1Z8HA

Crystal structure of a gdsl-like lipase (alr1529) from nostoc sp. pcc 7120 at 2.02 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
202
structure length
202
Chain Sequence
SKTQIRICFVGDSFVNGTGDPECLGWTGRVCVNANKKGYDVTYYNLGIRRDTSSDIAKRWLQEVSLRLHKEYNSLVVFSFGLNDTTLENGKPRVSIAETIKNTREILTQAKKLYPVLMISPAPYIEQQDPGRRRRTIDLSQQLALVCQDLDVPYLDVFPLLEKPSVWLHEAKANDGVHPQAGGYTEFARIVENWDAWLNWFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative lipase from the G-D-S-L family
publication title Crystal structure of Putative lipase from the G-D-S-L family (17135349) from Nostoc sp. PCC 7120 at 2.02 A resolution
rcsb
source organism Nostoc sp.
molecule tags Hydrolase
total genus 76
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1z8hA00
1J00A 2WAAA 4K3UA 5HOEA 1FXWA 2O14A 1FXWF 4I8IA 3DCIA 5A4AA 1DEOA 4S1PA 1U8UA 3KVNA 4Q7QA 4M8KA 4OAOA 4LHSA 3HP4A 4JKOA 5BN1A 5CD9A 4JJ6A 4JJ4A 1BWQA 4RSHA 4HYQA 1Z8HA 2VPTA 3DC7A 4TX1A 3RJTA 4H08A 3BZWA 4DEVA 1ES9A 4JGGA 4XVHA 3PT5A 1DEXA 3SLRA 1V2GA 4JHLA 1WABA 4K40A 1K7CA 3DT6A 1YZFA 3C1UA 2WAOA 2Q0SA 4K9SA 4RW0A 4HF7A 1BWRA 2APJA 2HSJA 1ESCA 3DT9A 4PPYA 1JRLA 3U37A 4OAPA 1VJGA 1PP4A 3DT8A 1ESDA 3W7VA 3P94A 3SKVA 1BWPA 4NRDA 1ZMBA 1IVNA 4K7JA 4IYJA 2WABA 2W9XA 5JD3A 1ESEA 1VYHA 2Q0QA 5B5SA 4Q9AA 3MILA
chains in the Genus database with same CATH superfamily
2DH5A 4ZIRB 3EK2A 4ZZ3A 3PGLA 2QN7A 3TLGA 2Q21A 4I5DA 1JIIA 1SVSA 2NAPA 2PIDA 3PIRA 3WLTA 4DARA 4JC5A 3CN9A 3ZZUA 3N59A 4B87A 5FADA 1PR6A 3OZAA 4AMVA 1HDXA 4HLUC 2YVAA 2BFBA 3GRFA 3IL2A 3JYOA 3KO8A 3USCS 4DMKA 2EEPA 1C8KA 5EJ8A 4TQAA 3RYCB 2Q9BA 1A9ZA 1V8FA 4IHKA 4O4JA 1Z0UA 3IP9A 5FO1A 3Q4GA 5B3JC 3DS8A 2ET6A 3PHHA 3TB6A 1CZUA 4ZZ0A 5KVVA 1VCMA 2BRUA 1U1IA 4RD6A 5GIPE 4RA6A 2QSUA 4DVGA 1O97D 4I4LA 4MWZA 3I52A 3N0RA 2HLDA 3FX2A 3MTJA 3C7TA 4R9SA 1E1CB 3TZHA 1A27A 2IF0A 4ARCA 5BXYA 1U8CB 1GO2A 1NBHA 1ZOLA 2ZJ7A 2XE7A 2JFGA 4O4HA 2P5SA 4ADSG 3KQVA 2H1SA 1BQ3A 2VAPA 1G291 3HYTA 3O3MB 4IS2A 4RS3A 5B4VA 4O2AA 1D2EA 2AL7A 1F0YA 5DNEA 4B6FA 4DMLA 2E5LB 4MVCA 3JQGB 4KUHA 1HZZA 4BTLA 4EG4A 1QF6A 4KQ9A 2EP7A 3RTEA 4G4SO 3H0CA 3F8TA 4B9AA 4O59O 3GGSA 4RAOA 3BS4A 4U4AA 1YOVA 4F3RA 1O0SA 1DXOA 4BRUA 3TLCA 2P9GA 2IY8A 5C31A 4XVHA 2JIBA 4ARAA 2H7XA 2PRSA 3SN6A 1KVQA 2PWBA 4DLVA 3ESQA 1N3LA 3IVAA 1I1OA 1ILEA 3SEZA 5H7XA 4BWGA 5CDFE 1GFWA 5JRZA 3RE1A 1ECCA 1PJ2A 4GM1A 3IC5A 3H9QA 3RI3A 4RDHA 5AVYA 2QGZA 1CE8A 3TR6A 3S81A 2BZGA 4KP7A 3I3SR 4URVR 4JI2B 5FBKA 4HEJA 5J4KA 5HWSA 1LBQA 5DCYA 1RT9A 2R25B 3L93A 1PK8A 3MC1A 4U2KA 2AKAB 4F2PA 4K0RA 4HWOA 5AI0A 2DQSA 3CUKA 1D8AA 2XVAA 2XUGA 1XOIA 1Z7GA 3GGPA 5LQRA 1QG0A 3ZWQA 2D4AA 2QNBA 2LW7A 2WHXA 3UUWA 2FEAA 2FUNB 2HMYB 3VPHA 2DQ4A 1MCZA 1NXSA 1T1SA 2VP0A 3KYDB 4LYGA 4R40A 2Y68A 5LDDC 3H3JA 3R5HA 4XGIA 2EARA 2BLLA 4KRFA 5HFNA 1Z8NA 2HA2A 2OHHA 2PX4A 5AHOA 1JJFA 5COBA 1M83A 1FZQA 1ZPDA 2AXPA 2EBFX 2ZT8A 3FUCA 1Y8ZA 3U3OA 1LI4A 1W2HA 3ASYA 4GG1A 1TTTA 2ISCA 9LDBA 1AK2A 1O58A 4HVAA 5IF9A 2X9QA 1MFZA 1UZUA 2RHOA 2ZSJA 1E3TA 1TTQB 1W5FA 2XSZA 4PIPA 4RZ3A 3VR4D 1NE2A 4UVEA 4RWZA 5A0VA 2RGEA 3QPDA 5AFSA 4NOMA 1LEHA 1NYQA 1POXA 2HBZA 4KFCA 5H02A 2QIPA 3GJZA 4X1OA 2FPRA 2F8SA 3AB3A 3CV3A 1MU0A 1UJ5A 1VZ3A 2NZ2A 3FOAA 1E2UA 1I7LA 3L77A 4E7OA 2XCRB 5KTTA 1KU6A 1P0IA 3CUEF 4C4PA 3IAUA 4YECA 5CVJA 1I13A 2B8TA 3GFVA 4BFXA 2OQRA 1LVHA 4Z7JA 4O4HB 1PQUA 4O3MA 1A8SA 4NI5A 1SUEA 3VYSB 5HOEA 1SVWA 1DC8A 2IPAB 2PHZA 5M7EA 2IZ7A 4FMDF 1JSCA 3PJGA 3SX4A 4YWHA 1NVWQ 4AU1A 3HN2A 3H2YA 3UPUA 4S1PA 4YS6A 2FH5B 3N8GA 4KLAA 3OPMA 3O94A 3QGMA 1I7PA 1RQGA 3VNUA 5JSHA 1KO1A 2O2HA 4F85A 2JAWA 3U7IA 4FHDA 1E1KA 3R0VA 4OHVA 2P4UA 1E9VA 3ICWA 4L22A 3HCWA 2GERA 4P53A 4Q66C 5DOZA 5EJFA 2ERYA 3QW2A 1G8YA 4XCXA 5TVKA 1X87A 2WT9A 3SF8A 1JLKA 1G3QA 1P0PA 2GD1O 2KQUA 3E3LA 1N5LA 4LFAB 1P62B 1UJMA 1XX6A 1UXKA 2EX4A 4HX5A 4QVGA 3D54D 4R3UC 1ODFA 3VDMA 2XNKA 4LMPA 5CG1A 2JLYA 1RIFA 1EUCB 3C3PA 3GOQA 3R41A 4IJWA 3MUOA 3OT4A 4IRXA 5KYKA 1CS0A 3GV0A 1LQTA 1V1JA 4BQRA 1T29A 4G81A 5ALIA 3N53A 3COZA 1CRQA 2GZ1A 3OZRA 3IP6A 4I50A 5AK4A 1UOPA 3H2IA 3HUTA 3QQ5A 1U02A 2CLIB 3DL4A 3FDXA 3GOHA 4GZMA 1ZNWA 2C61A 2B8EA 4I3HA 1Z26A 1M34E 2GWRA 1WDTA 2QVCA 2QZPA 1P5JA 3FF1A 1SRRA 4MQEB 3LBNA 2G40A 1JKFA 2F59A 4XDYA 1GN9A 1RTKA 5K2MA 1RCTE 5BP7A 2HBQA 1MP0A 4B79A 8GPBA 1IZ8A 2VOJA 4OQXA 4Q21A 5ICFA 4MWSA 1ECGA 3T0GA 3U3DA 5A4KA 1VSBA 3H75A 2J30A 1J56A 4XYMA 5FH9A 4MGHA 2Q0HA 4PICA 4UNQA 1DIGA 4DDKA 2A0KA 3Q3HA 1VJ5A 3TSOA 1YKSA 3LZDA 5GY7A 1XAGA 1JPNA 3WB2A 4C3ZA 2CKDA 5JQGB 1SCNE 3EA4A 3VYUB 4A0HA 1WHTA 2O8VA 2PH5A 2Q5QA 2Q8PA 3C1UA 3PGVA 2EU8A 3QU7A 3VQTA 4D3XA 4HVLA 1XDGA 3IDOA 4BX2A 2OCYC 4K2AA 4QDTA 1ZKDA 4YR9A 3U7RA 4PGGA 3ZPXA 5EJ4A 5IM4A 2UXBB 1E2JA 4KN9S 4LUCA 2ZR9A 5ALTA 1OU4A 2G07A 3DW1X 4LAFA 4WEOA 4C4YA 4YASA 1UBHS 3Q2KA 4I46A 1RBYA 2A1UA 3M9WA 4DPMA 4UXJA 4OQFA 3WLJA 1PZFA 3A1SA 3T3MB 2Z58A 2CJWB 4FUQA 2WILA 3TZQA 5J43A 3U3KA 3PLAE 4BBAA 3GAAA 4KKVA 2PRZA 2WG2A 4RKWA 1LPNA 1N5OX 3I28A 3P9ZA 5HRCA 3V8QA 4LTNA 2G9UA 3P19A 4YUAA 2FZ5A 1G2PA 4LC9A 2UYYA 1RM5A 4RK0A 5JHHB 3L41A 2B8WA 3HVJA 4IJQA 1AXEA 2ZIXB 1N2SA 2XB6A 4N0EA 1C3OA 1CY6A 5AVOA 4BLOA 2O6LA 3AL2A 2BGKA 3OQIA 3QMPA 4OREX 5BN5A 5KYGA 3EQ2A 1E1MA 3RS9A 4DR3B 1JVBA 2VF8A 4ZHQB 4D42A 2C5AA 1KBQA 4U9UA 1C7FA 5B7NA 3U4QB 2LTAA 1RAAA 5AQEA 1L7MA 1U90A 2ZSAA 4XFJA 1MA3A 2R0QC 3K09A 3N2KB 4TS3A 1GU7A 2JCGA 2OM2A 2XOXA 1J49A 1HYHA 3MMXA 4P1ZA 1V39A 1H4TA 3UWMA 5DTEA 3V1YA 2HFKA 4G0MA 4B47A 4KWIA 1SC1A 2NTNA 5J2UB 3IQXA 4KEAA 2GJKA 3Q7TA 1T26A 2G82A 5HCIA 2RHTA 3JD3A 1ST3A 1WUIS 2B8JA 5CCBA 1BS1A 4EKNB 1M2VB 4UNSA 5KNLA 3CT6A 3A9WA 1Q83A 4M0PA 3VSAA 1J20A 5EJ9A 1E99A 2JAPA 3I34X 1KH3A 2PK3A 2YJTD 3LG2A 4TROA 3R7SA 3L6UA 4GOXA 5KHLB 4QOJA 1VRWA 5CIYA 3EXEB 4ID9A 1DX6A 1GGEA 3UGKA 2GSWA 3IUQA 4B7AA 3EXFB 4WX2B 1YZHA 2X19A 2XUZA 1Y1SA 1T0UA 2QX6A 4KKXB 2C31A 4DZTA 4F6RA 1X7YA 2RAVA 3WQSB 5FV4A 3F97A 5ALXA 3TGPA 4N47A 1DE0A 1CF9A 2NU7A 5LYJA 4HQ0A 4DMCA 1DTSA 2L2QA 4LRQA 1ONOA 3NWEA 3OM8A 2DH6A 3STXA 3IB6A 5CM2Z 3ZUPA 1ZIPA 2CLOB 3OPNA 3JASB 4C7OA 1P1KA 1PT5A 4RHXA 3LCCA 4HLNA 1U2RA 3F2VA 1JB9A 1WY5A 2Q9AA 4M7PA 3PZBA 2YJGA 2HA3A 2QJWA 4G0XA 4W7SA 2DBYA 2FXVA 3UJNA 3D8NA 3AR4A 2IYPA 4LZPA 4EKGA 1VKJA 2W6JD 1HDOA 1EK1A 4WN3A 1TKBA 2JKZA 1F38A 5JMWA 2PVPA 1B74A 3SC3A 1E20A 2IS6A 3BXFA 1GNRA 4OQQA 3QE2A 1UOEA 2H1HA 4D81A 3VZRA 2QYHA 1PJRA 3C2QA 3DGFC 2BSXA 4MUYA 5H81A 2H8KA 4XSGA 4R8LA 4P7KA 4YDHB 5BN5B 3TR0A 3PU6A 4WCFA 4IM7A 5B2FA 5HJEA 2BSQA 5KNBD 1B26A 1JIUA 1Z4LA 1FEZA 1XD8A 5BVGA 3L8FA 3QFRA 4KO2S 3O8BA 1IMOA 1NW8A 5EXTA 1QRUA 3TKAA 5SY9A 4TSRA 1PK9A 4KPFC 1J21A 3QI7A 5F52A 2PTHA 4EO4A 1NQWA 1RABA 2WKRA 1YI0A 4OSOA 1QORA 4TKUB 1H4SA 1MT3A 1JG4A 2YMMA 1V9LA 4EA6A 1UJCA 2I4RA 3CBQA 1T1RA 1K97A 2YMQA 4Y7DA 3AESB 1MABB 1CX9B 2VDPB 1FPQA 1TNDA 4WZAE 5H59A 4UEJA 5DM1A 4ZO9A 5BQ3A 3WGIA 1ISHA 1UMBB 3R5SA 1HE2A 1KZHA 4AJJA 2XCUA 2R65A 3LHSA 1EP2B 4G5OA 3RYFA 2O2JA 4R9UC 1G7RA 4G4GA 4ND8A 5KVSA 2D5CA 3C6ZA 2XCIA 3NBUA 2R3SA 4C05A 1YZKA 3RHZA 4U3JB 3MILA 2O3RA 1R7RA 2VCYA 2JLQA 1X8KA 4OUDB 1HURA 5EUMA 4TXMA 1RLIA 1XMPA 2D0IA 2HDHA 4ENUA 2GM4A 3A3OA 3A1FA 3B1JA 3D2CA 1Z17A 5HFAA 4A26A 2VQ3A 3VNVA 4DTCA 2ID4A 5IUJC 5FHQA 4IIXA 4NDZA 2I66A 2YMLA 2OVBA 1UZAA 4DY6A 2AGVA 4ZQCB 2RGDA 4FD2A 1BS2A 1E6MA 2QG6A 1PNTA 2Y1CA 3F6CA 2JW5A 3ASZA 3K15A 4OGKA 5EP1A 2PYZA 4W99A 4RACA 3HUUA 3KQTA 3IB3A 3A2LA 5E95A 1N2GA 1TA9A 4EFKA 3WG9A 1OLXA 3GEDA 2FG6C 3PDUA 3HKEA 3GN2A 1F48A 4QBFA 2VPXA 2Z43A 1KDPA 3SM9A 4P4NA 3SP1A 1JFFB 1HYEA 2G25A 1IM2A 4Z0PA 5HJ7A 4OO3A 5F73A 5KSYA 1FDSA 1FDWA 1ZGHA 4UNRA 2WIDA 3LKBA 2VDVE 1L4KA 5A4MS 4OFZA 3E58A 4ENSA 1N1EA 1XZJA 4Z7NB 5GONA 1BEUB 3L7YA 3MS4A 2FMIA 3TE7A 1P1IA 3ODPA 4GQIA 4I3FA 1WL8A 2HRBA 2I34A 3GH1A 4WCFB 4EFMA 4TXJA 2FY8A 1T5TA 3SXUB 5BSVA 2CDNA 1UZMA 4M0MA 3S4YA 2CHGA 3VOBA 3LRXA 2XGGA 1JL3A 1ODLA 3TJRA 4ZVSA 1KJ8A 3BMCB 6CHYA 5AW3A 4LC1A 2DHRA 3JQQA 3P2JA 2VIIA 1L4FA 3B3QA 3WFJA 2JFNA 2O20A 2QRHA 3QVSA 3NAQA 3N0VA 1RYEA 3V48A 4PXSA 2WF9A 1ZQ9A 4LJ6A 2YXLA 4MAMA 3LCJA 3TRFA 3EBOA 3ZU3A 1T3GA 2DERA 1CSEE 2OHVA 1IN8A 1UEIA 3HSSA 1IUNA 3L9XA 5IKXA 3OWOA 2A9PA 1R3UA 4X45A 3CW8X 3U17A 3HZOA 2HWXA 5SYAA 1G6HA 3P9IA 4HI0E 2QMQA 1CP3A 1G3MA 1ZJWA 1J9ZA 1S9DA 5CX1B 5I7OA 1VL1A 3OOYA 1KHHA 2IZ6A 3ZHXA 2F3SA 1II0A 3B6JA 1ISGA 1NNI1 3PE4A 4U39A 4G0WA 2QJTA 2YINC 2CFTA 3AIOA 3FROA 3LWNA 4P5EA 3BWBA 2ILTA 1O96A 4EX7A 3C39A 10MHA 1GPMA 4HDAA 1W5EA 1V11B 3EAGA 4X6UA 1I1QB 5FA8A 2W2MA 4M0CA 1RXWA 1OVGA 1KFKB 2OK8A 2ORED 3QKUA 4TRJA 2B0CA 4H16A 4KTVE 1MB4A 4CV2A 3CKLA 1NJ6A 3H1EA 4CL0A 3F6PA 1IYZA 2C20A 2GAFA 3GR6A 4ZOLB 5JCZA 5DW3A 1A2BA 5C1IA 3S28A 3D4LA 2D00A 3F67A 4JVSB 3BRWA 3H5OA 5AVRA 2XE8A 3CUYA 3TR5A 3GFSA 4GS5A 4MWCA 1WUTA 3ADBA 1JHYA 3RT7A 2ONYA 3LLUA 4IKEA 1YGPA 3ENZA 3KB6A 4LXQA 4XLLA 1PS0A 1E8DA 4E5MA 3RVLA 4QE3A 1OFUA 2QGFA 1T6XA 2JGDA 3ICOA 2R6GA 4QXOA 1HA3A 5AKYA 2A88A 5AOVA 2W2QA 5JVDA 4A7PA 3WADA 4MV7A 2IVZA 5F51A 1UINA 2HMSA 1W35A 1ZITA 1RAGA 2XIJA 1KI6A 2OAEA 2P35A 2Q8NA 2JI8A 2HQ1A 1CJMA 3OQVA 5E1BA 2JJ1A 5THKA 4EQ6A 4GR5A 3RTGA 1Z0AA 2WPDD 5BSFA 1V1MA 3E2IA 3TAXA 2Q07A 3C6XA 4A82A 3ROPA 4WKCA 1OCEA 5L6LB 1RWBA 2DKFA 3SU8A 2OZLA 2ZE6A 4E5NA 5EQFA 3AFIA 3IX7A 2XZDA 1I7NA 1T3HA 3RC9A 2HF7A 2I2BA 1EYZA 2CLFB 2VP2A 3IO3A 4ZT5A 3T52A 2Q1XA 1Y7LA 4EYKA 3JVEA 2K5UA 3H3FA 4JJGA 2QF7A 4P7FA 1G5IA 3T3GA 4TSFD 2IXEA 1XQYA 4ZC8A 3KLBA 3SR0A 4H7JA 5IUKC 1QS0B 3QG1A 1YVUA 1CU1A 4KO1S 4OAOA 3DE3X 4EFLA 5BR4A 4JR1A 5ALGA 3FPCA 2RFLA 3VR5D 3HKCA 3UAZA 5JSFA 3GUUA 4Q15A 3NPAA 2Z2ZA 3WWDA 4WZZA 5DNUA 4R8MA 1QB8A 3JQFA 3QY0A 4IGEA 2GCNA 4MRNA 5GQSA 1II8B 2TMGA 3NAZA 3VV2A 1D4OA 1XAHA 3RFVA 4MPDA 1NFRA 3KJGA 1C9DB 1MG5A 5LKAA 2DWQA 3ADKA 1IHXA 1KNXA 3MWLA 3PNOA 4YJ3F 3WVNA 3RFCA 3HCBA 1P80A 1NYRA 3ABRB 4IIEA 4AS2A 2C54A 4AJLA 2GKGA 3B48A 3NHYA 4U8HA 3CWZA 5ER9A 4CRWB 2RI1A 3ORQA 1ZSVA 3SG0A 1SUIA 3O75A 3P0HA 4M9SA 4UCWA 4CKYA 4IIVA 1L5LA 3IA7A 4BLSA 3RT9A 3S1AA 4EY4A 1QQ7A 5JDCA 3V3KA 3NPMA 4UTOA 2WSSD 3HH8A 3LYLA 1CNEA 3JQDA 4WASA 1COWD 2A9JA 2HWWA 4KWHA 4D6XA 2FDCA 1H6BA 1CR0A 4EW6A 2WD7B 2X14A 1YS9A 1FMTA 1SEPA 4MGZR 5EUCA 3KAKA 1F0KA 4FI3F 2FSVA 1HO3A 1LBEA 4RXUA 3N2IA 2JGLA 4LYJA 4AJNA 1GRRA 2A86A 5TGDA 1B15A 3KIPA 3WYAA 2JD2A 2VJLA 1UXOA 4P84A 5AKLA 2B5OA 2O2CA 4KODA 4RV9A 5DZSA 4B17A 1M33A 3BMQA 2C58A 2JHCA 3GZTB 3EBLA 3B2EA 4JQYA 4KYVA 3ZQ6A 1V8ZA 4EQ6B 1SQSA 3LWBA 3BTUA 1ZJJA 1EZZA 1M8GA 2APJA 4POAA 3WYFA 2TMDA 1V1MB 4A27A 5T8KC 3AK4A 4QATA 3CQ9A 2Q8QA 4M0UA 1DQSA 4CTJA 2I3ZA 3MVEA 3VC2A 4YDRA 3GRYA 3FI0A 2PD4A 2P0EA 1E0AA 1NJ8A 2IH5A 3WK4A 4LDAA 1J25A 1USIA 1C41A 3CXRA 3T5CA 1F2TA 3ZGYA 1PSDA 1JHUA 2OFFA 1KQGA 1V37A 4IPTA 1TW2A 1IWPB 1M67A 4LJ9A 1WXGA 1OLUB 2RHMA 3FMFA 3NB0A 3WRWA 1EUDA 2F3UA 2R1VB 3B6ZA 3NUGA 4PNPA 5FI1B 3PC7A 1B4DA 3GFQA 3I32A 2IZ0A 1VBNA 4EY3A 3D31A 1ZM2A 1MB2A 5DIFA 1B41A 1ZP6A 4Q9AA 3C5HA 4NTZA 1OBCA 1Z45A 3MMNA 4JVLA 1MO4A 3OTHA 4OYLA 3UM9A 2UZ4A 5KNCH 2WAAA 2VNAA 3GLHE 1YJBA 3S2YA 2UU9B 3RSGA 2GZAA 2B5VA 2WYVA 1ZLYA 1I9CA 3UK7A 5U9CA 3D4OA 1LK0A 3D7NA 4EUEA 2GXAA 2GT1A 2BMAA 2UDPA 4KXYA 2BWJA 4F84A 1XVIA 2TRSB 1X13A 3WY9A 3UMRA 5JV5A 1HDEA 5K0SA 4X61A 4PYMA 4F93B 2J4CA 4QOHA 4BQIA 5BV7A 2OEPA 2F6RA 1K5PA 3RVNA 2PFKA 3NYIA 4BNDA 4DCTA 2Q6TA 4M22A 1Y4AE 3QEMA 4E46A 2QENA 1G4UR 5F4ZA 3SR3A 1PBTA 3FE2A 2XLBA 2HK9A 3NATA 3EVAA 4EG7A 4DCNA 1Q19A 1TEZA 4Q4CA 2PBLA 3OT1B 4L3VA 4NCXA 4QUKA 2A59A 5K2OA 2YXPX 3DTVB 3I9JA 2FA9A 4QD3A 1TEVA 5PGMA 1XL1A 4TMKA 3FSGD 2NUAB 3K9FC 3UAWA 1EFAA 1B3BA 2OV8A 3DQQA 5AI8A 4JBWA 4IWNA 2BTOA 2HBYA 1XPOA 1XRJA 3PTAA 2C3UA 1LU9A 3C74A 1H1DA 1PK7A 3WR5A 3A06A 3EWIA 5FLXA 2NNWB 2PV7A 3H65A 1J09A 3GRZA 4CN9A 1FBNA 3B3JA 4KQJA 4UXIA 1G5RA 1ZWKA 3TD9A 1BE0A 2XGMA 3D1JA 3N8HA 3O8QA 1KFCB 3PTZA 3VNBA 3VTFA 3A6LA 3HA7A 1N2BA 1N5RA 2JCVA 4L3OA 4IS3A 4GXNA 2RI0A 1C9YA 3PWZA 5ALHA 4AM8A 1T1EA 1ZO8A 1F8XA 3LP6A 4JC8A 3W1VA 3WFIA 4F91B 3T41A 1Z2DA 3EDMA 5K3DA 2PDAA 4EI2A 1QRTA 1NONA 4LXXA 1V2GA 4LVUA 5B58T 1IJKA 5HMMA 4P34A 2XMRA 3RFXA 3A6JA 4QYIB 1MC5A 1FFSA 3IVRA 5L53A 3F5SA 2DT8A 4BZXA 2NO4A 4YBZA 4HYYA 3DBLA 3LXMA 2Q7XA 3ADCA 2FPPB 4YXWD 3KJNA 3IOCA 3RKSA 1DKOA 5FT9A 4OXKA 3TLJA 2JLSA 1BTOA 3UXYA 1JR6A 3DMDA 2M2IA 4H7KA 1UJ2A 4AJPA 1WMBA 3U5ZB 3G79A 1TAUA 4TKLA 4LF4B 3GB9A 2HU2A 1KVTA 2Q0SA 4EYOA 4AZVA 5FWYB 4LX8A 5JWRA 1EX1A 1J1UA 2GARA 3KRTA 4GPBA 3WKEA 1ZUNA 1KZGB 3W2EA 3HB0A 1NXQA 2FAXA 1VJDA 4JLMA 4P3NA 5EMNA 5TJHA 4X3PA 1TMKA 4Q3CA 2Z4TA 1K9SA 3WWEA 2I7TA 1YRQA 2YR0A 5K8TA 1DCFA 3GCDA 4NZ9A 5I4CA 2GEKA 5KBYA 3KPVA 1ZK4A 2HSWA 3MT0A 3LY9A 2AMFA 3LUPA 1D7OA 2PLRA 3KSZO 4MVYA 4REQA 4EX6A 2NSJA 4B3HA 2I3DA 1GZHB 1CQJA 4C22A 1ESDA 2BGLA 5A62A 4JFAA 2QTLA 4PSCA 1MG0A 1VA4A 5A6VA 2V1XA 2IYZA 3H97A 3IE2A 3WBJA 4IIBA 3AM5A 2PKWA 3Q6NA 1ZN2A 1HTTA 1SBCA 1J5PA 4UCQA 3T61A 5E6SA 5C7YA 1TECE 2QOEA 2FG7C 4MUHA 1ZI9A 1M76A 3B3FA 4WOCA 4R9NA 3V1NA 5F2NA 1JVNA 3OO1A 4QWMA 4PAMA 1ONPA 2BOVA 2CJFA 5C1OA 4B7CA 2VZ0A 2W2TA 4XTRA 3ZQKA 3ZWPA 1KGSA 1ZU5A 4OTZA 4DV0B 3N5KA 2I4NA 2XYGA 4UEQA 3L0SA 2PYIA 2YZ2A 3O8QB 5DHPA 5FQOA 2NPFA 3TI7A 3RQIA 4LJ4A 2AZXA 3L8DA 1HOTA 2JGMA 3WDKA 2GEFA 1CYDA 1QQ6A 3PHJA 4NQRA 2QZZA 5JYBA 3HUEA 3NHMA 1XO1A 1KEPA 1F4PA 2Q5EA 3BFJA 4NFLA 4YRAA 4XB1A 4E6PA 5AHKA 5C34B 1RE0A 4Q19A 1TQ6A 2W0MA 5EZYF 2YX1A 3EVTA 2K6GA 1EZ4A 1I4DD 3R5JA 1A4IA 3F8WA 5DWVA 3WHPA 1X7WA 1KAGA 1K1EA 4UVGA 3C85A 4HQNA 3HM9A 3ZNNA 3AVOA 3E27A 3GYBA 4EPXA 3GJ5A 4F1WA 3N2ZB 4AZ3A 5B6PA 1XVTA 2QGNA 3JPYA 3WHLA 4CMEC 2WTUA 2XB8A 1A88A 3V4PB 3VSEA 1N3YA 1T8UA 1FIUA 5I9TA 2E1RA 3DHNA 1ONBA 5IP5A 1GQRA 1Q6YA 4PHHA 1X1AA 2P4EA 4JBLA 2HFJA 3KKOA 2Z6AA 1B8PA 1GPBA 3QUTA 3V6LA 2BFDA 5GPBA 4H1VA 1AC5A 2ZJOA 2XCTB 2Z6QA 3F96A 1I2AA 3P8ZA 2V6FA 3RG2A 1GYPA 3OIGA 4UDOA 2HSEA 2BFPA 3C1AA 2HIGA 4M76B 2R7NA 4GOKA 3LZCA 3WGQA 1GQFA 4B3JA 2GCGA 1A1SA 1U81A 1AQLA 1AUPA 2H5IA 4X6XA 1Z36A 3KPWA 3U4CA 5FWNA 5JAIA 4M21A 2H4WA 4F21A 3QBDA 4J4HA 1NULA 2F1OA 3GLQA 1T5LA 1MH1A 2HREA 4XR9A 4YJHA 1G8HA 2ZUSA 2WTAA 4BVFA 5HKOA 4LYFA 1KU0A 4OQLA 2I4LA 4GEGA 4QO7A 1KARA 3KHUA 4RMJA 1TJNA 3RIHA 1H05A 2GN8A 1O0CA 2JZOA 3PC3A 3FIUA 3HKDA 4U63A 3RTBA 4REMA 3OQ1A 4QRIA 1HE1C 5FYQA 3TINA 1WQ1R 3OLZA 3DDOA 2NVBA 1YKFA 3JQRA 3I1IA 4DB4A 3MTQA 1BX3A 3JSAA 5SZJA 1EXNA 3UO8B 4NS1A 4BHTA 2IH2A 5C4GB 1NF3A 4QTZA 2ODTX 2QLTA 4LA4A 2JHAA 1XTZA 2PJDA 2P41A 1QYWA 2RK3A 4PXAA 3H2HA 2P2NA 1ZISA 5KQMA 5IHPA 3HCAA 3VUEA 2FPLA 3HNPA 3QITA 1E6LA 1MBZA 1YXMA 3KYBA 4RXTA 3K1YA 1U1FA 4PHCA 2E85A 4NCNA 3TLYA 5I7VA 5EIBD 4V3CA 4CLRA 3CNLA 2A0YA 3MA0A 1JVSA 2F00A 2YIDA 2XZPA 4MJXA 1IVNA 5H3HA 3NCTA 1ISJA 4RGBA 5TC4A 4RLHA 4DUGA 3K20A 3RU9A 3E4CA 4PNHA 2YRFA 4UREA 4PQGA 1KMQA 3B78A 3O4HA 4FBGA 2Q5JA 1I3MA 1USWA 3X1JA 2LR0A 3VR3A 4DUYB 3VYWA 1YR7A 2BBTA 4D02A 5BUZA 2FPOA 2YJ4A 4LOKA 3BGVA 2Q2NA 3SY8A 5BN3A 421PA 1E8MA 1Q21A 1CDEA 3J7AC 3A11A 3IMKA 1FXWF 3DP9A 3X1MA 4D9GA 2VA8A 1TVCA 5HK9A 1XYYA 2X13A 1XUOA 4PANA 5NULA 1IOVA 1K6JA 3VDXA 1J1ZA 1BHQ1 5EESA 4D8TA 1EAMA 1R9GA 4BB9A 2EW8A 2Y27A 3A9UA 2R5FA 4OHPA 4PN7A 1CEYA 3QWFA 4TTPA 3WO1A 1JG6A 3T4PA 1DOZA 3HZRA 4V2UA 4FMCB 2G8LA 4L27A 1NVAA 5AVUA 1JG2A 4N6NA 2YY7A 4ZALA 3SR4A 1SCUB 1QFZA 3LDUA 4HXYA 2CHFA 1CJCA 1GUAA 1NT2A 1F8UA 2L69A 4WZBB 4BV9A 4DYDA 4S04A 5KO2A 1ZGJA 5DHQA 7MHTA 3CW2A 4L78A 3LBAA 5CDSA 4MEAA 4FILA 4TRMA 5F12A 2CN1A 1VIAA 4BL5A 5A5VA 3CB2A 2PV0A 4HXEB 3TEJA 1LSUA 2GEDA 2O3JA 4FHEA 5GVRA 4NAVA 5IJ0A 5KPDA 2RJOA 1KI8A 2Y0PA 2IH4A 1SU6A 4BX8A 1E1RD 2FRDA 4C30A 1G5PA 2WOOA 2ECPA 1YJQA 2VPTA 4V1CA 5T4FA 1ZSNA 1AA9A 3HDHA 4IILA 4JA0A 4R2IA 4BLVA 3QXSA 1Z07A 4EG1A 2SKEA 2QDXA 1NF2A 3TRHA 1OV4A 3DAGA 4OJMX 1NJ1A 1RQ2A 2PUVA 1N1DA 2OTCA 1XLVA 1A1VA 1LGYA 2HIMA 4ZQFA 1R0SA 2YWBA 3ND9A 2ZJAA 3HYRA 3L4KA 1A5ZA 4MYTA 2NZVG 1KEZA 2CB9A 2C9MA 2QYTA 1AS0A 3ESAA 3IOBA 4MA5A 2YYYA 4WVFA 3R9XB 3GZJA 1JYFA 1SBTA 3A1UA 4CLRB 4M3NA 5C1BA 3G9UA 3H9JA 2FU5C 2YC4C 1PR4A 4IHJA 3EPHA 4MQ5A 4IFTA 4I55A 1RLMA 2FWAA 4F1JA 2JC3A 1EVQA 3I05A 3OOHA 3K9LA 1B1AA 1DQRA 4FDUA 4LOLA 5EWLA 1KIFA 1F6WA 1WCV1 3UK6A 3VJRA 4F3TA 3ON5A 3EF0A 3UAVA 4HWKA 4BN0A 4CF6A 2D62A 2B4KA 2E5FA 3RUAA 1LC3A 3DDCA 2N75A 4IJMA 1GZ5A 1QIKA 3IDQA 4BNYA 4IDNA 1P7ZA 3WSTA 1JZSA 4HGPA 1EH5A 1JEQA 3GP3A 1AJEA 4WKNA 3F9RA 2E49A 1YHZA 3HB9A 3BSYA 3E7DA 2ZR7A 2G5GX 3ANTA 2QJOA 3RWBA 5KWVA 5EY5B 3ER9A 3ZD7A 2IIVA 3KU4A 4HT3B 5FLKA 2JL1A 1GXSA 4PE5B 2ATVA 3BBLA 5CCXA 3DB2A 4QM7A 1ORDA 2AG5A 1BDJA 2NZ8A 3LPLA 1FU4A 2NVWA 1N1MA 1QQAA 3EY9A 1O7JA 4JJFA 5CTJA 1TAGA 5DM0A 1MN6A 3ZCSA 4L2IB 3SC2B 4X8MA 3T7CA 5DK4A 1A8HA 1L8LA 1Q0HA 4HQKA 3DF9A 1E0KA 1ZCAA 2BKEA 2NX2A 2OBFA 4ZU6X 4L0CA 4ZI7F 2V0GA 2JGAA 1VKNA 2EZUA 3G0IA 2IPOA 1U3VA 4YMLA 5IRCD 4X7RA 2PX6A 4IMRA 4FEAA 4Q6BA 4IO0A 1U4NA 5DNAA 5ENVA 4EVQA 4D4IA 1HYGA 2J5KA 2WWRA 4GXRA 3ER6A 4LX0A 1QK5A 4HDQB 2IA5A 3UOAB 5CDTA 4MLPA 6NULA 5LSAA 1Z5PA 3TDMA 1PTKA 4H7IA 3HXKA 2PX3A 2YN0A 4RYLA 1WKBA 1ZICA 4ZYVA 3L8YA 2HJRA 3IS3A 2HZ7A 4YAJA 4OJNA 5CA1F 5HS4A 4IFIA 1GG9A 4JI1B 5JZVA 2X2EA 3BFPA 2O57A 2CHEA 1GLGA 1YE5A 3OJ0A 4LYEA 2ZUEA 3CRVA 4BAZA 3MCUA 2HIHA 1UXHA 3WWYA 4RMHA 1RC0A 1IZYA 2Y1XA 3FD8A 2GRAA 3DULA 4YUXA 4C4RA 2FZWA 3G1WA 3EEIA 4MUXA 4YO8A 3VNQA 1GKKA 2VC2B 4G56A 4PFQA 1OYOA 5LA6A 5JWOA 5CFNA 2B69A 2B83A 5EWLB 1Z3IX 2O59A 3IIKA 5T67A 3JQPA 4DGQA 1E98A 2HPAA 3MAAC 4P80A 1TUBB 3PSAA 3DAHA 3VX3A 2M1XA 3MFQA 4ZCSA 3P2MA 4P8RA 2OD7A 3AH8A 1R5BA 3FFXA 3D6UA 2Y1FA 3GMTA 5AK6A 4CUZA 1BVHA 3K6KA 3QXHA 2O7NA 3AG5A 3JTEA 4JJZA 3UJ9A 1DKQA 4M0EA 3X3HA 4CQLA 3NNNA 4QNMA 3U1VA 2C57A 2Z04A 4BP1A 4E3WA 3MYRA 3CVUA 3H5LA 3HY3A 2FEKA 3I6ZA 2EGUA 3OF2A 1JLSA 4GF5A 3K6JA 3TOVA 1JXMA 2H2HA 1WOYA 3QYPA 3CLVA 4KO3S 4LZWA 2DFNA 2KHZA 5ADWA 2N1MA 2W5UA 2CCKA 4BEVA 2GTIA 1MEEA 4KAFA 4XUGB 3WP1B 1A3CA 1AGXA 2WNSA 1NW4A 4UMVA 1AQJA 4RTLA 1G8AA 1R0YA 1SXJE 2HU8A 3NKLA 3T4EA 2IUUA 1T0JB 1Z4NA 3RNLA 1GNVA 1VSTA 3BAZA 1BC5A 2LRHA 4AZ0A 2C96A 3ZNQA 1KVSA 1OD6A 5TEWA 4D92A 1RZUA 2HRZA 3IMFA 5DGXA 1IM5A 2AX3A 4MRMB 5AJUA 1SC4A 1R37A 1YL7A 1JDZA 2W48A 4NJOA 2IHUA 1EWKA 5AJWA 3LS2A 4DLTA 1UIMA 4AG5A 3E84A 3PR2B 4OGFA 1VM6A 1IG3A 4IUDS 4ZVRA 3W3ZB 3G2NA 4BE9A 2PT6A 2FK8A 2BFEB 1E4VA 4QPNA 4XTCS 4URYR 5EXPA 1GARA 5CT4A 1O9HA 3BH6A 2VLBA 4QYXA 3LKVA 4IDFA 3TJMA 3SPXA 2PLNA 3W2IA 3PPYA 3A0RB 3FLBA 3VBEA 4HSGA 5D51S 3UAOA 1IU9A 3MLAA 4ZK2A 4TL9A 1P0QA 5FULA 3E2MA 1Z4IA 1H1LA 4G9EA 3VH4A 3QJ5A 4GC9A 2OGWA 3DZBA 3C97A 3SYLA 3WLAA 5C8DA 1C8BA 3I9NA 1Z12A 3I01A 3O4JA 3GCWA 5CDFA 4CODB 3SF0A 1QLWA 1JU9A 3T7KA 3DR3A 3K1JA 3TQQA 3HA2A 1I3CA 5E4JA 3ZTTA 3GEIA 4ZPJA 5K03A 5LDHA 2M6RA 4QEDA 1H94A 4NH0A 3DVAA 1D3AA 4ZQGA 1QP4A 1CUZA 4JIGA 4YRFA 4ZGWA 3NC4A 1U6IA 2NW6A 4O63O 1KJZA 2PXXA 3O8CA 4DBLC 4JFRA 2KS6A 2J1LA 2FSUA 4B4DA 1I01A 1KTVA 4MYSA 1PI3A 2IUTA 1CR1A 4I8XA 4PXYA 1V4BA 4FFPA 5HIJA 2EFGA 1Q2UA 1KYYA 1LVGA 1TM7E 1WZNA 2C9YA 1PJBA 1XZMA 2HGSA 2JFVA 1Z06A 2H5EA 3UXHA 5GZ1A 2WRZA 3JQ9A 1FRQA 2VT2A 5DLDA 3PNYA 3IUEA 3ZJVA 3IHWA 2FJ0A 3ESBA 1OX4B 1YZNA 1T4MA 3FPJA 1BXGA 3PPWA 2D8MA 3QWIA 5DLYA 3TLZA 3WB0A 1KS9A 2WJGA 4KO4S 1XDBA 4U0KA 5FL7D 2FRVA 4UU8A 2QQEA 3J80A 2YHIA 2OQVA 3C5EA 4R2HA 4L8FA 2HA7A 3WGMA 1DV1A 4BBPA 4D0NA 5IBCA 3GGOA 1J6UA 1GT91 2JFOA 1IHUA 2FFRA 2I6TA 1IB0A 1ZINA 1AKWA 2IYQA 3NXSA 4BKUA 1GA6A 3MJTA 1ZW6A 2ID7A 1MTZA 3D3NA 3PQ6A 4WCDA 5EKXA 4F3CA 2FUG1 1YS6A 2ZUBA 1EP9A 2R6JA 2JIDA 3DF7A 3IXMA 4ZYUA 5MGNA 4HJRA 1ADYA 1DTWA 1COZA 2FLKA 2PPVA 2B3DA 3G2QA 4JYCA 4EOGA 1V7QA 2WUDA 4DR1B 2Y99A 3G59A 1UWCA 3PUHA 4PZEA 1N5MA 2RC6A 4C4ZA 4YT8A 1GILA 1NKVA 1QYDA 2CBGA 4KLNA 2IL1A 1QO7A 1K68A 2FW7A 3A2MA 4BFSA 4X65B 1BGWA 1Z29A 3PQ7A 4FDMA 4BUCA 1YVPA 2JCBA 4J6EA 3U56A 1GDTA 2RH8A 1UOOA 1KMNA 3KEQA 4G97A 3ZUGA 1NASA 2DP4E 3DOIA 5EWMB 1D04A 4CFSA 2AC4A 2BI4A 2A5JA 3UKOA 4QXRA 2ZJ1A 3WNBA 1MQ8B 5G4KA 1H1LB 3T3IA 4LOHA 3O2NA 3D1VA 2H0QA 5CTAA 5LZ8A 4F3YA 3D4IA 2HLPA 3FVQA 3R24A 3R0XA 4DBZA 1PE0A 3H6GA 2C88A 2PZFA 4S3MA 3SIRA 2IOFK 3GMIA 2GLUA 3IILA 4YBRA 4PSAA 2ZIEA 3EEQA 1QO0A 1IEXA 4OATA 1N9ZA 4UE6A 2FZVA 4JSRA 3B2QA 3QK7A 4ZQBA 3P9KA 4OAPA 4Q1DA 4MNTA 5DBIA 5IAGA 1Q0PA 3Q12A 4RVFA 5ALDA 2HNBA 3KKEA 3P0JA 3U3ZA 3X43A 4J7UA 4W9NA 1BE1A 1WZIA 3JWHA 2XVYA 1ZNZA 5GTDA 2C97A 4LZNA 3GLRA 3M5DA 3KQPA 3WGVA 2WHRA 1BFDA 4C0LA 4C76A 1PZXA 2V8OA 4ROSA 1M34A 1P0MA 3C3JA 4RIFA 4K26A 4YJKA 2QRMA 1QGZA 2PRJA 3C7DB 5G0SA 4EM6A 2VTBB 1ZCFA 2DR0A 1KK3A 3O1LA 4DSUA 1DLJA 1KYZA 4RF3A 4CV0A 4DJ5X 3OKFA 3PRJA 2NTYC 4DV4B 4FOPA 1HFWA 3IUMA 4LI0A 4DCPA 5KNCA 2AMYA 5DX1A 1G1AA 3C98A 3N70A 5HJ2A 1KQNA 4D9HA 4MUNA 1SB9A 1TUEA 1DL5A 1USGA 1YK1A 4GNKA 1Q16A 2HJHA 5CIQA 1LTKA 2PQ6A 3T9FA 3QRWA 3DJFA 4P3YA 2FETA 4ND1A 4EHIA 1RHMA 1Z6PA 2ZIAA 4M9XA 2Q28A 2RJNA 5ECYA 1NY6A 1NRJB 1YJCA 1QV6A 1A7KA 3A4LA 1PQYA 3KUUA 1T4CA 3W5IA 4BVGA 1M2GA 4LNUA 3ES9A 3FCCA 3O3CA 2C42A 4GPTA 2H4JA 3HJAA 3CJQA 1Q0TA 1GVHA 1NMSA 1VL8A 2X9LA 3DMFA 1N9KA 4B9EA 3AU8A 2RG7A 1U8TA 1JEOA 2J9XB 3I0ZA 3NIBA 4WZ6A 3G9ZA 4ZVVA 4FGLA 3M7IA 4AZTA 4CQMA 4Z3KA 2VSNA 2YN4A 2EATA 5KCMA 2PN1A 2H7CA 3BB3A 4FB4A 2ZRPA 1DQYA 2XTJA 2Z8ZA 2CLMB 4QBIA 3UKJA 4RGYA 3CEJA 1MO5A 3D3KA 3F7NA 1E0DA 5FBHA 1EXDA 4MKFA 4FONA 3D0OA 2ZRIA 1CBUA 4RSHA 4RE6A 1JLRA 1R6VA 5I9MA 3MHPA 1Y6QA 2VDNB 4JJ8A 3T3DA 5LQMA 3DMHA 3L06A 1CQPA 1J2EA 4D45A 1FP4A 3ESZA 5J5CA 2IX3A 4LMRA 4JUFA 3LXRA 1UK9A 2BELA 2YV5A 4FGUA 3V8BA 4KJZA 2L17A 1WULS 2ZE8A 3HLKA 4EI8A 5AVXA 3GA5A 2JCYA 1PVOA 4HQFA 1ZVKA 2F3TA 3GL9A 3I9LA 2Q45A 5IJAA 4OQNA 4FN4A 2IEDA 3WLRA 3GPCA 4BIIA 4E33A 1JQKA 2EL9A 2W2PA 2YTZA 3L7AA 5P21A 1VLJA 3SQOA 3VSDA 3ZHUA 5DI3B 4DG8A 1GIAA 3S2IA 3KWLA 4BRSA 2BUBA 1RI1A 3MCWA 1DRJA 3JWIA 2XE4A 3FWKA 3HABA 5HR5A 5KYNA 3PA8A 2B7BA 1LPMA 2NSHA 4L9SA 2X40A 1IY9A 1K5GA 4RF5A 4UBJA 3DEAA 3GN1A 4FDAA 3I30X 4J94A 4CQLB 2QYOA 2XMQA 1LSOA 3GPBA 2IYYA 3PDWA 3VHXA 5B55A 5C2JB 5HQTA 5EC8A 1KOFA 4TRRA 1AQUA 3GP5A 1D9ZA 1NF8A 2J32A 5BYAA 4QDUA 4QWWA 3W5HA 1XWFA 4Y2PA 5AVJA 1THGA 2VJMA 1A77A 4GMGA 2XBLA 3WE7A 4AZWA 3QTBA 3VR5H 5AKJA 5K4GA 1L5HA 1C1YA 4UNIA 5M2QA 2QY6A 3MINA 4HAVA 5JS6A 4KHPB 4NWIA 1PUIA 4RENA 1QE0A 4EYGA 3O7WA 1T10A 3B9BA 4ZANA 4QNRA 2J09A 2VJNA 2AC2A 1Y3DE 3NH9A 1AGRA 1G4AE 1DKLA 2H00A 1XAIA 3ETCA 2RD2A 1NZFA 3FNHA 4LNUB 4FNMA 5BQPA 4CFYA 1T9CA 4DDMA 3AYZB 2CLEB 1V3QE 1P61B 4GP9A 3GLSA 4DM7A 4QRDA 1U7OA 2AIRA 1MJGA 2QRVA 3QH4A 1YBMA 3PL1A 2HV9A 3PSHA 2HA0A 5H68A 5L40A 5DNYB 3THXA 4Q3AA 2F1KA 3HJFA 1X7DA 1SC6A 2LIPA 4LY9A 1T9AA 5BWMA 1DU4A 4ZTBA 4CM8A 4BDTA 1HORA 3I9V6 3NYQA 3PQFA 5G0WA 2JIOA 1CZLA 2RBKA 4IDQA 4WNIA 2XBUA 2CXOA 1J39A 1X3SA 1ZIOA 4MWTA 5F23A 5COQA 2FB9A 4XAQA 3N6VA 5ELXA 3K0SA 3C4JA 1GRNA 3K0CA 3VZPA 4QIHA 1S3FA 2O0MA 2BP7A 3OTGA 4FDTA 4WEQA 1KOLA 1RHUA 1BXZA 1L9XA 5IVIA 1N6RA 2VRCA 1BKYA 4NZOA 2RMKA 3EJWA 4MEBA 4NE2A 3U0BA 4B46A 2YNMA 3FUVA 1OH6A 4DQ0A 1TZ2A 3P4UA 3DEYX 1PAUA 5HUQA 3D4BA 2BC9A 1H8ED 5DU2A 4TKVB 3V55A 2VYNA 4ZD6A 1J0CA 1ZH4A 1F14A 1LFAA 2O2ZA 1J42A 2AF4C 2N42A 1YB2A 4Q7QA 1KXJA 2JAOA 2PXHA 1CUFA 1B3RA 3EASA 1WPGA 3CLTD 3LQQA 1ADFA 1EFRD 2OB1A 1K2WA 3ZZ1A 1HBJA 3ANXA 5FB3A 2I8LA 3R76A 5B3LA 2R8ZA 3OX3A 3WIDA 3VHXB 4URHA 1XVAA 4RZSA 5FLEX 5TPZD 4CLOB 4B74A 4C7VA 1MF7A 1ZD1A 2XUAA 1P6XA 1NQ5A 2W6ID 3WLOA 4GSYA 1T8TA 3ZV6A 2GJ4A 4OI0A 3O9MA 2VJMB 2G80A 1WXQA 2YY6A 1A82A 4JODA 2GEBA 1WZUA 1U0FA 4GKBA 1VHJA 3H5IA 1E2FA 3G02A 3LT1A 4MR8A 1QNLA 1XZDA 3EUAA 4PQFA 3GT0A 2JZNA 4WLVA 5CB6A 1EXMA 2PO5A 5JNRA 3OCJA 4LMAA 3DE6X 3F3MA 1UC5B 1VC2A 1EPUA 1QK4A 2VDWB 1H2ZA 5FOQA 1QDUA 2FPGA 3SZOA 1US8A 5JATA 4OJKA 4BRZA 1P7VA 3WK6A 4L8GA 5JI3E 3R1IA 5D5HA 3UT0A 4LDJA 5CNJA 3NBMA 1IZ7A 1IBCA 3TW4A 3TWOA 1OB2A 3OE5A 3WHIA 2OGUA 4UQOA 3EFOA 1MAAA 2C5SA 1QMPA 1GG8A 4FFWA 3WK9A 3THXB 5LLSA 4CLEA 4CIDA 2XYHA 3QEOA 4Y0AA 2V6IA 2BFFA 3KJIA 3T9AA 1E96A 4A91A 4EGSA 2WQ7A 2CV2A 2FPMA 2WHPB 3QVXA 1LDMA 3M3PA 3K2EA 4ZMRA 5B37A 3OUZA 3H4TA 4PHGA 1EEHA 1CUWA 2DPHA 3TL2A 2OHXA 2XRYA 4EBBA 2YKGA 2QAIA 1AKMA 2W58A 3AWIA 4MYUA 2PANA 2G09A 2Q3JA 1E7SA 2BEWB 1PV2A 1RWQA 2V6JA 3ZDRA 4BO1A 1K4YA 2GS9A 3JD4A 3SMQA 3HGMA 1EP1B 2PKYX 1UJ6A 3TYXA 1PGQA 1GL3A 2HMVA 3CTMA 3RASA 1U2TA 2W0SA 4HEA1 1JAXA 3W7VA 5C9ZA 5KCZA 3FBWA 5T7BA 1NAIA 2MR6A 4MIOA 1BG6A 4AP5A 4CDRA 1OB5A 3BDAA 1HT1E 5H9VA 4JI7B 4EAQA 1XIVA 4MV5A 1Z82A 2C9ZA 4HP8A 5E4YA 4NXNB 4H59A 4TN5A 5IVHA 3ZZMA 5IT9A 3DUFA 3L43A 1VGQA 3UGQA 4GX0A 2Y9MB 3I12A 1I36A 2J9RA 2PH3A 3I0NA 4FMDB 4H7EA 1QZ3A 4L16A 4DIBA 2L42A 1NTOA 2Y1DA 4HFNA 2AFVA 4DIDA 1TU0A 4KQCA 2XZLA 4AKHA 1ZYUA 5K6TA 5E3IA 1T9GS 4G26A 2B4RO 4ND6A 3ZDFA 3OQJA 1KY3A 16PKA 4NENB 4UUMA 5EPOA 1O5TA 9ABPA 4RTNA 2A5YB 1NATA 3DBHA 2CXSA 4N3GA 4MUEA 1CRZA 2I8AA 4ZT6A 1KMHA 1JDJA 2IXTA 4MYHA 3RUCA 2OKCA 5HZHA 1UFKA 2EF1A 2ISSD 4J4TA 1NC3A 4JHXA 3DFIA 4JLSA 3RROA 1WP4A 2FPGB 1K3UB 4DIOA 1XKLA 3QX9A 2PSEA 4HB0A 4J1TA 1GPLA 1CC1S 4RVSA 1DX9A 3GH3A 1C7RA 5BNZA 3VZDA 4A36A 1T5BA 2XEDA 2VJOA 4D4GA 4UM7A 2CJYA 3AJ8A 4E6EA 1HQDA 4EAAA 1DAMA 1EHCA 3SJ7A 3Q3GE 1Z16A 2D7CA 1FVOA 4QUAA 4U00A 4QUIA 4FCWA 5J58A 1ORWA 3RSQA 3VR4A 2A5LA 2B9VA 3NGMA 4UBKA 2GCOB 1ZK2A 3W5DA 2BFFB 2A67A 1XRRA 1FNMA 4W1PA 5KIAA 5CJPA 3ITEA 3MRSA 4A8TA 3GLUA 1M8KA 5MGBA 1ECLA 1WCIA 4CT4B 1WXDA 4PFKA 2MHCA 1IZ9A 1AF7A 2RIPA 5CFQA 1DWQA 3IV9A 4G0PA 5BT8A 3TFOA 5EZ5A 4NHOA 1SB8A 4KX5A 3W79A 3NUQA 3PT5A 4M1TA 1SWWA 1AMUA 1TF7A 3BPSA 3QEKA 3KKKA 4GOMD 4L85A 2JEOA 4PYOA 5CVCA 5A0TA 2XDQA 3JZIA 4PBTA 4QYWA 3UW3A 2PGAA 5K4HA 3Q8MA 4HGOA 3OC6A 3TQSA 5KVAA 5AWFC 1BE8A 3SQLA 5IABA 1G7CA 4BVHA 5B7PA 3E9RA 4QXAA 4XQGA 5D00A 4YAOA 1IK6A 5EAIA 2XYPA 3ABIA 2GWHA 3PXXA 2EC5A 2X2FA 4ZAZA 4C4XA 4CLHA 1OLSB 2X3FA 3LZ6A 1GAQA 4IIJF 3NEYA 3AUAA 3PPIA 2J3LA 4QEKA 1DC6A 5A5EA 4JWKA 2MINA 2DTDA 5K4AA 3HR4A 4Y9RA 2NU6B 4HQ6A 2F64A 4KXUA 4XASA 1JHDA 3UJCA 3KFXA 2GJ8A 3T3NA 1E64A 2EBHX 2FR8C 3HI4A 2B1IA 4MKGA 3X0DA 4K2HA 4A23A 1FS5A 1BGXT 2CXQA 1ZVQA 3WSVA 2IHVA 1YQQA 3IFSA 4DCUA 2VDMB 2XB4A 4MK4A 3PGJA 4KB5A 1NUTA 1QR6A 4YP6A 4YRBA 2VZEA 2V7GA 2VNJA 4MUIA 5TRTA 5EWJB 3IE0A 3BGSA 3N2YA 4K6MA 1TD1A 3GVHA 3TQIA 5IAEA 4C89A 2NZWA 4RL6A 2BGTA 3FR8A 3UYKA 3LGXA 3ZLJA 1RJEA 1ZIYA 2NXCA 1HQKA 4FI3C 4FKZA 1ZMRA 2FOIA 1U3GA 3FHLA 1NVVQ 2OL4A 3BGDA 4IUCS 5C3UA 3LK7A 3TE6A 4G23A 4W7IA 4NBUA 3B7GA 1CKEA 2DG2A 3AW8A 3LA8A 4KE8A 2ZRAA 3C3WA 2X5NA 4Q3OA 1E9DA 2WWGA 4GMFA 2C03A 2UUCB 3WL3A 4WPGA 1FQKA 4D7AA 1TZKA 2AZ4A 2Z2KA 3CR3C 4KXVA 5FTLA 2O19A 1ZWLA 2B1RA 4R51A 2GCEA 2PZAA 4MS4A 3PQDA 1Q22A 5AK3A 5TX7A 4Z2AA 1FLDA 4K3VA 5GZ6A 3NHUA 4XIFA 3TSYA 1KSJA 3VPBA 1A97A 5KYWA 3TM5A 3KSBC 2J6IA 2ZK7A 1UQTA 3RDPA 4FJ1A 4D9KA 1YU6A 4MO9A 4U9HS 4ZYLA 1K4KA 1P1HA 3DHYA 5JBIA 3H1GA 2VHUA 2A7XA 4Q1CA 1E5XA 3VISA 1ULZA 1JG3A 2DULA 2XDQB 2EHJA 3MERA 4KSYA 4E03A 1G0OA 4HN2A 2MSCB 4F4JA 2P4SA 1WEHA 3L7DA 2SCUA 1TYBE 3LA6A 3QKSB 4X0EA 3U26A 1XP5A 2GSDA 3ZCRA 2HV8A 5ESXA 1Z7EA 4OAQA 5T4HA 1GPJA 2I29A 3ZE2B 3GIWA 1VBKA 2FDXA 3OI7A 1I2CA 3G7NA 4QPCA 3DKRA 5JCOA 3BWCA 2I71A 3KQMA 2UUBB 1JHVA 3PR3A 3RB8A 1IUOA 3IBTA 4EPTA 3LBIA 3CE6A 1FRZA 3L4EA 1ZRNA 3T7JA 1J97A 5SZIA 3HDGA 5HKLA 4JUIA 2NUPB 3EW7A 3TSAA 4KR6A 3FGPA 2I4IA 3HYSA 1OQAA 3KLMX 5EEHA 3JS5A 3NBAA 2CNBA 2E18A 4MIKA 4IZOA 3O4GA 3DFUA 4RNCA 2WZDA 4O1MA 3HEAA 4XFKA 4R0VA 4V03A 3VYTB 2O48X 2SNIE 3GLHA 1UBTS 3N8KA 3PHCA 4DJFC 2AFIB 2HJVA 4GI5A 3LTNC 4XWAA 1PJ8A 1B0UA 2GYWA 2O2DA 1QFSA 1VE3A 1K92A 1VLHA 2UAGA 3IUBA 4KPGA 3FFWA 4OK6A 3ONWA 1XZAA 1NBIA 1AHPA 1QXSA 3B3AA 2H7VA 1EK2A 2FEWB 3WDMA 4EY5A 3NWJA 3IV7A 1RM4A 2R8PA 5LZ2A 3T1YB 1NNSA 1BU8A 4B3SB 1PD1A 1ABEA 1RRGA 5LB2A 2Y0CA 3EGXA 3E1KA 3IA2A 4LJKA 3Q8LA 4Q02A 2QP3A 4TZKA 4UTPA 2O8DA 3ZV7A 1LQUA 1VA5A 2PSFA 3CURA 1M66A 3KTAA 3CIOA 3NTLA 4ERNA 2PCJA 3HK2A 5ALFA 5FIUA 1T0BA 3E5NA 4MS4B 1PJTA 1U0EA 1X74A 3KQWA 5DX0A 2ZI6A 3UY4A 1E5TA 4N1AA 3ZCPA 2I6SA 2IZ1A 3GRCA 1MEOA 1Y5MA 3HKBB 1YT5A 4P83A 4UDXX 4G1BA 2WJYA 3NAGA 5DP2A 3ZBPA 3T9EA 1FDVA 2Q3BA 3DOJA 4OHYA 3TTYA 4DDWA 2XQIA 1XEWX 2V7QD 4WN9B 5JPIA 5KOJA 1P0FA 4MI9A 4S0XA 3O4IA 2FSHA 4RHFA 3GLVA 4C5AA 4RZXA 1I14A 5DSXA 3QV2A 1DBSA 2SCUB 3DEZA 3GT3A 4PIMA 1F4VA 2OSBA 4MV8A 4P93A 5IMBA 3X2EA 5EHZA 4PO3X 5DBFA 1GZUA 2ARKA 1JSXA 2JFUA 2O8BA 1Z8FA 2CDCA 3NVDA 5JG7A 1FTNA 4QQNA 3BMOA 1HOXA 5TEVA 4BVBA 1XMIA 1R4AA 1Y34E 2G77B 2TECE 1DIBA 4IQ0A 1BA3A 2W6JA 4J8PA 4W8GA 3D81A 4P92A 3NS7A 2SHKA 1OW3B 3QE4A 3MYYA 1IZZA 2ASEA 2KE5A 2V65A 3MJFA 4HH1A 4I5GA 1U28A 3G17A 5AHWA 3ONEA 4C1BA 2QJRA 1W0KD 2VT6A 3HC7A 3TQCA 4E08A 2DR2A 4ESOA 3K9WA 1XZCA 3RVQA 4CEJA 1P39A 1PF7E 1JW9B 4N7JA 1BHSA 1MOZA 1ZBDA 2Y1GA 3MK31 1GQ2A 4PVCA 4B7ZA 5KNBA 4LDQA 3IQDB 3LUCA 4PZUA 3KE8A 3PFNA 5HG0A 2DFLA 5CLIA 2AQIA 3L8HA 3EAFA 4L8VA 3WLMA 1YU9A 1KKLA 5BOSA 4D8UA 2WE7A 3QVGB 4DIMA 2FV8A 4NONA 4LHSA 3HZHA 4P2GA 4R71A 4N7MA 4ACAA 2PLFA 2W6PA 5AW4A 1N32B 3H16A 4LMBA 4QECA 1BMQA 1Z18A 2X4GA 4WOJA 1JSLA 1PJCA 3R0QA 1E7QA 2YOHA 4PZ0A 1JTEA 4TYMA 5C1PA 1G3UA 2AR7A 2C5LA 4RDXA 3OQMA 2P6OA 3HV0A 1DXHA 1OY1A 4DDHA 4DPLA 3R3HA 5ES4B 1SBIA 2JAXA 1BZYA 3EGXB 3JATA 3L6OO 3LK6A 4ENRA 5J2TA 2B2CA 4CU2A 2O8DB 4JB0A 2GFQA 4ZAVA 2EJTA 1E59A 4U7TB 4MQUA 4M0LA 2ATCA 3JY6A 1N8KA 4M1EA 1E6UA 2ZCVA 4JGBA 4DV1B 3EULA 4PY2A 4LE2A 4DBLE 3OZEA 1QP8A 1JQLB 3KZMA 3ET5A 1JR3D 1W87A 1WB5A 2F8MA 3RC3A 1DCMA 4OH7A 2F1RA 1KAQA 2N0SA 4Q34A 2R00A 1QKIA 3F6SA 2ZVDA 1JH8A 4AWBA 5KOJB 2JLBA 4DJDC 4CR6A 3LL4A 2ZYIA 2P65A 1SUCA 1PW7A 2ZQYA 4FOTA 4DCMA 2WYWA 1RQPA 2QTCA 4LPSA 2H6EA 1NPTO 4MR9A 2O8BB 3CRRA 3G49A 4OHWA 5BWOA 3LLSA 3RBVA 3CG4A 3FGZA 3Q87B 3QKRB 5L7YA 2QEQA 2XLCA 3CRQA 1ZIDA 2AFHE 3UTDA 4PYRA 2FMUA 4AY5A 2C3OA 2YIMA 4RF4A 4KQHA 4FX5A 2EJBA 1A96A 3TUZC 3TF5A 1FBTA 2VP9A 2FUKA 1YVDA 1TFRA 1VJ1A 4AY4A 4GPZA 4ENQA 5BYKA 5C80A 5DBHX 4I7EA 2MOKA 1ZC3A 3OFKA 1M8FA 3FCYA 3T5MA 3U49A 4AC9A 2PMKA 4XJSA 3AL3A 1F4LA 4AROA 1W1UA 3FTNA 2GVDC 2QX8A 3GJ6A 5JADA 3S8YA 5AKKA 3A6GA 4ARVA 1RWKA 3U48A 2AWNA 3GFTA 1ITZA 3HBJA 5EFOA 5EXSA 2XCSB 2IS4A 4CR8A 3TW8A 3WI7A 1C0EA 1T43A 2DHCA 1YDWA 1Q0ZA 3OX1A 2XY4A 3WGOA 1N9GA 2OXFA 1K88A 3F5MA 4AK9A 1N0HA 3OLWA 4QLAA 3W3AD 3WL5A 1QDEA 1LDYA 1NSTA 1J00A 3HU5A 1T2NA 1WQ4A 2I67A 4FUTA 1G17A 4HUQB 3OMWA 1Z6XA 2WM2A 3BYZA 3ZN2A 1NLYA 2XF2A 2HCBA 3PJFA 1P7WA 3THWB 1R2QA 2HHLA 5DSZA 1S8AA 4AL4A 2ID8A 1OWOA 3ZLVA 1TCBA 1XN1A 3OCVA 2FSSA 3EDRA 4GMHA 1IWOA 1MRSA 2WNHA 4Q9LA 5FPYA 4EWLA 4HGZA 2WYOA 4MIYA 2H4HA 4Z49A 5J2TB 2E21A 1Z74A 1EDZA 2OORA 3LT0A 4BATA 1MJNA 3AIIA 1USKA 5G3YA 2OO5A 1GU0A 1L4MA 3CONA 1MRNA 2DLNA 1NJ5A 4YRTA 4UFPA 4CKBB 2VPZA 1P1RA 1LS6A 1LA2A 1PGPA 1RYHA 5DK6A 4RV4A 1SIBE 2LVBA 4TL6A 1ZDMA 2OXTA 4NIMA 1JAHA 3FOBA 5KWIA 1FS6A 2YQ5A 3BILA 3RWOA 2XB9A 4CNBA 1SD1A 3VJKA 1QGED 5E2IA 4B8WA 1OGJA 3DZDA 2ZTSA 3M9XA 2GEJA 3L8CA 3UK0A 3AW9A 1YJ8A 4HGRA 4YJ3B 3ABZA 2WKPA 3EDYA 3ORRA 4F8EA 3MXTA 3HG7A 3KBOA 3VJLA 4IINA 1Z37A 4EJ0A 1SO8A 2X0JA 2IXDA 4RCYA 1KMMA 3PEVA 1MB9A 1JDNA 1XPRA 4MR9B 1GTMA 3BE8A 4KNWA 4PLFA 5CVVA 5LLDA 3N75A 4EUKA 1BXRA 4UMFA 4H08A 3DLCA 2GK3A 2IJGX 1JDBC 4OU5A 3U19A 4UCXA 1TYCA 4RZIA 5CXXA 1S2NA 1U7XA 5G0VA 1EGQA 3Q8WA 4V02A 5AHRA 4XGKA 4DIKA 3G5LA 2XR1A 4FIZA 4BMVA 2WPDA 1CVIA 2J33A 1GVNB 3DEHA 3M82A 2BONA 4K9OA 4NQZA 1CIVA 1PQWA 3PNMA 4OU4A 1LNZA 4DADA 3S1SA 4R2WA 1O6GA 4J0KA 1KHTA 1N92A 1QVRA 2AK3A 1G19A 2JH3A 2XMZA 5LBTA 5BSUA 4C7BA 5CVEA 3TW8B 1S4MA 1T2AA 3BTVA 4GOLD 1X1RA 1T9ZA 2OZPA 4HZGA 4Y67A 4R81A 4Z54A 1V71A 2ZB3A 3TMYA 1XHLA 4ARZA 3OCWA 3ISVA 3S2UA 2CY0A 1K6IA 1U31A 3KZNA 4OMDA 4TSFA 5DYIA 2WQZA 1PWHA 2JGIA 5JAOA 2R1ZA 1RXSA 4DIEA 1QKKA 1SN7A 3EZ6A 4K1XA 3V1UA 3M6VA 3VR5A 3G2JA 3QLUA 4KVZA 4TV8F 4CCWA 1DPFA 4BECA 3T5GA 1YHNA 2EAUA 3C6QA 3E8MA 4JYMA 4MJLA 4UHFA 4UHKA 3RFFA 2ZAOA 4CMBA 4EB8A 3INTA 1IZ0A 1AHNA 3OZBA 4KXMA 3D59A 2J3QA 1GSOA 3UMCA 1DWPA 2G0NA 2G9VA 3P9RA 2V6BA 4N3AA 1VIMA 1W5BA 3K6SB 4WV3A 1RW4A 1KSFX 4MVJP 4V0LA 4D4MA 5CMLA 4YDSA 3BWVA 4NMWA 3GWZA 4NRDA 1KKMA 1OA1A 5JZ9A 4HG2A 4PCLA 3T06B 1KP2A 4ENWA 5KREA 1GTZA 4XDZA 1RLUA 3WYNA 3ITNA 3JVDA 4ABTA 5I7UA 3D1LA 3KTOA 3EUFA 3W05A 3R44A 4PCAA 1LDBA 3ZY4A 3KR1A 3PE6A 4Y2GA 1PL8A 1COWA 1JKIA 1QGUA 3AB7A 4M2LA 4MO2A 2F8TA 1JDPA 3ENWA 4JOBA 4Z86A 3SHTA 5AKZA 5D5QA 3KQSA 1W36C 1YZQA 4PYIA 4YRLA 1GKIA 2EFHB 4KQ1A 2IBTA 5CFLA 1M6EX 2D7DA 1IWBB 4GLJA 1I2ZA 2QD3A 4DILA 1W8IA 1WM1A 1Z4OA 1NUSA 4AKEA 4TRNA 3K5WA 1BXRB 4AF8A 3Q9NA 3PG5A 4ALMA 4PPQA 4F7DA 4X6YA 4WK0B 4G37A 3M34A 4HFRA 2NT3A 1XTTA 4HDOB 2GLXA 2IS1A 4G4IA 5J59A 4GGOA 4LKOA 2NPOA 2I3GA 3A26A 5CR9A 1P7YA 1MEJA 3VO9A 3ZE6A 5AXDA 7ADHA 1IK4A 2WQ6A 4Z0HO 2FE4A 1XZFA 3H5VA 3P4YA 2VXBA 4V0OA 1C29B 1HE3A 3LSYA 4P82A 1UBJS 3MCAA 2YOGA 1CK4A 1NHWA 2V7WA 2Z1DA 1Y9EA 3COYA 4S1OA 3ZDAA 3EGDA 1FX0A 1MV8A 4QUDA 3D9QX 2H2GA 1OFTA 5ISMA 3CFYA 1HDIA 3BORA 2QT9A 4KIGA 1EK5A 2XNCA 1I5OA 2OCKA 4BO6A 2WV7A 3D6TB 3OA0A 4AO6A 3CS3A 3PGMA 4FFNA 3R7BA 4UTRA 5JSUA 1AKNA 3GRRA 3FCAA 4MQ4A 4PYLA 2PLWA 2GK7A 3S2GA 5GADl 2VA9A 4KK4A 5CLHA 2B20A 3CY6A 1KF0A 2YV3A 4DSTA 1Z13A 5C4MA 1EDBA 2O3TA 1Q7EA 3CLKA 3LWDA 4ND4A 1QPBA 3QFTA 4IF4A 2CXUA 2PMBA 1EDEA 3RBXA 3WK7A 5ALYA 1GFZA 3K0FA 2WE8A 1Z4JA 2WU1A 5LP6F 3TNYA 2YXEA 3HMQA 3NTRA 2D8AA 2JDID 3HWRA 3OLVA 3KVYA 4Q4HB 2P11A 2IV7A 2J5RA 2LUOA 2HRDA 1ACJA 1NVUQ 3QOYA 1E18A 4WGFA 2NO6A 3E5MA 2HF2A 1M5UA 5ICEA 3LT5A 1ZM3A 3RRZA 1AQNA 1FTSA 2ZIGA 3EQ6A 4R98A 4DEYA 4DLKA 4BP9A 3AI1A 1V48A 1WVMA 1PVDA 2CUTA 3F49S 4KDRA 2A4KA 3AFHA 3S2EA 3WGZA 3D0RA 3LUFA 3E18A 1Z6QA 1UAAA 3HP1A 2FFAA 1FUEA 4CJXA 2DE0X 2VCHA 4J90A 4WBNA 1JRLA 2ZYVX 1G7TA 3HCRA 4C87A 3QELB 1QZZA 3FPLA 2BGUA 2ONJA 2GILA 5D1NA 4IDBA 4JSYA 5IJ9B 2CF5A 2AEFA 2OLKA 2P75A 2RARA 3GGDA 4UEWA 4PAQA 1IQPA 4WBXC 4X1KA 2AUTA 3WGLA 3DT8A 1Z6YA 5AVKA 3OBIA 7GPBA 3ZKAA 1IG0A 2ZPTX 4WXMA 2AI2A 2EZTA 5CT6A 1TZCA 5FXMA 2JK1A 1TIKA 1U7DA 3P7MA 1OH8A 2WIJA 3QLVC 4PAOA 5CYPA 2I5PO 3GLIB 2WB4A 4FFBA 4R8RA 5EKSA 3SC6A 2GFHA 1J0EA 4Q1BA 5BXQC 1XNGA 3FZQA 4OSPA 1QVAA 1NX9A 4MVWA 3R8XA 1RZRD 3TMKA 3U44B 1PT6A 3ADDA 1QC5B 1G21E 1NXPA 3AINA 3REFA 3WYBA 4F04A 5IJZA 3AF5A 1TJPB 2OQIA 5CVUA 5J5AA 2WVHA 2GETA 1M3SA 1EJ6A 2O7QA 2VEDA 1ZRHA 3FDZB 2IU4A 5EIOA 4RKYA 3ROGA 1U4OA 1HXHA 4I9HA 1K5HA 2RHGB 1H1TA 2EFEB 4RJIA 3WNZA 2IHKA 3RU2A 5FCDA 9MHTA 2FF5A 2G36A 3K9HA 1A2QA 2NYAA 4FBMA 3U09A 2JRLA 2W6OA 2ZQZA 5EZYB 2WKQA 5IC5A 4D8YA 1N7JA 5I7WA 5DYNA 2AZTA 2M1ZA 4RK6A 1FJ2A 3IDAA 1BDIA 4RZUA 1EFHA 2BFNA 1TYEB 3IE1A 4FSHA 2H17A 1TYZA 1WVGA 4DREA 4O4IF 1WXEA 3O8NA 4COKA 1RI4A 3C5WP 3DKPA 5IULC 1FFXA 3A31A 2CCGA 5I4BA 4QASA 4U6QA 3PPXA 3NKVA 2ZM5A 3IT0A 1NUUA 3ST7A 3T5DA 3GJYA 4BC1A 1ZXBA 1ND5A 1RTTA 2YWXA 2OPBA 3CF4A 4N0DA 3W8EA 2Z57A 2ZEJA 2VRBA 4CCYB 5JNLA 3OCZA 4TXLA 2V55B 1OWLA 4LHEA 3RG8A 1HLPA 3PUIA 3V7WA 4BZQA 4YV7A 3DG9A 4AQDA 4HTFA 1QBKC 1XLUA 1ZS9A 1WBJB 1GA1A 4FLMA 5GM2A 3THRA 2OAP1 3OKCA 1N5KA 1YB1A 5TB5A 5E9QA 1H85A 4UVIA 1W96A 4ZCMA 1OC2A 4RMNA 3OEED 3PUJA 1PX0A 1Y3BE 4R8KA 3GWGA 3LYHA 4HDKA 3IBCA 2AK2A 1RXIA 5TDHA 3ZDDA 7REQB 1TK2A 1I3OA 4HFJA 4N49A 3TLKA 3QU2A 4QUGA 3HR7A 3S40A 4A6PA 3AF2A 2ATEA 3P97A 4MIEA 2QTNA 1BXKA 3DYIA 1XCOA 1QR2A 1W4AA 2X3YA 1PNOA 1SHZA 4GRAA 1OJLA 1U0GA 4J0QA 2WFLB 1P81A 1EE1A 1JV2B 3SIXA 4QJ5A 5FTKA 4EQZA 5A1JA 5FAKA 3SZUA 3B89A 5ERYA 1RHJA 1VSQA 1Z6ZA 2BGIA 2VDKB 2O5EA 3IJ5A 5AJHA 3Q41A 3QOFA 3ZHVA 5A9SB 1YCDA 5LPNA 3BHMA 1EA7A 3SKXA 4IDCA 5IZCA 1XEFA 3U37A 1R9NA 2NYUA 3WTCA 3WGJA 6AT1A 3OICA 3FAZA 1VL2A 3LRPA 5J47A 1ISMA 4FYXA 1PJZA 2XKJE 3KVRA 3LF2A 3JRXA 4NPHA 4DNPA 1N0IA 2IW1A 5FPKA 1DWUA 4N0PA 4P98A 2CF6A 2QMZA 1EX9A 4FYMA 2CMHA 2ZRMA 3ET4A 3K9NA 4YIKA 2ILVA 3FYUA 5CA0F 4JI8B 4NG4A 5LOVF 3BF8A 1R12A 1RJFA 2NAFA 4ZAXA 1U2PA 2QR3A 1SBZA 3OQ6A 3JQCA 2Z4SA 1CXZA 2HBRA 1R5NA 2ZB4A 4YAFA 3WHKA 1SU8A 2IPNA 3V4SA 5JEEA 8ABPA 3UV6A 3FUTA 3BH7A 1DZ3A 3ZQJA 2H0AA 4JLKA 1N5JA 3V2UA 1ORRA 2QR5A 3ECCA 5HGJA 4Z1OA 1Z63A 1XNQB 1SXPA 3KBBA 5J9FA 4S24A 2HD4A 4HEQA 1W34A 5DCWA 5L6MB 5IAOA 5TJ9A 1QHFA 1JDBB 2FWPA 3IQEA 4KR2A 1RHQA 1C0IA 1CEEA 2YZNA 3PRHA 4BEBA 2BZSA 1OFGA 2O8FA 3Q3CA 4OKSA 3OWHA 3JARA 3FRJA 4MYRA 1C9NA 2OFPA 2QE7D 3EVNA 4TTRA 2R79A 4W8HA 5JRDS 5K6AC 1U8ZA 1WE2A 1JQAA 3ZWVA 2HQOA 3UA4A 1U2GA 4F1KA 3QBJA 2H8GA 2P68A 3I73A 4LDNA 5DGIA 5C1DA 1LPOA 3IAAA 3H8VA 3GEGA 1W30A 1U8UA 4WLNA 2ZJ3A 2FWNA 1QCZA 1SKBA 4U1RA 4D98A 3OOSA 5BVHA 3D0KA 1I1HA 2WMDA 4KYIB 3UBMA 4BBJA 3T0IA 4CHGA 2DUUA 4D44A 1GYRA 1VYUA 3GAZA 1L5SA 2CEKA 2Z98A 1XXHB 1V7PC 5GM1A 4ZI7A 4N6GA 1DBPA 5H82A 2FZEA 1FSSA 3AMVA 4ZZIA 1Z4KA 5L7TA 2I9KA 3G0HA 2AZMA 1GPWB 2I2WA 2V3WA 3CX7A 4G67A 1Z0DA 1CZNA 5JDIC 3EVEA 1NQOA 4Z4HA 2JJ2D 4K0KB 4FC6A 1YF3A 3IUPA 2HQSA 2ADMA 1MX5A 1YACA 3MF4A 1YQEA 2AZDA 4DYVA 5CA1A 3LI2A 4L15A 1UFOA 4WJZA 5A71A 1W5TA 1Z9BA 3GLTA 3HCPA 3T7IA 3WYEA 2XXJA 5TY0A 1CUGA 1G6KA 1ZD3A 2Z4RA 4JROA 5AT1A 2ZROA 2C2KA 3LDHA 4JSTA 3WWPA 3H4VA 3KEFA 4CCSA 4GWLA 2JIZD 3SGLA 3H2SA 2P9YA 3H18A 4GI2A 4DWWA 3ZNPA 2O05A 5HA5A 2XKKA 1MD9A 2WLTA 4KE9A 1WJGA 1P17A 4ZTUB 4F9FA 2AEJA 3CT4A 2ZRNA 1NURA 4URWR 2Q3HA 2YMPA 2OHOA 5A0FA 3NJ4A 3F9IA 4D96A 1MAUA 4NL4H 3CZRA 1P6QA 1Z38A 4GBED 3EWAA 1EFPB 2IEGA 4NU0A 2GXUA 3ZWBA 4DSZA 1C81A 2QKYA 3K5HA 4YMIA 2ETVA 4AKIA 1TIBA 2RCNA 3DAPA 4GX2A 4C0QC 4CM3A 2PR7A 1T36A 1I7DA 3NR2A 3AKCA 3K4HA 5F3RA 4BWYA 5CXUA 3GC6A 5AOCA 3MAJA 1EBUA 1XA4A 3PGA1 3V2GA 4C2BA 8OHMA 2O8FB 5LNK1 2BEVA 3JARB 2C0CA 3HBNA 3NDIA 2ZJ5A 3KZ1E 3RRBA 3MEQA 3NBFA 4WQMA 1XTVA 5TMDA 1PJQA 4HFMA 3RSFA 5BRAA 3WKAA 5C7OO 2JVJA 1E1RA 2C94A 5AUQA 3GEHA 1CT9A 1KPHA 4EUNA 2Q1SA 3BCUA 5IG2A 1BWPA 3SM3A 1O03A 1OZFA 3NFRA 2XMGA 3NUZA 1CEQA 3IOEA 3H0KA 4EHLA 4R83A 5A06A 1CY2A 1G2IA 2OBBA 1VECA 2E0IA 3LQRA 4XPIB 4K6OA 5ALQA 2H1CA 1Z7WA 5LDGA 2TSYB 3THSA 5H1YA 4MSUA 5K3CA 3E8XA 4IIDA 1EXVA 1KDOA 1ZK0A 4ZI7B 3V8PA 3VRHA 5FOUA 3IOMA 3GDGA 4DPKA 4UUQA 4E2ZA 5HZKA 4Q9IA 5J40A 1KI3A 3GJTA 3ZE0B 3FJYA 4BJ6A 2VG8A 1E1NA 5TGZA 3EXAA 3OTIA 2FUEA 4C06A 3O9VA 3KSUA 1UC8A 3FNGA 4KVAA 2O2IA 4I4TA 5FKJA 1HDYA 4L5IA 4X97A 5LZ4A 4K8OA 2VXOA 3OQNA 1PZGA 2Q5OA 2PUJA 5CA1B 2F1JA 3B7WA 2ZP1A 1FY2A 2W2KB 2MSLA 2Y93A 2X9NA 1HG1A 1OBOA 4Q7JB 2CSXA 2LBPA 2R4QA 2GBLA 2JD1A 1BX1A 3KT6A 4IQ4A 2VPPA 4AIIA 2Q4DA 3AGPA 5KNDD 3WLHA 1J4AA 2CUZA 3A4YA 3ABQB 3OJLA 4LWPA 1ZCJA 1JKJB 4MS3B 2F48A 3UA3A 1TCAA 1YR3A 1QNFA 6PFKA 2JIRA 2NLOA 4YA6A 3D8UA 3QFCA 3CUUA 3VH1A 1G7SA 1J5XA 4IVPA 3ZYCA 3KKLA 4WXEA 3OOWA 2AN1A 4R7GA 4Q9KA 2W6ZA 3DEFA 4HZUA 5EQJB 3DTNA 4RHUA 3GBSA 3KDPA 1T5DX 1E7WA 1YBVA 2GBFA 4M7OA 1TZMA 3DEIA 2YWEA 3ABSB 5CP8A 3TBFA 2IW3A 2GZRA 3RRXA 4JC4A 1N78A 4J75A 4V38A 3TPFA 4Q93A 3OJCA 5CGQB 2P8JA 4D41A 1R4MA 3GPDG 3K0HA 4G0NA 1DUVG 3L49A 2D2IA 1F7VA 1DLIA 2WTXA 4BGUA 5KS2A 4Q4DA 1TM1E 3G9QA 3TX6A 3CF4G 1OZAA 1Q1QA 3GJ8A 1OJ7A 2BEVB 3L4BC 3RO7A 4KGDA 3AJRA 4QODA 3K9QO 4QXMA 2ESRA 4L5CA 2H65A 3EZNA 1HDZA 2CNWD 1CCWA 1RKXA 3BWEA 4WUTA 1R8JA 2VBCA 4F38A 3QEAZ 4V0QA 2I2DA 2B61A 3FAKA 4X1IB 1LTHR 1C4OA 2XJ9A 3ENVA 3N3BC 5F21A 2ZYWX 3CZ4A 4L50A 3ZOKA 1FOEB 2J9FB 5LUAA 1ZAYA 4MLZA 3BJEA 4TMFA 4EEXA 3F3YA 4TWIA 3UHAA 5BSEA 4FC7A 1CVRA 3OQOA 2PFGA 3LT4A 3ZDXB 5D7NA 1IHOA 3MJDA 4IHAA 3TBKA 3RUFA 4Q9HA 2CGEA 6LDHA 4OGWA 4YPFA 3AM4A 2AD1A 2EZ4A 1J5EB 4NJEB 1NVDA 3MPOA 1NW6A 2YH2A 5HYVA 4KLRA 1UPTA 1LLUA 2J6BA 3AZOA 5B12A 1RXUA 1OHHD 4Y2SA 4HPWA 1H5QA 3EVCA 1V16B 3EVBA 4IICA 1H0RA 3STUA 4NMLA 3LUAA 4JOQA 3V8NA 1KQFA 1V43A 5TMEA 1HRKA 3MS2A 4DV6B 3VAZA 3RS4A 3IPYA 3UJ8A 5D3MA 3ZCTA 3C4VA 1TA0A 4PM4A 5B4TA 3L7OA 3OFVA 3O90A 1Q92A 3QE3A 3ONNA 3A1CA 3SKVA 2H52A 4E4TA 4DNXA 1GEEA 1P0CA 3MUNA 3OJEA 4GPAA 2OFOA 2P9ZA 4O5AA 1JQ5A 1RRCA 3F2IA 5IU6A 1E3MA 2H29A 4RHCA 4EO9A 1XTKA 2YFKA 3D2AA 1ID1A 5KHAA 5A03A 1FP6A 3D02A 4D3YA 2QM3A 1IHYA 4UZSA 3RIEA 1P7CA 1J2JA 1JHZA 2ZRDA 2FVYA 2Z95A 1DELA 4KIWA 4K6FA 5DGTA 4PYNA 5TT0A 1RLTA 3V80A 1TXGA 4HSEA 4B3MB 1S0UA 2BL4A 3BAFA 621PA 1L4UA 2BR4A 1GNPA 1R4MB 2ODAA 5D7BA 1U9IA 1C50A 2JEYA 2ACEA 2GUWA 1UDAA 1TTPB 1X9IA 2FFHA 3LY7A 1IBSA 3U4GA 1PR5A 3RS7A 5ITZB 1FYDA 1UKCA 2H2IA 3MUEA 4OG2A 3V2IA 1L7AA 1WCXA 2CMGA 2EF0A 3PHGA 3JAMA 1ZJZA 3EEBA 3UCEA 1VCOA 1HNWB 1SBQA 3M1IA 2C04A 5AIAA 3UB2A 4HOYA 2YZGA 3LW8A 3SLGA 1RWMA 5FUYA 4LY0A 3RS8A 3DBOB 4B85A 1WR8A 4FD3A 3MELA 5LJIA 3HLYA 2C7PA 3W7AA 5JYEA 1W9HA 3BQ9A 3PXUA 4RK4A 4WDRA 5B4UA 3NXKA 4R7ZA 1XP8A 3WLKX 4EF6A 3S29A 1JR4A 3WLQA 4ND7A 2XQFA 1M6HA 1OE0A 3GJ0A 4XWYA 3UENA 1ADBA 2DPMA 4J29A 1Y6ZA 3VFDA 4LBYA 5CAEA 1AH2A 4HNTA 1GM5A 4QXQA 4CBVA 1DARA 1B2RA 2D7JA 2FWBA 3OCCA 1A9QA 3VU8A 5CB4A 2AR9A 4B0PA 5D85A 2FEMA 1QVVA 1V8OA 1VTKA 1Y7TA 4Q3DA 3ZK8A 2Z3VA 1Q0RA 3U81A 3KWMA 2BGRA 2PG3A 2ZWPA 1NLMA 3M4JA 3AFMA 4B2YA 1D1SA 3K0EA 1R8XA 2V7PA 2IHZA 2CDBA 4R2JA 4R1UA 2IU3A 3EGEA 3FMGA 3UMFA 1TRHA 4JHLA 1GL9B 2G4LA 4KNVA 3NC0C 5FWXA 5B2ZA 1IBRA 4AX4A 1X94A 1NUAA 4YTEA 1MX9A 2HO5A 4HAYA 4A4DA 1Z0SA 2ODNA 4BNTA 4LNHA 2PUTA 5ERGB 3L0OA 4HDRB 2Z6VA 4IXTA 3CF6R 4QJ4A 3SS9X 3ZD6A 1IY1A 1W581 2DFKB 2PQ0A 2RAPA 3M1LA 4K6KA 1IN1A 3JVVA 4LQLA 4CDMA 1BMFD 1NR1A 2BMVA 1L7VC 1XJWA 3EDOA 3NC1C 1RIIA 3PFIA 4FNGA 4B5LA 1YO6A 4E1AA 3WYCA 3OOJA 2DPGA 3FWZA 3ZCVA 5C81A 2MYPA 3OMLA 4F60A 2DLDA 1CY0A 2YC2C 3CZ5A 2DHDA 4E21A 5EIHA 1BS9A