WH8A 2OY3A 2IOTA 4IMQA 1EAIA 5FXLA 4OS1A 2HNTF 2TIOA 1A5IA 3BG4C 1O5GH 4D9QA 2GT7A 2XC0A 1C1OA 5L30H 4K2YA 1P3CA 5I46H 1EOLA 1O2GH 1WV7H 4CH2B 2HOBA 4WY3A 1YGCH 3TVJB 3RXKA 1WAYB 1WBGB 1DFPA 3RXFA 4NA9H 1SGRE 4JK5A 2CV3A 4XFQA 1NU9A 7LPRA 4YLQH 5DGJA 1GBFA 3T5FH 4NGAH 3FZZA 1XM1A 1ELFA 1ZOMA 1VJ9U 1ELCA 2R0LA 1UCYE 5GXPA 3SQEE 4JYTA 3ZZ3A 3EA9A 2VGCC 5JB8S 2GMTB 3Q3YA 4CREA 1G2LA 1PQ7A 1DOJA 3GY5A 1EAUA 1QA7A 1P02A 2AFQB 2ZG0H 4CR5A 2A4GA 1O31A 1LPGB 3ODFA 1S6FA 2R2WU 1P09A 1YPJH 4ZHAA 2Z3EA 1XUHA 1X7AC 3U8TH 1C1TA 1N6XA 1NPMA 2FOFA 4AB9A 4OS7A 1XUIA 2AH4X 5GPIB 2ZDKA 1MD8A 3DT0H 3LGIA 2GD4B 1CBWC 2BB4A 4IS5A 1ZHRA 4PROA 1C1UH 2AMPA 2VH6A 1GI7B 1C2HA 1KDQB 1GBHA 1GI3A 4ZKNU 5LPRA 2P3FH 1ZTKA 3ZVAA 2ZFQH 3RXRA 2ALPA 4CBNA 1D3PB 1O3PB 1ETRH 1JMOH 1W2KH 3LU9B 1BHXB 1OKXA 3UOPA 1K1NA 1EASA 5EU8A 4YOGA 2RCEA 1QA0A 1GGDB 4X1SU 1ELTA 2SGAA 2GCHF 4Q7XA 3BTGE 1D6WA 1IQMA 1N8OC 1NO9H 1O2SA 2H1UA 3BEFB 4ZHMU 4UEHH 2ZU4A 3S7KB 1C1SA 4B74A 1Y3XA 5EXMA 1GI6A 4BXSA 4DG4A 2FOHA 3DHKH 1O2TA 5T6DA 2J9NA 2DE8A 4X6NA 5HGGA 1NFXA 3B8JA 5EG4A 1EZSC 2HNTC 3M7UA 3P6ZB 1O2NA 3U1JB 2D1JA 2J94A 1UTNA 2PGQB 1K1IA 1MD7A 3KF2A 2OXSA 2PSYA 3OTJE 1HRTH 4H6SB 1UK4A 4CH8B 1CHGA 2BD5A 2FOMB 2OTTX 1O2KA 1OPHB 2VB0A 2UUKB 1MZDA 5F6MA 1MAYA 1LDTT 2EI8A 1UTPA 1YPHE 1ETSH 3BF6H 1SGYE 1V2QT 4ZROA 1SGNE 1P9SA 3KL6A 3RC5A 2F83A 4ISNA 1FY8E 1IQIA 1TWXB 1A61H 1DX5M 4Y6DA 2VINA 2Z94A 1H8IH 2FDAA 2GGVB 4WMFA 3LOXA 1YCPK 1XUFA 1QHRB 2BQ6B 1QBNA 3SGBE 2O8TA 1CHOF 5AHGH 2ZEBA 1P11E 4NSVA 3F1SB 2JH6D 3ZZ4A 3MFJA 3BEIB 3LH3A 2VH0A 1FNIA 2BDBA 5F8XA 4KKDA 3SU4A 2XYAA 3P92A 1OWIA 4KP0A 3Q76A 1GHAG 2AGIX 4BTTB 2QV1A 1TRMA 2ZQ2A 5TCCA 1UVSH 3LIWA 1C5QA 1NFUA 1GI2A 1SVPA 2VIDA 3PM3A 1NS3A 1ELEE 2LPRA 8ESTE 1J8AA 1TBZH 3QX5H 1JXPA 2FI3E 3IWMA 4MNWA 4YZUA 1BTXA 1A7SA 1NC6A 1S5SA 1INCA 1T8MA 1ZZZA 5EGMA 1J17T 4IC6A 1IQGA 1HAIH 1AVXA 1C2FA 1PYTD 1VCPA 2WPKS 4Y11E 4K5ZA 3A8CA 2A1DB 4FUDA 1CA8B 1C1PA 3SBKA 5FAHA 5JDUB 4KTCA 2BD9A 1S83A 1ZPBA 3B23B 2FYQA 1T31A 2A31A 2VVVA 3DFJA 2UUFB 2OCVB 2R3YA 1D3TB 1NRSH 3CENA 3LGVA 4TY7A 2O8WA 4JZFH 4MLFB 3RXGA 1QGFA 5CMXH 1BTYA 2NU4E 4ASHA 2WINI 1QNJA 1V2RT 3LONA 1C2LA 2TGPZ 4RN6A 2KAIA 1S85A 4I32A 1MKWK 1C5ZB 5FX5A 5HM2A 1LHFH 1TOCB 4AGJA 1LQEA 5F03A 1ABIH 3PO1C 4AFQA 3TJUA 1JRTA 1C5OH 3ZZBA 1IQKA 4WXVA 5DP9A 1T32A 4JCNA 1MAXA 1WCZA 1C2IA 2BY8X 3VB5A 1NZQH 2V35A 3UR9A 2OD3B 2QY0B 1GJ4H 2VGCB 3KCGH 4U01A 6CHAB 3RXCA 3SW2B 1T8LA 2ULLA 4I8HA 4BTUB 4O03A 4Y0ZE 3L33A 1BBRE 3SGQE 3VB3A 1W8BH 1DLKB 4XBBA 1Y5AT 1GMDF 1KTTB 3NCLA 1KY9A 2D26C 3NK8A 4AB8A 2ODYB 1MZAA 1UVUH 2BD3A 3VEQB 2P16A 2ZGHA 5IYTA 1J14A 4FUJA 3ZVBA 1GPZA 5FBIA 1ZHPA 4FUBA 5DP4A 2OQ5A 3UQOA 1ELGA 1CT0E 2JA4A 1W0ZU 1TONA 2HRVA 1QRZA 1CBWB 4NIYA 3E90B 2BD8A 5I25A 5C1XA 1NROH 2PKSB 3V13A 1H9IE 1Y8TA 1RTLA 2PKAA 2FM2A 1CO7E 4LXBH 4K8YA 5GIBA 3VPKA 1GI1A 3O8BA 3RXTA 4X6PA 1BRAA 1H1BA 2G5NA 1CVWH 1V2WT 1E34B 3PWCA 4LZ4B 4O3UA 5EW2H 1P2QA 3NWUA 1BY2A 2BZAA 3MNBA 2G55A 1O2MA 3MHWU 3PYHA 4NZQA 2QCYA 3A83A 1YCPH 3VXEH 3A84A 2SNWA 1TMTH 1B0FA 4GAWA 1Q31A 3A8AA 4CRFA 5HYOA 3CP7A 3W94A 4MNVA 1K9OE 2JKHA 1T4VH 1OP0A 5DP3A 3UPEA 2FS9A 4JK6A 4FUHA 4O9VA 5C5NA 5JPMH 1O39A 4ZKOU 3RU4T 5IDKA 1EQ9A 2C3SA 4ABIA 2ZGXH 2SGFE 1Y5BT 1HV7A 1IHSH 2F9NA 4CBOA 3GCOA 2BQ7B 2C8XB 1EPTC 1C2DA 2ZPSA 3CS0A 2XWBI 3EYDA 4XDEA 1UVPA 2AIQA 2F9UA 1GHZA 2XBYA 1HNEE 3SHAH 1DS2E 2EEKA 2W26A 3ZVGA 4B1TA 1IQJA 2Z3CA 2ZFTA 3GICB 4H4FA 4INHA 1SLVB 4OS5A 1O2UA 3RXPA 2VWLA 2Y7XA 1AKSB 3TNSA 1E0FD 2AMQA 3PMAB 1JIMA 2ASUB 4BAMB 1BRUP 4TWWA 3PWBA 1AZ8A 2SGDE 2Y6TA 2JOPA 1A0HB 2QXHA 1TQ0B 3PTNA 3ATLA 1ELVA 1AUTC 1GBLA 1QBVH 4Y79A 3A88A 1DDJA 2ZF0H 3Q00A 1G37A 4B2BA 2NWNA 2Z9IA 4CRAA 4OGYA 1D3QB 1SLWB 1MH0A 4LOYH 3M5OA 4O97A 4I8KA 3SOSA 2AGEX 1S84A 2W7UA 2PUQH 5FCKA 1G30B 5A8ZA 1ANBA 1AVWA 2GCHG 2BDIA 1GBJA 1NRNH 4HI3A 1C1QA 3FP7E 3U9AH 1MKWH 2ZDNA 1UTKA 1HJAC 1BA8B 1C5UA 2P95A 2WV4A 4WMDA 1P2NA 2BOHB 4K8BA 4Y7BA 2WUBA 2QC2A 1DT2A 2Z9GA 2BDGA 2F91A 4I8LA 1AMHA 1O3MA 1HYLA 3M3TA 2XWAA 1ZTLA 3FZDA 1QCPA 2Q6GA 1OWKA 1LTOA 4CRBA 4A5TS 1TIOA 3DA9B 4K3JA 5F8TA 9ESTA 3K6YA 1FZZA 2QF3A 4X2WA 5K7RA 3T29A 1Y3UA 1SG8B 3RXIA 2BY7X 1BCUH 1DANH 1UHBB 4WMEA 1PPHE 5DO4H 3LC3A 2OTVA 5A0AE 2J38A 5JBAS 1MTVA 3GY8A 3T26A 1O34A 1P01A 1A0JA 2FX4A 2B7DH 1LVBA 1KDQA 2XTTB 1IQLA 3BTKE 3RXHA 1GJ5H 1TB6H 3PMHB 5C2ZA 1V2VT 1O5FH 2UUYA 4OS4A 4BAOB 1FY1A 3S9BA 3ZZ6A 3SUGA 3ESTA 1QB6A 5A0CA 5EW1H 4I7YH 1BITA 4Y0YE 3GDUA 4X2VA 2BLVA 1CHOG 1JOUB 3PO1B 2OLGA 1C5WB 4ABJA 1K2I1 1EJNA 1C5LH 1GJ9B 2STAE 4E05H 4DURA 4OS6A 3MU1A 1EZQA 4M7GA 2FX6A 3AAVA 2HPQH 1A3EH 2ZNKH 1XXDA 4YOJA 1EATA 1BMNH 3O8CA 1M9UA 1C9TA 3STJA 1O3GA 1P3EA 3F9HA 1O5BB 6LPRA 2A2XH 1DPOA 4U2WA 1FAXA 4HFPB 4AFSA 1C1MA
chains in the Genus database with same CATH superfamily
2W5EA 1AY6H 1TNIA 5IK2D 1G2MA 2XCFA 5J4SA 4IGDA 3BEUA 1BUIA 2SGEE 5GCHF 3FAOA 2GDDA 3NXPA 1U6QA 1SQRA 1AIXH 2Y80A 1MKXK 3Q3KA 1Y3YA 1CE5A 2Q1JA 1YWUA 1QRWA 3P70B 1GJ8B 1LVMA 4GSOA 5DP7A 9LPRA 4UE7H 1EOJA 3A82A 1TGBA 1HAHH 3MO6A 2OBOA 3P8OA 1KXDA 1EX3A 4ABDA 1TLDA 2FZZA 1O3AA 1Z6JH 3F9EA 3ZVFA 1EJMA 2NU2E 2JP0A 2WPHS 2ZHWH 1S81A 3U8RH 3SNBA 5J4QA 2QAAA 1MTSA 3MU5A 1VZQH 1HAGE 1G3EA 2R0KA 5EOKA 2OP9A 3SU5A 2A0QB 1YLNA 3VB7A 3R3GB 1W7GH 1DXWA 2D2DA 2ZDLA 3RXUA 4M9FA 1ZPZA 2P59A 5L2ZH 3GDVA 5DG6A 4VGCC 2BDAA 3GY2A 2P8OC 3PROA 3TK9A 4DGJA 3A85A 3E0PB 2XC5A 1FONA 3FP6E 1GBDA 1Y3VA 2BDYA 2QA9E 4ASUD 1IQEA 1YLDA 1ZYOA 4ZH8A 2PR3A 3H7OA 1QY6A 1DWDH 3RM2H 2EY4C 3K2UA 1DLEA 3STIA 1O3HA 2PW8H 2GV7A 3UTUH 1GWAA 3ZYEA 2Y81A 3RUOA 3MYWA 1FY5A 2YMSD 1V2MT 2QXIA 1O37A 1TNGA 1UMAH 1NM6A 4NIWA 4XBDA 3GYLB 1BMAA 1EPTB 4ZHLU 3VB6A 1GMDG 4AG1A 2AGGX 3K65B 1L4DA 3SV2H 1O36A 1UTMA 3Q3XA 4D7GA 4K1SA 1DWEH 4ABAA 3TGKE 3HGNA 4X6MA 4Y76A 1XMNB 2ZO3H 3ENSB 3RC4A 2C8WB 4ISHH 2GDEH 4J2YB 4YOIA 3SHCH 2ODQA 4YXWD 2VIVA 2HLCA 3QDZB 1BZXE 2FESH 1XVOA 4IBLH 3ZVCA 2PWXA 1ZSJA 3HPTB 3UNRA 2FWWA 1MTNC 3SV8A 4BAKB 2WPJS 2XNIA 2H6MA 2C8YB 4GHTA 3C27B 3RLYH 1EB1H 2OC1A 1W7XH 1PYTC 1JWTA 2XRCA 3AW1A 1LVYA 3I29A 1UCYH 3ZV8A 3U69H 3SORA 1W0YH 5ABWA 1QTFA 1RGQA 3SI3H 1MCVA 1SBWA 3A80A 1CSOE 5BPEA 3BTEE 3MWIU 3P95A 4AC9A 3KIDU 1OWDA 4ZXXH 1O35A 4DY7B 1TGSZ 3T27A 2ZFSA 4A1TA 2J97A 1V2ST 1N6YA 3BIVH 2ZFFH 3GOVB 3LGYA 4JZIA 5GJ4B 2R3UA 3TITA 1OWHA 3P17H 3BTHE 4FU7A 1BMMH 1AZZA 2OC7A 3U8OH 1B0EA 4AN7A 1O3BA 3UWJH 5SGAE 4K1TA 4FETA 5E0HA 2PTNA 4ACAA 2FI4E 1QZ8A 5CDFE 1F92A 3V3MA 3PRBA 2QF0A 4Q7ZA 5DK1A 1ELAA 1O5DH 1V2UT 4DW2U 2HVXA 2NU0E 3AVZA 1G9IE 1KXFA 1OXGA 1DUEA 2CMYA 1T7CA 3SV6A 1LMWB 3F68H 4ABGA 4AORA 4IW4E 2GX4A 3HKJB 5DP6A 2ODPA 1MKXH 4RKJB 3TH2H 2PFEA 3MQKC 5FHTA 4WXIA 2A7HA 1K1JA 1SR5C 2ZA5A 1HXEH 3I78A 1MQ6A 3LC5A 1O5EH 1MQ5A 2ZWLH 3EGKH 5E2PA 2R9PA 2RDEA 1WTGH 2PSXA 1C1NA 3SNCA 2G4TA 3OY5U 3UREA 1F5RA 3E1XB 5DJ7A 4B6EA 2SGQE 5GNDA 5E0JA 8GCHF 1FN8A 2GCTC 1FIZA 3UY9A 1O2JA 1Y3WA 1E79D 1KLTA 3D65E 5F8ZA 1G32B 1L2EA 1P57A 2W3KA 1QURH 4RSPA 1QB1A 2ZPQA 3RXVA 1BTUA 2FXRA 1YPEH 3A7TA 2B5TB 3NUMA 3SI4H 1SI5H 2FO9A 1BQYA 1EUFA 2G81E 2ZQ1A 2HWLB 2VBCA 1NT1A 1B5GH 1K28D 3KQBA 4YLUA 2XXLA 1VITF 1QL8A 3AASA 3OSYA 2QXJA 2ZHQH 2V7QD 1C2KA 4GUXA 2VNTA 3NRLA 2ZDAH 1NRRH 2GVFA 1CA0C 5HM9A 3AK5A 1K22H 1NU7B 2V0BA 3SNEA 5T6GA 1AWHB 1LKAA 2BD2A 1H8DH 1VJAU 1ZRBA 3KQCA 5A8YA 1FI8A 3HATH 3LGTA 5C5OA 4BAHB 2BLOA 4DT4A 4NIVA 2W6JD 4F4OC 3Q77A 3EAJA 2G51A 3NKKA 3TGIE 1SFQB 1FLEE 1PPBH 3RC6A 1UW7A 1DICA 3SJ8A 2Y5FA 1AKSA 1ANEA 1W0KD 1H4WA 4CHAC 1MTUA 2IJOB 1SGTA 2GTBA 1TFXA 1XXFA 2BLWA 1ESBA 2Y82A 5JFBA 3SU2A 8LPRA 3OE7D 1EB2A 1Z8GA 1UK2A 4JZ1A 4ABEA 2JIZD 1HIAB 4INKA 1GCTC 1AB9C 2BQWB 2A45B 1OHHD 4B2CA 5T6FA 3M5MA 1BJVA 1CT4E 2F3CE 4Y71A 1OYTH 1KIGH 1MU8B 1C5VA 3QZQA 1E38B 3RU4D 3BG4B 1NN6A 1V2NT 2M5TA 1C5MD 2P3TB 1O30A 1F5KU 4TYDA 2F9BH 2O8LA 2P8OB 3PV4A 3RXAA 4YM9A 1PPGE 4I33A 2ANKH 2ANMH 4ISLA 4WJG2 5FCRA 1LQDB 1S6LA 3M61U 3ZZ7A 1UTLM 2A5IA 2I6QA 2FOEA 4U30A 1DWBH 2IJD1 3BSQA 4Z6AH 3WW7A 2KCAA 4Q80A 1UJ1A 4FUCA 1C4Y2 1C4U2 5GCHG 1DY9A 2VIQA 1G36A 1HJ9A 1F0UA 1TE0A 4NWKA 2ZI2H 1GJCB 1GHXH 1F2SE 2ZU5A 2A5KA 1FPHH 1BTPA 1C2GA 1FDPA 3RLWH 3TH3H 5LH8A 1ZMLA 3E0NB 1OX1A 2ZIQH 2P3UB 2UWLA 2XBXA 2A7JA 1ELDE 3NPSA 1TALA 4IMZA 3RMMH 1ANDA 3HGPA 1C2MA 3MNCA 3RXJA 1XKBC 4CRDA 5AFZH 2C4FH 1UHBA 2G4UA 4MG3A 3GYMA 1EZXC 1ZGVA 3ZZAA 1A46H 2OUAA 4YESB 5AF9H 1GVKB 2OC0A 4MVNA 1WXRA 5E2OA 1AD8H 4FUFA 3SJKA 1A1RA 5HIZA 2V6NA 1P04A 4Y7AA 1LPZB 1ACBE 1LHCH 1EAWA 1SPJA 1RTKA 5C1UA 5LGOA 2RA0A 2H9HA 5FX6A 3PLBA 1D6RA 3O8RA 2DE9A 1QB9A 1O3OA 1Z8IB 1ABJH 2EA3A 1T8NA 3MU4A 3QTOH 3ZVDA 1BBRH 5TJXA 2Y5GA 4GCHF 2HALA 1GI4A 1WTHD 2G8TA 3T62A 1Y5UT 4ZUHA 3ITIA 3OEHD 1C5TA 8KME2 1P57B 1O3LA 1TX6A 2WPIS 3VXFH 3EA8A 2ZFRH 2W6ID 3H09A 3C1KA 3DSGA 4I86A 1J9CH 1N8OB 5HIYA 3TH4H 1EXFA 1LKBA 2KM0A 1RIWC 1V2OT 2G52A 1GHYH 1OS8A 2FI5E 3QUMP 2FODA 2BDHA 2WV5A 2BZ6H 3OU0A 3WY8A 3KGPA 1A5HA 3TNTA 1AGJA 3QWCH 1GI9B 2A7CA 5L2YH 1CQQA 3AAUA 1O3JA 2ZECA 3PB1E 1B7XB 1HAVB 1AU8A 2VIPA 2O8MA 1MMJN 1UO6A 1XX9A 1DVAH 1GVLA 3SZEA 3MO3A 1KXEA 2FOBA 2H9TH 2QXGA 3V12A 4B73A 1UTQA 2Z7FE 3P8NA 3FKSD 2RA3A 1TPAE 1S0QA 2Y7ZA 2ZKSA 5EIYA 2W7SA 4OS2A 1RJXB 4MQAA 3E3TA 3BTDE 1BTWA 3E16B 1TX8A 4NA7A 5LPFA 1GI0A 3SU1A 1F5LA 3RU4E 2EC9H 3D49H 4JMYA 3LPRA 3URCA 1Z7KA 1AHTH 3UUZA 2KCPA 1ZPCA 3A7ZA 4GPGA 1O33A 1EP6A 3F9FA 1MABB 3GCNA 2KX4A 1SGFG 1FX0B 1NY22 3A7YA 2SGPE 2THFB 4FXGH 1QL7A 3SV9A 2FS8A 4K60A 1F7ZA 2H2ZA 1BRBE 2XCNA 3TLOA 5LPEA 3GCHC 3V7TA 3BN9A 1NRQH 4Y8ZA 1G3CA 1HUTH 2FLRH 4R8TB 2VVUA 1C4V2 1OOKB 2Z6BD 4NWLA 1GBEA 1RTFB 1YKTA 3PLKA 4OGXA 1O2WA 1SQAA 4E7NA 1AFEH 1K0HA 2RG3A 1ESTA 3QO6A 5EXNA 5E8EH 2VWNA 2OINA 3M36A 3OY6U 3FFGA 1CA0B 4RT1A 1WUNH 2XBVA 1O2OA 1L0ZA 4B75A 3SU3A 1EPTA 4UFGH 4ZAEA 2J95A 1KLJH 3ATKA 4BANB 2BY6X 5KEDA 2C90B 4AX9H 7ESTE 1O3EA 1HBTH 2VU8E 5H4IB 2Z9JA 5A09A 2F4LA 1GMCF 1E37B 1C2EA 1TMBH 3D62A 1TMUH 4ZXYH 3MI4A 4CHAB 1BJUA 1HAZB 1G3DA 3SNAA 1SLXB 1T4UH 3GY3A 3RXMA 1P10A 1W3CA 1EAXA 2VIWA 2BTCE 5JBBS 3RXOA 4DIHH 1MBQA 2CHAC 1GCTB 1AB9B 4U32A 1TRNA 2OBQA 3RMLH 4FUGA 1P2KA 1ZRKA 2B8OH 2V3HH 1RS0A 8GCHG 1UCYK 2ZHFH 2FIRH 1TGNA 2CGAA 4X1PU 3U1IB 3W95A 5DN6D 1P12E 5CE1A 1W14U 1HDTH 5PTPA 4ABBA 2ZTYA 1P2MA 1LPKB 4A1VA 3ZZDA 1QIXB 2O9QA 1J16A 1S82A 1SGCA 1J15A 4YTAA 1O2XA 3UR6A 4E7RG 2CN0H 3MU0A 2GZ8A 4MTBA 4UFEH 1C1WH 3SJIA 3SUDA 2VWMA 4WH6A 5T3HA 1VITG 1XUKA 5EODA 3VFEA 1O2RA 3KQDA 1BMLA 1VKYA 2DUCA 3RXBA 4NFEA 3ATIA 1EZUC 2WPMS 1Z1IA 3SNDA 4UONA 1L1NA 2GV6A 4FU8A 3LDXH 4MPWA 1D3DB 2P94A 4JZDH 5JBTA 2JH0D 1THPB 2BD4A 1C5RA 1TPOA 2BVRH 3SQHE 3S9CA 3SYJA 1KTSB 2VIOA 3TK5A 1C5YB 1SGEE 1VCQA 3AW0A 2TBSA 2OYAA 1SB1H 1A3BH 1DY8A 3BTFE 1S0RA 3M5LA 3SO3A 1SL3A 3ZZ5A 1DXPA 5FBEA 5A2MH 3GISB 1MTWA 3N7OA 2ZTZA 2FMJA 1LHGH 3UWIA 7KMEH 3HK3B 4K1EA 1O2LA 1QJ6B 4YT6H 2XOKD 2ILNA 1GJ7B 3LGWA 1AN1E 3ATMA 6GCHF 2GKVE 2CF9H 3DFLA 1KXBA 5KECA 4Y8YA 1Z6EA 2TGTA 4A92A 1FMGA 1TGCA 1UTJA 1E1QD 1E1RD 4WF8A 3SUEA 1FY3A 3QN7A 2ZGJA 1ARCA 5DP5A 1NFYA 2PV9B 4A1XA 1PQAA 2PTCE 2K8IA 2A32A 1ORFA 1RIWB 4MPUA 4NSYA 1GL1A 7GCHF 5EQRA 1SQTA 2AYWA 1SLUB 1YF4A 2WZQA 2HVYB 4NIXA 1YPMH 2JH5D 2CF8H 3ZZCA 5C0TA 5EXLA 2UUJB 1P05A 3A7VA 3F3BA 1GI5A 1GJAB 4ZMAH 2JETC 3UNSA 1SC8U 1YLCA 3IITA 3TJOA 1GVZA 1H9LB 4TWYA 1EP5A 1HPGA 3LJOA 1QJ1B 2YNAA 1GHWH 4FVDA 1QR3E 1NESE 3P8GA 5FPSA 4X8SH 5CHAC 1MU6B 2V3MA 1SSXA 2FLBH 3E8LA 1DSTA 1K1OA 3BIUH 4Y10E 1YM0A 1SFIA 2K1QA 3TPIZ 1GHBF 1W10U 5GWZA 5FPTA 1DITH 1XUGA 2H5DA 3EA7A 4JYUH 1PPCE 2Q6FA 2AIPA 1DWCH 1HIAA 4JZEH 5A8XA 6CHAC 4WVPE 4Q7YA 2F9VA 2PP6A 1AFQC 1BRCE 1Z8JB 3MH4A 1L1GA 1VITH 1ZJKA 2ZHDA 3GCHB 4GCHG 4INLA 3RXEA 1G3BA 3M35A 2EI6A 1CU1A 2ALVA 3UFAA 3ZVEA 1BB0B 1FPCH 1RD3B 2BXUH 1BIOA 2XNDD 2WYGA 1FIWA 3IG6B 1SHHB 3BG8A 2J4IA 1P0SH 1GJDB 2J98B 4KGAA 1EKBB 1IHTH 1P2JA 1HJAB 1RRKA 1NTPA 1YPKH 3A89A 1P8VC 1HAOH 4HZHA 2PKSC 3K9XB 5EQSA 1VR1H 1YPGH 3EE0B 4QT8C 1OP8A 1ZTJA 3NZIA 3BV9B 1DE7H 2AERH 2YMSB 4KTUA 2YOLA 1S6HA 1TNHA 1PPZA 1GMHF 3M5NA 4AYVB 2C93B 1C1RA 1ZMNA 1O2HA 1SKYE 1LVOA 1GG6C 1DUAA 2IPHA 1O3KA 1TNKA 4B2AA 1SGIB 3A7WA 1HXFH 1Y59T 2BXTH 1ID5H 4BNRA 5L6NH 1IOEA 1XUJA 1ESAA 1JBUH 3U98H 2A4RA 5C67A 2CHAB 2V3OH 2WSSD 3LJJA 3RXSA 4J1YA 2ZDVH 1ANCA 2ZU1A 4AGKA 1JIRA 4DJZB 3KEEA 1RXPA 1OYQA 1FQ3A 4TPIZ 4NZLA 1SQOA 4K69A 4ISOA 3D23A 3GY6A 2Z9LA 1WQVH 5AFYH 1AE5A 1O5FL 3LGUA 2IPQX 3MTYA 4IC5A 5ETXA 2AMDA 4D7FA 5TCAA 1PQ8A 2EI7A 5G4BA 3F9GA 3WWFA 1BBRK 3ZV9A 3BTTE 3KQEA 4ABHA 1Z1JA 2XW9A 4RKOB 1FJSA 1YP9A 2F9PA 4SGBE 1P2OA 4DVAU 4O3TA 4AG2A 2QF5A 2O8UA 3KHVA 2Z9KA 1O2PA 1KYNA 2OQUA 1TYNA 1W12U 3E6PH 4NG9H 1UVTH 4AFZA 4ACBA 2A5AA 4Z0KA 2GT8A 1NBMD 1C2JA 1K1PA 1V6DA 2AS9A 2FTMA 1Z8RA 1A5GH 4X8VH 3P8FA 3A7XA 1O5AB 1O38A 4RT0A 1VGCC 5EJZA 4D76A 4R0IA 5E0GA 2G5VA 2FPZA 4X0WU 3QGJA 2D8WA 3EQ0H 1LCYA 1ZGIA 3PMJA 2ZDMA 2ZU2A 1GHVH 1GMCG 4HTCH 1HAVA 5C3NA 3QLPH 1C5PA 1OWEA 2JJ1D 2EQNA 1Q3XA 3GCTF 1HAPH 2FP7B 3I77A 2KZ4A 3TK6A 4THNH 1A2CH 3KQ5A 2NU1E 1CGJE 1HFDA 4Z1MD 2ZFPH 3S9AA 1FAKH 2I6SA 2BM2A 4XE4A 4FUEA 1EFRD 3VB4A 4GHQA 2PUXB 1AVGH 2FOGA 1K1LA 1KLIH 2BVSH 2QN5T 2ZCHP 4TSFD 5EJLA 1HAXB 4IN1A 1O2IA 3FANA 3UOUA 1BOQA 2J92A 4NCYA 1ZJDA 2HGTH 3A86A 1UVOA 1AO5A 1UK3A 2ZGCA 5C20A 1YY3A 2TGDA 4BOHA 3ATWA 4UFFH 1P03A 3R0FA 1IQFA 2FOAA 1HLTH 1E36B 2F9OA 1W11U 4ZKSU 3F2FA 1PJPA 1QQUA 4VGCB 3URDA 1GBIA 1K21H 2LELA 3H7TA 3KNXA 1V2JT 1SGDE 3U28C 3N7DA 4UFDH 2VVCA 1EJAA 4MDSA 1TPPA 2RDLA 1O3FA 5DSFA 5ESBA 4YT7H 5DPAA 1GBKA 3M37A 1SGFA 2JETB 1SGQE 3ELAH 1KSNA 4BAQB 2ESTE 3MH7A 2UWOA 5EPNA 1IAUA 3JZ2B 1GDNA 1ZR0A 3FO8D 1HAYB 4MPXA 1T8OA 4Y8XA 2Q6DA 3UB0A 5CHAB 1TNJA 5K0HA 2J34A 1OSSA 1BT7A 1IQHA 2BX4A 1C5NH 3MNSA 4BTIB 3DD2H 1WOFA 1UTOA 2HPPH 4X6OA 1MTNB 6ESTA 1TGTA 3FVFB 2BD7A 2IN2A 2ZTXA 3M7QA 2ZZUH 5B6LA 2W3IA 3DSPA 5DP8A 4TY6A 6GCHG 1SMFE 1AFQB 2ZP0H 3FP8E 1WSSH 2OC8A 1D9IA 4ABFA 2G00A 1GJ6A 4TT3D 1GCDA 3VGCC 1QFKH 4YO9A 4ESTE 4Q63A 3SUFA 3TGJE 1L4ZA 2FYRA 3MU8A 1W13U 2ZPRA 4BXWA 4P02A 2QIQA 4AZ2B 1NBME 4FUIA 3RDZA 1O2YA 1GBAA 4A7IB 3LH1A 1BHXF 1MUEB 3TJVA 2LNCA 4UDWH 7GCHG 5C94A 1TBRH 4MNYA 4DT7B 1PQ5A 4SGAE 2BVXH 3H5CB 1QL9A 2Y5HA 1QQ4A 3QK1A 4X1RU 1GL0E 3A81A 3T2NA 2ZC9H 4DIIH 1TX7A 1THRH 3SN8A 1KXCA 1L1JA 1CGIE 3SU6A 1FXYA 5B6OA 3SU0A 2C8ZB 5ESTE 1TBQH 2A4OA 4JYVH 1O5CB 1QBOA 1F0TA 2SNVA 1GG6B 4I8GA 2B0FA 3ZYDA 1YCPM 2ZCLP 2B9LA 2GZ7A 2BDCA 4H6TA 1GHBG 4F55A 4DOQA 1WQSA 1TOMH 3CS7A 1OP2A 3S69A 4KTSA 2BOKA 1OWJA 1ARBA 3MOCA 1P2IA 1O5EL 1O3DA 3N99A 3RM0H 1GI8B 1A4WH 1GDQA 4CRGA 1HGTH 3BTQE 2WPLS 4Q2KA 3RMNH 1ZHMA 1O32A 1ELBA 3QTVH 1GDUA 5GDSH 4IN2A 4X2XA 3MNXA 4X8TH 2FOCA 3TIUA 1SGPE 2GCTB 5FPYA 1O2VA 1H8ED 1D4PB 2QGRA 3OX7U 1LHDH 3RMOH 4AYYB 1HCGA 2VWOA 2GMTC 2A2QH 3A8DA 2J2UA 1ZMJA 1AUJA 4ISIH 3T25A 3N7EA 1GBMA 3PMBB 2BYAX 2BLQA 1V2LT 4X1NU 1KXAA 1AI8H 1V3XA 3MH5A 3HK6B 1F0RA 2PGBB 4TPYA 1N1LA 5BRRE 5C1YA 1VGCB 5AVDA 1JRSA 1PPEE 1YPLH 2CJIA 2JDID 1H8HD 2QYIA 2WYJA 5C17A 3RXLA 4A6LA 3TU7H 1O3NA 1C1VH 4B71A 1CGHA 3RP2A 1BTZA 3GDSA 3PTBA 3SGAE 1E35B 3L3TA 1YPHC 3BTME 1GMHG 2A4QA 3ZZ9A 1DSUA 2NU3E 1BMFD 2BMGB 4XRNA 2KAIB 2HNTE 1XKAC 1O0DH 4F49A 1C9PA 4HGCA 1YC0A 2BHGA 4X2YA 1MBMA 2ZGBH 1TPSA 2TRMA 4FU9A 1A0LA 1V2KT 1GGDC 3GY4A 3JZ1B 3G01A 3SZNA 3EDXB 5HMAA 3SJOA 1FV9A 4XBCA 1TA2A 5A0BA 1GBBA 1P06A 1FY4A 3KN2A 4XSKU 1VCWA 1CT2E 1SHYA 2AHME 4X1QU 1GHAF 4XOJA 2PLXA 4LK4A 3ZZ8A 1GJBB 3M7TA 3LT3A 4AOQA 1F0SA 3E91A 2GZ9A 3MO9A 2BX3A 1TA6A 2RFKC 1V2PT 3ODDA 4KELA 3T28A 3QZRA 1Q2WA 3MMGA 2OK5A 2PHBA 3UNQA 4B76A 2R2MB 1HJ8A 1YBWA 3OYPA 3RXDA 3GY7A 2QE7D 1H9HE 1O3IA 2TPIZ 1PFXC 2J98A 3K6ZA 3SJ9A 1ETTH 2ZU3A 3MH6A 3S0NA 4H42U 1V2TT 1AQ7A 2ZCKP 4CR9A 4AFUA 5JBCS 1O3CA 3PLPA 1ZLRA 4D9RA 1P9UA 4CRCA 1MCTA 5EQQA 2PKAB 1PPFE 1BDAA 2XBWA 4WWYA 1SOZA 1K1MA 3PV5A 1RFNA 3HKIB 3TJNA 3GCTG 1GBCA 3F2GA 1QRXA 1W0JD 1WDIA 2WUCA 4GVUA 1NRPH 2P93A 1AE8H 3F0OA 1XVMA 1Z71A 1THSH 1TRYA 2STBE 3BTWE 1BTHH 2GP9B 2SFAA 3V0XA 1LHEH 1SOTA 1C5XB 5JYIA 3QGNB 1IQNA 3M3SA 4I31A 5HXFA 3L6PA 2WPDD 1TABE 1TQ7B 3KYFA 1AWFH 1FN6A 4LZ1H 1C5SA 5CHBA 4I8JA 4MNXA 1FUJA 4NA8A 1TAWA 2BY5X 3VGCB 1DM4B 2H5CA 2XC4A 3F6UH 2ANWA 3RXQA 3LKWA 1YYY1 3M3VA 3UQVA 1O2QA 2Z3DA 4UD9H 5JB9S 1QJ7B 2TGAA 2FEQH 2UWPA 1GBTA 3B9FH 1TNLA 2H9EH 1KMHB 3UIRA 3DUXH 1WU1A 5DKMA 4D8NA 2BY9X 3A8BA 1NFWA 1ZSKA 2ANYA 4NFFA 5F53A 3O8DA 1LO6A 2CXVA 4OM9A 2VJ1A 3SV7A 2AEIH 4DCDA 4FVBA 1WYKA 4MPVA 4X8UH 1ZSLA 2FTLE 3S7HB 5EPYA 2YNBA 1O2ZA 2ZHEH 4ZKRU 1HB0B 4GLYA 3A87A 4E06H 4WH8A 2OY3A 2IOTA 4IMQA 1EAIA 5FXLA 4OS1A 2HNTF 2TIOA 1A5IA 3F2HA 5C0UA 3BG4C 1O5GH 4D9QA 2GT7A 2XC0A 1C1OA 5L30H 4K2YA 1P3CA 5I46H 4XD7D 1EOLA 1O2GH 1WV7H 4CH2B 2HOBA 4WY3A 1YGCH 3TVJB 3RXKA 1WAYB 1WBGB 1DFPA 3RXFA 4NA9H 1SGRE 4JK5A 2CV3A 4XFQA 1NU9A 7LPRA 4YLQH 5DGJA 1GBFA 3T5FH 4NGAH 3FZZA 1XM1A 1ELFA 1ZOMA 1VJ9U 1ELCA 2R0LA 1UCYE 5GXPA 3SQEE 4JYTA 3ZZ3A 3EA9A 2VGCC 5JB8S 2GJGA 2GMTB 2KR7A 3Q3YA 4CREA 1G2LA 1PQ7A 1DOJA 3GY5A 1EAUA 1QA7A 4F48B 1P02A 2AFQB 2ZG0H 4CR5A 2A4GA 1O31A 1LPGB 3ODFA 1S6FA 2R2WU 1P09A 1YPJH 4ZHAA 2Z3EA 1XUHA 1X7AC 3U8TH 1C1TA 1N6XA 1NPMA 2FOFA 4AB9A 4OS7A 1XUIA 2AH4X 3FOAA 5GPIB 2ZDKA 1MD8A 3DT0H 3LGIA 2GD4B 1CBWC 2BB4A 4IS5A 1ZHRA 4PROA 1C1UH 4RI0A 2AMPA 2VH6A 1GI7B 1C2HA 1KDQB 2K0QA 3KYGA 1GBHA 1GI3A 4ZKNU 5LPRA 2P3FH 1ZTKA 3ZVAA 2ZFQH 3RXRA 2ALPA 4CBNA 1D3PB 1O3PB 1ETRH 1JMOH 1W2KH 3LU9B 1BHXB 1OKXA 3UOPA 1K1NA 1EASA 3OAAD 5EU8A 4YOGA 2RCEA 1QA0A 1GGDB 4X1SU 1ELTA 3PRDA 2SGAA 2GCHF 4Q7XA 3BTGE 1D6WA 1IQMA 1N8OC 1NO9H 1O2SA 2H1UA 3BEFB 4ZHMU 4UEHH 2ZU4A 3S7KB 1C1SA 4B74A 1Y3XA 5EXMA 1GI6A 4BXSA 4DG4A 2FOHA 3DHKH 4Q4LA 1O2TA 5T6DA 2J9NA 2DE8A 4X6NA 5HGGA 1NFXA 3B8JA 5EG4A 1EZSC 2HNTC 3M7UA 3P6ZB 1O2NA 3U1JB 2D1JA 2J94A 1UTNA 2PGQB 4ASHA 2L6OA 1K1IA 4B6FA 1MD7A 3KF2A 2OXSA 2PSYA 3OTJE 1HRTH 4H6SB 1UK4A 4CH8B 1CHGA 2BD5A 4HG6A 2FOMB 2OTTX 1O2KA 1OPHB 2VB0A 2UUKB 1MZDA 5F6MA 4FOUC 5FL7D 1MAYA 1LDTT 2EI8A 1UTPA 1YPHE 1ETSH 2HLDD 3BF6H 3OTPA 1SGYE 1V2QT 4ZROA 1SGNE 1P9SA 3KL6A 3RC5A 2L74A 2F83A 4ISNA 1FY8E 1IQIA 1TWXB 1A61H 1DX5M 4Y6DA 2VINA 2Z94A 1H8IH 2FDAA 2GGVB 4WMFA 3LOXA 1YCPK 1XUFA 1QHRB 2BQ6B 1QBNA 3SGBE 2O8TA 1CHOF 5AHGH 2ZEBA 1P11E 4NSVA 3F1SB 3CNRA 2JH6D 3FN8A 3MFJA 3ZZ4A 3BEIB 3LH3A 2VH0A 1FNIA 2BDBA 5F8XA 4KKDA 3SU4A 2XYAA 3P92A 1OWIA 4KP0A 3Q76A 1GHAG 2AGIX 4BTTB 2QV1A 1TRMA 3OEED 2ZQ2A 5TCCA 1UVSH 3LIWA 1C5QA 1NFUA 1GI2A 1SVPA 2VIDA 3PM3A 1NS3A 1ELEE 2KCYA 2LPRA 8ESTE 1J8AA 1TBZH 3QX5H 1JXPA 2FI3E 3IWMA 4MNWA 4YZUA 1BTXA 3DCLA 1A7SA 1NC6A 1S5SA 1INCA 1T8MA 1ZZZA 5EGMA 1J17T 4IC6A 3WWBA 1IQGA 1HAIH 1AVXA 1C2FA 1PYTD 1VCPA 2WPKS 4Y11E 5EJ1A 4K5ZA 3A8CA 2A1DB 4FUDA 1CA8B 1C1PA 3SBKA 5FAHA 5JDUB 4KTCA 2BD9A 1S83A 1ZPBA 3B23B 2M2AA 2FYQA 1T31A 2A31A 2VVVA 3DFJA 2UUFB 2OCVB 2R3YA 1D3TB 1NRSH 3CENA 3LGVA 4TY7A 2O8WA 4JZFH 3PV2A 4MLFB 1QGFA 3RXGA 1BTYA 2J5UA 2NU4E 2WINI 1QNJA 5CMXH 1V2RT 3LONA 3EE7A 1C2LA 2TGPZ 4RN6A 2KAIA 1S85A 4I32A 1MKWK 1C5ZB 5FX5A 5HM2A 1LHFH 1TOCB 4AGJA 1LQEA 5F03A 1ABIH 3PO1C 4AFQA 3TJUA 1JRTA 1C5OH 3ZZBA 1IQKA 4WXVA 5DP9A 1T32A 4JCNA 1MAXA 1WCZA 1C2IA 2BY8X 3VB5A 1NZQH 2V35A 3UR9A 2OD3B 2QY0B 1GJ4H 2VGCB 3KCGH 4U01A 6CHAB 3RXCA 3SW2B 1T8LA 2ULLA 4I8HA 4BTUB 5T1VA 4O03A 4Y0ZE 3L33A 1BBRE 3SGQE 3VB3A 1W8BH 1DLKB 4XBBA 1Y5AT 1GMDF 1KTTB 3NCLA 1KY9A 2D26C 3NK8A 4AB8A 2ODYB 2KFWA 1MZAA 1UVUH 2BD3A 3VEQB 4P00A 2P16A 2ZGHA 5IYTA 4ZCNA 1J14A 4FUJA 3ZVBA 1GPZA 5FBIA 1ZHPA 4FUBA 5DP4A 2OQ5A 3UQOA 1ELGA 1CT0E 2JA4A 1W0ZU 1TONA 2HRVA 1QRZA 1CBWB 4NIYA 3E90B 2BD8A 5I25A 5C1XA 1NROH 2PKSB 3V13A 1H9IE 1Y8TA 1RTLA 2PKAA 2FM2A 1CO7E 4LXBH 4K8YA 5GIBA 3VPKA 1GI1A 3O8BA 3RXTA 4X6PA 1BRAA 1H1BA 2G5NA 1CVWH 1V2WT 1E34B 3PWCA 4LZ4B 4O3UA 5EW2H 1P2QA 3NWUA 1BY2A 2BZAA 3MNBA 2G55A 1O2MA 3MHWU 3PYHA 4NZQA 2QCYA 3A83A 1YCPH 3VXEH 3A84A 2SNWA 1TMTH 1B0FA 4GAWA 1Q31A 3A8AA 4CRFA 5HYOA 3CP7A 3W94A 4MNVA 1K9OE 2JKHA 1T4VH 1OP0A 5DP3A 3UPEA 2FS9A 4JK6A 4FUHA 4O9VA 5C5NA 5JPMH 1O39A 4ZKOU 3RU4T 5IDKA 1EQ9A 2C3SA 4ABIA 2ZGXH 2SGFE 1Y5BT 1HV7A 1IHSH 2F9NA 4CBOA 3GCOA 2BQ7B 2C8XB 1EPTC 1C2DA 2ZPSA 3CS0A 2XWBI 3EYDA 4XDEA 1UVPA 2AIQA 2F9UA 1GHZA 2XBYA 1HNEE 3SHAH 2WV9A 1DS2E 2EEKA 2W26A 3W1EA 3ZVGA 4B1TA 1IQJA 2Z3CA 2ZFTA 3GICB 4H4FA 4INHA 1SLVB 4OS5A 1O2UA 3RXPA 2VWLA 2Y7XA 2QF4A 1AKSB 3TNSA 1E0FD 2AMQA 3PMAB 3UAIC 1JIMA 2ASUB 1COWD 4BAMB 1BRUP 4TWWA 3PWBA 1AZ8A 2SGDE 2Y6TA 2JOPA 1A0HB 2QXHA 1TQ0B 3PTNA 3ATLA 3VG8A 1ELVA 1AUTC 1GBLA 1QBVH 4Y79A 3A88A 1DDJA 2ZF0H 3Q00A 1G37A 4B2BA 2NWNA 2Z9IA 4CRAA 4OGYA 1D3QB 1SLWB 1MH0A 4LOYH 3M5OA 4O97A 4I8KA 3SOSA 2AGEX 1S84A 2W7UA 2PUQH 5FCKA 1G30B 2WHXA 5A8ZA 1ANBA 1AVWA 2GCHG 2BDIA 1GBJA 1NRNH 4HI3A 1C1QA 3FP7E 3U9AH 1MKWH 2ZDNA 2JJ2D 1UTKA 1HJAC 1BA8B 1C5UA 2P95A 2WV4A 3GS9A 4WMDA 2LP6A 1P2NA 2BOHB 2F43B 4K8BA 4Y7BA 2WUBA 2QC2A 5HKKD 1DT2A 2Z9GA 2BDGA 2F91A 2YMSC 4I8LA 1AMHA 1O3MA 1HYLA 3M3TA 2XWAA 1ZTLA 3FZDA 1QCPA 2Q6GA 1OWKA 1LTOA 4CRBA 4A5TS 1TIOA 3DA9B 4K3JA 5F8TA 9ESTA 3K6YA 1FZZA 2QF3A 4X2WA 5K7RA 3T29A 1Y3UA 1SG8B 3RXIA 2BY7X 1BCUH 2CK3D 1DANH 1UHBB 4WMEA 1PPHE 5DO4H 3LC3A 2OTVA 5A0AE 2J38A 5JBAS 1MTVA 3GY8A 5KGOA 3T26A 1O34A 1P01A 1A0JA 2FX4A 3DSOA 2B7DH 1LVBA 1KDQA 2XTTB 1IQLA 3BTKE 3RXHA 1GJ5H 1TB6H 3PMHB 5C2ZA 1V2VT 1O5FH 2UUYA 4OS4A 3F0PA 4BAOB 1FY1A 3S9BA 3ZZ6A 3SUGA 3ESTA 1QB6A 5A0CA 5EW1H 4I7YH 1BITA 4Y0YE 3GDUA 4X2VA 2BLVA 1CHOG 1JOUB 3PO1B 3ZIAD 2OLGA 1C5WB 4ABJA 1K2I1 1EJNA 1C5LH 1GJ9B 2STAE 4E05H 4DURA 4OS6A 3MU1A 1EZQA 4M7GA 2FX6A 3AAVA 2HPQH 1A3EH 2ZNKH 1XXDA 4YOJA 1EATA 1BMNH 3O8CA 1M9UA 1C9TA 3STJA 1O3GA 1P3EA 3F9HA 1O5BB 6LPRA 2A2XH 1DPOA 3OFND 4U2WA 1FAXA 4HFPB 4AFSA 1C1MA 2KCOA
chains in the Genus database with same CATH topology
2W5EA 1AY6H 1TNIA 1G2MA 2XCFA 5J4SA 4IGDA 3BEUA 1BUIA 2SGEE 5GCHF 3FAOA 2GDDA 3NXPA 1U6QA 1AIXH 2Y80A 1MKXK 3Q3KA 1Y3YA 1CE5A 2Q1JA 1QRWA 3P70B 1GJ8B 1LVMA 4GSOA 5DP7A 9LPRA 4UE7H 1EOJA 3A82A 1TGBA 1HAHH 3MO6A 2OBOA 3P8OA 1KXDA 1EX3A 4ABDA 1TLDA 2FZZA 1O3AA 1Z6JH 3F9EA 3ZVFA 1EJMA 2NU2E 2JP0A 2WPHS 2ZHWH 1S81A 3U8RH 3SNBA 5J4QA 2QAAA 1MTSA 3MU5A 1VZQH 1HAGE 1G3EA 2R0KA 5EOKA 2OP9A 3SU5A 2A0QB 3VB7A 3R3GB 1W7GH 1DXWA 2D2DA 2ZDLA 3RXUA 1ZPZA 2P59A 5L2ZH 3GDVA 5DG6A 4VGCC 2BDAA 3GY2A 2P8OC 3PROA 3TK9A 4DGJA 3A85A 3E0PB 2XC5A 1FONA 3FP6E 1GBDA 1Y3VA 2BDYA 2QA9E 1IQEA 1YLDA 1ZYOA 4ZH8A 2PR3A 3H7OA 1QY6A 1DWDH 3RM2H 3STIA 3K2UA 1DLEA 1O3HA 2PW8H 2GV7A 3UTUH 1GWAA 3ZYEA 2Y81A 3RUOA 3MYWA 1FY5A 1V2MT 2QXIA 1O37A 1TNGA 1UMAH 1NM6A 4NIWA 4XBDA 3GYLB 1BMAA 1EPTB 4ZHLU 3VB6A 1GMDG 4AG1A 2AGGX 3K65B 1L4DA 3SV2H 1O36A 1UTMA 3Q3XA 4D7GA 4K1SA 1DWEH 4ABAA 3TGKE 3HGNA 4X6MA 4Y76A 1XMNB 2ZO3H 3ENSB 3RC4A 2C8WB 4ISHH 2GDEH 4J2YB 4YOIA 3SHCH 2ODQA 2VIVA 2HLCA 3QDZB 1BZXE 2FESH 1XVOA 4IBLH 3ZVCA 2PWXA 1ZSJA 3HPTB 3UNRA 2FWWA 1MTNC 3SV8A 4BAKB 2WPJS 2XNIA 2H6MA 2C8YB 4GHTA 3C27B 3RLYH 1EB1H 2OC1A 1W7XH 1PYTC 1JWTA 2XRCA 3AW1A 1LVYA 3I29A 1UCYH 3ZV8A 3U69H 3SORA 1W0YH 5ABWA 1QTFA 1RGQA 3SI3H 1MCVA 1SBWA 3A80A 1CSOE 5BPEA 3BTEE 3MWIU 3P95A 3KIDU 1OWDA 4ZXXH 1O35A 4DY7B 1TGSZ 3T27A 2ZFSA 4A1TA 1V2ST 1N6YA 3BIVH 2ZFFH 3GOVB 3LGYA 4JZIA 5GJ4B 2R3UA 3TITA 1OWHA 3P17H 3BTHE 4FU7A 1BMMH 1AZZA 2OC7A 3U8OH 1B0EA 4AN7A 1O3BA 3UWJH 5SGAE 4K1TA 5E0HA 2PTNA 2FI4E 1F92A 3V3MA 2QF0A 4Q7ZA 5DK1A 1ELAA 1O5DH 1V2UT 4DW2U 2HVXA 2NU0E 3AVZA 1G9IE 1KXFA 1OXGA 1DUEA 2CMYA 1T7CA 3SV6A 1LMWB 3F68H 4ABGA 4AORA 4IW4E 2GX4A 3HKJB 5DP6A 2ODPA 1MKXH 4RKJB 3TH2H 2PFEA 5FHTA 4WXIA 2A7HA 1K1JA 1SR5C 2ZA5A 1HXEH 3I78A 1MQ6A 3LC5A 1O5EH 1MQ5A 2ZWLH 3EGKH 5E2PA 2R9PA 1WTGH 2PSXA 1C1NA 3SNCA 2G4TA 3OY5U 3UREA 1F5RA 3E1XB 5DJ7A 2SGQE 5E0JA 8GCHF 1FN8A 2GCTC 1FIZA 3UY9A 1O2JA 1Y3WA 1KLTA 3D65E 5F8ZA 1G32B 1L2EA 1P57A 2W3KA 1QURH 4RSPA 1QB1A 2ZPQA 3RXVA 1BTUA 2FXRA 1YPEH 3A7TA 2B5TB 3NUMA 3SI4H 1SI5H 2FO9A 1BQYA 1EUFA 2G81E 2ZQ1A 2HWLB 1NT1A 1B5GH 1K28D 3KQBA 4YLUA 2XXLA 1VITF 1QL8A 3AASA 3OSYA 2QXJA 2ZHQH 1C2KA 4GUXA 2VNTA 2ZDAH 1NRRH 2GVFA 1CA0C 5HM9A 1K22H 1NU7B 2V0BA 3SNEA 5T6GA 1AWHB 1LKAA 2BD2A 1H8DH 1VJAU 1ZRBA 3KQCA 5A8YA 1FI8A 3HATH 3LGTA 5C5OA 4BAHB 2BLOA 4NIVA 4F4OC 3Q77A 3EAJA 2G51A 3NKKA 3TGIE 1SFQB 1FLEE 1PPBH 3RC6A 1DICA 3SJ8A 2Y5FA 1AKSA 1ANEA 1H4WA 4CHAC 1MTUA 2IJOB 1SGTA 2GTBA 1TFXA 1XXFA 2BLWA 1ESBA 2Y82A 5JFBA 3SU2A 8LPRA 1EB2A 1Z8GA 1UK2A 4JZ1A 4ABEA 1HIAB 4INKA 1GCTC 1AB9C 2BQWB 2A45B 4B2CA 5T6FA 3M5MA 1BJVA 1CT4E 2F3CE 4Y71A 1OYTH 1KIGH 1MU8B 1C5VA 3QZQA 1E38B 3RU4D 3BG4B 1NN6A 1V2NT 2M5TA 1C5MD 2P3TB 1O30A 1F5KU 4TYDA 2F9BH 2O8LA 2P8OB 3PV4A 3RXAA 4YM9A 1PPGE 4I33A 2ANKH 2ANMH 4ISLA 4WJG2 5FCRA 1LQDB 3M61U 3ZZ7A 1UTLM 2A5IA 2I6QA 2FOEA 4U30A 1DWBH 3BSQA 4Z6AH 4Q80A 1UJ1A 4FUCA 1C4Y2 1C4U2 5GCHG 1DY9A 2VIQA 1G36A 1HJ9A 1F0UA 1TE0A 4NWKA 2ZI2H 1GJCB 1GHXH 1F2SE 2ZU5A 2A5KA 1FPHH 1BTPA 1C2GA 1FDPA 3RLWH 3TH3H 5LH8A 1ZMLA 3E0NB 1OX1A 2ZIQH 2P3UB 2UWLA 2XBXA 2A7JA 1ELDE 3NPSA 1TALA 4IMZA 3RMMH 1ANDA 3HGPA 1C2MA 3MNCA 3RXJA 1XKBC 4CRDA 5AFZH 2C4FH 1UHBA 2G4UA 4MG3A 3GYMA 1EZXC 1ZGVA 3ZZAA 1A46H 2OUAA 4YESB 5AF9H 1GVKB 2OC0A 4MVNA 5E2OA 1AD8H 4FUFA 3SJKA 1A1RA 2V6NA 1P04A 4Y7AA 1LPZB 1ACBE 1LHCH 1EAWA 1SPJA 1RTKA 5C1UA 5LGOA 2RA0A 2H9HA 5FX6A 3PLBA 1D6RA 3O8RA 2DE9A 1QB9A 1O3OA 1Z8IB 1ABJH 2EA3A 1T8NA 3MU4A 3QTOH 3ZVDA 1BBRH 5TJXA 2Y5GA 4GCHF 2HALA 1GI4A 1WTHD 2G8TA 3T62A 1Y5UT 4ZUHA 3ITIA 1C5TA 8KME2 1P57B 1O3LA 1TX6A 2WPIS 3VXFH 3EA8A 2ZFRH 3C1KA 1J9CH 1N8OB 3TH4H 1EXFA 1LKBA 1RIWC 1V2OT 2G52A 1GHYH 1OS8A 2FI5E 3QUMP 2FODA 2BDHA 2WV5A 2BZ6H 3OU0A 3WY8A 3KGPA 1A5HA 3TNTA 1AGJA 3QWCH 1GI9B 2A7CA 5L2YH 1CQQA 3AAUA 1O3JA 2ZECA 3PB1E 1B7XB 1HAVB 1AU8A 2VIPA 2O8MA 1MMJN 1UO6A 1XX9A 1DVAH 1GVLA 3MO3A 1KXEA 2FOBA 2H9TH 2QXGA 3V12A 4B73A 1UTQA 2Z7FE 3P8NA 2RA3A 1TPAE 1S0QA 2Y7ZA 2ZKSA 2W7SA 4OS2A 1RJXB 4MQAA 3E3TA 3BTDE 1BTWA 3E16B 1TX8A 4NA7A 5LPFA 1GI0A 3SU1A 1F5LA 3RU4E 2EC9H 3D49H 4JMYA 3LPRA 3URCA 1Z7KA 1AHTH 3UUZA 1ZPCA 3A7ZA 4GPGA 1O33A 1EP6A 3F9FA 3GCNA 1SGFG 1NY22 3A7YA 2SGPE 2THFB 4FXGH 1QL7A 3SV9A 2FS8A 4K60A 1F7ZA 2H2ZA 1BRBE 2XCNA 3TLOA 5LPEA 3GCHC 3V7TA 3BN9A 1NRQH 4Y8ZA 1G3CA 1HUTH 2FLRH 4R8TB 2VVUA 1C4V2 1OOKB 2Z6BD 4NWLA 1GBEA 1RTFB 1YKTA 3PLKA 4OGXA 1O2WA 1SQAA 4E7NA 1AFEH 2RG3A 1ESTA 3QO6A 5EXNA 5E8EH 2VWNA 2OINA 3M36A 3OY6U 3FFGA 1CA0B 1WUNH 2XBVA 1O2OA 1L0ZA 4B75A 3SU3A 1EPTA 4UFGH 4ZAEA 2J95A 1KLJH 3ATKA 4BANB 2BY6X 2C90B 4AX9H 7ESTE 1O3EA 1HBTH 2VU8E 5H4IB 2Z9JA 5A09A 1GMCF 1E37B 1C2EA 1TMBH 3D62A 1TMUH 4ZXYH 3MI4A 4CHAB 1BJUA 1HAZB 1G3DA 3SNAA 1SLXB 1T4UH 3GY3A 3RXMA 1P10A 1W3CA 1EAXA 2VIWA 2BTCE 5JBBS 3RXOA 4DIHH 1MBQA 2CHAC 1GCTB 1AB9B 4U32A 1TRNA 2OBQA 3RMLH 4FUGA 1P2KA 1ZRKA 2B8OH 2V3HH 1RS0A 8GCHG 1UCYK 2ZHFH 2FIRH 1TGNA 2CGAA 4X1PU 3U1IB 3W95A 1P12E 5CE1A 1W14U 1HDTH 5PTPA 4ABBA 2ZTYA 1P2MA 1LPKB 4A1VA 3ZZDA 1QIXB 2O9QA 1J16A 1S82A 1SGCA 1J15A 4YTAA 1O2XA 3UR6A 4E7RG 2CN0H 3MU0A 2GZ8A 4MTBA 4UFEH 1C1WH 3SJIA 3SUDA 2VWMA 4WH6A 5T3HA 1VITG 1XUKA 5EODA 3VFEA 1O2RA 3KQDA 1BMLA 2DUCA 3RXBA 4NFEA 3ATIA 1EZUC 2WPMS 1Z1IA 3SNDA 4UONA 1L1NA 2GV6A 4FU8A 3LDXH 4MPWA 1D3DB 2P94A 4JZDH 5JBTA 2JH0D 1THPB 2BD4A 1C5RA 1TPOA 2BVRH 3SQHE 3S9CA 1KTSB 2VIOA 3TK5A 1C5YB 1SGEE 1VCQA 3AW0A 2TBSA 2OYAA 1SB1H 1A3BH 1DY8A 3BTFE 1S0RA 3M5LA 3SO3A 1SL3A 3ZZ5A 1DXPA 5FBEA 5A2MH 3GISB 1MTWA 3N7OA 2ZTZA 2FMJA 1LHGH 3UWIA 7KMEH 3HK3B 4K1EA 1O2LA 1QJ6B 4YT6H 2ILNA 1GJ7B 3LGWA 1AN1E 3ATMA 6GCHF 2GKVE 2CF9H 3DFLA 1KXBA 4Y8YA 1Z6EA 2TGTA 4A92A 1FMGA 1TGCA 1UTJA 4WF8A 3SUEA 1FY3A 3QN7A 2ZGJA 1ARCA 5DP5A 1NFYA 2PV9B 4A1XA 1PQAA 2PTCE 2A32A 1ORFA 1RIWB 4MPUA 4NSYA 1GL1A 7GCHF 5EQRA 1SQTA 2AYWA 1SLUB 1YF4A 4NIXA 1YPMH 2JH5D 2CF8H 3ZZCA 5EXLA 2UUJB 1P05A 3A7VA 1GI5A 1GJAB 4ZMAH 2JETC 3UNSA 1SC8U 1YLCA 3IITA 3TJOA 1GVZA 1H9LB 4TWYA 1EP5A 1HPGA 3LJOA 1QJ1B 2YNAA 1GHWH 4FVDA 1QR3E 1NESE 3P8GA 5FPSA 4X8SH 5CHAC 1MU6B 1SSXA 2FLBH 3E8LA 1DSTA 1K1OA 3BIUH 4Y10E 1YM0A 1SFIA 2K1QA 3TPIZ 1GHBF 1W10U 5GWZA 5FPTA 1DITH 1XUGA 2H5DA 3EA7A 4JYUH 1PPCE 2Q6FA 2AIPA 1DWCH 1HIAA 4JZEH 5A8XA 6CHAC 4WVPE 4Q7YA 2F9VA 1AFQC 1BRCE 1Z8JB 3MH4A 1L1GA 1VITH 1ZJKA 2ZHDA 3GCHB 4GCHG 4INLA 3RXEA 1G3BA 3M35A 2EI6A 1CU1A 2ALVA 3UFAA 3ZVEA 1BB0B 1FPCH 1RD3B 2BXUH 1BIOA 2WYGA 1FIWA 3IG6B 1SHHB 3BG8A 2J4IA 1P0SH 1GJDB 4KGAA 1EKBB 1IHTH 1P2JA 1HJAB 1RRKA 1NTPA 1YPKH 3A89A 1P8VC 1HAOH 4HZHA 2PKSC 3K9XB 5EQSA 1VR1H 1YPGH 3EE0B 4QT8C 1OP8A 1ZTJA 3NZIA 3BV9B 1DE7H 2AERH 4KTUA 2YOLA 1S6HA 1TNHA 1PPZA 1GMHF 3M5NA 4AYVB 2C93B 1C1RA 1ZMNA 1O2HA 1LVOA 1GG6C 1DUAA 2IPHA 1O3KA 1TNKA 4B2AA 1SGIB 3A7WA 1HXFH 1Y59T 2BXTH 1ID5H 4BNRA 5L6NH 1IOEA 1XUJA 1ESAA 1JBUH 3U98H 2A4RA 5C67A 2CHAB 2V3OH 3LJJA 3RXSA 4J1YA 2ZDVH 1ANCA 2ZU1A 4AGKA 1JIRA 4DJZB 3KEEA 1RXPA 1OYQA 1FQ3A 4TPIZ 4NZLA 1SQOA 4K69A 4ISOA 3D23A 3GY6A 2Z9LA 1WQVH 5AFYH 1AE5A 1O5FL 3LGUA 3MTYA 4D7FA 4IC5A 5ETXA 2AMDA 5TCAA 1PQ8A 2EI7A 5G4BA 3F9GA 1BBRK 3ZV9A 3BTTE 3KQEA 4ABHA 1Z1JA 2XW9A 4RKOB 1FJSA 1YP9A 2F9PA 4SGBE 1P2OA 4DVAU 4O3TA 4AG2A 2O8UA 3KHVA 2Z9KA 1O2PA 1KYNA 2OQUA 1TYNA 1W12U 3E6PH 4NG9H 1UVTH 4AFZA 2A5AA 4Z0KA 2GT8A 1C2JA 1K1PA 1V6DA 2AS9A 2FTMA 1Z8RA 1A5GH 4X8VH 3P8FA 3A7XA 1O5AB 1O38A 4D76A 1VGCC 4R0IA 5E0GA 2G5VA 2FPZA 4X0WU 3QGJA 2D8WA 3EQ0H 1LCYA 1ZGIA 3PMJA 2ZDMA 2ZU2A 1GHVH 1GMCG 4HTCH 1HAVA 5C3NA 3QLPH 1C5PA 1OWEA 1Q3XA 3GCTF 1HAPH 2FP7B 3I77A 3TK6A 4THNH 1A2CH 2NU1E 1CGJE 1HFDA 2ZFPH 3S9AA 1FAKH 2I6SA 2BM2A 4XE4A 4FUEA 3VB4A 4GHQA 2PUXB 1AVGH 2FOGA 1K1LA 1KLIH 2BVSH 2QN5T 2ZCHP 1HAXB 4IN1A 1O2IA 3FANA 3UOUA 1BOQA 2J92A 4NCYA 1ZJDA 2HGTH