1Z8SA

Dnab binding domain of dnag (p16) from bacillus stearothermophilus (residues 452-597)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
146
structure length
146
Chain Sequence
MAKKLLPAFQNAERLLLAHMMRSRDVALVVQERIGGRFNIEEHRALAAYIYAFYEEGHEADPGALISRIPGELQPLASELSLLLIADDVSEQELEDYIRHVLNRPKWLMLKVKEQEKTEAERRKDFLTAARIAKEMIEMKKMLSSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the helicase-interaction domain of the primase DnaG: a model for helicase activation
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase
molecule keywords DNA primase
total genus 38
structure length 146
sequence length 146
ec nomenclature ec 2.7.7.-:
pdb deposition date 2005-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.860.10 Mainly Alpha Orthogonal Bundle DNAb Helicase; Chain A DNAb Helicase; Chain A 1z8sA01
1JWEA 2Q6TA 1T3WA 2R6AA 2LZNA 2R5UA 2VYFA 3GXVA 2HAJA 2R6CA 4IM9A 4EHSA 4ESVA 1B79A 1Z8SA 2R6AC 2R6DA 3BGWA 2R6CG
chains in the Genus database with same CATH superfamily
1JWEA 2Q6TA 1T3WA 2R6AA 2LZNA 2R5UA 2VYFA 3GXVA 2HAJA 2R6CA 4IM9A 4EHSA 4ESVA 1B79A 1Z8SA 2R6AC 2R6DA 3BGWA 2R6CG
chains in the Genus database with same CATH topology
1JWEA 2Q6TA 1T3WA 2R6AA 2LZNA 2R5UA 2VYFA 3GXVA 2HAJA 2R6CA 4IM9A 4EHSA 4ESVA 1B79A 1Z8SA 2R6AC 2R6DA 3BGWA 2R6CG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWE A;  2Q6T A;  1T3W A;  2R6A A;  2LZN A;  2R5U A;  2VYF A;  3GXV A;  2HAJ A;  2R6C A;  4IM9 A;  4EHS A;  4ESV A;  1B79 A;  1Z8S A;  2R6A C;  2R6D A;  3BGW A;  2R6C G; 
#chains in the Genus database with same CATH topology
 1JWE A;  2Q6T A;  1T3W A;  2R6A A;  2LZN A;  2R5U A;  2VYF A;  3GXV A;  2HAJ A;  2R6C A;  4IM9 A;  4EHS A;  4ESV A;  1B79 A;  1Z8S A;  2R6A C;  2R6D A;  3BGW A;  2R6C G; 
#chains in the Genus database with same CATH homology
 1JWE A;  2Q6T A;  1T3W A;  2R6A A;  2LZN A;  2R5U A;  2VYF A;  3GXV A;  2HAJ A;  2R6C A;  4IM9 A;  4EHS A;  4ESV A;  1B79 A;  1Z8S A;  2R6A C;  2R6D A;  3BGW A;  2R6C G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...