The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
88
|
structure length |
88
|
Chain Sequence |
MLKLNLKKSFQKDFDKLLLNGFDDSVLNEVILTLRKKEPLDPQFQDHALKGKWKPFRECHIKPDVLLVYLVKDDELILLRLGSHSELF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
molecule keywords |
conserved hypothetical protein HP0894
|
publication title |
Solution structure of conserved hypothetical protein HP0894 from Helicobacter pylori
pubmed doi rcsb |
source organism |
Helicobacter pylori
|
total genus |
10
|
structure length |
88
|
sequence length |
88
|
ec nomenclature | |
pdb deposition date | 2005-03-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05016 | ParE_toxin | ParE toxin of type II toxin-antitoxin system, parDE |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | YaeB-like fold | RelE-like |
#chains in the Genus database with same CATH superfamily 1WMI A; 4FXE D; 5IWH A; 4LTT A; 4MMJ A; 3OEI C; 3KXE A; 4ML0 B; 5CW7 B; 4LS4 A; 4PX8 A; 2A6S A; 2A6Q E; 1Z8M A; 4MCX B; 5CZF C; 2KC9 A; 4Q2U B; 4LSY A; 4MMG A; 3G5O B; 2KHE A; 4NRN A; 3BPQ B; 4ML2 A; 5CEG B; 4YY3 Y; 5CZE B; 2A6R A; 4FXI A; 4FXH A; 5IXL A; 2KC8 A; 4MCT B; 2OTR A; #chains in the Genus database with same CATH topology 3VJ7 A; 1WMI A; 4FBD A; 4FXE D; 5IWH A; 4LTT A; 4MMJ A; 3OEI C; 2A8K A; 3KXE A; 4ML0 B; 5CW7 B; 4LS4 A; 4PX8 A; 2PD0 A; 2A6S A; 2DFX E; 2A6Q E; 3HI2 B; 1Z8M A; 2DJH A; 4MCX B; 3AO9 A; 5CZF C; 2KC9 A; 4Q2U B; 2FHZ B; 4LSY A; 4MMG A; 3G5O B; 2KHE A; 4NRN A; 3BPQ B; 4ML2 A; 5CEG B; 4YY3 Y; 5CZE B; 2A6R A; 4FXI A; 4FXH A; 5IXL A; 1XQB A; 2KC8 A; 4MCT B; 2OTR A; #chains in the Genus database with same CATH homology 1WMI A; 4FXE D; 5IWH A; 4LTT A; 4MMJ A; 3OEI C; 3KXE A; 4ML0 B; 5CW7 B; 4LS4 A; 4PX8 A; 2A6S A; 2A6Q E; 1Z8M A; 4MCX B; 5CZF C; 2KC9 A; 4Q2U B; 4LSY A; 4MMG A; 3G5O B; 2KHE A; 4NRN A; 3BPQ B; 4ML2 A; 5CEG B; 4YY3 Y; 5CZE B; 2A6R A; 4FXI A; 4FXH A; 5IXL A; 2KC8 A; 4MCT B; 2OTR A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...