1Z9AA

Crystal structure of the asn-309 to asp mutant of candida tenuis xylose reductase (akr2b5) bound to nad+
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
319
structure length
319
Chain Sequence
SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFDDPWDWDNIPIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the substrate binding site of Candida tenuis xylose reductase (AKR2B5) with site-directed mutagenesis
pubmed doi rcsb
source organism Candida tenuis
molecule tags Oxidoreductase
molecule keywords NAD(P)H-dependent D-xylose reductase
total genus 112
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1z9aA00
2P5NA 2HV5A 3ONBA 3LD5A 1VBJA 4FALA 3LZ3A 4GCAA 3EAUA 4XVEA 3UZWA 5HNUA 4JTAA 4I5XA 4XZHA 3V35A 1J96A 3T42A 1LQAA 4PMJA 4NKCA 2IPWA 5AZ0A 1T40A 4WGHA 3UZZA 2C91A 4DZ5A 4DBSA 2ACUA 2PDKA 1YE6A 1Z89A 4EXAA 4JTQA 2PDQA 2PDNA 4HBKA 3V0TA 4JQ3A 3RX3A 2PDMA 4Q7BA 3BV7A 2WZMA 1AZ2A 2INZA 2PDYA 1GVEA 4L1WA 1MRQA 2HE5A 4ASTA 4F40A 2IKHA 2I17A 3ONCA 2PD9A 2PF8A 1HW6A 5HNTA 4GA8A 3LQLA 4IGSA 1K8CA 1XGDA 4WDTA 2NVCA 1SM9A 4FZIA 3MC5A 4LAUA 4JTRA 3V0UA 4JQAA 3ERPA 1Q5MA 4WEVX 2IPGA 2WZTA 3R6IA 3U2CA 2PDLA 1S1RA 4QX4A 4PUWA 1VP5A 1IHIA 4EXBA 5LIXX 2HE8A 3GUGA 3H7RA 1QRQA 2IKIA 5LIWX 3GHSA 2ACRA 2R24A 3LENA 4LBSA 4FAMA 1RY8A 4YVPA 2IKJA 4DBWA 1QWKA 1Z3NA 2PDFA 3CV7A 3RX4A 4HMNA 3Q65A 3CAVA 1XJBA 3B3DA 2IPJA 4GABA 4PUUA 1UR3M 4QBXA 1X97A 4IJRA 1PZ1A 4G5DA 4OTKA 4PR4A 1AH4A 1YNPA 2AGTA 3M0IA 4L1XA 1S2AA 3G1RA 3LBOA 4YU1A 4QXIA 2DUZA 2BGSA 2NVDA 3LN3A 1FRBA 1OG6A 3VXGA 2INEA 4JIRA 3N2TA 2IPFA 4JTDA 3WG6A 2FZ8A 3FJNA 4PRRA 4LB3A 2FZ9A 1AH3A 1ADSA 2PDHA 1S1PA 2BP1A 2HVNA 4PRTA 4R9OA 3WBYA 3BUVA 4YVXA 3O3RA 3R43A 2DV0A 3D3FA 3C3UA 5AZ1A 4XO6A 3BURA 3P2VA 1JEZA 1AH0A 1ZUAX 3R8HA 1M9HA 2FZDA 2PDJA 2PD5A 2ALRA 2FGBA 4GQGA 3R58A 3KRBA 3CASA 1A80A 3R8GA 2VDGA 4JTCA 3S3GA 3UG8A 3UFYA 1C9WA 1ZSXA 5LIKX 5LIUX 1ZGDA 2PDGA 3CMFA 2PEVA 2CLPA 2IQ0A 3RX2A 1YE4A 2FVLA 3FX4A 4WDUA 2F2KA 2PDWA 3UZYA 4XO7A 2PDBA 5LIYX 5C7HA 3UGRA 4JQ4A 3BCJA 5DANA 2ACSA 3NTYA 4LB4A 4XZIA 3CAQA 4YVVA 3QKZA 3Q67A 2PDIA 1EKOA 2PDCA 3DN5A 4JIIX 2HEJA 2HVOA 3M64A 2R9RA 4GQ0A 2A79A 2QXWA 4XAPA 3GHTA 1S2CA 1US0A 4WRHA 2PFHA 4GIEA 4AUBA 1HQTA 3G5EA 4ZFCA 4XZNX 4LAZA 1PWMA 4IJCA 1PZ0A 1ZQ5A 3LQGA 2IS7A 2DUXA 3H7UA 3H4GA 2BGQA 4RPQA 3R94A 3UWEA 1IEIA 3O0KA 1MZRA 4WDWA 5JH2A 1PWLA 4H8NA 1XF0A 4QR6A 5JH1A 1YNQA 4H7CA 3R7MA 4XZLX 2F38A 4JIHA 1X96A 3MB9A 2HDJA 2J8TA 2PZNA 4JQ1A 1AZ1A 3GHRA 4Q3MA 1AFSA 1RY0A 4DBUA 3LNMA 1Q13A 3V0SA 3WBXA 2PDXA 1T41A 3N6QA 3UZXA 3DOPA 5M2FX 1EXBA 3WCZA 4XK2A 3V36A 2I16A 3COTA 4ICCX 3WBWA 5KETA 3EB3A 3UYIA 4GACA 4MHBA 3CV6A 2ISFA 3F7JA 3GHUA 1MI3A 4XZMX 2ACQA 4FA3A 1PYFA 1LWIA 1RALA 4LBRA 3M4HA 3LZ5A 3EB4A 2IQDA 1Z9AA 1R38A 1EF3A 3LEPA 3UP8A 2FZBA 5HA7A 4XVDA 2PDUA 2IKGA 2PDPA 4JQ2A 1X98A 4WDXA 4YS1A 3LUTA 1EL3A 1Z8AA
chains in the Genus database with same CATH superfamily
2PAJA 3ARYA 4DPQA 4XSMA 3VNJA 3LD5A 1MQPA 3E5BA 3G1SA 3EDFA 5AYZA 1OQFA 3LZ3A 4LYQA 4O4WA 4DIAA 4HZ8A 4S3BA 1SZNA 5E93A 1K6AA 2CLOA 1CYGA 1SW0A 4Y90A 5LA1A 4D6EA 1JZ6A 3H26A 4AG0A 3N73A 2GYIA 4PTDA 2Y6ZA 3HJEA 3VNIA 4JICA 3NCOA 2PP0A 4TX6A 3QM3A 5K9XA 4LC8A 2CU0A 2GGGA 1A5SA 1RH9A 3LGEA 2O4MA 4QJ1A 1OX6A 4F40A 1U33A 2GK1B 2QIIA 1BRLB 3ONCA 2UBPC 4GBDA 2XGIA 3K8KA 1MXGA 1VEOA 3DCPA 5A1AA 5T9BG 2JQXA 3R8RA 3T8QA 1RBAA 1XDLA 2I1OA 1BG9A 3NPVA 5JQ9A 1XYAA 3N18A 3WFLA 1EC8A 4HNTA 4NX0A 3T1GA 3PWAA 3U2CA 3DI0A 4MPKA 4R3UA 5HR7A 5BROA 4EVZA 1G9HA 2QCCA 5HXMA 3ZJ6A 1A3WA 2Y24A 3ATZA 1UUMA 3W7JA 4JNYA 3GHSA 1REQB 2GDVA 3WLTA 5H8UA 3LENA 4JHOA 2OT0A 1L9WA 2WSQA 4GVIA 2UY4A 1LM1A 3QLLA 1M6JA 2TSYA 2YCIX 3H54A 3FYOA 1FH8A 5AECA 3BDKA 2AQWA 4S23A 2V2CA 3KLKA 2WVVB 2VMFA 5D05A 1UASA 2GPTA 3PANA 3SGZA 1R2SA 4QXIA 1GVQA 3EWUA 4KMQA 1G4PA 2NVDA 3LHWA 3LN3A 5LNRA 5BNKA 4KCWA 4PC8A 4PTXA 2RGMA 1EYEA 2NX1A 4KETA 4R27A 3SCOA 4TTUA 4CD6A 1TTQA 4GVFA 2Q8LA 4XZWA 3USBA 2PBGA 4JTKA 1DQUA 2WMKA 2RKXA 3CUJA 4I9JA 1BRLA 1AK5A 1FX6A 3LXAA 4R9OA 3GU1A 1DBTA 2RHGA 1VFOA 4O1BA 4MZ1A 3DYMA 3G77A 2DV0A 2DZAA 1RVKA 3D3FA 1KTCA 3M5XA 1QUMA 1R85A 2D24A 1XQLA 4MDPA 1W1B1 3EOOA 3SR7A 1CIUA 3VO0A 2Y1HA 5EFFA 4RCXA 2KZHA 3HFTA 1ZUAX 3MPGA 2W9MA 4RDYA 3UJFA 3GDTA 3L5LA 3W72A 5AHNA 1KCKA 8RUCA 1VCFA 2DSKA 3EA2A 2EKGA 1AQHA 1EF2A 4S3JA 4CLMA 4JIQA 2XIJA 4JZ5A 1GVSA 4XUGA 4Q22A 4QQ3A 4KRTA 4DJDD 1H63A 4L56A 3NL3A 4PULA 1QPOA 1GEHA 5F2LA 3W81A 1VJIA 3O7UA 6A3HA 2G50A 4GKLA 2Z28A 3UERA 3CAKA 3NEHA 3B8DA 1IV8A 1UZHA 1ZSXA 3U7VA 3KVJA 3MI3A 3T78A 5JMUA 2IQ0A 1W8GA 2OU4A 1M68A 2ONEA 4L80A 3T08A 5FJIA 2B7QA 3WUBA 4XO7A 4PTNA 3TP4A 3AFBA 4AD0A 5GPRA 3P82A 3WNOA 3G1FA 5REQB 3GXDA 3VGDA 1VPQA 3L21A 6ALDA 1G69A 5G2HA 4H8HA 2ISDA 1K8XA 4KGLA 4Q8UA 1F61A 1HN1A 3BLFA 2VEMA 3GVRA 4DBDA 4D6IA 3VKJA 2AAMA 3C0LA 2REQA 2VGIA 2R9RA 1C8QA 3GNNA 2NV9A 3DG6A 5LA0A 4YTUA 3LY0A 3W2KA 4PB3A 1B3ZA 3JU2A 5D37A 2VC7A 3F2CA 3AIEA 5FOOA 3BSGA 4UUIA 4UFIA 5AN7A 1XXXA 1SMDA 2ISWA 3OGRA 2BGQA 2R1LA 2GSJA 2X16A 3LGDA 4H8NA 3OVGA 3O0FA 3LMZA 1YNQA 2WOQA 3WF4A 2TYSA 5LNUA 4ZTYA 2G3FA 2NXGA 4MFDA 1R9XA 3MB9A 2Y61A 1FWFC 1XRFA 1VFLA 4M56A 1H51A 4MIMA 3S0CA 2WKLA 3OVQA 1OM0A 5LHFA 3S2NA 4AWEA 3WBEA 4MNLA 4I9TA 2OKTA 1I1WA 3WBXA 2EQDA 3CHFA 5BZAA 3DFHA 1E0XA 5FIPA 1IIHA 3L65A 3UPWA 2I16A 3WQFA 3E9AA 1HVQA 1VEPA 1W1A1 4JY9A 3LCHA 2PTDA 1XLKA 2E9BA 4PTMA 2OZTA 3CGTA 2YB1A 1XLGA 2WQDA 1FWBC 4CQ8A 1D8CA 3QPZA 1UIPA 2WBKA 3EWDA 4HPNA 2QIWA 4HMDA 4D9PA 5EY5A 4FXFA 1H1NA 2XIBA 1SU5A 4Q4QA 5M3WA 4PTWA 1HIZA 4GD0A 2DH2A 2NWSA 3TTQA 4KWSA 2ZUSA 4M80A 4S38A 4FO4A 5J04A 3ZLHA 3IJ6A 1FWEC 1L2QA 3MSRA 4GO8A 1EEPA 4LUIA 5AHMA 1W91A 4JTEA 4B16A 1DQXA 4KH2A 4HA1A 2CZ5A 3H6OA 1GJPA 4POCA 3ISIX 1VF8A 1M5WA 3W1MA 1CPUA 1BQGA 3PZTA 3THCA 3V35A 3VD9A 3AU6A 3YPIA 2VZSA 3IV3A 2QJMA 1EJTC 2D3LA 1XYZA 2R91A 1V8EA 3TN5A 1L6SA 3HGSA 2ZIDA 3VC5A 4K8GA 2CBUA 4EXAA 2AQVA 2WC7A 1YXDA 4LH8A 3V0TA 3RX3A 2H3BA 3DI1A 1SO6A 3S8HA 2WLZA 1X6UA 4MJZA 4L5ZA 4D1JA 3W1TA 5HBFA 1KM4A 4LRSA 3WQCA 3NDYA 4HMEA 3AJXA 2YPIA 4WSHA 1GONA 1VFSA 2QV5A 3BQ6A 3EA1A 3APTA 4GWEA 4GA8A 3LI1A 1TPH1 3DFOA 4LT9A 1B3XA 3HPXA 4JYDA 2ASHA 7REQB 4JQAA 1V6TA 2HPMA 1XI3A 4Y6GA 4O1FA 3EDJA 3WF0A 5A2CA 1LWHA 4KCVA 1A5BA 3UF9A 3R6IA 4IPIA 2PDLA 4PYSA 3QQWA 4HTBA 1OZQA 2B4GA 5FJUA 4NI8A 4LAKA 3FJ6A 1RY8A 1ZJHA 1EJVC 4UCFA 1TUFA 1UP3A 3BARA 5DMNA 3DEQA 2QDEA 3TV8A 4P8VA 4V2XA 1UD2A 2R8WA 2X0HA 4O0ZA 1ZJIA 4DLMA 3F4WA 3IEBA 2BY3A 1V4YA 3TWAA 3TYUA 1JI2A 1LP6A 1RQBA 3SN0A 3SEPA 1DIOA 3P62A 1AMKA 1O1ZA 3VCCA 3UXKA 1FRBA 1VIWA 1G7VA 3PY2A 4ZZ9A 2YB4A 3N2TA 4JTDA 4D8ZA 1FVPA 1XS2A 3PZ9A 3AIUA 3W1LA 2WJEA 3HZ3A 3VKAA 1KBKA 3C8FA 3IS4A 5FEXA 4E0CA 1OX4A 2WSRA 3BC9A 3MUAA 4M1BA 1E72M 2CZDA 3WBAA 1I2PA 3URNA 1GKPA 1TPEA 1M7PA 2PLKA 1PB0A 1EJRC 2AMXA 3A3XA 1FUYA 1OIMA 3OLIA 4W8BA 1OD0A 2VD9A 3OPSA 1AJZA 2CLHA 4MM1A 5HOSA 1EXPA 3FS2A 4V33A 1MEHA 5HMFA 3C0JA 2YYTA 3P2VA 3TTSA 2XVLA 2NQZA 1TSIA 1PPIA 5MF5A 1GZJA 3AWOA 3M0YA 4E4PA 5I24A 1QNOA 4W8LA 2FGLA 3BMXA 3C2EA 2GSEA 3I3EA 2G95A 3ZMRA 5G4HC 5C6MA 4DUOA 2ZYFA 1T8XA 4LF1A 3BE7A 1TFVA 3CASA 3W75A 3H4WA 3WUEA 1EQPA 3W2JA 3WQ6A 3GR8A 1CNVA 1YADA 2DT2A 2VZTA 2CKRA 3VZZA 2YA2A 3NVDA 1QBBA 4FI4A 4LFYA 2QR6A 3K13A 1ZGDA 3HB9A 1XLFA 5AB3A 3ITGA 3P74A 2ZX5A 2ZZ3A 2UY3A 3KVMA 4P7NA 4UNKA 1Y7VA 2Y2WA 4UC5A 4C7DA 3SIMA 5KZDA 1TJ1A 4HK6A 4RK8A 5IOBA 3W87A 1E15A 3MSYA 1OD8A 3BCJA 5BOOA 3E0FA 3NSXA 2I7GA 1LRTA 3TTEA 3QEZA 4EPKA 9RUBA 1PKLA 4Z2JA 3WQGA 1JVNA 5J5RA 3QZ6A 2J4GA 1QATA 4ZCWA 4Q8NA 5HK4A 4GQ0A 4NY2A 3R1ZA 3AC0A 2V2DA 1EJWC 3IWPA 4PSPA 2Y7GA 3MUY1 1HF6A 1HJQA 4M6VA 1P0NA 1M1BA 1U1JA 4LAZA 4IJCA 3QR0A 2OELA 1GQJA 3ZM8A 4DF2A 3A22A 1XIGA 3RR1A 4MLJA 4PCPA 4FOJA 3WMLA 2FHBA 1CB2A 4LSBA 3UWEA 2G3IA 3PR2A 3NWRA 2GJLA 3T2QA 2JEPA 2OO6A 3NZ1A 2EG7A 3EX1A 3VYLA 2J8GA 1DXFA 3MHGA 2VZUA 1YXYA 1OGBA 2VEPA 4MPQA 4CEXC 1LDCA 4P5UA 2NUYA 3R0DA 3AXMA 4BF7A 3V5CA 2YDSA 2XH4A 1WDWA 3T7VA 1POKA 4OUIA 1DWFM 1DIDA 1DWGM 2OMAA 4BK9A 1IE7C 1OGSA 4B2DD 3UZXA 5LXEA 4QROA 2CZEA 1MW0A 4IXXA 4AXKA 3A4XA 4EKJA 2ICSA 3ITTA 3QZEA 1NU5A 1WOBA 2CBIA 1NJJA 1TV3A 3ELFA 3W27A 4MWAB 4QAIA 1I45A 5BWFA 2ZQ0A 1S2TA 2QCLA 5HWNA 5XIAA 4S3DA 4KCTA 3C3NA 5FCZA 4GLEA 4HN4A 2VXNA 4M24A 4PCFA 3CXOA 4UZUA 3HMCA 1WYIA 3HG5A 3VNKA 5A69A 3KRZA 1LWIA 5FF3A 5DCDA 1OJXA 3SECA 3TW7A 3KTSA 4WSKA 3OGVA 4PUEA 3RO6A 3B4YA 1ZL1A 5B80A 3P8JA 3N13A 2VQUA 4CU6A 4O0QA 3MW7A 3GKAA 1CLVA 4HU0A 2RGLA 3QQ0A 1E1CA 5A8NA 3GNPA 2G0WA 1Q66A 4UOZA 2A2IA 1PDZA 3VCNA 3PBVA 3WQVA 1TIMA 5E6ZA 3TYAA 1HGWA 1YMYA 1H11A 4MKNA 5HWMA 2ZFAA 3HG4A 2XTKA 4GK8A 2GJNA 5T26A 1KD0A 1R2TA 3N3MA 2Q01A 2BODX 2QAPA 2X8RA 4JQ3A 3THQA 3PZIA 2W6RA 4L7ZA 4AEFA 1TELA 1WZAA 1QT1A 3BVJA 1I2NA 5FF0A 3O63A 3VPLA 2WPBA 3D0CA 2RJHA 5FF7A 3W53A 1L0PA 4IGSA 3S42A 4ZQMA 4GOAA 3FDGA 2NV2A 3RLGA 2XYLA 3CHDA 3DDMA 5GJMA 3TAOA 3FGCB 3GLCA 5U7SA 4HP5A 3U6WA 1AA1B 2V0TA 2HE8A 2GVYA 4UFHA 1I0DA 1TWDA 3V3WA 3IIOA 1YPXA 1NM9A 3WX7A 4US5D 4RLIA 4PBEA 4PL1A 4BI6A 2YA0A 1V51A 2GSHA 2IPJA 2VZOA 2F9RA 4PUUA 2O56A 1SFLA 5K9CA 3PJXA 3ZVHA 2WB5A 4L9YA 3HQ1A 2NXIA 4TIMA 4WJ8A 4CNTA 2XUCA 1X38A 1FP9A 4M3PA 4HCHA 2ZZ1A 4J7RA 3Q45A 4P7OA 1QW7A 5D03A 6REQA 5EB8A 1P7TB 1RBLA 1TVNA 3PFMA 1GYLA 4W8AA 3AIRA 1JUBA 1HL8A 2A6NA 3G18A 3G1VA 3W83A 5CSRA 5T91A 1ZJBA 4LB3A 2YBUA 3GC5A 3LCGA 1XYFA 4WKFA 1W9UA 3EOEA 3N11A 1ADSA 3TQVA 1ZBCA 4K6AA 3WLKX 4JHZA 4PRTA 5EFDA 3CB8A 2VO5A 1ICPA 5BXPA 4HJWA 4ZSTA 3CIVA 1RPKA 2OZ8A 3GTFA 3M1ZA 2R1NA 5F2MA 4FOUA 1YRRA 5HUPA 2POZA 3QV6A 7ENLA 1J6PA 4DELA 1XCXA 2VD8A 4XWUA 3BG5A 2XM1A 1RCOB 3NAVA 4IIEA 5M5DA 3B4UA 3BMWA 3WUFA 3V7PA 4E8DA 3QHMA 4AEOA 4CD7A 2IXVA 4A8RA 2ZUVA 1KFWA 1JPHA 1KLZA 1I75A 3IJ7A 3RMEA 2WSPA 3NGFA 4O4VA 2BBFA 3BCFA 1GK8A 1TMQA 3W4RA 1DL3A 2VM8A 2WXDM 3Q94A 3NQ7A 2BXVA 4P8XA 4AF0B 1JYXA 3CZEA 1C9WA 3V5OA 3VNDA 5A5WA 4FX6M 3L2MA 3LLFA 3SJNA 3WDIA 4C65A 4JIEA 5FJPA 4ZSUA 4MY9A 4OV4A 3MBFA 3UETA 3SRFA 3GDBA 1Y0EA 4Y9PA 4H83A 2CIPA 1H2JA 3KRSA 1BGAA 1K7XA 1DHPA 4GISA 5D33A 3W3OA 1Q6LA 2WO5A 4QIUA 3SI9A 2X2YA 2YLAA 4U10A 3R4IA 3C61A 1XV8A 1JPKA 2Y7EA 1ZAIA 2A7NA 4PBFA 1F3WA 1XH0A 1SW3A 1KXHA 2P88A 5LZLA 3QKZA 1CGVA 2BDQA 1GG0A 1P48A 2VUYA 4L64A 3AI0A 3A4AA 5IBXA 3THDA 4Y9MA 3M5VA 1OHLA 1UZ4A 3L7RA 2QPUA 4UTIA 4CCDA 4BKNA 1OIFA 1XX1A 2QCGA 3ZLFA 1SSGA 3M7WA 2TAAA 1EC7A 3O16A 3ANYA 2EG8A 4P7RA 3V5FA 4J35A 2BOEX 4C6IA 3MO4A 4W84A 3AS3A 4F0MA 3UGVA 1WE5A 2A3AA 4R7JA 4I7UA 2ZZ2A 4GUHA 2FJKA 3IVTA 4O11A 5AHLA 4WK9A 1S3HA 5CPMA 5CSSA 4N02A 1LL4A 1UKQA 5G2WA 3S47A 1IEXA 2NX3A 2YX0A 5I03A 4XZLX 1OC5A 2F38A 3IRSA 3UNDA 1OCJA 1X96A 1GVRA 5A8PA 1RJPA 3VKDA 1JD7A 2E09A 3OA5A 2QUNA 1EA0A 1K9EA 3LBCA 4CNUA 4EAYA 2XGZA 3TSDA 1X39A 3NEVA 3VMNA 1Q8JA 3MHUA 1JRBA 4LEQA 2ZA2A 4DXKA 5TF0A 3WD0A 3L68A 1V6WA 2RDUA 5KETA 3EB3A 5XIMA 3H7VA 3CUZA 1Q6FA 3ZSSA 4QE1A 4IGNA 4JFVA 4H9YA 4RXFA 4KERA 4I5RA 3O6AA 3O1NA 3PPGA 1TTJA 4O14A 2PLCA 4Q4MA 1A53A 2VKZG 4EE9A 5HA7A 1R3TA 3BPWA 2FJUB 1CXKA 3E0IA 3TQKA 4R7OA 1XIHA 4E5TA 3KDOA 1UPMB 1S2UA 1EQCA 2FVKA 1RA0A 1LT8A 1H50A 4IL2A 1Q2RA 2WM0A 4GPNA 3GB6A 4J5NA 4XVEA 5AYBA 4Y7EA 1T5AA 4O50A 1NDYA 3PVFA 4RE2A 4C1NA 4WHBA 5D02A 3FOKA 1CLKA 1K9FA 3MHFA 4JOMA 3LYEA 4DZ5A 1TB3A 4IQLA 5JBDA 1Q6QA 1JIBA 4LAOA 1CWYA 4ZENA 4I7VA 4P8UA 5C55A 3UWYA 3R0UA 1CXIA 4XQ6A 3TCSA 3VNYA 4L1WA 4PMOA 2J7DA 3KW3A 4IFOA 2HS8A 2R94A 7TIMA 1BYDA 1LRQA 4PMDA 3K2GA 2PF8A 1QW9A 1VBGA 1R87A 3R5EA 4X60A 3MBDA 2XH0A 1J18A 1JAEA 3TR2A 4DZHA 1X1OA 4IMCA 1ZCOA 1EWEA 5G5IA 1V7YA 1EPXA 5EGRA 3WY1A 4HVXA 4W88A 3N2XA 4HNOA 3VIMA 1O5QA 3E1F1 1V0LA 3GNDA 3WEOA 1BHGA 3QOKA 3W76A 5D2WA 2FH6A 1UC4A 1FWDC 4XAYA 1XC6A 2ACRA 1XH1A 1JCXA 2WW5A 3KUMA 1E9ZB 4AZ6A 3GH5A 4MKSA 4BS0A 3FHQA 1D3GA 3Q65A 3GSMA 1ITXA 1MNSA 5E9AA 2H6RA 1GT8A 5CC7A 2IMRA 2PU1A 1BQCA 1Y5WA 2WV8A 3D46A 3CZ8A 3I4KA 3BXWA 2XIIA 5T8GA 5PTDA 3MCMA 2FFIA 4FB7A 1YNPA 1BFNA 2ZDSA 1JRCA 3AJ7A 1W56A 4RL3A 3G1RA 2H3DA 1KXQA 5IM51 3JZEA 4H00A 4MWAA 3NQFA 3PTQA 6ENLA 3OBAA 1FQ0A 5FF4A 1EB3A 3T0TA 5G2IA 1XLCA 3UR2A 1EJXC 3SIZA 3PZNA 3N14A 2DVTA 3GDMA 1AH3A 2NT0A 1GOKA 3PP7A 5G1TA 1F74A 5ABFA 3PBWA 2HXUA 3KOXA 1WZKA 3DHUA 3H2EA 3SCPA 3BH4A 4U5KA 4AD5A 1EIXA 1WCGA 2P0OA 3WENA 1C29A 4FX7A 5IXEA 1JFXA 3BL3A 4O54A 2CCRA 1RHCA 5FEPA 3EYPA 3QR1A 3UVAA 3SY1A 4H01A 1RJQA 3C2VA 3I68A 4UIOA 1UR1A 1VJSA 4M8UA 1NOFA 5BOEA 3NGJA 1MUMA 5C7VA 1W32A 3JRKA 3PB0A 5LHEA 3FAXA 3QN3A 2HNEA 1XSIA 2Z1BA 2W61A 3BO9A 1DIEA 3GG1A 1U30A 4I8YA 1LBFA 2Z0IA 3OVRA 3ZVHB 4RDZA 4FXRA 1UWUA 4WDUA 1XIJA 2F2KA 2WSYA 3ARRA 4F4RA 4B90A 3VK5A 3L4TA 5CSYA 1GVIA 2FTWA 2GFTA 1GJWA 1ZCCA 3LBMA 2ABBA 2WJZA 1WOAA 4U28A 4CNNA 5KITA 5ABGA 2YDRA 4XZIA 2DZBA 5A8OA 1CXLA 3OZMA 2YA1A 1EBGA 1J9YA 2AKMA 3TFCA 2PDCA 3W6YA 3NO3A 4F3HA 1S3TC 2I5QA 1BSLA 1TPDA 1DHKA 4L9XA 2HVOA 3BAJA 3F5LA 1KV8A 4IPLA 2GJXB 1XYLA 1IWBA 2E3ZA 1JF5A 4R53A 4XAPA 4FLRA 4L6OA 1US0A 4WRHA 2ZUNA 4K7VA 3IIPA 4GZEA 4DNHA 1JXKA 2B7OA 5HINA 4AUBA 1XBZA 1CX9A 1PWMA 2CESA 2GLKA 3LQGA 3LCIA 2DUXA 3BV4A 1ZLPA 4KPLA 3VI2A 3U0HA 2FHCA 5K4ZA 3G6LA 2ZRVA 4BF5A 1BPLB 4BCEA 1UC5A 2WQPA 3THUA 3RYSA 3VM5A 2CHNA 1FXPA 5GJPA 4CQ9A 3CH0A 1JNDA 5C9WA 3LHVA 7PTDA 1TJ0A 2WZEA 3VGHA 3W28A 4WUIA 4YJ5A 4OBTA 2VYOA 4RV8A 1DIKA 1V0MA 1AZ1A 3DHPA 2X1TA 4W5ZA 2L5HA 4G6CA 3W85A 1WZLA 3M07A 2FPVA 2YXGA 2VNCA 1I0BA 3KM8A 4J2MA 1MYRA 1OF8A 1EDQA 4IJBA 4CU7A 3ZZ1A 1GVFA 1RR2A 1W3LA 4JYEA 4PGLA 1E4IA 3AS0A 2F2HA 1TPVA 3EWYA 4Z1DA 1FOBA 1GUVA 4KS0A 3DAQA 4EF9A 1OYCA 4IPJA 3MCNA 3WSUA 3WDQA 5D2TA 3RLVA 4FLOA 3AXKA 3PM6A 3PSVA 4AF0A 3B9NA 2IQDA 1Z9AA 3TYCA 4Q7IA 2Z6IA 1RCXB 2WWDA 3FDKA 2WKGA 1K3UA 3BAYA 1BWLA 4M29A 4Q8WA 2J66A 4DUWA 3WK3A 3NDZA 3PUDA 1TWZA 3UR8A 3MMWA 1SFTA 4GBUA 3AIVA 1BYBA 4NF7A 3ZO9A 3KOYA 1P6BA 4LXFA 3RHGA 5D9NA 3T42A 5A6KA 1OT1A 3KBVA 2BS9A 2V5KA 5E0FA 4ACZA 4YNGA 3NO1A 2ZCGA 1TUXA 4CNPA 5A6LA 2D20A 3PSWA 2UY5A 3OIHA 4RNJA 3SUSA 3B0PA 4XV0A 2Y5SA 1ME8A 4QCEA 3WNPA 1EPVA 1LZOA 3B8SA 2V30A 1J0KA 4DYJA 2JGQA 2PB1A 1JZ2A 3QZAA 3AUOA 1IEWA 1M7JA 3WMCA 2FTPA 3GRIA 3KBJA 2VP8A 1VBHA 4FNSA 4NL1A 4WDTA 1TYGA 2QVHA 4W4QA 2Q8ZA 6CGTA 4O19A 1RQEA 1IT8A 3FW6A 3VOIA 4WVXA 2IPGA 2P10A 3RAOA 3VFCA 3FIGA 1B4KA 3HPSA 5FA5A 2FGZA 3GNOA 2BOGX 3S2MA 3BOLA 2PA6A 4I5UA 3AYVA 2X7WA 3KOZA 1B0IA 2LLEA 4KFPA 2A3CA 1E6SM 2QJGA 4ZBCA 3CAVA 2P1FA 2PC4A 2WCGA 2ISSA 1UYQA 2B0MA 3APGA 2OEKA 3C86A 1FFRA 1OSEA 2RH9A 1QNPA 1QFEA 1N55A 1PZ1A 2GWGA 2V5BA 4G5DA 3ABOA 3KP0A 2O55A 4R9XA 3MZ2A 5FJTA 3F1QA 3S1WA 1XLEA 4LWWA 4FNTA 1H60A 2V5JA 4GC3A 3DG3A 3W70A 1XLLA 4GVGA 1KWKA 1E4NA 2J24A 3MI2A 2V5LA 3VXGA 4RZ4A 1AJ0A 1NWSA 3EWZA 4WR3A 3WG6A 3BLIA 2WVUA 4KKXA 1YEYA 2XU2A 5FKYA 1VC4A 4CVUA 2QZRA 2ZWZA 3VC6A 3WK0A 1UH2A 1QXLA 4AEEA 4MYAA 3THAA 3KP1A 1YW1A 3V16A 4ZB2A 4M6QA 3ARQA 3B06A 4IMDA 7XIMA 4AZHA 3OOQA 3IACA 1DJGA 4P7QA 1AJ2A 3IV8A 5I09A 1SO3A 4CEUC 3KCOA 1PYMA 4JN8A 2Y8UA 1PJ9A 3VTRA 3XIMA 2EJAA 3OLEA 4JCMA 4DI9A 2J7HA 3LRMA 3F4VA 4Z0JA 5HWJA 4GUGA 4J3SA 3C2OA 3PK7A 5CC5A 4IFKB 1SJBA 3UXLA 5FL1A 1V0KA 3IIVA 4A4AA 3PZMA 3O8AA 1SFJA 4A3HA 3TZFA 5LNVA 5T9CE 5B7ZA 1XUZA 2GUYA 1KGUA 2DSWA 1UB3A 3W7KA 2BHYA 3VKBA 3WDHA 3LHUA 4KT2A 4Q8PA 4GE8A 2ZX9A 3QPEA 1PKMA 4LYRA 1E5JA 2RDWA 4YXGA 1B31A 2Y88A 1NFBA 4J3ZA 1ADDA 1OFDA 4JTSA 3PTDA 5DELA 5AVHA 1HNYA 1ISYA 2QDHA 1JULA 1MFVA 4AC7C 2O9RA 2GUBA 3G0UA 2PMQA 4XKYA 4F9JA 3VIPA 1E6QM 2J47A 2C7FA 3S83A 4EPEC 5E5CA 3K30A 4UB9A 3OODA 3KVLA 4Y8EA 3RFAA 3S9IA 3B8UA 5D9PA 2ZE3A 1V6XA 4MZ8A 1PTDA 2Y0FA 3WELA 3S2JA 2XSXA 4MMWA 4GIEA 3TK7A 3W2LA 2ON3A 4DRSA 4XBJA 2NQ5A 5LNSA 1GW1A 1PTAA 1AQMA 1JYWA 4PUKA 4LUSB 3RM8A 4UFJA 1H0GA 3POCA 4IMEA 3TMQA 4A2SA 1D8WA 3H4GA 1AL8A 2C14A 4RPQA 3S1XA 3IUHA 1PWLA 3GTXA 1LBMA 2OQLA 5JH1A 3H2MA 5CJNA 3R7MA 3GXPA 1R0MA 1UROA 2FHFA 5F4XA 5DT5A 3ZR4A 3DFTA 3STEA 3MZNA 5A6MA 2JF7A 1RP9A 4QDPA 5D04C 1VHCA 3IJ8A 4CD5A 4Q3MA 5HUOA 1AFSA 4RX0A 1XQKA 4G9PA 1M7OA 3G1YA 4B4FA 4AIBA 1Q85A 4JNMA 1WP6A 2GGIA 3N2BA 2AL2A 1UJQA 1U22A 4TQTA 3PHAA 3W7PA 1OF6A 3M0XA 1GPWA 1CCWB 1Q6OA 2OLAA 4LUTA 2FZNA 2G3MA 3W22A 4U31A 3BOXA 4JX6A 1ZALA 3TKFA 2XWEA 1KBIA 3QY7A 1UD8A 1FP8A 1VHNA 3WBWA 3MMUA 4ADSA 4KFNA 3WO8A 1HL2A 2DZXA 2GUUA 4UTTC 4A6GA 4AHPA 4YWIA 5DXXA 2ISFA 1OX4B 2GQ9A 3P14A 3CBWA 4AXNA 4BY3A 3UWWA 5HATA 4NYYA 3D5HA 4Z2HA 5KTLA 1FWJC 4RE3A 3LZ5A 4AWSA 3T55A 4A29A 3RLHA 2C0HA 3RRAA 2D0HA 3TXZA 5I0DA 1UCWA 2ZRXA 1BVZA 3RM4A 3MKCA 5CC3A 5CZTA 3AXIA 3NQCA 3LPFA 5FL0A 4YS1A 3L5MA 3WQ4A 2Y8KA 1KM1A 4Q8OA 4DB7A 4HNLA 3SFKA 3PB2A 1VCVA 4FALA 1EX5A 3R89A 3LHZA 2YXOA 4IT1A 2VI0A 2O9PA 3ES7A 3IJIA 1FHDA 5I5RA 5DMMA 1GKRA 2YCLB 1K77A 1J5SA 4AZBA 5MHBA 1VFUA 3ARWA 4Z2KA 5REQA 1EH9A 3GS6A 1TKKA 4IFKA 1NFPA 4GQBA 2HS6A 4RDVA 2VFGA 2VENA 4MOZA 3GDRA 4M82A 3T0AA 4PB5A 1H61A 2HPIA 2VOTA 2EJ1A 1J10A 1YDOA 1ODZA 2F6XA 3OJGA 1TMLA 4JX5A 1B4EA 3WLIA 1X6NA 5G1YA 1V3HA 3GR7A 1UQZA 4C5YA 3BGAA 3E96A 4HGXA 2E1DA 4O8AA 3CUIA 2WJFA 4DJED 1HW6A 2I57A 3NG3A 3LQLA 2XWDA 4AWUA 3VA8A 1Q7QA 4NJJA 2DIKA 4PMQA 1F8IA 4TUFA 2WC4A 4LAUA 4PEEA 1Y65A 5I77A 1VGAA 1GOOA 4LF2A 4OBRA 4UTLA 1KCZA 4ZB0A 3UD6A 2WWCA 3AMKA 2UZ9A 3OYZA 2WHMA 4GGHA 3CWHA 1LQ2A 3UY7A 3FEMA 2Z26A 5LGXA 3TYBA 4H7VA 4WZHA 4CD8A 1GOIA 5BU6A 1ESWA 3W1XA 3GXFA 3CV7A 4IICA 1OCBA 3WD1A 4AD2A 4LALA 1P1MA 2H90A 3NA8A 3BMVA 4PMRA 3W86A 1X97A 2O7QA 4LOCA 4XB3A 4NZFA 3WF3A 3VDGA 3EXRA 5F4WA 2X1IA 4U3AA 2QVNA 4FF5A 2OPJA 1AODA 3LLXA 1LOSA 7ODCA 4JD4A 3GH7A 2P0IA 1SUXA 5HR6A 3MP3A 4C1LA 4A3YA 4GX9A 3IAPA 1XG3A 4W5UA 2ZX6A 1TG7A 3T05A 3AMLA 3NQGA 1J0ZA 5BU9A 1A5AA 3S6OA 6REQB 4ZO7A 5AOUA 1ZNNA 1UZ1A 4A2RA 3NM3A 2CBJA 4QSHA 4TX9A 3WBYA 1G1YA 5E6YA 4FMVA 4HSHA 3CPRA 3EWBX 3M41A 3O3RA 3VIJA 3UR5A 4YLWA 4E2VA 5DQPA 4Y9AA 1EFZA 3U5UA 3OG2A 4LBUA 1XDMA 4ZA0A 3T9PA 4HPXA 3M7SA 3WYZA 1ZP4A 5CLWA 4ZQNA 4GO9A 3B8VA 3GBEA 1H7WA 5EU9A 1HFBA 1DQWA 1E4LA 1H4PA 2E1WA 3ANVA 4N4PA 3G1XA 4O15A 3ORWA 2GK1A 4QJ3B 4P7LA 3VOFA 3WF1A 3IPWA 1OADA 4ICNA 3KRBA 4RNHA 2P53A 3UJSA 4XIAA 1SO4A 4C6MA 1XBYA 3R8GA 3TJ4A 3L2LA 1ODUA 3BLPX 4Q8QA 3BLDA 1EC9A 3NQ6A 4DHGA 2BXYA 1T99A 2YCEA 4PUDA 3DH7A 4LPCA 2JK2A 4IL0A 3IGHX 3PPFA 3AROA 2VWSA 2PBOA 4R85A 2A21A 2O92A 5D9OA 4KBXA 3RX2A 2H9AA 1FBAA 4DLFA 4DBEA 4UCGA 1F6KA 3GC2A 3HO8A 2W63A 1O5XA 5LIYX 2X40A 1E51A 3QSTA 4ILSA 4ERGA 5H8PA 4N42A 4JEJA 1XIMA 3H8AA 4J4KA 3WUGA 3HV8A 3HN3A 1UR9A 3KWXA 2DZPA 3HPZA 3PBYA 4LEFA 2AGKA 3CNYA 1IYXA 4X9YA 3WLQA 1TX2A 3NTYA 1WKYA 3GW0A 2XGBA 1V3IA 3CAQA 4OOUA 3QKEA 3ALFA 1A5LC 5AHIA 4C6FA 4GYKA 4O10A 2Z1XA 2ZDRA 2ZX7A 3WJSA 1A3HA 4URIA 1X6LA 3WEZA 2YYUA 1OK6A 2NLYA 4X63A 1BXBA 3KL5A 3KFTA 1NQ6A 4YTTA 5KMYA 4UR7A 5MKGA 4IUOA 3FSTA 1MQRA 3NR0A 4QCFA 2DU2A 3ANUA 4XTIA 3APYA 4IGMA 3ECQA 2QF7A 1E70M 3U7BA 2PWEA 1OWQA 5I23A 2XFRA 2GDUA 2PTWA 2GGJA 5EKYA 4R88A 4F79A 2WNQA 2E9LA 3EXSA 2J6XA 4QR6A 1NH6A 4CVWA 1BLIA 4PFMA 2PLMA 1QO2A 4HKPA 4MB1A 4S3CA 4DJDC 2QULA 1W31A 4ZO8A 4QDWA 5DEZA 4Q4KA 2Z4GA 4AIOA 3M16A 3MANA 1XGEA 1BXNA 5CH9A 4DBUA 3G3MA 3VZYA 4FNRA 2JF6A 4OIFA 4YPJA 1EJSC 1MEWA 4EP8C 2OB3A 3DOPA 3UU0A 2OFJA 1PEZA 2ZVIA 3FA4A 3C5QA 3PZUA 3MQTA 1FA2A 3S2CA 4ACYA 3UYIA 2XVPA 4MHBA 4JKLA 3WQEA 3ABQA 3RK8A 3WL1A 3GFZA 3PPCA 4PCTA 5LNWA 4PMXA 2HTMA 3BZJA 1R8LA 3H22A 3VD4A 2ATMA 3GX9A 2GVEA 1H7RA 4J3WA 3NQVA 3WNKA 1XLMA 1JYVA 3AU2A 4N0RA 2OYLA 4ZR8A 3GNRA 1E3ZA 3P80A 2CPUA 1TR1A 2H8ZA 1CZ1A 1MNZA 3NO5A 4ZOBA 2P5NA 4M81A 2EPKX 4NSBA 2HV5A 3Q37A 4QNEA 3W23A 2EHHA 4NP7A 3HURA 1NWRA 1R9ZA 3BG9A 1V08A 5AC4A 1UOZA 5I3GA 1VLIA 2OR2A 1E0WA 1TX0A 3CL7A 1C7SA 3FN9A 1GQLA 4HSOA 1ZAJA 4FOKA 4GUJA 1IWAA 4FK9A 3VOGA 2JBMA 4AVNA 3LCLA 3OEXA 1GTEA 3HA1A 1DJZA 1Z44A 2WZMA 1QPQA 1S2VA 2AL1A 5XINA 3LM3A 2HE5A 1J8VA 3AZRA 4HCDA 3NIYA 3KBSA 2PPGA 2YFOA 3KVKA 3QYQA 2JKEA 4Z1CA 5K7JA 1MDRA 4UFMA 4EK7A 4GRSA 3EX3A 1VCGA 2VEFA 1VKFA 1NY1A 4IIBA 1JPMA 1LJYA 1UKOA 1VBRA 1LT7A 4IX0A 3F5KA 1F5ZA 4W85A 3B40A 5K4XA 3DHFA 1UQYA 1S1RA 2QCNA 1Q6CA 1PIFA 3HG3A 4F2BA 3T4WA 4ZEPA 2JKAA 1TV5A 2G3JA 4ALDA 4WOZA 3GAKA 3U4FA 1IR2A 5AC5A 2IKJA 3TWBA 3M0HA 1YPIA 3TIMA 1QNQA 1EZWA 3N1AA 1NEYA 3OTRA 3L0KA 3GVVA 3CIWA 2OTDA 1RXOB 4UTTA 1XW8A 4QITA 1KC7A 4YCPA 4L1XA 4CCEA 1G4EA 2VTFA 2ZRYA 3SW6A 3MWAA 5LKYA 2ZXQA 3UT0A 4B5NA 6XIAA 4O17A 2WVTA 3MSDA 3W6LA 1WQ5A 1TVPA 2F61A 1ONEA 2Y7FA 1MW3A 3H12A 3DGRA 3T0DA 4E2BA 2BVYA 4YYFA 4IHCA 3TW6A 3B04A 4GHRA 2WMIB 2PDHA 2PP3A 4L4PA 3BUVA 3LTYA 1VH7A 2ZE0A 5K9DA 2C1GA 5JBFA 1F76A 3C3UA 4ZMGA 5BRBA 5BWAA 3C2FA 3LRKA 4ZVJA 3QQ1A 1QCWA 3BURA 4EOUA 2J74A 3MO7A 3UW6A 1AH0A 2PODA 2VC5A 1G4TA 5D32A 4IIDA 3T07A 4OVXA 4MNMA 1IEVA 2BMBA 4WF7A 2CNCA 5D8WA 5A94A 1JQVA 4H04A 3SZ8A 4N6FA 2Z1KA 2A3BA 1ISXA 2XG9A 3T6CA 3VNMA 2YBTA 4KEUA 3OP2A 4MJ2A 1RD6A 3JUGA 5BRQA 2QAFA 4UTWC 1LUCB 1BVNP 3IVUA 4S3KA 5DRCA 3V4BA 2V38A 1OINA 2DZVA 2VEGA 1JCTA 4H8VA 4E38A 1THFD 5LIUX 5C2CA 3N12A 3VD5A 4D6CA 1UWTA 2C71A 3S9YA 3MT1A 2V5CA 4N2YA 4O8RA 3TC6A 4X3ZA 1I8JA 3UGRA 8XIMA 5C5YA 4HOWA 2DSVA 1QASA 2ACSA 3WD3A 3FGCA 1MVYA 1S5NA 4H9TA 2NQ9A 1BAGA 3BOFA 4UXDA 3SGUA 4IF2A 3AHVA 3SCVA 3KEHA 1HGYA 2WMHA 1JZ4A 1Y5VA 3T0CA 3AZSA 4ZODA 2AMGA 2A0NA 3HM7A 4HZ7A 2V9DA 3W7IA 2B7PA 2F84A 4TMCA 1DJQA 3R25A 4WLCA 4LUYA 4L9ZA 4L6HA 4UQCA 2H9AB 2VQTA 1IEQA 2W67A 1TE6A 2J6VA 1GEQA 3L4UA 4HA3A 4LY8A 2GWNA 3K4AA 1W9VA 4AZCB 4YTRA 3RPDA 4HPJA 2E67A 1P5BA 1O94A 4Y9OA 4FNPA 1OABA 4J3XA 4JTGA 2X2GA 1W54A 1XF0A 3GTNA 3U3HA 3OU8A 3L4XA 4GX8A 1TV7A 1Q6DA 2QDDA 3P5YA 2R1KA 4OT7A 4DXXA 4JYFA 5RUBA 3TLLA 2D2GA 2CWXA 2JE8A 5EL1A 3STGA 1PX4A 3PAOA 5B7YA 3UPMA 2J78A 4ZO9A 4LV4A 1XC4A 1XBVA 1B9BA 1D3HA 3BG3A 4NG3A 4AWTA 3V1PA 4LS1A 2Z2AA 3MYOA 1TCMA 1S46A 1FXQA 1VBUA 5D30A 4BI7A 3CC1A 4L61A 4KEMA 5I7GA 1RV8A 5A8GA 4NXKA 3UJRA 3SURA 3F7JA 4XZMX 2CW6A 4PH6A 3DC0A 2YZRA 3T2PA 4FNUA 2GQ3A 2BHUA 4Q4RA 1UWQA 3U8GA 3UBPC 1LTDA 3N04A 4DF1A 1X98A 4HTYA 3SRHA 3H2CA 3PN8A 3S5OA 1FWHC 3NQDA 5HJYA 4ATDA 3ONBA 3CJPA 2BOFX 4NASA 2F8QA 3DG7A 5M17A 3W7RA 1P0KA 2XH2A 1J96A 2GDQA 2X1SA 3IAQA 3GUWA 2DVXA 2REQB 2ZA3A 1MDLA 2I9UA 3AS2A 3LG3A 3EMZA 3AUJA 1JGIA 5IDZA 3IJQA 4HBKA 3GWQA 5DF0A 1P0DA 2Z29A 1X7FA 3QR3A 4DWSC 1KFKA 4FLQA 3TCEA 4XD6A 1I2RA 4DJFD 3NQBA 3V1HA 3EDKA 1H7NA 3E6EA 5C8BB 4FIQA 3EEGA 3I3DA 3W74A 1LLWA 2EO7A 1PX8A 5CZKA 2VFIA 2AOSA 3QFEA 3MDUA 1R3SA 1XIIA 5G4WA 3GD6A 2X1RA 3W7GA 3WH7A 4D6HA 1NP0A 4KGJA 1F05A 1IHIA 1V6UA 1VP5A 5ABFB 4NI3A 4A3RA 2CYGA 1QRQA 5H1WA 1IGSA 1PX3A 1FH9A 3IJLA 3ARZA 3VVGA 2VR2A 2OLSA 1PO9A 3BJFA 3NPXA 1ITCA 3A47A 3NM1A 4H1ZA 4MWAD 2V3DA 4NILA 5L9FA 1E6PA 4OU1A 4L4LA 3KTXA 3S1VA 4I3GA 5CJ5A 1C9DA 1E9IA 3OZYA 3P67A 4RE4A 3W37A 3CQIA 1LWJA 2EF9A 2WNWA 4HK7A 3GXMA 2DW7A 3W7LA 2Q3RA 2YR1A 4AZCA 1TA3A 1KM0A 5IDIA 1R7AA 2WKJA 1AW2A 2QV4A 3W7MA 4CKQA 4X9SA 4AY1A 3AAMA 3W71A 5F2IA 3KX6A 3O6YX 3MA8A 4A22A 3CV1A 1MW2A 4XSLA 3KZSA 3LCFA 1QI5A 4PRRA 3UNTA 1U83A 4LCRA 1Z69A 2J27A 5A6AA 2BVDA 1NF0A 1O12A 3GZ3A 4BHYA 3SCTA 3N4EA 1GPFA 1QNVA 8CGTA 2OZ3A 3R43A 4KIEA 5LSMA 2C1HA 1UUOA 5ABEA 1N8FA 3JVAA 4WSJA 1AMYA 4JN7A 1TZ9A 3ZYZA 1PZ2A 3WLNA 2BHZA 4PCNA 2ADAA 4AZ7A 3AIQA 2EXOA 3EMCA 3W7HA 1FWCC 5KZMA 1US2A 5ECUA 4GIAA 5I3FA 4JL2A 3P5ZA 2XVGA 3W02A 4IH3A 5CZ0A 3SCRA 1J5TA 3LERA 2FGBA 1RUSA 1E6ZA 2D69A 1O7AA 1LL7A 1Q6GA 3JR2A 3R58A 4PUNA 3TA6A 3UXAA 4K2SA 4LCSA 4J3VA 4DUVA 1R3QA 2HSAA 2XN2A 2C19A 3S3GA 1AL7A 4L65A 3TW9A 2GGEA 3CO8A 8XIAA 2YGYA 4DJFC 4YTSA 1W1YA 5AYIA 2FVLA 4DO5A 1WNOA 1QOQA 3ITOA 3GXNA 3W1UA 1JZ3A 3P0XA 1KW1A 3FFSA 4B9YA 1V3JA 1WO2A 3A13A 1BGGA 5C7HA 2ESCA 5FSDC 1F4HA 1ZFJA 2EEXA 1GYMA 4ZFMA 2BVTA 2ODOA 4O0KA 1KCXA 3CH9A 3FAWA 3AHZA 3P81A 3POHA 4LB4A 3HOJA 3NFUA 1WZMA 2VCAA 3AS1A 1V02A 4LNYA 1KRAC 1Z42A 1QPKA 3R79A 2WMIA 3K8LA 3EDDA 4UTHA 1CDGA 1ZP3A 3L0NA 4PUMA 4Z42C 4S2CA 5C71A 3SN1A 2XIMA 4AQLA 1SJDA 2PCQA 4TR9A 3WLLA 5A6SA 5F7UA 1LLZA 3KDNA 2HMCA 3VCRA 1BSIA 4QJ5B 5H6HA 3EXTA 3H21A 2NX9A 3TYDA 3GG8A 4XZNX 4UMCA 4ENLA 2X7VA 4BJHA 4UTKA 1R86A 1Q8AA 2YIHA 3OBEA 5CC6A 1XBXA 1SGJA 3LS9A 3VKKA 1DOSA 3AYTA 4R7WA 1TV2A 2WMFA 4NNAA 4H7CA 2WC3A 3A9IA 3MUCA 3N9RA 5DMYA 1ZJAA 5A8MA 4DZIA 3CIXA 1W3JA 2CLIA 4Q32A 1FWSA 3TTOA 1B9ZA 2C6QA 4JX4A 4AIEA 2VCBA 3BW3A 1WKEA 1FY6A 3FV9A 4IP7A 3MUXA 5EMMA 4AB4A 4GINA 3DBPA 4Z17A 3MKVA 1Q4WA 3GTHA 1J4EA 4FPSA 1MI3A 5K2ZA 1W3KA 2FDMA 2E68A 1V3LA 1QOPA 2D2JA 1LORA 3R13A 2E6FA 3RNDA 4BEUA 3ICJA 1TIWA 3KXQA 1W8SA 4PMZA 3WQ8A 3WF2A 3GH4A 1A4MA 4YCOA 3ARSA 2ZUWA 2GJXA 4MUPA 4CD4A 1ME9A 1R5YA 4J27A 1LLOA 4DWSB 4DJEC 1WXYA 3MDWA 3CEPA 4HHMA 3VOJA 3URBA 2MNRA 2G8ZA 2BG5A 2HNHA 1DEDA 5I3KA 3EAUA 3CQKA 4F2TA 1YDYA 1K7EA 3HFYA 4JTAA 4B5WA 1UWSA 4PMJA 1C7TA 4NKCA 4R5EA 3S6DA 5AZ0A 4UMAA 3AYSA 3R0KA 5E0KA 1P1XA 1QWGA 4ATLA 4RNFA 3SN4A 3V75A 1LROA 1X1ZA 2J7EA 2P3ZA 2P76A 1GORA 4H4IA 4UTFA 4LYKA 4AFYA 4J2PA 3UCCA 1TPC1 3WLMA 2PS2A 2D2OA 3ITVA 4RDWA 3UCQA 4Q7BA 1GVEA 3NZGA 2HISA 4TOQA 4RR4A 1C3FA 3B8TA 1GTHA 3OQ8A 2V3FA 2PSNA 3BAIA 1OFPA 4UFKA 2V81A 3MV11 4OGZA 5C70A 2DUAA 4HNNA 1F6YA 1KBBA 4LX4A 4EWND 4DYEA 3W25A 1GQKA 1V77A 2V67A 1WX0A 4DYKA 4EIVA 1O95A 1AD1A 2A3LA 2HCVA 1A5OC 3TC3A 4OUEA 1W1TA 1VLWA 1ML1A 3NPWA 3LDVA 2OGYA 4O18A 2FLIA 1TJRA 3CUGA 3PZGA 1F6PA 4YVPA 1XCWA 3GIQA 3IIXA 2QS8A 3CZKA 3RCNA 4XISA 3HF3A 5DX7A 3RCMA 1B30A 3Q58A 4IIHA 2ZX8A 4YN5A 3K1GA 4PBGA 1A5KC 1BG4A 1EYWA 3GXIA 4JS3A 2SFPA 1Z48A 4K37A 4AISA 1QOXA 1XFBA 3M0IA 4HHLA 5FF2A 1HP4A 2OG9A 3DX5A 2WJDA 1HG3A 1IF2A 2Y4SA 3T44A 3WH8A 4C6PA 3HU7A 3PFRA 2GOUA 1UBSA 3TROA 3MMDA 4JIRA 3OIXA 4KW2A 1J0YA 3REQA 1HKIA 3N17A 2FZ8A 3WQWA 3V18A 3VU2A 2J9ZA 3GU2A 4C7FA 1UD4A 1KLYA 1RLCL 3GIPA 1NSJA 4NZ5A 3P84A 4NRRA 2G5WA 3TUUA 3DYPA 1DTNA 2XM2A 2CZFA 4W86A 1VIZA 4FXJA 2Z2UA 2WMGA 4C60A 2TMDA 4BZYA 3MU7A 4DAIA 2QJIA 2VWTA 4HPGA 5HMEA 1XHGA 3SQMA 2NXHA 1T7LA 3VILA 3GK0A 3FJLA 4EPDC 1XINA 2W27A 4D6DA 1PIGA 2HK1A 1C93A 5DY2A 1JD9A 2EGZA 3PJWA 5DCBA 1JDDA 4IG2A 2FDSA 5CBBA 1YYAA 4UZSA 5F1VA 3B05A 3RLUA 2OO0A 5KSWA 3VDAA 3E49A 4Q6JA 5DBTA 1UPPA 1PSCA 3SRDA 4ZOEA 4KRUA 1KFBA 2YL5A 8A3HA 4HCLA 3HPFA 3VD7A 4DM2A 3F4CA 4M19A 2B31A 4E6MA 1LL6A 2XN0A 1UKSA 2ZA1A 3S1UA 4AVOA 3QW4B 3I7RA 2DIEA 2CXGA 4AHQA 5H2ZA 2PEVA 3HQOA 4C6OA 2XDFA 5HMSA 1OFBA 3GIYA 4KESA 4F0KA 1QPRA 4DVOA 2PDBA 4JFWA 4UTMA 3DKJA 2ZC8A 2MANA 1S5TA 2A5HA 3QHNA 4AH7A 3EKGA 1EGVA 4KCUA 2WHLA 1HTIA 3L66A 1KFJA 3I7SA 3SUUA 4XKMA 3KAOA 1RZMA 3WNMA 2NQJA 3GC4A 2W62A 3PAJA 1EKOA 2CFFA 3CHVA 3DUGA 3LPOA 2RUSA 3TYEA 1FKXA 5GVJA 3M0KA 5D4YA 5HPOA 4H6EA 1UIOA 5GJNA 1FHUA 1V03A 2HBXA 2OOGA 3TLQA 2WZIA 5LXXA 2OYKA 2CLMA 3WDJA 3EBVA 4GYJA 3A3WA 1DJIA 1M04A 2F7FA 2VR5A 5IRPA 4HYWA 1HQTA 3K4WA 1J0HA 2X05A 5DMLA 2Q3OA 1GZ1A 1WDDA 3H7UA 1PIIA 4JGDA 3QMSA 2C3ZA 3R94A 3QMTA 3I4EA 4S2BA 4WDWA 5JH2A 4M7TA 3VIIA 4ADUA 1E3XA 5CPLA 4AU0A 1J79A 4GUIA 2V3EA 1K6WA 1Q7MA 3VAVA 2NUXA 4FR1A 3FA5A 3PF3A 3I7QA 4ACZB 4QJ4B 4HJFA 1F7BA 3QRHA 1CECA 2ATSA 4BEQA 4H9VA 4RZBA 3AOFA 3VNLA 2YL8A 5GNYA 3VGEA 1Q2SA 3N6QA 3EZ4A 2VX6A 2PU0A 4CQAA 3ATYA 4MY1A 3ABZA 1UD6A 4QDMA 3WCZA 2HJPA 2TPSA 3LLDA 3AWNA 4L4OA 4GI8A 2QMKA 3OGSA 1HKWA 2V6AA 5AC8A 2ZZ6A 1X7IA 1M41A 2OKOA 3COTA 3PTKA 4F0LA 1XRSA 1EGZA 1SSDA 3BLEA 1W1IE 1XRTA 4ADTA 2VDHA 3AYRA 1E6RA 1LOQA 5EMUA 1NWUA 2Y7DA 3I3BA 4TVUA 4A21A 3SUTA 1PYFA 5SWUA 3N19B 3FYPA 2ZTJA 5MKGB 4PMUA 4NAEB 3M0JA 3L0GA 4MWAC 3ZT6A 3KLLA 3ZSTA 3VIOA 1KRBC 2WAGA 3GY1A 5TIMA 3SCSA 3UY8A 1EF3A 2FZBA 2RFGA 1L2UA 2PDUA 4F2UA 3L5AA 2BY2A 4WDXA 3GVWA 1W6TA 2CZVA 3IK2A 3MUIA 3TE9A 4D71A 3LHYA 1K8ZA 2E7FA 2FPYA 3B9AA 1QK2A 5FD0A 3C2YA 2YDQA 4GCAA 4N9DA 4W7WA 1XD0A 1GHSA 3QGAC 4UNLA 5FJJA 4I5XA 3E2SA 3LCWA 3EPMA 1V6VA 5BMWA 1T40A 3UZZA 2BV9A 4Y96A 3QMRA 1SZRA 1YE6A 3WLPA 1FWGC 4X0NA 4AYGA 5CSUA 2PDNA 4MYXA 3FHAA 3BQ5A 3UXIA 1VRXA 2Z1SA 4NYUA 5TBOA 2INZA 2PDYA 4I6VA 3KL3A 2NZLA 4ASTA 2IKHA 4U5IA 2C0AA 2Y5EA 2QPXA 4IG2B 2OQHA 1XP3A 3VFLA 2X30A 2R1PA 4XG1A 1CGUA 2DORA 1DJXA 1E1EA 1KV5A 2NVCA 1YQ2A 4GI6A 3RF9A 2VX7A 3EOSA 6TIMA 4LUTB 3R12A 4UQEA 5J8LA 1AQ0A 3OVPA 5KEZA 3QSRA 2WZTA 1PXGA 1LRNA 4NAEA 2VL4A 1YHTA 3H7RA 4W89A 3JS3A 1NIUA 1L6WA 4HSNA 1MUWA 2QNEA 4ZOAA 2DT0A 2O4QA 4Q8MA 1OC7A 2QCHA 2VFHA 1OCNA 3AHYA 4FSAA 4LBSA 5EMJA 2OZ0A 1QWKA 2PZ0A 3CHEA 4WOQA 3RX4A 3GM8A 1VJZA 1CGXA 3W1QA 2OX4A 1MXDA 3BGGA 1SW7A 4CQCA 2P8CA 1VS1A 3T40A 1W5QA 4LAMA 1UR3M 3B8IA 2UWFA 3GBDA 1E9YB 2G37A 1U1HA 3G8EA 1AH4A 2QMJA 2DZWA 4YTQA 3VMOA 3P8IA 2ZUTA 1N8WA 4TO8A 1JCLA 4LUSA 3SCNA 1FDJA 4K8EA 2HVMA 4Q8VA 3LB0A 3RJXA 2OXNA 2VVNA 1FHLA 3O06A 3LNPA 4FEZA 1V7AA 4LCQA 3HQNA 2EG6A 5D38A 1R3RA 1JDEA 1NDWA 1IZCA 3GAYA 5CAKA 3KWSA 1E43A 2V69A 1TVLA 5A8QA 3WJYA 1YNYA 3G3DA 3MCOA 1E73M 3RITA 4AIUA 2VGBA 2YCKX 4AY7A 1ONWA 2ISVA 4DQWA 3LA4A 4H9XA 3M9YA 3VINA 2WHKA 3KS5A 1N8IA 1F3TA 5I79A 3SM0A 1JFHA 1Z7AA 3WMSA 1QI2A 1R3WA 5FEZA 4DJFA 4H6RA 1K8YA 4XAFA 2OWWA 1MFUA 2GGHA 2PWGA 3KHDA 3VIHA 3EB2A 1EP1A 1KFLA 5LYRA 4L1GA 5FI8A 3LI0A 2TODA 4GQGA 1SPQA 1TPB1 4BR1A 3QC3A 3FKRA 4IQDA 3NQMA 2J7BA 1ZU8A 3ZWSA 2DPEA 4YYCA 2Q6ZA 2I5IA 1TMHA 3D47A 1NVMA 2J7CA 2G4FA 1RVGA 4HZ6A 3A64A 4B5XA 4XKYB 2YDAA 4U4MA 4IPPA 1PV8A 2KAUC 3CS2A 3MI6A 1R3YA 2DY3A 4PEKA 4HT3A 1O5RA 3B8WA 4ES4A 4IMFA 2NSOA 1CGYA 2E4TA 1E0UA 1CI1A 3W38A 4D6JA 3TQPA 4GC4A 4J3UA 3DU0A 2FTYA 2R14A 4HYRA 4JNZA 1W3HA 2YXXA 1PUDA 2QQ6A 2NWRA 5BRPA 3RUBL 5HQMA 1BTMA 3CAWA 4UOJA 4YVVA 1S5WA 2QYGA 4O1CA 3UWZA 1DJNA 3RM9A 3PS7A 4K36A 2DJXA 2DZUA 1HO1A 2CHOA 1GOXA 3O6DA 1W9PA 3PULA 2BSLA 3QY6A 1JCMP 3GYEA 2QKFA 3DIPA 1GOMA 1YTDA 3NPUA 1RA5A 2QJHA 3VOHA 2O0TA 2PWVA 4IISA 3RU6A 2FB3A 1PHQA 4AW7A 3KRUA 3GE7A 2BTMA 3CTTA 2V5DA 3W9ZA 1H7OA 3PJUA 3NJ3A 3TN4A 4MADA 3GFYA 4U33A 3U5YA 3DC8A 2PWFA 4S3FA 2UY2A 2XVKA 4Q33A 1KNWA 1DJYA 1KXTA 1VD6A 3U2ZA 5A2BA 1UR0A 3FJ4A 2PZNA 4LVAA 3PUOA 4MKVA 3QYSA 1QI4A 2RAGA 2XN1A 4C6QA 4OOZA 3V0SA 3GXTA 2PDXA 5CZJA 1TPUA 5CLTA 2V8ZA 5CZSA 3TNBA 1VFMA 5TD4A 4QLKA 3MY9A 4MZYA 2NT1A 4C7GA 5I00A 4DWSA 3TQ0A 5JXQA 4NRSA 2DEPA 1HXJA 4B3LA 3WD2A 3UESA 4Z0SA 3N6HA 3UG4A 4PFHA 3WLJA 3DXIA 4UQBA 2HXTA 3T4CA 1N7KA 1SZFA 2G4JA 2J9YA 1E1FA 1WAUA 1B3YA 1OVDA 3N2MA 3H24A 1J2WA 3EB4A 5JIWA 3S2LA 4PTVA 1SFSA 4WY0B 1XR2A 3OBKA 1QI3A 2DSUA 2C15A 2PDPA 3U48A 4PMNA 2CXEA 3AALA 1ICQA 1UR2A 4B15A 4LQ1A 3W24A 2J88A 2OWXA 3MYPA 2VX4A 1A5CA 4MY8A 1Q65A 1V5XA 1VBJA 1TJ2A 3N34A 3U57A 1NARA 3G1HA 4ROPA 4TTGA 1OG0A 2V82A 4C6CA 4Z2IA 2VEIA 3T8LA 3W1RA 4K8HA 2Q09A 3FKKA 4DJDA 3GTIA 4X2PA 3PZOA 4KFOA 3L4YA 1VB9A 1QBAA 1B2YA 3SCUA 3QW3A 1ZENA 3SDOA 1AQFA 1UBPC 3ZXWA 1SR9A 5FAGA 1P4CA 4HHPA 2XZ7A 2QGHA 3O07A 1K4GA 1RD5A 4I6KA 3MTWA 1FCQA 2I14A 4DXVA 1WPCA 4Q4SA 2D1ZA 1KM6A 3KZPA 2A3EA 2WCAA 4O16A 3C8NA 1VQTA 3F2DA 4HQVA 1TR9A 3RPMA 5AC7A 4EAMA 3IK4A 2D2HA 3WJXA 1SVDA 2W3ZA 4IMAA 3TU9A 2VT0A 1Q5MA 1DVJA 1PKYA 4XIMA 2DQWA 2G3NA 3CQ0A 4NX5A 3WDPP 1GZGA 4A3UA 4FHAA 2Q02A 3GUGA 5DFAA 9CGTA 3DBNA 3P61A 4MNKA 1E71M 1R3VA 5JIPA 4QG6A 1HJSA 2E77A 4XZ9A 4CCCA 3M47A 5LIWX 1J11A 2Z1WA 4MB5A 1HJVA 4NAFB 2I9EA 3A9BA 3RRXA 3GU9A 4XBKA 3U4AA 1KQYA 2Y89A 1H1YA 4CNSA 2WPGA 3CLMA 4CUCA 2VC9A 1XLDA 3SY5A 2ZZ4A 4DAFA 2XZ9A 1QJWA 3WQDA 3NXLA 3QXBA 4YU1A 1W1ZA 1KFCA 1YTEA 1LOLA 3VKCA 4NXSA 5DO8A 3WK2A 1O4UA 2E0PA 2ZRWA 1K7FA 2J77A 4Z2GA 3TH6A 1HJUA 2ZUMA 4HA4A 5I78A 2OYMA 3W84A 2IPFA 2ZTKA 1IXOA 4JXCA 1IXQA 3TNOA 3AIBA 3HIJA 1EX1A 3SCQA 3NZPA 5CBJA 1VFTA 3QV7A 3PZQA 4NZCA 3B03A 1BXCA 1PAMA 4YVXA 2Z25A 1BF6A 2XJ7A 4GI4A 2VC6A 4JTFA 2ZZ7A 1OYAA 1MW1A 1JDAA 1JZ5A 4B3KA 3W29A 4NHVA 5CXPA 5I06A 1RSCA 3KHJA 4UMBA 2NLIA 3SQSA 4UFLA 1MEIA 3UEQA 3G1DA 3GDLA 3BJTA 4D8AA 2FMOA 2PDJA 1XL9A 1TRDA 4QHRA 4BWLC 4OQVA 2YSWA 2NVAA 3ABRA 1WDSA 2BASA 2XH7A 4S39A 2ZXBA 3CT7A 3FXGA 2EBNA 2C18A 4GYPA 4JTCA 3KTCA 3XISA 4C1NB 2CETA 4Y2WA 3CM4A 4F8XA 3H2NA 2PDGA 2VFFA 4ZE5A 2OEJA 3A3HA 3BAWA 3H4XA 4G8TA 1JDCA 3FX4A 2OSWA 4NJKA 4A3QA 2V2HA 1TWIA 1S2WA 3ZR5A 4M1RA 4MF4A 2EKCA 4US6A 4XD3A 4JQ4A 1BKHA 5BXRA 3CHCA 3P93A 1PS9A 1CGTA 2J62A 4H2HA 4E4FA 2D23A 3P0WA 1P0BA 2Z27A 2FMNA 4S3AA 3DN5A 2CLFA 1F07A 1O68A 4LNCA 2DDXA 2O9TA 3TVAA 3URAA 3NURA 1WKDA 1WXJA 4DWSD 3PWIA 1EJUC 2A79A 1UH4A 3IARA 1ZHAA 3REQB 3JW7A 4IXHA 3RXZA 3CO4A 1B54A 4W7UA 3KBWA 2E40A 2BZNA 3PJTA 5C54A 1MUCA 1TV4A 4GJIA 1R46A 1W3NA 2YOCA 1TPFA 1IEIA 4QTGA 2YCJA 2PF0A 1JDFA 2PRHA 6XIMA 4LVDA 4AD1A 4JKMA 1PBGA 1NQKA 4RXGA 5HQEA 3E0LA 5CGMA 5IBXC 3SSZA 3CEUA 4RW5A 3CUFA 3ES8A 1QW8A 5CPTA 3R2GA 4H9ZA 1ME7A 3HGOA 3KBMA 3PPHA 1O66A 4Q7NA 3LPGA 5D8ZA 4ML4A 4B4HA 3TDFA 3VIGA 3EKLA 3PTMA 4RZ6A 5D2VA 2E5BA 1VFFA 2QCDA 1IR1A 3H55A 2D22A 1VFHA 4IZGA 4C90A 4JFUA 1ZRQA 3XINA 4KWUA 4QM1A 1H3GA 6PTDA 4NJGA 3BK0A 3RJYA 5AFDA 3IUDA 1V93A 5A6JA 1L8NA 4RV3A 3PC0A 5HMDA 2A1YA 1J0JA 4BQ3A 3MWCA 3UPBA 1O60A 5DRIA 3GHUA 1AD4A 2VFEA 2WVVA 3SAZA 1ZAHA 2Y5JA 4JTUA 2XHYA 4INFA 1N2VA 3VX1A 3W7CA 1O5KA 4WJEA 5EPDA 1WBHA 1NP2A 2YW3A 3QC0A 4RPPA 4C6KA 1ZBVA 1EDGA 4IP5A 4DO7A 1FFQA 1R38A 3M0ZA 1BF2A 3LEPA 3UP8A 2C16A 4ATWA 1LUCA 4GNVA 3BGJA 3FXYA 3CUHA 1FWRA 1EDTA 1XPGA 1H0IA 2Z1VA 5DCEA 4GQRA 2QPSA 1EBHA 1ADOA 1H5YA 4P8WA 4GYFA 4AAJA 4CGTA 3E74A 1U5HA 3W82A 1XGZA 4HU3A 1F3XA 2BY1A 1QAPA 1EJ7L 3RIKA 4MNJA 1K1DA 1SJAA 4BFAA 3I6RA 3OO2A 1D7FA 3EKZA 5C9XA 3WD4A 2C91A 2I5GA 4F0SA 4IWWA 3IANA 4K68A 4MSSA 1OFAA 4IQEA 2JIEA 3ITLA 3UA4A 1NFGA 1H1ZA 3EA3A 3PNZA 3W1AA 4ZQCA 1FWNA 1IZJA 3GYCA 2PD9A 3U2OA 1IIGA 5FAJA 5HNTA 2HZGA 1K8CA 1UOKA 5IFPA 2PLJA 1SM9A 4NU7A 4FZIA 4H6QA 1NDVA 3MC5A 4B5SA 2VRQA 4YHEA 3M5YA 2NUWA 3UA3A 1XRVA 1XWYA 4JIPA 4OHQA 2GZXA 1HKVA 2WYSA 1W9DM 2FKPA 4M5PA 3WNLA 3ZR6A 1POJA 3VE9A 3E2RA 2WHJA 1PZ3A 3H2FA 1S5VA 4TV6A 1V79A 3BAKA 1HKKA 1XLHA 1QU4A 4L4MA 2R24A 1A0DA 4PN2A 1FTXA 2WBGA 3TN6A 2ALDA 3A12A 3CL6A 4TXEA 1Z3NA 1TZ7A 4CCZA 4GABA 1Q6EA 4UR9A 4DN1A 4BQ5A 3ITXA 2E8YA 4NZ4A 4PR4A 1BWVA 1HKMA 1KGXA 3K5XA 1S2AA 5E09A 3O6CA 3LBOA 3WLHA 4TV5A 4GJJA 5CQ1A 3M44A 2WMJA 1W9XA 1CTNA 4PODA 3UCDA 1XIDA 3SCWA 4N6EA 4X2RA 2Z00A 1TWWA 3LU2A 2XIQA 5CPNA 3QVQA 3PBGA 2VOMA 4QG9A 4MAVA 4BQ4A 1H62A 3H53A 1VENA 1Q7ZA 3LV5A 5DXYA 4MFEA 4A8LA 2ABAA 4CQBA 3CWOX 4JBRA 5I3IA 4AMAA 4UTUA 2PTZA 1PDYA 1S1PA 3BZGA 2GVLA 4U2YA 1ISWA 1YXCA 4UQ9A 2PE4A 3CMGA 4ZGYA 5C9UA 1RQHA 3C4UA 2G41A 1ONXA 1J01A 4GIRA 3S1GA 4XO6A 2JGYA 3BCDA 3DESA 4CN4A 3PUEA 3ZOAA 4DF0A 5C2GA 3ARPA 9XIMA 1W1VA 1US3A 1RJRA 3GDKA 4AYSA 4OJYA 4PSRA 4S3EA 2FZDA 5CCZA 4YL2A 4C6EA 5I6SA 4IIFA 1SYTA 1JUEA 5A3HA 5HPCA 2XPKA 3QPYA 1EUAA 1PKNA 3WN6A 4EWJA 5DY3A 1GWJA 5D2XA 3ID7A 4E3TA 3L67A 4EX4A 1QVBA 1YTKA 1JCNA 3A5FA 3IJ9A 1A80A 7CGTA 4NT0A 4KRZA 1C8XA 4PRWA 4GI9A 5HAOA 3GKFA 3L23A 2Z2BA 3N29A 1RLDA 2EPLX 3CMFA 1DJWA 4WQ6A 1TCDA 3G0XA 2A7PA 2WNNA 1J0IA 1OCQA 3GVQA 2J8FA 1M01A 3AXXA 2XFWA 4S1FA 5AHEA 5AKQA 3EMQA 1XD1A 1HP5A 3DFNA 5I07A 3ZJKA 1I9CB 4DJEA 4BWLA 1TE1A 3H70A 5D9MA 3T0BA 3CUXA 4NZ3A 2R82A 2PTYA 5FJOA 1B90A 5HNNA 2QHAA 2VDIA 3KS6A 3EPNA 2CBVA 1DWJM 4RUBA 4JFTA 3CQHA 1CXEA 4HMCA 3W07A 1HL9A 4GQQA 4NZJA 1WB0A 2OVLA 5F1UA 3BW4A 4LVBA 2J13A 1GVOA 4F0HA 2ZBTA 4HPHA 3K4DA 3MP5A 4GY7A 3BLLA 2J9XA 4BQ2A 2E6DA 4JPGA 5ENLA 1P43A 4XD5A 4BA0A 3WL0A 3K1DA 1DPMA 3PZVA 1JJKA 1UA3A 5HJXA 4R34A 3W00A 2CWNA 3VIFA 5A2AA 3WLOA 1EHAA 2JKPA 3ZFHA 1V3KA 2Z7GA 4XD4A 1LG1A 2IXUA 4B5TA 4Y8FA 4I90A 3AXHA 4QLLA 1K4HA 3K8MA 1XIFA 4Z1YA 3ZVIA 3PG9A 1H7XA 1C91A 3E0WA 5BOFA 3NQAA 4JHMA 4F0RA 3TYZA 2QW5A 4X22A 3BTNA 2AL2B 5A6TC 3W73A 3L4ZA 4UQDA 4N4QA 1XFCA 4K1WA 5EBAA 5L6UA 4IMGA 3SJ3A 4OV9A 4OKDA 1SMAA 3VDCA 1P6WA 2ZXAA 4I8DA 1A5UA 4D1IA 3OA3A 4AY8A 1G7UA 2W5FA 2HWGA 4CNOA 3H2AA 1W3IA 4LBRA 4O28A 2G97A 3N2OA 2O9OA 4B2DA 4LVGA 2CLKA 4V15A 3KOFA 3VZXA 2ZVRA 4YIWA 1RBOB 4ERIA 3VD3A 1UR8A 3HPAA 3M0VA 4UOQA 1JUKA 2E6YA 3FY1A 5AY7A 1FCBA 2RDXA 4GUFA 1Z8AA 2DZTA 1FDYA 1E5NA 3LK6A 2QGYA 1JCJA 3W0KA 4IX2A 4RNIA 1UKTA 2A4AA 1TTPA 2CHRA 3EPOA 3UZWA 4KQNA 1WBJA 2PGFA 4KEVA 3ZLGA 3NL6A 2DQXA 3QHOA 2PTXA 1OK4A 4PUJA 3B9DA 1W5MA 5CPQA 1I60A 3DERA 2ACUA 1ISZA 4E2OA 4JTQA 1R30A 3A5VA 5IFTA 2PDMA 3BV7A 1ICSA 4HNCA 3W7NA 1MZHA 4J28A 3CLWA 4EF8A 3DGBA 3QLDA 2I17A 1WAWA 4X0VA 3QTPA 4O1EA 3DYOA 4DWDA 2EPOA 3WQPA 1XLIA 3Q4DA 2VCCA 5U4NA 1OFOA 2X1UA 3CV2A 4J9JA 5C0QA 4G7EB 3V0UA 4IQJA 3ERPA 3ARXA 3RU8X 4WEVX 3ZT5A 1KBLA 3NQEA 2BY0A 5LGZA 4ERAA 4OFCA 1B3VA 1O1HA 1WA3A 4LW7A 4E2DA 3NOEA 3N4AA 3DFQA 4PUWA 1UKPA 4HN8A 4KIRA 3QTGA 1UUQA 4N9BA 5CPOA 4GZ7A 4FP1A 1EO5A 3GZAA 1XSJA 1H09A 4FAMA 1EZ2A 4AZGA 3IJDA 3ZQ9A 4HMNA 3AHTA 4B5UA 1XJBA 3UR7A 1ALDA 3CQJA 2GL5A 2WNZA 1ECEA 3NUKA 2FZMA 4NIRA 2CEQA 2RDTA 1EHNA 3N6JA 1Q4NX 4OE7A 2PUZA 2CKSA 4MB4A 7REQA 3LSBA 3I6TA 3B9OA 5DT7A 1PCKA 3AMGA 1LQ0A 4QG8A 2VGGA 4H7ZA 1IWPA 2BWGA 3EEZA 3AISA 4WKHA 1IXNA 4JTHA 2DFAA 3GVGA 3NZQA 1EGMA 4O57A 3CK5A 4WY0A 1TTIA 1HKJA 4O13A 1ZB5A 2FZ9A 2PWUA 2Y85A 3MMTA 2E5CA 1NTHA 4CN1A 1FHVA 4ZXLA 3ME3A 2J79A 2A6LA 1EEXA 2E28A 1ONRA 1MO0A 2ZC1A 3GO2A 4CN6A 3TXVA 5BXTA 1OT2A 1H49A 1XISA 3TC7A 3M6YA 1KQZA 1XLJA 3WNNA 3NZRA 2GOKA 3S5SA 4Z2LA 1PTGA 2W0UA 1JEZA 3UJ2A 4NNCA 3FSUA 2DW6A 1MXSA 3R8HA 1KM3A 5HDRA 1UMYA 2C13A 3IGSA 3GNXA 2ALRA 3RR4A 3KCJA 4ZOCA 4AX6A 3OW1A 1EP2A 3NQ2A 4WKAA 4GNKB 3BWWA 4Q8TA 1S39A 3DECA 1TWSA 4WJXA 1HT6A 3DFYA 3L4VA 4NZ1A 5I3JA 4QLJA 1G01A 4TVCA 3UZ5A 1EIBA 1SQ7A 3EOUA 4H2CA 2CITA 2NV1A 1XIBA 1OFRA 3W1NA 3LV6A 4MGGA 4BI5A 3VGFA 1JR1A 4FLSA 3TN3A 2CLPA 4EPBC 3KL0A 1Q6RA 4GKTA 1BEUA 3QH2A 1CW2A 4WGXA 1U1UA 3VOCA 4DZAA 3N9SA 5AC6A 1JNEA 3UZYA 2C1IA 1CEOA 2ZZ5A 1DE6A 1KB3A 3LM7A 3F2BA 4WIWA 1UR4A 4AD3A 1W5PA 1GNXA 1PVNA 4KWWA 4C6BA 3PG8A 4JAWA 1AW5A 3TTYA 2PDIA 3C52A 1GQNA 5E70A 4G7EA 4A8NA 3G1AA 4H9UA 1WDPA 4LRTA 3S5NA 4HIBA 4E4UA 1GQIA 1PE1A 1JF6A 4DO6A 4DUXA 3TOYA 3P60A 1S2CA 3W7EA 2YKKA 3GW3A 2QF8A 4NJHA 1TQJA 4RKAA 5C9RA 4PCSA 5KZ6A 3WLSA 4H19A 4U3CA 4G1KA 1UG6A 2PURA 1XM3A 1K02A 1QK0A 4ZFCA 3CU2A 3UWVA 3S5ZA 3BICA 4KF1A 1Q63A 4G2DA 3O9NA 1J2BA 3VMPA 1FWWA 1M65A 3FLUA 3QV8A 1GHRA 1T96A 3SUVA 2BVWA 3HMJG 4UNIA 3S46A 2NQLA 2XFFA 2G96A 5EYWA 4K38A 2P8BA 2HDJA 2J8TA 4DI8A 4HYVA 3ZJ7A 3EX4A 2F6KA 4G1NA 2FYMA 1VRDA 5D2YA 2EAWA 1T41A 4HOXA 4YHGA 5A6BD 1ITUA 2A85A 1W3TA 2YL6A 4V1YA 4MB3A 1CGWA 4GXWA 2X42A 3V36A 3UQNA 2INFA 4RW3A 4GY1A 4ICCX 2POTA 1J93A 4XUYA 4H9MA 2E25A 3FVMA 1ZTVA 4K39A 1HVXA 4WY0F 4LS0A 3H2OA 2WCSA 2ACQA 3HJZA 4FA3A 4ORIA 1EOMA 5BCAA 5C9ZA 4NVTA 3UYCA 5M03A 1K9TA 3M4HA 3SQLA 3ZJ8A 3ITCA 4YMZA 3UWQA 3VUPA 3G0SA 3N2CA 3LXCA 4GMEA 5TQLA 3M0MA 5EMKA 4QRNA 1V3MA 2IKGA 1SZGA 3ENLA 4JQ2A 2NQHA 3I10A 4TVDA 1XH2A 1NELA 3LUTA 4GIYA 4UTJA 3WJZA 1A49A 3WQ5A 1FWIC 1K03A 1GG1A 1TZZA 5F4SA 3SGGA 3G24A 4C6NA 4I7WA 1E6XM 1DWIM 2W91A 1HJWA 4XZHA 1NOUA 5G4EA 1LQAA 2WM1A 5JBEA 1GJUA 4UR8A 4GXPA 1C92A 3TZNA 2XINA 1PHWA 1GKQA 1RPXA 3IGUA 3W88A 3TOPA 2PDKA 1Z89A 3WK1A 2PDQA 2MUCA 4RJEA 3TSMA 4JTLA 3ARUA 1QPNA 5EBUA 1IZKA 1NWTA 4K1GA 1HUVA 2BLEA 1XLAA 1MRQA 1UD5A 2OLHA 1Z32X 1OY0A 2IW0A 4QAWA 3P3BA 2PI6A 2WVSA 3USZA 4Q4OA 3S9ZA 1QHOA 3I65A 4HB7A 4HHHA 4XTDA 1JXJA 3TSBA 4MDOA 1VAHA 3D3AA 3VM7A 1QDSA 2PP1A 1K9DA 2XSBA 2VEKA 4QX4A 2AKZA 2OODA 1YPFA 3KE0A 2D0FA 3WLRA 3FVDA 4KEZA 2YFNA 2OWCA 4LC6A 1L8PA 4F66A 2BFGA 4NQ1A 4H8UA 1NAL1 4IGHA 1I6NA 2PDFA 1E6NA 5ECVA 2D3NA 4AMCA 4GVHA 4FXSA 3B3DA 1A0CA 3HGRA 3E12A 4E8CA 3M0LA 3ITYA 1QNSA 1MSSA 3T81A 3MUZ1 4QBXA 3Q2DA 4QGCA 2DJLA 3QGVA 1YIXA 3T2OA 1BYCA 4H3DA 4WX2A 3SBFA 4HNUA 2ZUUA 5A6BA 3W01A 2ZADA 2NW0A 3L9CA 1IT7A 5F2GA 1DXEA 2YZ5A 2I56A 3A24A 4C5ZA 3EX6A 4QP0A 3HTWA 3HQPA 1L6FA 1Q3NA 1UHVA 2QUUA 3O2LA 5I3HA 3W26A 1EA9C 4N7QA 5FSEC 4QFUA 1VYSX 4UQAA 2E9MA 2OEMA 2ZOXA 4IFRA 2DVUA 2JIWA 2R6OA 3A4JA 2OT1A 3WFZA 3ARTA 4JCLA 3U2EA 3QY8A 4GJ1A 4V1XA 2W79A 3SRKA 1GOQA 3EWXA 5D09A 1D9EA 3RO8A 4MJMA 2IUZA 1M9HA 1I2OA 2V63A 3AQUA 4V28A 3PBUA 2CLEA 2QCMA 2WANA 4QE4A 3FK4A 4DPPA 4HU8A 3CYJA 4L6DA 3N9KA 4DNMA 1XUUA 3SY8A 4ZE4A 4EACA 4XBSA 4QEEA 3E3HA 2VDGA 4G7FA 1M3UA 1QHPA 2WZHA 2WLYA 2W92A 2WSKA 1EWDA 3SFWA 2ANUA 2VZVA 3LRLA 2QUVA 1T0OA 4DY1A 3INPA 5TNVA 3U9IA 3UG5A 1G94A 3R10A 3L12A 4WCJA 5FJRA 3W2NA 1BD0A 4W7VA 1WDQA 4JEQA 3MSGA 2W4XA 3LXBA 1O6IA 2Y70A 5AVNA 2HRWA 2DGAA 3DFPA 3NXFA 4IM4A 4REQA 4JTTA 1JPDX 1Z41A 4GXMA 3QJAA 3WDRA 1KWGA 2DZSA 2YJQA 4MAZA 2WK2A 5KINA 4LGXA 3C56A 2XVNA 2C8NA 1J12A 1KFEA 3L4WA 5E9XA 2OJPA 2VJXA 4GY0A 3M64A 1RCQA 2QXWA 1UA7A 1C8YA 3NYZA 1E56A 3F4DA 3WQOA 2XISA 2V68A 4D6FA 3VDBA 3F4NA 2E8ZA 3P7YA 4MJ4A 2Z7KA 1PZ0A 1ZQ5A 4AD4A 1ENUA 5GNZA 5CAHA 1AW1A 3GQYA 3EDEA 5JVLA 1D3CA 3NSNA 5AYXA 1GYNA 2V3GA 1ZBKA 4NJIA 3PBMA 4PB4A 2GQAA 1F9CA 1CENA 4JIHA 3FNDA 1AVAA 3SADA 1YX1A 3B0UX 1A5MC 4C6JA 2KX9A 1ZS2A 1TV8A 4ZL1A 3C0QA 3C0SA 1XYCA 4XX6A 4Q6XA 3UWUA 2VRKA 3B0XA 5CJMA 3DHDA 4ZTXA 1B1YA 1KXVA 1HJXA 3C2RA 3E38A 5FESA 4GH3A 5AYYA 1EXBA 4JTJA 3B9EA 2OQYA 4B91A 1I4NA 2DSZA 2YBVA 4JDBA 1JI1A 2P3EA 1G4SA 3BLOA 1XCFA 4GACA 1JZ8A 2QJNA 3WEMA 1YDVA 3NNTA 1H7PA 8TIMA 3ZT7A 1JQXA 4IUGA 3EX2A 4OZOA 1DV7A 3RG6A 3RN6A 1P0EA 2VGFA 5M1TA 1WUFA 1TJPA 4A05A 1JGMA 1W5NA 4D72A 2VUNA 2BB0A 3WH5A 2R1MA 1EL3A 4J3TA 4JN6A 1W1PA 4K3ZA 3HGJA 2HK0A 4LY4A 1YDNA 1D2KA 4M6UA 4P2VA 3P6LA 3QBUA 4LJ3A