1Z9AA

Crystal structure of the asn-309 to asp mutant of candida tenuis xylose reductase (akr2b5) bound to nad+
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
319
structure length
319
Chain Sequence
SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFDDPWDWDNIPIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H-dependent D-xylose reductase
publication title Probing the substrate binding site of Candida tenuis xylose reductase (AKR2B5) with site-directed mutagenesis
pubmed doi rcsb
source organism Candida tenuis
molecule tags Oxidoreductase
total genus 112
structure length 319
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1z9aA00
2IPWA 4JTQA 1PZ0A 3CV6A 4GQ0A 3ERPA 3LZ5A 2BGSA 5KETA 1FRBA 3MC5A 4XZLX 4ICCX 1RY8A 1C9WA 1XGDA 1ZGDA 4XO6A 4I5XA 2PDMA 3G1RA 3UZWA 4WGHA 4XVEA 2F38A 3BURA 3T42A 2PDKA 3G5EA 2ALRA 1RALA 2IKIA 2INEA 4XO7A 3CASA 1ZSXA 2PDLA 2PZNA 3O0KA 3EB3A 1Z89A 4IGSA 4H7CA 1MZRA 3UZYA 4LB4A 2PEVA 4DBUA 2ACRA 3BUVA 3S3GA 4Q3MA 2PF8A 3GHTA 4JIIX 3R7MA 1PYFA 1YNQA 2NVCA 4JTDA 1Q5MA 2ACQA 3COTA 4LAUA 5DANA 1LQAA 1PWLA 3WBWA 3DOPA 3LN3A 2C91A 3F7JA 3UG8A 1XJBA 4YU1A 2FVLA 3UFYA 3R58A 1T40A 4WEVX 2IQDA 2R9RA 4WDXA 1EL3A 4XAPA 4JQAA 4XZIA 1EXBA 4PR4A 1YE4A 4YVXA 5AZ0A 5LIXX 4DBWA 1Z3NA 2FZ8A 3H4GA 4JQ4A 4JIRA 2ACSA 4GA8A 3LEPA 1Z9AA 4XK2A 1AH0A 2DV0A 2WZMA 2INZA 3UZZA 3WG6A 4JTRA 4L1WA 3RX2A 1IHIA 3NTYA 2IS7A 2HEJA 2PD9A 4GACA 4LBSA 3RX4A 1A80A 4IJCA 2HVOA 1AH3A 3N2TA 4XZNX 4HBKA 1R38A 5HA7A 1LWIA 2DUZA 4PUWA 3CAVA 3WBXA 4WDWA 1YE6A 5AZ1A 3WBYA 4WDTA 4YVPA 2QXWA 3CMFA 4Q7BA 2PDWA 3GHSA 2P5NA 4LBRA 5LIWX 3KRBA 1AZ2A 1XF0A 5HNTA 2HV5A 2PDPA 3WCZA 4JTCA 3VXGA 4YVVA 3D3FA 4EXBA 4RPQA 3LD5A 3UP8A 1Q13A 2PDNA 3H7RA 2HE5A 4JIHA 1HQTA 2IQ0A 5LIKX 2PD5A 4H8NA 3R8GA 4FZIA 3QKZA 4JQ1A 4G5DA 2BGQA 3GHUA 4AUBA 1UR3M 2PDCA 1J96A 4GCAA 2CLPA 3CV7A 3ONCA 4LAZA 3GHRA 1AFSA 4DZ5A 2PDGA 2I16A 4QBXA 1X97A 2DUXA 4PUUA 3UWEA 4PRRA 2HE8A 4QR6A 3M64A 3UGRA 3LQGA 3BV7A 2IKJA 2VDGA 4XZMX 2PDYA 1AZ1A 1YNPA 4NKCA 3EB4A 3FX4A 5HNUA 3V0UA 1GVEA 3BCJA 1IEIA 3R6IA 1PZ1A 5JH2A 4L1XA 3LNMA 2PDXA 2WZTA 4FA3A 2BP1A 2PDBA 4YS1A 3U2CA 3ONBA 2IPGA 2IPFA 3LBOA 3V0SA 2PDFA 1OG6A 2J8TA 2F2KA 4LB3A 1QRQA 2IKHA 1K8CA 1VP5A 4WRHA 3V0TA 1T41A 2HDJA 5LIUX 1AH4A 1ZUAX 3R43A 1S2CA 3LZ3A 4QXIA 5LIYX 5C7HA 3GUGA 3UZXA 4FAMA 2A79A 2NVDA 5M2FX 2PFHA 4PRTA 1JEZA 1US0A 2ACUA 1VBJA 4GQGA 1PWMA 3CAQA 3H7UA 4JQ3A 3P2VA 4R9OA 1M9HA 4GABA 3C3UA 2PDHA 4FALA 2FZ9A 4IJRA 4PMJA 3V36A 4QX4A 2PDJA 1Z8AA 4F40A 3R8HA 2PDQA 3UYIA 3DN5A 1S2AA 1HW6A 1X98A 2PDUA 3O3RA 1RY0A 3LUTA 1MRQA 2I17A 5JH1A 2IPJA 3Q65A 1SM9A 4OTKA 3M0IA 4ASTA 4EXAA 3EAUA 2R24A 1X96A 2ISFA 1ZQ5A 3LENA 3B3DA 4WDUA 1S1RA 2AGTA 3V35A 2FGBA 4MHBA 1S1PA 3FJNA 4JQ2A 2PDIA 2FZBA 4XVDA 4DBSA 1MI3A 3N6QA 4GIEA 3MB9A 2IKGA 3LQLA 3R94A 2HVNA 3Q67A 1QWKA 3M4HA 3RX3A 1ADSA 1EF3A 1EKOA 4ZFCA 2FZDA 4HMNA 4JTAA 4XZHA
chains in the Genus database with same CATH superfamily
2IPWA 4XKYA 3DFSA 4QCFA 4GQRA 2ATMA 3LHWA 3NL2A 3NQGA 4I9TA 5F2LA 3LCWA 4JTHA 3LHTA 3LK6A 1FWAC 2MNRA 4IIHA 4W84A 1UH4A 3DERA 4HNNA 3APTA 5CZTA 1JPKA 1Q7MA 3LYEA 3L0GA 1POKA 5RUBA 4XO6A 1E6PA 1XIFA 2VCAA 3AIEA 2HBVA 1JULA 1MSSA 1SU5A 1VB9A 3UR5A 3IIPA 3T42A 5ECUA 4FR1A 2TYSA 4B2DD 2ZZ4A 3CUZA 4QE4A 4P8UA 1BPLB 3BG5A 1R2RA 3EDKA 1X39A 3W84A 3VCNA 1SO5A 2ZC1A 1TR1A 3L0NA 3VVGA 3WD4A 4DNHA 1EP2A 3GQYA 1LP6A 3TR9A 3CLWA 3TVAA 2NVCA 1PKYA 3COTA 5G4EA 5FJRA 2GGIA 1Y5VA 4DAFA 3PWAA 4I9JA 3KBMA 4FO4A 4NAFB 4PMNA 1A3XA 3S1UA 4D71A 3MCMA 3R58A 4GIYA 1T40A 1L2UA 1KKOA 3SGGA 3U5YA 8CGTA 3OZMA 4BQ2A 4WDXA 4UFIA 2XHYA 4QITA 1NSJA 2YDRA 2EKGA 4ZA0A 3MA8A 4PUKA 4IPJA 3RNDA 1JCXA 3OBEA 3L0KA 4GUGA 1MQQA 1W1PA 3V5FA 2J27A 4UFJA 3DEQA 2NXHA 1VR6A 3WEOA 1DWGM 3LSBA 3SCRA 3TSDA 2VEFA 1KBLA 4DJFC 4GYPA 3AIRA 3IJ6A 3WL0A 2GDVA 2IS7A 1W1YA 4JY8A 1ISYA 3TSMA 5HNRA 3EWDA 4KESA 1CECA 3WMCA 2BBFA 4W4QA 1VRDA 5JVLA 1A3WA 2AAMA 2OGJA 3W2MA 5IFPA 1XM3A 4RK8A 1A5CA 2XVPA 4DY1A 1RCQA 4I7UA 2WHKA 2PCQA 3I65A 3T2PA 1LM1A 1NFGA 2Z27A 3LM3A 2G4JA 3E49A 1F73A 4IFRA 1AVAA 2WC4A 4LBRA 3SRHA 2GGEA 4RZ5A 1K02A 3MUY1 4QHRA 3W73A 1KA9F 4UTMA 3LB0A 4L6HA 3VXGA 3PUGA 4A8IA 4LS2A 3PM6A 1JIBA 3VPLA 4C7GA 5BNKA 4Z1BA 3GTIA 2XZ7A 4JOMA 1JCMP 1ZBWA 5FEWA 3IARA 2ZICA 3EA2A 2W9MA 2WKLA 2Z7KA 3GNXA 4TTGA 4D8AA 2ISDA 4W8LA 2I1OA 2I7GA 1O5QA 1RQEA 2QKFA 4ZQCA 1EEPA 3N04A 2PLCA 3TYBA 4WKAA 4HA3A 3B9AA 2OLAA 2BVTA 5CLTA 4TTUA 4DLFA 3BAWA 3O2LA 3E0VA 2QPUA 4PMZA 2IXUA 4PMDA 1JCTA 2VRQA 3A5VA 3WZ0E 2Z6JA 3UWEA 3K46A 4AD3A 1HZYA 3L21A 4NXSA 3CUIA 3DKLA 1ZAJA 3HJZA 4RZ4A 4AHQA 3VILA 1F5ZA 2WQPA 1RXOB 3V5OA 1EQCA 3R13A 5AYBA 3QLDA 1KBKA 3I68A 1GVEA 3W7OA 4CEUC 2Z1SA 5HQEA 4WY0B 5I6SA 2GZXA 3ZOAA 2X1SA 2HBXA 3IJLA 1E0VA 4IIFA 3K4AA 4JICA 4K7VA 2PDBA 2GL5A 2PAJA 4GE8A 3C2EA 5CBJA 1M3UA 1YYAA 4C60A 5FAJA 1I2RA 3IV3A 1UD8A 5GPRA 3MMDA 4U5KA 2WPBA 1K8CA 2I5GA 3WH5A 3E9AA 1SZFA 2EG6A 3B8DA 2W6RA 3WKZA 3BQ5A 4C6QA 1VC4A 2D2HA 1SO3A 3IAQA 1TV8A 4PRTA 2OYKA 4MWAB 1K1DA 4A3YA 3N73A 4L4MA 1L9WA 3W7KA 1TX2A 4OT7A 4CD5A 4BI7A 1W9PA 4FIQA 4QIUA 3RF9A 1IEQA 1H5VA 1YXCA 3UG5A 3TX9A 3QR1A 3MQTA 3ID7A 1X6LA 3EBVA 4BCEA 4C65A 3ARQA 3VX1A 3W7PA 1E6NA 2UY5A 2Y63A 3IVTA 5DCBA 4HMDA 1V6XA 4MB1A 1GKQA 4O11A 3SECA 4C1NA 3ANVA 3WUEA 5HPOA 3MMTA 4WKHA 4HOZA 5DEZA 4JTTA 1FXPA 3H4XA 3PZGA 2C8NA 4H6KA 3WDIA 3ZJKA 1YPFA 3FJLA 2QPXA 3IK4A 4ERAA 4O16A 4CN6A 1TWZA 1ZNNA 1OT1A 2FB2A 2ZADA 4WXYA 1LWJA 1P48A 4PULA 4HIBA 4DZIA 1ITUA 4S3DA 5HUPA 3K1DA 4JS3A 2PRMA 2PLJA 1SW7A 3FHAA 3LGDA 4RE3A 1ML1A 1XBVA 1J5TA 3AHXA 4OU1A 1IEWA 1DJXA 2VQTA 3E2SA 1CB7B 1GZJA 3W0KA 4PTMA 3PBUA 2IQTA 3BARA 5BXRA 2WNNA 1S39A 2C1GA 3K8KA 4ZQMA 3MC5A 1Q8AA 3KVMA 5FOOA 2ZWYA 1C9WA 2WSPA 4KPLA 4Y9AA 1B0IA 3G1RA 1WDDA 4YXGA 4OGZA 4ZXOA 3S6TA 4JNZA 1WAWA 4XVEA 4AD4A 2XGIA 4RNJA 3BURA 4YHEA 2C19A 3W7LA 1W3IA 3HG4A 3N17A 2PDKA 5CC7A 3UJEA 4QLJA 2GVEA 2WNQA 1TQJA 4C6OA 3O0KA 2G3IA 5CZ0A 1TV7A 1XI3A 5CBIA 5I09A 3ZT6A 4LVAA 1TRIA 4J3VA 2FTYA 2V5BA 2GSEA 5EU9A 1ZCOA 1PYFA 4JTDA 3VO0A 3F4DA 3U7BA 3NCOA 5LGXA 3CT2A 4B9ZA 3O63A 4A8RA 4K6AA 4XG1A 3SCTA 3GM8A 1JNEA 1TWIA 4R85A 3TNOA 3SW6A 2E0PA 5E93A 4XAPA 4MB4A 2G3NA 1YIXA 3DHPA 4DO6A 3AFBA 2WVVB 4S23A 1M6JA 2CLMA 5AZ0A 1V3HA 4BQ4A 1U33A 4UTWA 3RMJA 1GJUA 1TE6A 2A7NA 4HZ7A 4GY7A 2J62A 4XK2A 3FGCA 3BAXA 3UZZA 2D3LA 2X1IA 3ALGA 3F4CA 3W1XA 1Q2SA 5E70A 3IUIA 2D0HA 4KCVA 1BXNA 2Y8KA 4JYEA 3WLRA 2WOQA 4UTTA 2DJLA 4JL2A 1A80A 2YOCA 1GYLA 1QO5A 2FDMA 4E3VA 1QTWA 5JU6A 1XIIA 3IWPA 1QBAA 1X6NA 3HPFA 3UA4A 1OF8A 3H70A 3ZR6A 5DMNA 1SR0A 4Z1AA 2CZDA 3CM4A 3WQGA 4FB7A 2WNWA 1R9ZA 4NJGA 4MFEA 2H9AA 4R88A 3AXHA 3T9PA 2CIPA 2TRSA 1FWDC 2PDWA 3VIKA 5I3DA 1S5WA 5H91A 3RM9A 4EXQA 1QATA 1MDLA 1P7TA 5KZ6A 1E55A 2YB4A 4ONVA 1VLWA 5D2WA 2HV5A 1WZLA 5F2MA 2QMJA 4DUVA 1RSCA 2OWCA 3P6LA 2R1KA 3GIQA 1EC8A 4K8HA 1MUCA 3OBKA 2FTPA 1XINA 4BQ3A 1K7EA 3BG9A 2A2IA 4XIAA 2CU0A 4LRSA 5C71A 4B9YA 3II1A 4CNSA 5DRCA 3R8GA 1DWIM 3LTPA 4LV9A 1DPMA 5HMSA 3MKVA 3A5FA 3GC5A 4HPGA 3UD6A 3N2XA 1HN1A 1VBRA 3WJXA 3KE0A 4AWUA 5AKQA 3L4XA 4MAVA 1TG7A 4HTYA 2REQB 1CGWA 3HU7A 3GDRA 2PTWA 1SFSA 4BFAA 4TO8A 1XDLA 2D1ZA 1KM1A 4TR9A 4Q22A 3SO7A 7REQB 2XIJA 2QUNA 4I6KA 4O15A 5DRIA 3EWUA 1FY6A 3E1F1 3G1XA 3O15A 1A5NC 1GOKA 3BZGA 3CEUA 3H2EA 5AVHA 5HR6A 4DWSB 3CMGA 3RMEA 1B5TA 1IIGA 3VC6A 1EJUC 4EIVA 3INPA 3N9KA 4MF4A 2J7HA 3URQA 4P2VA 4RZBA 2KX9A 2A6NA 1FWBC 2D20A 3PK7A 1VHNA 1SZNA 1P5BA 3G3MA 3LHYA 5A2CA 5BYWA 2QDGA 3W1QA 3KVJA 2OSWA 5JBDA 1QPOA 3E2VA 1Q65A 1DXEA 2YBTA 4OHQA 4LB3A 1BG9A 5D4YA 2G3MA 4WRHA 3V0TA 3QYQA 4HSOA 2CLKA 4LYPA 3CUFA 3R43A 3KVKA 2G97A 5E0KA 1Z42A 4NNCA 1OADA 1EWEA 4NZFA 3H2NA 3M9YA 5D2XA 4EAMA 3NQ8A 1YKWA 3VKKA 3PUDA 1HJQA 1XCFA 2Y7GA 3A3XA 3TOYA 1QT1A 4HYVA 3TN6A 4YLWA 1MUWA 1TE1A 4NZ1A 4D8ZA 3OIXA 3P74A 4GD0A 4HSHA 1I1XA 3LLDA 3ZJ7A 4EE9A 2E6DA 1UZDA 2P53A 4WR3A 2G96A 2DP3A 3L4VA 2PZ0A 2PDUA 3CIXA 3HV9A 4PODA 1MRQA 3EX3A 5A8QA 4TX9A 1ZRQA 5HMFA 3ENLA 3B8TA 4K37A 1E1CA 1TREA 4MY8A 4Z2IA 2JALA 1UZHA 1NDVA 1JZ2A 3HGOA 1XDJA 2QMKA 2E6FA 3W7HA 3PHAA 1MMFA 3W2UA 1DORA 3DBNA 4UMBA 2NUYA 4NZJA 3MHFA 2CPUA 3EX2A 2WJZA 4P8WA 1NOWA 2HVMA 2PP3A 2QUTA 3EGJA 5K9CA 2R1NA 4RLIA 6ENLA 5D8WA 3BH4A 1VFLA 3KOWA 3IIVA 1WA3A 2FPTA 2QLYA 5HJLA 2J78A 2V3GA 5F2GA 1XYZA 2VFIA 1V08A 1TSIA 1K7FA 3O6AA 3BLFA 1I45A 4CU8A 1XIHA 1XSKA 4JTQA 4M3PA 4EPEC 4NJHA 4DF0A 3NEVA 2CXGA 3OP2A 1FRBA 2I5QA 5FIPA 3LG3A 1YEYA 3CL7A 2Y7FA 3KTSA 2F38A 1NP2A 1JFXA 1GGOA 1A50A 3THUA 1ZSXA 4H6QA 4X61A 1NF7A 3APGA 3SJ3A 3OOQA 1F07A 3UZYA 3KWXA 4V1XA 4FR6A 1UPMB 4RDVA 1XQKA 2XN2A 3SCWA 4EACA 1MW1A 4NZ3A 1V93A 2FJUB 1BQCA 4JFUA 3L4ZA 5CBBA 3WBWA 1BYCA 2DZWA 3WLHA 2RHGA 3P67A 3UG8A 3WQEA 3WQFA 4YU1A 1VZWA 1AD1A 3AMLA 1CGUA 3HG5A 2XVNA 1FP8A 4J3TA 3WD0A 1E72M 1GW9A 1OHLA 1EXBA 1FH7A 1E5JA 3ABZA 1V51A 2A7RA 1OFRA 3C2YA 1DJZA 4UC5A 2AKZA 5KZEA 2YPIA 4Z2LA 1G4SA 3M0KA 1MRAA 5C0QA 5I24A 3EDEA 1KR1A 3NM3A 1AH0A 3LRLA 3VIMA 1YXDA 3W75A 3DENA 4FX6M 5GNZA 2XWDA 1BKHA 2NVAA 3EWWA 1KLYA 1Z7AA 1TWSA 1ONWA 1NOFA 3W70A 1YBQB 4L1GA 1B9BA 4ILSA 1E1FA 3F5LA 3N2TA 4KIEA 2G8ZA 1KM6A 3NYZA 3PPGA 1V02E 4XIMA 4AYSA 3ZVHB 1OK6A 1NVMA 3GBEA 1IEVA 2ZZ6A 2VZVA 1TWDA 3QMTA 4DUXA 2XH0A 3QQ1A 2VVNA 3AIVA 3K2GA 2WSYA 5HNTA 2XM1A 5K2ZA 1RV8A 4EP8C 1NH6A 4MTVA 3UCQA 5E6YA 3GC4A 3PTQA 4JTCA 3WK1A 4XBSA 2VDIA 3GX9A 3BAJA 2NWSA 3OG3A 1OSEA 3CZ8A 3I3DA 4JNYA 5ENLA 4HCLA 4YTTA 1KWGA 4NIRA 3QH2A 4HKPA 5G1YA 2HE5A 5DO8A 2PWGA 3ABQA 3ZSSA 3MO7A 1XIGA 5H8UA 1GHRA 4B5SA 3ISIX 1S3HA 3NR0A 3OVRA 5CKSA 4A35A 1G0CA 5LNVA 1ODZA 5IHSA 1SVDA 3ONCA 1UKSA 5BRPA 2FQIA 4WGXA 4DJDD 4DZ5A 3BK0A 3M7WA 1QW7A 1FQ0A 4YNGA 4QBXA 1LBLA 1O68A 2VZTA 2VGFA 1OCQA 3QY6A 3SSJA 3TYCA 1F3TA 2BVWA 3UGRA 1AMKA 4RPPA 4XUYA 3GTNA 3PZTA 3ARWA 1H50A 4PUNA 4PRWA 3NVTA 2H3BA 5I3GA 4POCA 3MANA 1EIBA 2Z25A 4NZ5A 4OE7A 3GVVA 1RJQA 5LXEA 1DJNA 2BP1A 1UWAA 3AMKA 3MI6A 3GXDA 3ABOA 4UTUA 4CKQA 1PO9A 1I2NA 1K4HA 4HNCA 4NZCA 5CH9A 4HCHA 4OBSA 4PL2A 4AD1A 2J8TA 1NWSA 1AL8A 3S1XA 1VP5A 4UFKA 4G7FA 1T41A 6A3HA 4FXFA 3CV2A 5EMLA 1SJBA 3WEZA 4JIQA 1TCDA 5FJJA 1U1UA 3MSDA 4R9XA 2YLAA 1LG1A 2DT3A 3FJ4A 5EA9A 1QFEA 1R5YA 2FPVA 3BLLA 1HXJA 3IGUA 1RBLA 4UCGA 3LXBA 3M0YA 2PP0A 2W63A 3M44A 1IZJA 1YQ2A 2W3ZA 5REQB 3B8VA 5A6KA 1TX0A 2NT0A 2HNEA 4M0XA 3VD9A 4HOWA 3TJLA 3N12A 3OZPA 1UBSA 1CXHA 4C1NB 3DDMA 4G6CA 3W7CA 4H3DA 3FYYA 1BTMA 1NDYA 3NL6A 4C6MA 3VDHA 2R1MA 2TPSA 3GYCA 3KRSA 1OFBA 4BKNA 3HOJA 3EKZA 3UWUA 3O3RA 3S1VA 1Q6EA 1P6CA 4ERIA 5D9MA 5HJYA 2OB3A 2E5BA 1ME8A 4TVCA 3BGGA 4UNLA 4IPLA 3QC3A 3EAUA 4Z1DA 1L6FA 1ZHAA 1S5MA 5MKGA 2E9LA 4X2RA 3CQIA 2VEPA 4GUFA 4GISA 1H7PA 4H6RA 3ZJ6A 3RLHA 1X38A 3EMQA 4PB5A 3ZJ8A 1B3VA 3PFRA 4FP1A 5A6JA 3KCJA 5BU6A 3A4WA 1S1PA 4OWGA 2HZGA 3PZMA 4XSLA 1TFVA 2BSLA 2PRLA 1WXZA 4F3HA 3KX6A 1AK5A 4GC4A 3BMWA 2D23A 4TX6A 1C90A 4LUJA 4B5TA 4JCLA 1R30A 3E38A 2FZDA 1W56A 2W61A 3O07A 1KXTA 2QHAA 3RLGA 1E9ZB 4HA4A 3NL3A 1GKPA 3CV6A 4O8RA 4C5YA 4RUBA 4GXMA 4ZCWA 3TIMA 3B8WA 4D72A 3C5QA 5KETA 1PDZA 3G6LA 4D2JA 1TV2A 4B4FA 3WK2A 1RY8A 1FDJA 1IZCA 4I5XA 1K6AA 3T08A 3BSGA 1KFJA 3JRKA 2RDXA 3N9RA 4MVAA 3W28A 2Y70A 4JTKA 3WLPA 1EJSC 4BEUA 1BYAA 1I6NA 4G7EB 2VFHA 1JL8A 1XIDA 3AXMA 1AA1B 1MZRA 1CENA 4U2ZA 1GQKA 3H22A 3P82A 2VUNA 2F8QA 2F2HA 3A4XA 3NPUA 3VDCA 3STGA 3W7GA 1Q5MA 3RJXA 5AHLA 3VNLA 2QCFA 2Y61A 1QJWA 5HBFA 1MNZA 3WY1A 2YDAA 3RR4A 5HUOA 3R25A 2ISWA 3EA1A 4Q33A 1S2UA 4BI5A 4WEVX 3BLIA 2UBPC 1SW0A 1Q45A 3ZWSA 4JQAA 4MPKA 3FJ6A 1YE4A 4K7YA 3HIJA 5G4HC 2ESCA 3H4GA 5FJOA 3TJ4A 3W72A 2VC5A 1A5LC 4OOZA 3T0BA 2J74A 3G1DA 3TOPA 1JD7A 3V4BA 2X7VA 3EWYA 4JX4A 4MSSA 1U30A 5EMUA 2VOTA 1CTNA 3NTYA 4I7WA 3NQBA 4N6EA 1XSJA 1O6IA 4URIA 4B4HA 5HWMA 3RPDA 3GFXA 4OVXA 4CD8A 4HBKA 4YCOA 2CHNA 3ARPA 2HK1A 4M82A 1V0NA 3GIPA 3QR3A 2QCDA 3FS2A 2P10A 4RL3A 1NU5A 3WBYA 2QR6A 4MUPA 5EMKA 4AFYA 4O52A 2FHCA 2NXIA 1E0TA 3SQMA 3NL5A 3WLJA 4ERGA 3GH5A 1DIKA 3VI2A 2FGZA 3TXZA 1OK4A 1A5AA 1J0JA 3VMOA 1L8NA 3DG3A 4XTIA 1XYLA 5DXYA 1W3KA 4UQCA 1CXFA 2QGYA 3LD5A 5AECA 1XDMA 4FLQA 2F9RA 1J9YA 1XYCA 1EC7A 2EGZA 3UP8A 3GFZA 4GLEA 4GXWA 1FCBA 4PTNA 4JX5A 3W25A 1FWFC 1R9YA 2ZXBA 1Q66A 3IJ9A 4FZIA 4AHOA 4EANA 2VC7A 3LA4A 2G3FA 3WMLA 4UQDA 1FFRA 3GW3A 3O7UA 5CJMA 1J96A 2CERA 2OU4A 4LVFA 3AICA 9XIMA 3WQWA 4XBKA 4F8XA 4ZL1A 1R7AA 1E70M 1L8PA 2R14A 2D2OA 3MBFA 5G5IA 2ZX8A 2Z28A 3B9NA 4C7DA 4HGXA 1EJWC 3BGAA 3TH6A 4QDWA 3TA6A 5FA5A 2ZDSA 4Q4KA 2VDGA 5BXTA 3HFYA 3NQCA 7A3HA 1JYXA 1TCMA 3ITGA 3MCOA 4J5NA 3EB4A 1XHGA 3VNYA 1XIEA 3MV01 4B5WA 2C1IA 2YZRA 3SZ8A 3WBEA 1KGUA 4YJ5A 4E4FA 2YCEA 1FFQA 4NP7A 1VCVA 4YS1A 1POJA 4JPGA 1UD3A 4GI9A 3PBYA 1XKYA 3ONBA 2O9OA 3H24A 1PAMA 2QCHA 4P7NA 2J77A 1DJIA 3ARRA 4M6VA 2BTMA 4ACZA 2VR5A 5FEXA 3CQ0A 2HDJA 4EF8A 4NNBA 2DZSA 3IV8A 4Q6JA 2YZ5A 1I2OA 3M46A 1GTHA 1XLCA 2QDHA 4R27A 5M2FX 1TIWA 3ECQA 4UR9A 1V0KA 2V5KA 1JEZA 2VYOA 3BSHA 4Q8MA 1UZ1A 3K30A 4GQGA 2CXEA 1E1CB 2YL5A 2CLLA 5DMLA 3CMJA 4IG2B 1OFDA 3R11A 1A5BA 1QI5A 1KCLA 1E6QM 1TWWA 2X40A 3LHUA 4PMJA 2CZFA 2CKRA 3OQEA 3N3TA 5GNXA 5BMXA 2ZZ7A 3CGTA 2EPHA 2GJXA 4HA0A 3ALFA 5AHEA 1JQXA 2GJNA 2E6YA 1Y7VA 4BWLC 3QTPA 1GT8A 1ICPA 1QR7A 4XD6A 1MDRA 2FVMA 3GTHA 5EKYA 2YXOA 4LALA 4MUZA 1M53A 2GK1A 5FF0A 3APYA 1DL3A 4A3QA 4AC7C 4LEFA 4CVWA 4ML9A 3QW4B 2VO5A 3AHZA 3KOFA 2A4AA 3KTXA 2B7OA 3TA9A 5C8BB 2VX6A 3NQ7A 4I9MA 4GH3A 2P88A 2BY0A 4ZE5A 3MZ2A 1EHNA 1T7LA 2MUCA 2B31A 2VX5A 5CPNA 2BHYA 4GI8A 3MUXA 4DBSA 1XG3A 4O10A 5BWAA 2QVNA 5F4XA 1ONXA 3EKLA 3VZZA 5DXXA 3N9SA 1FWGC 4RDWA 1UH2A 4PCTA 1HKIA 1VCGA 3N6HA 3UXLA 4EAYA 2PLMA 2V5CA 3Q94A 2WHJA 1OQFA 2DGAA 4ZMGA 4S2BA 3SN1A 4Z0JA 3QFEA 3W7DA 4CNPA 4Z2HA 3TE9A 4DUOA 3B0VC 1T5AA 4E38A 3VGEA 1D3GA 2WMIB 1MXSA 5ECVA 4H2CA 5A5WA 1R46A 1XG4A 5I3HA 2WV8A 2V3EA 3TZNA 3ES7A 3FXYA 4EX4A 2VGIA 4MNJA 4CNOA 3L2IA 1LUCA 3GTFA 1X7FA 4LUYA 2YXXA 3ZS4A 3GVQA 1DE6A 4WK9A 3PVFA 5MHBA 3M0VA 2R94A 4BF9A 1G5AA 2PWVA 3SIMA 1EX1A 1OCJA 4AZCA 2GDUA 3WNPA 4M1BA 4N4QA 5BU9A 1ZL1A 2ZX5A 1NIUA 1XC4A 2PF8A 4PTDA 4JIIX 1ECQA 1YNQA 4LAUA 3AHTA 3A12A 2VDHA 1TR9A 2QUUA 3SR7A 3NM1A 3F1QA 3N29A 4W8BA 3KL0A 1L6SA 3P93A 1E9IA 5D2YA 4GRSA 5AHMA 2C91A 5CPTA 1UHVA 4LYKA 3PZOA 4KCTA 4ZTYA 5D32A 2XTKA 3PS7A 2VTFA 3ITVA 1HVQA 4XZIA 4PCSA 3VDBA 2G50A 3W6LA 4KEMA 1WXYA 1BF6A 4QJ3B 4PMOA 5IXEA 1ALDA 4ZB0A 1UMLA 1VS1A 4O57A 4PSRA 4H6EA 3QPZA 3A9IA 3B06A 4RXFA 3DYMA 3VK5A 3HJEA 1XD0A 4S1FA 1EJXC 1XPYA 1W5PA 5HPCA 4IPPA 1TPB1 2EXOA 1FWSA 1RCXB 5EMJA 1Q4NX 2OFJA 3NQDA 3TTSA 4ML4A 3QLLA 3T8LA 4NT0A 4DZHA 1JR1A 2FGLA 2BOEX 2DFAA 3W1NA 4DBDA 2VFGA 3T09A 1JCJA 1G67A 1GVSA 3W7EA 3LERA 1FKXA 4CNUA 3MP4A 2ON3A 2Z29A 2WYSA 3M0ZA 5AC8A 4DXXA 3U9IA 3BO9A 4IUGA 1GWJA 3C0SA 4J2MA 5DFAA 1CW2A 5IDZA 4IQDA 1OC5A 2OWWA 5FCZA 4MNMA 1EPXA 4MDOA 3CTLA 3RCYA 4QLLA 4O8AA 5F4SA 1LOSA 1AG1O 3O9NA 3WCZA 1IR1A 2NX1A 4N02A 3DHUA 1MYRA 1HP5A 2BB0A 3UGVA 3UT0A 3PPCA 3T4WA 1XWYA 3OQ8A 5A6AA 3K4DA 2VI0A 4WSKA 3TLQA 4GY0A 4UFLA 5U4NA 2ZZ1A 3B8UA 3MSRA 2OQYA 2DUAA 2W66A 3RLUA 2WAGA 1MO0A 2J7GA 4GZEA 4NL1A 3STFA 3WD1A 4AUBA 2CLHA 3AXKA 2Z1BA 1R47A 2RAGA 3WELA 1UR2A 1C92A 3HV8A 1U5VA 2ZWZA 1AFSA 3ABRA 3DCPA 3K5XA 2PDGA 1D8CA 4GCXA 3HPSA 4M80A 3S6DA 3MS8A 4YPJA 1KCKA 4IMGA 4AAJA 3GXPA 4O4WA 3GH7A 4LY8A 3S2CA 2V63A 3RU6A 2DSVA 4O14A 4UZUA 4QR6A 4L65A 4K36A 4Q8WA 1J0KA 1EIXA 1UP0A 4PMQA 3BCDA 1JXKA 2FJKA 3EDFA 3RILA 3U7VA 1M65A 4JN8A 3GC2A 5A2BA 1HFBA 3S6OA 2H8ZA 3TWBA 4LUTB 1F74A 1DWJM 2CYGA 1UUQA 3PZVA 3EDDA 4C1KA 4Q8NA 3CB3A 3U4AA 4K39A 4IMFA 1E9LA 4NYUA 3UWQA 2V30A 4M7TA 1W91A 4NF7A 4N9CA 4GJJA 5A95A 5FJUA 4GBDA 4B5XA 2OZ3A 1W9UA 3VE9A 1WX0A 2JFEX 4UBPC 1PV8A 3THDA 1FDZA 4C6KA 3BW4A 1CGYA 4WX2A 2J13A 3KOXA 3TDFA 3L68A 3C61A 2QVHA 2C3ZA 4XAYA 4HZMA 3RCNA 4DX3A 1PIGA 3OODA 4PUMA 1DJHA 1XYBA 3CAQA 3OLGA 3LMZA 2C79A 1W54A 3CHVA 4XAZA 4O0ZA 2QCCA 5MKGB 3QY7A 4QNWA 3P8JA 4MKVA 1X7IA 5CPQA 3WK0A 4FEZA 2VQUA 3SFKA 1KFBA 4IISA 3UYIA 4CCZA 2E1WA 2O9RA 4FNQA 1IEXA 4IGHA 4ZO6A 4H8UA 4IFOA 5EPDA 3TN4A 3W4RA 1JNDA 2XFRA 5I79A 3VGBA 1HVXA 3G0SA 4B3ZA 3W37A 4ATLA 1PKNA 3VOHA 4GBUA 3AIUA 1X1ZA 4EPDC 1LG2A 2QJJA 1ZBKA 4EXAA 2R24A 3QN3A 1DE5A 1ZCCA 3SBFA 3B9EA 1CDGA 2OX1A 1XP3A 3MU7A 1P0DA 1RAKA 2WNZA 2FH8A 3EPNA 3WD2A 3WX7A 3AMGA 3LTSA 5D30A 1M01A 1NF0A 2EPOA 1F05A 2EHHA 4LYRA 1MI3A 1VHCA 3ITCA 3Q58A 4ZGYA 2Y5EA 2QCLA 4L7ZA 1EP3A 1HKWA 4H9TA 1KFLA 3U4FA 2B7PA 2F7FA 1J01A 2Q6ZA 4RE2A 3TQ0A 5I7GA 3PNZA 3EX6A 3MUZ1 1UQYA 1BWLA 3BLDA 2JIEA 4W7WA 1DTNA 1K4GA 4D1JA 3HFTA 1G94A 4IXXA 1H51A 5M3WA 4ICCX 3G8EA 5D2VA 1J0ZA 2A3HA 3BL3A 3VDGA 5DELA 5J8LA 4QE1A 2WVSA 1W1A1 2P8BA 3HQOA 1LROA 3W6MA 4PE8A 1H49A 4GVIA 1HNYA 3WMSA 1CBGA 1FHVA 2V81A 5FACA 3RM4A 4ZTXA 4E2DA 1SZEA 1I0BA 1W1IE 4HN4A 4UMCA 2ACQA 3FAWA 3T05A 4AMAA 3B9DA 5DANA 3KCLA 3V18A 2W91A 4IFKA 5FAGA 4PBGA 2ZUTA 4MB3A 1V03A 1VAHA 4Y9MA 4W7VA 1A5SA 1B3YA 4FLOA 1GQLA 1BGGA 3WQDA 3DECA 3IJ8A 1F8MA 2HISA 4KCWA 4AZBA 3SY1A 4PR4A 4XZ9A 4EPBC 4NASA 4GUJA 1ADOA 3RUBL 4ADUA 2XIBA 1WYIA 1UD5A 5BCAA 4HPJA 1GYMA 2BY2A 1W9BM 2P50A 1KXQA 4QAIA 3WDJA 1W5OA 1RQHA 3PANA 1J2BA 1K77A 3D47A 3TROA 4L1WA 2PURA 5XIAA 4JTIA 3HMJG 1IHIA 1AQHA 1UASA 3KP0A 4Y2WA 2I57A 4WJEA 4XZNX 1ZP3A 4WQ6A 5DCEA 3KL5A 1DVJA 1R85A 3WLLA 2PGWA 4QROA 3WJZA 2E9BA 5BOFA 3BSMA 7CGTA 3CAVA 3W85A 4TOQA 1B9ZA 5CZJA 5AZ1A 3RITA 4WDTA 1TVLA 2G5WA 4E8DA 4OV4A 1SFLA 3BOXA 3GHSA 2P5NA 4X0VA 4O1DA 5LIWX 3AMCA 2EG7A 4WHBA 1QPRA 4A2RA 3CB8A 2E28A 4PMUA 2DT1A 3WEMA 5U7SA 4Y9NA 3BLEA 4WY0A 3T6CA 3P8IA 3MKCA 3LV5A 3TCSA 3EEZA 4H01A 1SJCA 2ZE3A 4R5EA 4GYFA 1G1YA 4OOUA 3S83A 3R0KA 1LORA 1NELA 3QY8A 4RNFA 2PDNA 1YXYA 4K3ZA 4FLRA 2PWFA 1GONA 4MLRA 4F66A 1VFUA 3GB6A 2ZRWA 3U3HA 1UIOA 2OJPA 3VZXA 3BTNA 3QZEA 4JQ1A 4ZO8A 3NZ1A 3EA3A 2FLIA 2YFNA 4LOCA 3C8NA 4LAZA 3GHRA 1OC6A 3ZT7A 3KOZA 5B7YA 4LYQA 5T9BG 4G1NA 1ZS2A 3OGSA 1ZJIA 4JN6A 3NQ6A 1TMHA 1EJVC 4X60A 1JJKA 1KB3A 1W2VA 1MW0A 4PUUA 2HS8A 1HJSA 1PCKA 4BEQA 1QASA 3M41A 3NDYA 3FVDA 2DQWA 3KLLA 4P7RA 2XFWA 4TVDA 2F6KA 4ZFMA 5HMDA 4LU0A 1RK6A 4IQEA 4JR5A 1A53A 5BWFA 4F0LA 3MUCA 1ZB5A 3HB9A 1BSIA 1SFJA 4JEQA 1QI4A 3ITTA 1XH0A 3WENA 3IIXA 1IT8A 3KHDA 1DQUA 1RQBA 2XN0A 4RDZA 1TQXA 3H55A 1I2PA 3CZEA 3U2CA 4F2BA 1NFBA 1H4PA 3R5EA 4BY3A 3W87A 1TJPA 3LBOA 3WDRA 1J8VA 3S5ZA 1OG6A 2DVXA 2F2KA 1NWUA 2IKHA 3S1GA 4IX2A 3QJAA 4CD6A 1B90A 2Z26A 1HL2A 1S2CA 4L4OA 2GJXB 3W83A 4KBXA 5LIYX 5C7HA 1K70A 3BGJA 4UNIA 1NEYA 2NVDA 1FWWA 4NJJA 1IGSA 1V3JA 1R0MA 3R12A 3FA4A 3RPMA 2G41A 1M41A 4S3CA 3M5VA 1ZTVA 2R91A 1EDTA 4FX8A 4QG8A 5I06A 4L9ZA 1M5WA 3ITOA 1ITQA 2ISSA 2PC4A 3W7QA 5A6MA 1M7JA 2XVLA 3NEHA 3RG6A 4XWUA 1M7XA 1UPPA 4RNIA 2PDJA 4Q4OA 3R8HA 4HYWA 1FH8A 3S5OA 4KEZA 1V6UA 3KOYA 2DPEA 5D38A 3LUTA 4N9DA 4AZ7A 1OFQA 2KZHA 2ZXAA 4XUGA 1KTNA 4OTKA 4E4UA 3OLDA 2AL2A 1AUSL 1UJQA 4UUIA 1MVYA 2JBMA 3TFCA 3TAOA 4HMCA 3F03K 1XYAA 4JTFA 4W93A 3Q37A 1W9VA 5LZLA 4TX8A 1VFMA 1L2QA 4DXVA 2XH2A 3BW3A 2BHZA 4I8YA 4R33A 4FF5A 4Z0SA 2GOKA 3UQNA 1SZRA 4D9PA 1PHQA 2XJ7A 1IIHA 3MW7A 3VCRA 1OYAA 1XLJA 3WDQA 1MFVA 1A3HA 1JRBA 3SADA 4PMXA 4FI4A 3P0WA 3QF0A 1RHCA 1RJRA 3PWIA 2Y0FA 2J7EA 1QW8A 1G01A 4JKLA 3UWYA 3CS2A 4LAOA 3WQ5A 3K8LA 2DZAA 1V3IA 1ENUA 4ORMA 1TTPA 2RJGA 4QSHA 3H23A 1LJYA 1PZ0A 2WVVA 1KRAC 4MYXA 4C7FA 3BPWA 1YPIA 3WLNA 3I4KA 1U83A 3LZ5A 1J79A 3G8RA 1PIIA 3CPRA 4L64A 2YJQA 2JQXA 4O1CA 1XGDA 1V7AA 3UVAA 4UTKA 4WGHA 3MZNA 2OYMA 2H3DA 4NQ1A 3C4UA 1JDDA 4FIRA 3QGAC 4L80A 2G4FA 3CASA 1YDOA 3SN4A 4KGLA 3T8QA 2HTMA 3C2RA 5IBXA 3GG7A 2D2GA 1PXGA 1AMYA 2WC3A 1BEUA 2HXUA 1TJ2A 3TONA 2ABAA 1YHTA 1RVGA 4S3EA 2W67A 3L7RA 3A6OA 1XRTA 3IRDA 4K1WA 3IEBA 3QQWA 1WDRA 3VA8A 3WLOA 4IP7A 2VC9A 1UBPC 2ZX7A 2OSXA 1KD0A 3PG9A 4OBTA 2X0YA 4R7OA 1XBXA 3UY8A 3DX5A 3H21A 5BMWA 5LNUA 3GVWA 4MZYA 1R86A 1VGAA 4K38A 4C6DA 1VD6A 2DIEA 2XGZA 4UFMA 4QTGA 1QOQA 2ACSA 3TZFA 3CK5A 2GVYA 3GW0A 2INZA 5AYIA 3WLMA 4GNVA 3PP7A 3UZJA 1TV4A 1RPKA 1S2WA 3L9CA 3W71A 3G1HA 1A4MA 2VHLA 4QS5A 2HEJA 2JF7A 1QI2A 1M7OA 1BG4A 2C14A 6XIAA 1LOLA 1AH3A 3ZVIA 3K13A 5C54A 3DHFA 2LLEA 4JDYA 3P81A 3QXBA 1XH1A 3W7JA 4ADTA 5XINA 2PLKA 1VBUA 1K3UA 2JKAA 2POZA 3CUXA 4ZODA 1U1JA 3XISA 1W5NA 7REQA 5CC3A 1XYMA 2WPGA 2QAPA 2YYTA 4JYFA 3URBA 1BWKA 1CXKA 2DZVA 3G1SA 3VNJA 1ZPTA 5CJ5A 2DZBA 1HO1A 3W2LA 4RX0A 3KRBA 4J3XA 3A47A 3TN5A 3N4EA 2X30A 2E5CA 3TC6A 3ATYA 3FAXA 4XX6A 2YW3A 2NV1A 2JK2A 4DJDC 3UPBA 4AU0A 4HYRA 3N34A 4GFIA 3DH7A 3SB0A 5LA0A 4HPXA 1E4LA 1PZ2A 1NWRA 3KXQA 3HGJA 4XTDA 4Z1CA 2TODA 1GQIA 3H7RA 1XCWA 1XSIA 3RAOA 4FNSA 4PTVA 3SCUA 5LIKX 1FWRA 3DHDA 4B16A 1SO4A 4UTHA 1TELA 2PDCA 4PB3A 2RDUA 3BV4A 4Q4MA 3W2NA 4KW2A 2Q09A 2GGJA 3I10A 3PBGA 2Y7EA 3KRZA 1JUBA 4XAGA 4D6JA 2PA6A 3H4WA 2G3JA 4HK6A 5A8GA 3W27A 2PTZA 3LQGA 3FKRA 3HPAA 1HL9A 3AXXA 3H7VA 1DQXA 4GPNA 4H9VA 2WWCA 4UOQA 2X2YA 2PDYA 3MJMA 2ZKMX 5TIMA 4E5TA 3FOKA 3GR8A 3TEVA 5HNUA 3V0UA 3W26A 6CGTA 3WQ4A 1VFOA 2EPLX 2WJDA 1GVQA 1PZ1A 3EOSA 2Z0IA 4M5PA 1PZ3A 1JF6A 3LBMA 4PN2A 3QW3A 1XGZA 3VIFA 1TJ1A 4NUWA 5EFFA 4KEVA 2Q3OA 3V0SA 3MUIA 3E6EA 4JXCA 1VKFA 3HQNA 1EA0A 2QULA 1SW3A 2BOFX 1QK2A 2CW6A 4JTJA 1Q7ZA 2XVGA 4GUHA 2WHLA 4A3HA 5JMUA 1IGWA 4O13A 2QPSA 3T07A 3FVMA 3KCOA 4L4LA 4EPKA 5FSDC 1EGMA 1A5MC 3WLTA 2W62A 3T78A 3UW6A 2WBGA 8RUCA 3AU6A 1MEWA 4LFYA 3VNKA 3NFUA 4R9OA 5BXSA 4CVUA 4FALA 4IMEA 2XFYA 3EKGA 2J75A 4QX4A 1RD6A 1Z8AA 3KDOA 2OT1A 3S2NA 3BE7A 3DN5A 1J18A 1X98A 3OB8A 1W9DM 1O94A 1PUDA 1RP8A 3ANUA 1WDWA 2IPJA 3WBAA 3BMVA 1BSLA 4Q8OA 3BLOA 3GY1A 1SM9A 1FWEC 5T26A 5C2CA 3L4WA 1TA3B 2X1TA 1UW9A 4DBEA 4DB7A 1RR2A 1TTIA 4OQVA 2ISFA 1FH9A 3ANYA 3S5NA 4UQEA 2ZCGA 3CH9A 3LENA 3VMPA 3B3DA 2YFOA 4YTRA 3AYRA 3W82A 4N6FA 4FXSA 3C0LA 3T55A 1CWYA 3UWVA 3LNPA 2XVKA 1O12A 4RR4A 4AMCA 2AGTA 2A5HA 3FA5A 4L6DA 3LPOA 1MWOA 2R82A 4BS0A 2NQ9A 3GK0A 4HB7A 5BRQA 1J0HA 3MO4A 2VD8A 3GAKA 3WDPP 1ICSA 1DV7A 3PBMA 1ITCA 3KBVA 4O54A 5A6SA 3EXRA 2QT3A 2G37A 2HVNA 4D6FA 1U5JA 4GH1A 5E09A 1KNWA 1BTCA 4O50A 2BVDA 3QKEA 3UJ2A 2W5FA 1KFKA 3G0XA 5G4WA 1EQPA 2H8XA 4FSAA 1GYNA 5G2IA 1PS9A 1VEOA 4G2DA 4IPNB 2DDXA 1TB3A 1W8GA 1VEPA 2DIKA 1Y5WA 1Q6OA 1XRFA 2Q8XA 3HZ3A 3IJDA 4QJ4B 4Q7NA 3WNKA 4B5VA 4YTSA 3GDMA 3C8FA 3FK4A 4O1FA 2PDMA 4ZVJA 1SUXA 4W5UA 2OG9A 1NOUA 2YCIX 3DFOA 5K9DA 1XFCA 4IFKB 4Z2JA 1CLKA 2YB1A 1N2VA 3VKDA 1TPWA 1U22A 2VEIA 3W6YA 4DNMA 1FA2A 4AZHA 1YBQA 4MGGA 2C1HA 4IJBA 3LMYA 3EOUA 1FWNA 2J9ZA 3D3AA 4IGSA 3QPYA 3WD3A 4WKFA 3NQ2A 4GHRA 5AYZA 3F4NA 1DWHM 3E5PA 3VD3A 5D9OA 3EDJA 3LCFA 4K8EA 1AQFA 1UYQA 3S3GA 1Q2RA 4OUEA 4UTJA 3R7MA 3ZVHA 2X16A 4Z1YA 3LGGA 1UKQA 1PX4A 3G1VA 1LQAA 2ONEA 4ZO9A 1N8FA 3LBCA 2DJXA 2FVLA 4IQLA 2PBOA 2PWUA 4XD5A 4AY1A 1XLBA 4ATWA 2FFCA 1EL3A 3LXAA 4M81A 5CSRA 4KRTA 1E43A 3N4FA 1H7NA 1EZ2A 1QO2A 5MF5A 4DI8A 4EWJA 7TAAA 3KDNA 3VDAA 2DU2A 4JIRA 4MJ2A 3IANA 4Q8QA 2DSUA 4P7QA 5CPLA 5E1QA 1KRMA 4E4PA 3HG3A 1UC4A 1QNVA 1SR9A 3A9BA 1CX9A 4PA8A 3PNUA 2CHRA 2Z2AA 3ZFHA 4AHPA 2PD9A 4HJFA 3CQHA 5ABTA 1AODA 4M29A 1KXHA 4JFWA 3BXWA 3QSTA 1JYVA 3M5YA 1R38A 1ME9A 1XLIA 2QIWA 3NPXA 1E9YB 3H26A 4TIMA 2ZZ5A 3I7QA 4ZO7A 1X6UA 3VNZA 2JF6A 1CGXA 2OTDA 4MKSA 3ATZA 5A1AA 3CL8A 3GAYA 1W3HA 3UR7A 4B91A 2Z4GA 1P0BA 4Q7BA 1BAGA 3NVDA 3L4UA 1TZZA 4XV0A 2Z1KA 1H0IA 5CC5A 2FHBA 4GYPC 1C7TA 1GOQA 1DKWA 1YDYA 1AZ2A 1W3LA 2ZUSA 3VUSA 1LBMA 2WWDA 1UA3A 4IP4A 4ZOBA 4E2VA 1SSGA 3GS6A 4WIWA 2P76A 4XB3A 2A3EA 4C6CA 2I56A 4GIAA 3VAVA 2HS6A 3FYPA 4Y8FA 4W9TA 3U2EA 4IICA 1EFZA 3V7PA 3PTDA 4HHMA 1OIFA 1QNPA 1F9CA 4WY0F 2Z7GA 4KH2A 1CXEA 5KEZA 3KP1A 3S8HA 1NP0A 3CEPA 1MEIA 1H7RA 3O0FA 2JKEA 5BW6A 1G7UA 3NWRA 1LTDA 2BMBA 3CH0A 1KRCC 4C6NA 3TNBA 5REQA 3THCA 5A6LA 1PKMA 5BOEA 3N19B 3NOEA 1G69A 2HE8A 3W38A 1GCYA 1WCGA 3IJQA 5G2HA 4BJHA 3R10A 4AX6A 1FOBA 1UD2A 2BWGA 4CCCA 4LXFA 1B1YA 1GPFA 3QV9A 1OIMA 1EUNA 4MY9A 4ZSUA 1A0EA 4XBJA 5E0FA 2OQLA 3AU2A 1KQZA 1OCNA 3CAWA 3ZXWA 4FA3A 1QHZA 9RUBA 1UIPA 2ANUA 2WSKA 5CQ1A 2C16A 4FPSA 1SFTA 2QF7A 4CD4A 4ZB2A 2KAUC 4YYFA 2EKCA 1OG0A 2ZDRA 3MVTA 3JR2A 1QRQA 3MYOA 4OJYA 3TW6A 2HCVA 5LIUX 1PJ9A 1G6CA 1KM2A 3J7HA 2A79A 1XS2A 4DJED 4O12A 2PP1A 2PFHA 4MZ8A 4XD3A 4I6VA 2AL2B 4RV8A 2V2HA 5EB8A 1Q6RA 2WKGA 2E8YA 4M19A 1W3JA 1S2VA 1R2TA 4N42A 5HAOA 1MQRA 5DX7A 3WLIA 4Q6XA 3LPFA 1REQA 3RYSA 3UA3A 4Z17A 5I00A 1CLVA 1ESWA 3QV7A 2AQOA 4F40A 4LH8A 3TYZA 3AMDA 3P61A 3KLKA 2BS9A 3WQ6A 2I17A 3JZUA 2XGBA 1UOKA 3I7SA 4V28A 4E2OA 1W1ZA 3P84A 2YSWA 4S3BA 4AZ5A 3AWOA 1LQ2A 3ICJA 2IXVA 2ZYFA 3RRXA 1K6WA 1WKYA 3OW1A 3L2LA 4YN5A 3UNDA 3NSMA 3G3DA 1P1XA 2NQLA 4AC1X 4G7EA 4YCPA 4GYKA 4US6A 5DY3A 1S1RA 2YIHA 4FS9A 3E3HA 2XWEA 7ENLA 3T7VA 2WLZA 4GZIA 1UR4A 3MWCA 2QNEA 4OFCA 4S3FA 5IOBA 1PDYA 2QJGA 5E6ZA 4XVDA 3I3EA 1KBJA 5D2TA 1SZGA 1BXCA 3VIJA 3GDLA 5I03A 1YW1A 2NZLA 1BXBA 4WCJA 1JFHA 1GEHA 3Q67A 1VYSX 3W1PA 4KMQA 1EF3A 1MZHA 1JPDX 3S47A 2OOFA 3AO0A 1OFAA 4EK7A 2A85A 4CGTA 1IXNA 2OO6A 1OX5A 1VFFA 4WOZA 4Y6GA 1TIMA 3CWHA 1JF5A 5DCDA 5FJIA 5EMYA 4PUDA 4E0CA 4HN8A 5C2GA 1HJXA 3E96A 4I8DA 3ME3A 4NAEB 4DAIA 4U28A 4B3KA 3TLLA 5HXMA 4JBRA 2WBKA 2GJLA 5FF7A 2C15A 2PRHA 3MJYA 1XPGA 1PL9A 3CQJA 2IKIA 2JEPA 1T99A 1DWAM 2X42A 3WK3A 1RH9A 1XLDA 2J7CA 3DFYA 2PBGA 4OKDA 1CNVA 2P3ZA 4J40A 1ODUA 1Z44A 5AOUA 3BUVA 5JBFA 3GG0A 3KZPA 4O53A 1Z48A 2V3FA 1ZJBA 1RLCL 1UWQA 4FOUA 4M6QA 2E68A 3LN3A 2GJPA 1DEDA 2QDEA 3HPZA 3M5ZA 2Q8LA 4BQ5A 4BI6A 1MW3A 4GX9A 3G1YA 3NPVA 5IHRA 2D22A 1C8XA 3S46A 4Z2KA 5EL1A 3U57A 3G18A 3MT1A 4IQJA 2GQ3A 1E1EA 2Z1XA 3VE7A 2CBIA 3WG6A 1VRXA 5KZDA 3REQB 4HTBA 3RGTA 1KW1A 2NX3A 2PGEA 1P4CA 4JHZA 2J24A 4ECLA 4GACA 2X1UA 3VOFA 4A21A 2HROA 3VFCA 3VMNA 2TAAA 1R87A 1XRVA 1IE7C 2DVUA 1LLZA 3WBXA 1JCYA 1UR9A 4KWVA 5I23A 2BGNE 4GOAA 4A22A 2CC0A 4HD5A 4GZJA 2GWGA 2W4XA 3MMUA 1OEPA 3LM7A 1BYDA 2OLHA 2HXTA 3OGRA 2QJMA 2NV2A 3T81A 2CFFA 4AY7A 3D3FA 1F76A 1VJZA 1VPXA 2ZZ2A 4UTFA 2Q02A 3M5XA 3VFLA 1OFEA 4AQLA 4UTIA 1GTEA 1ZAIA 4AWEA 2AL1A 2BFGA 1S5VA 3FEQA 4MY1A 3USBA 3CZJA 1UZ4A 1R3WA 4JFSA 4ZXLA 2C71A 4Q8TA 3HM7A 4P5UA 3QKZA 5L9FA 1KBIA 5GQBA 1P0KA 3W1UA 1U5HA 4AW7A 1H1ZA 3POCA 3CUJA 1QPQA 1BKSA 1Q7QA 3T0CA 4N7QA 3BOLA 1CT5A 2NSXA 3EWXA 2OEKA 2V38A 4LTSA 3GXNA 4CQ8A 5DMMA 3W00A 1GZGA 2EPKX 5AHFA 2CLEA 4IG2A 1Y0EA 2ZOXA 5AHNA 4D6GA 2XISA 3BV7A 2IKJA 1XL9A 2GGGA 4GX8A 2GSHA 3H8AA 2V8ZA 2ZQ0A 1SPQA 2EO7A 4NKCA 3SUTA 3KBWA 2GQ8A 4MDPA 5AC5A 1K8XA 3LY0A 1O4UA 3SDOA 4DELA 4O18A 1DQWA 4MJMA 4WD0A 1R3VA 3S2LA 1X8FA 4JHOA 4Q8VA 4PUJA 1AD4A 3FIGA 5EGRA 4QSFA 3TMQA 1IXPA 3ZZ1A 1GVFA 4LCQA 1VJSA 3CL6A 4KFNA 2WC7A 3G0UA 4DPPA 4MNLA 1GZ1A 3AUJA 5K9XA 3C3NA 3OU8A 1QUMA 1I9CB 4ICNA 4J7RA 2PUZA 1WDPA 1XYFA 4WUIA 1GNXA 3N2CA 4PL1A 1RBOB 3TC7A 3JW7A 3PZQA 4R53A 4RCXA 3AS2A 3V75A 3MI3A 4ZR8A 3G2GA 4PEKA 4LV4A 1D7FA 3SUWA 2GUYA 3HPXA 1US0A 4QCEA 4EF9A 4MWAD 2BY3A 2GVLA 3L5MA 3ZLHA 4ZQPA 3HQPA 4KS0A 4G56A 1E15A 3WNOA 3TQPA 4MNKA 2QS8A 1RA0A 2FZ9A 4IJRA 4LQ1A 2PWEA 2CEQA 3OEXA 2WMIA 1HW6A 3KZSA 4O1AA 1ZALA 1XGEA 2ZUVA 1KM0A 3R0DA 4V33A 3QMSA 3R89A 1G4PA 1GEQA 2BZNA 4NI3A 4I3GA 4W88A 4UNKA 1K9FA 3FNDA 3DFPA 3N11A 5A8NA 2WKJA 4JIPA 1TRDA 3CLMA 3B9OA 4PTXA 4BF7A 5JBEA 3USZA 2X8RA 4REQB 3URAA 1UKOA 4ZBCA 3P80A 4BK9A 5M5DA 3GYEA 5HINA 2VNCA 1OY0A 4TXEA 1V3LA 3LCHA 2D3NA 4HK7A 3UJSA 4UMAA 1EF2A 1I75A 3PSVA 3T0DA 2YR1A 1WOAA 4BA0A 3OVPA 4CQCA 2NXGA 1PB0A 3E0WA 3M4HA 2BOGX 2YDQA 5CZSA 5HQMA 2J7BA 2CITA 2Y1HA 3DESA 4GI6A 2VM8A 1JAEA 3XINA 2XN1A 4JTAA 4P8VA 1QK0A 4UZSA 1QNRA 1CYGA 4AEOA 5E0CA 2RFGA 3N18A 4S3KA 1CCWB 1TUXA 4NNAA 4DF2A 1XBYA 3IJIA 1GVRA 1TTJA 3NSNA 4HT3A 3WNLA 1K9TA 1T96A 1PBGA 4P8XA 1HX0A 2NSOA 2YCLB 1J11A 1H61A 2INEA 3WNMA 2PDLA 2WVTA 2PB1A 3LOTA 3CJPA 3HF3A 4X9SA 1OX4A 4RW3A 3ZWTA 4R7WA 4L6OA 2EQDA 3KBJA 1C8YA 3AYTA 4GFSA 4IPIA 5D9PA 3NZQA 3A13A 2O0TA 3ABXA 3SUVA 4DJFA 2ZTJA 4PYSA 4D1IA 3MCNA 3F7JA 3IAPA 1XLEA 3EXSA 4YWSA 1SSDA 1Q6DA 1ONRA 1PE1A 1XUUA 1IQ8A 1L6WA 1LLOA 2AAAA 3CO8A 2I9UA 5I02A 3FSTA 4MOZA 4B5UA 4ZENA 2E67A 2OLSA 2V0TA 1QW9A 2CLIA 3CU2A 4I7VA 5F7UA 1OVDA 1XFBA 2O7SA 1R2SA 3AOFA 5CC6A 4MG4A 4LRTA 3DFHA 1NARA 3H12A 1OGBA 3FDKA 2HMCA 4PCFA 1EGVA 1TZ9A 2ZRYA 4IMDA 4O4VA 2ZRXA 3MP5A 1UUOA 1IZKA 1JPMA 4RW5A 1FUYA 5BROA 3DGBA 1UCWA 1XLAA 1VCFA 2GWNA 3M16A 5FESA 1DP0A 4CNTA 3MPGA 1H1NA 2O4QA 5A94A 3ORWA 1TPVA 1E71M 1YRRA 1QOXA 2HRWA 2QXWA 5SWUA 3H54A 4JTUA 3W7MA 3ZYZA 5M1TA 1BHGA 4L56A 3E12A 4AF0B 4H7ZA 1KTCA 5I0DA 1W5QA 4C6LA 1BLIA 2VZUA 1T6MA 5LA2A 1RVKA 4WJ8A 1D9EA 3WH7A 4GYJA 4FX7A 3UY7A 3PJUA 4LUTA 4YVVA 3PPHA 3KBSA 1MUMA 1OM0A 1FWIC 3TJXA 3C0JA 3GO2A 4M8UA 3VIHA 2WMJA 2RDWA 4J1OA 1Y8BA 1L6GA 1HL8A 1MXDA 3EX1A 1JQVA 4DZAA 1O60A 2CBVA 3BAYA 4ORIA 4OZOA 2BGQA 2V2CA 3LU2A 2CLPA 1CGVA 4LWWA 1FXQA 2GVJA 1VLIA 1OT2A 1KQYA 1DIOA 2I16A 3DYPA 3UG4A 4PTWA 1OJXA 2FFIA 3TTYA 4N9BA 4J9JA 5M03A 3KBNA 1SQ7A 5T9CE 3QSRA 2CLFA 2Z00A 1V6WA 2H6RA 2X1RA 1KC7A 2VFEA 4PH6A 1ZY9A 2J79A 2P8CA 4MKNA 4ZOCA 4XZMX 1CGTA 3QMRA 3LX9A 4W85A 4M7SA 1YNPA 1XX1A 4OUIA 2ZA2A 6XIMA 1JDCA 4GINA 5D03A 3UVIA 4PSPA 2ZX9A 4GJ1A 3CIWA 1Q8JA 1JDEA 4IH3A 5BOOA 3UPMA 1PCWA 3BG3A 2DZUA 3DFQA 2PDXA 2WZTA 3A22A 4DWSD 1KM4A 2AOSA 1C7SA 2OQHA 1PTAA 3CYJA 3GFYA 3I6EA 3C6CA 1VBGA 2IPFA 3WFAA 2Y7DA 4X9YA 2JEQA 1REQB 4GKLA 1N55A 5TBOA 3VD7A 3VD4A 5C9RA 1LL6A 4H1ZA 3D6NA 5F4WA 5CZKA 1LZOA 4PCNA 3STPA 4WJXA 2OKTA 3V1PA 5JXQA 2ZUUA 4JEJA 4TMBA 2OODA 3A3HA 3U6WA 3MSYA 2Y4SA 4NU7A 4QISA 4GGHA 5DY2A 5HWJA 3C3UA 1B31A 2YKKA 2NQ5A 1UP2A 5F1UA 4INFA 1XLLA 2XPKA 1J0IA 3EWCA 2BXYA 4ZB5A 3DU0A 4GXPA 3VU2A 2RGLA 3W74A 1FCVA 3MSGA 4QQUA 4KWSA 3NO3A 1XV8A 3TW7A 2ZA3A 1A5OC 4KRZA 2F6XA 3QV8A 1B54A 1TV3A 2QCMA 3EOOA 5TQLA 3QOMA 1X1NA 3TSBA 3S9YA 4MWAE 3RR1A 3M0JA 1IWBA 3O8AA 8XIMA 2Z2BA 1UROA 3WYZA 4WDUA 3ZLFA 3P60A 4GGBA 3OTRA 4IM4A 4YTQA 3M07A 1TUFA 1GUVA 2Y24A 1C91A 2FZBA 2BODX 3NXFA 3MHUA 3EEGA 3VCCA 3DGRA 4MYAA 3LQLA 1O66A 4GVFA 3GSMA 3TQVA 4UWMA 5AC7A 4AZIA 1OZMA 1WOBA 1BWVA 2G0WA 5I2UA 4HMNA 2YCJA 1GORA 3TC3A 3TTEA 3GRIA 3PF3A 3RDKA 3QHMA 3M0LA 2ZUMA 2Z2UA 4AZ6A 4JKMA 2VENA 5FEPA 4D6HA 2Y85A 1LYXA 1XUZA 1JGMA 1F4AA 2VCCA 3C2FA 1ELSA 2QCEA 2VD9A 4QE5A 1LT7A 1PTDA 3TMLA 4PMYA 5EY5A 2HNHA 3WSUA 5LXXA 3MTWA 5C9WA 3VTRA 2EG8A 4FNPA 5I3KA 1RALA 1M04A 1GVIA 3EB3A 2C0HA 4MADA 5C9UA 4JCMA 4PGLA 4JGDA 2E25A 1YLVA 1KV8A 2RDTA 2J9XA 4DBUA 4C5ZA 1W17A 2A0NA 3GG8A 5D05A 3G22A 5GJNA 1BYBA 3GHTA 2FMNA 3EB2A 4Y90A 4DLMA 1PX8A 3BC9A 3FDGA 1VJIA 1HG3A 1HP4A 4W8AA 3UEQA 5DMYA 2J8GA 5FD0A 3PB2A 2PSNA 3NDOA 1SMAA 1FWHC 1YX1A 4DM2A 3GR4A 2C18A 2Q3RA 3QHOA 4Q8UA 2ZZ3A 4PMVA 3HN3A 4KFOA 3ELFA 1Q6FA 1Z3NA 1YADA 4EKJA 3AZTA 4C6EA 2OO0A 4H8HA 3TV8A 3DUGA 1LL4A 1JCNA 1QOPA 2WZMA 5CLWA 4DO7A 3ITLA 3SSZA 1XQLA 1PPIA 3T40A 2PU1A 3EOLA 3BVJA 3W2JA 3NQFA 4CNNA 3GH4A 2A3LA 3LXCA 4IZGA 4U3AA 3OG2A 4XSMA 4KWOA 1CZ1A 3TK7A 2ZIDA 2OT0A 3IPWA 2Z24A 2D24A 2B7QA 1DHPA 1EOKA 3NO5A 3R8RA 1LWIA 3UXAA 1LQ0A 3W3OA 1UKTA 4NY2A 3PSWA 4ZOAA 5FF4A 3SURA 4Q7IA 1W8SA 5KITA 5D37A 1IYXA 3WLKX 4LNYA 3FLUA 2WJFA 4K2SA 2NUWA 4Y8EA 5CPSA 3SEPA 2AQWA 3QHNA 1J0YA 3VIPA 4DIAA 2C13A 1UOZA 4CUCA 3W1RA 2VX4A 4OIFA 3QYSA 5LKYA 3VABA 1W6TA 3UYCA 5G1TA 3VD5A 4HJWA 5IRPA 3LDVA 4YL2A 1DJQA 4MJ4A 3ZR4A 5DLCA 3O16A 4WSJA 1F3WA 3HTWA 1KRBC 8TIMA 3C86A 1WKDA 3WF2A 1AL7A 5DF0A 5FF2A 1I2QA 2OZTA 4AYGA 4GZ7A 1FKWA 2IQ0A 1ONEA 3QFWA 2PD5A 2QQ6A 1BF2A 3WO8A 3U2ZA 3WJSA 3CV1A 2ZTKA 3WQPA 1YDNA 3SY5A 2ZVRA 1RLDA 3N15A 4AH7A 6REQB 2FYMA 4MB5A 1EH9A 2HQAA 1VFHA 1N7KA 5LHEA 4ES4A 4LAKA 5I3JA 3PR2A 5FJPA 4I5UA 2SFPA 4DM1A 1MQPA 1AQ0A 3T4CA 5L6UA 3IACA 1WAUA 1R8LA 1NY1A 1XLFA 2I5IA 2AKMA 1AZ1A 3FYOA 6TAAA 1SMDA 4FXJA 2A3CA 2PE4A 2EAWA 4IIGA 4RZ6A 2G95A 2O4MA 1YPXA 1TKKA 3BZJA 4DRSA 4HU0A 3MDWA 1V4YA 3CHFA 2YDSA 1I4NA 1F7BA 3EMZA 4LNCA 3O6CA 3CXOA 2PS2A 1LRQA 3OJGA 1HKMA 1W3NA 1Z69A 2GQAA 4NX0A 1VEMA 1J2WA 3EPMA 1B3WA 3BAIA 1ZUAX 2D69A 3GU9A 1W37A 2V5DA 2VFFA 4TVUA 3UZXA 2WM0A 4DQWA 1WKEA 3GNDA 4UTLA 2QDDA 1EX5A 2WCAA 2QUMA 1CPUA 1LT8A 3W07A 1E4IA 4F2UA 4BF5A 3PZUA 4C91A 1JYWA 3V36A 1XR2A 3GU2A 3WH8A 1XIJA 2E5DA 3AHVA 2DH3A 5CEWA 1GK8A 2YLLA 1JUKA 1P6WA 3NXLA 4N0RA 3M0XA 3RM8A 1WV2A 1DXIA 3I3BA 1IT7A 2FTWA 4KQNA 1XICA 1JI2A 1X96A 1GJPA 2XUCA 3QGVA 1XC6A 1DYSA 3EOEA 1EO7A 4X22A 5AB3A 4ZSTA 5CXPA 2E6AA 4PZVA 3CNYA 4M6PA 1UP3A 3IGSA 5DT5A 3GDKA 4Z42C 1OZQA 4H04A 3W1MA 5AC4A 3KVLA 2GVGA 4AX7A 5LGZA 5FF3A 3E0IA 4J35A 1K8ZA 4HMEA 4AD5A 4GIEA 3SI9A 2CNCA 4PEEA 2I9EA 1WBHA 3POHA 1BVWA 3U48A 1D3HA 4JX6A 3WF3A 1ADSA 1EKOA 3SIZA 3M6DA 4HHHA 2ICSA 5D02A 4U3CA 5CSUA 1DHKA 3M43A 1OX4B 2VEGA 5T8GA 3CC1A 3SRFA 4EVZA 3LV6A 4GQ0A 5DN1A 1RPXA 4HP5A 1CI1A 5C6MA 1GQNA 1FHLA 2VEKA 1WZAA 3PJXA 1QNOA 5H6HA 3GG1A 1VFSA 3NQMA 1YMYA 1VF8A 3L67A 3L12A 2CKSA 2J47A 5IM51 3NO1A 4ZOEA 3GXFA 1OGSA 4KETA 3AZRA 1EZWA 1B4EA 3MKKA 1ISXA 4GVGA 4FHAA 5G1MA 1WPCA 4JTEA 3QBUA 2E9MA 2YA0A 1GJWA 1Z89A 3MV11 5CPMA 2RH9A 3D0CA 3TP4A 2VCBA 1B3XA 3PN8A 4Q8PA 4JY9A 1Y5XA 3H2AA 1ZENA 1E6ZA 2OKOA 2X05A 1O1HA 1YTEA 4C6FA 3V5CA 2QJIA 3UFYA 2YXGA 1DIDA 4U4MA 4H9XA 5EBAA 4XKYB 5CG0A 4PC8A 1ISVA 4LUSA 3HURA 1L0PA 3O06A 2FVKA 2AGKA 1JCLA 1ZBVA 4GA8A 3LEPA 4JD4A 2DV0A 4CQBA 1XLMA 3D5HA 2UV8G 3FW6A 3ARTA 1R3SA 4L61A 4QJ1A 4JTRA 4XAFA 3TTQA 4QAWA 3RX2A 2E40A 1CB2A 3AAMA 4PBFA 4IJCA 1S38A 1TMLA 3VUPA 2WMKA 5HA7A 2XH4A 4A29A 2WJEA 3GZAA 1SJAA 2DUZA 5CAKA 3UR2A 4W87A 3CHCA 3F4VA 4WDWA 3GNRA 4HNUA 4IL0A 1TPDA 1PIFA 1E3ZA 3EMCA 2AQVA 3MVIA 3GVRA 3P3BA 2Y89A 4HVXA 3W9ZA 1V7YA 4S39A 3ZLGA 1XF0A 1EDQA 5LHFA 3QTGA 3AXIA 5EYWA 2GGHA 4AEEA 6ALDA 2ADAA 4E3TA 2GFTA 2X7WA 4V27A 5A6BA 3NA8A 3GZ3A 1FVPA 2FMOA 2XFFA 2VZSA 2FH6A 1PEZA 3W1AA 3IVUA 3PBWA 1W1VA 4QQ3A 3W23A 4PMRA 1XISA 1XW8A 1J5SA 3LGEA 5FJTA 3SQSA 4D6DA 2DH2A 9XIAA 4H8NA 4AY8A 1UMYA 4NXKA 4FF7A 2QV5A 3LPPA 2A1YA 4G5DA 4D8LA 1Q6CA 1UR3M 5IFTA 3IUDA 4H7VA 1O5XA 4WOQA 3S9ZA 1OGGA 2DW6A 1T0OA 3SUSA 3VOGA 4IMCA 4L9XA 4M24A 4QFUA 2NLIA 2GQ9A 3N2OA 5D8ZA 4QS6A 3T44A 2J6XA 2V82A 3MHGA 2BXVA 4GNKB 3STCA 1JAKA 3TAKA 4DXKA 1NAL1 1ZFJA 1GQJA 1MEHA 2CHOA 4KF1A 5B80A 2CZVA 3OVQA 5C5YA 5DT7A 1OC7A 3ARSA 1P1MA 1MFUA 4DJEC 2EPMX 2WCSA 1B4KA 3BJFA 1TA3A 2VELA 3ZR5A 1KFCA 2P0OA 1P43A 3W29A 3NOYA 1PSCA 1TPH1 3VIIA 3AYVA 5AVNA 1E6RA 4UB9A 3DC0A 3B03A 3ZSTA 2PDFA 2OVLA 3WJWA 4H9MA 1K8YA 1EA9C 4JTLA 2GLKA 2NX9A 4QXIA 2O9PA 3LZ3A 3PPFA 4O19A 4NX5A 1WBJA 3GUGA 3LLFA 2XIIA 1KXVA 2VRKA 3W86A 5F2IA 1ICQA 4KGJA 1Q4WA 1PWMA 1E6SM 2QAFA 5LNWA 1J4EA 2VL4A 3P2VA 1N82A 2XYLA 2DSWA 4MZ1A 1H1YA 3ZQ9A 2PWDA 4DPQA 1WE5A 1W0MA 3NZGA 2XM2A 1GOXA 2YA2A 3S9IA 4I90A 5HK4A 4GIRA 2FIQA 2FB3A 3NZPA 1OF6A 3HGRA 3L4TA 5JQ9A 1NTHA 2INFA 1RY0A 2YX0A 4RE4A 3C0QA 4DWDA 4UQBA 4LVBA 2OMAA 3SFWA 3P0XA 1E6XM 2OSYA 5FEZA 4AWSA 4FNTA 3AZSA 1R3QA 3GXTA 2HJPA 1SO6A 2WSRA 1F3EA 2W92A 1L6YA 1Q3NA 3IJ7A 3KW3A 3RRAA 3TYDA 5H8MA 4O28A 3GWQA 2Q8ZA 4UXDA 3WNNA 1WZMA 3HO8A 3VC5A 2QUVA 2BHUA 1QPNA 4NZ4A 3H2OA 1TPC1 5KSWA 2XZ9A 2UZ9A 4A05A 4JQ2A 3BLPX 4F0MA 3A24A 3F5JA 5F1VA 1VIWA 4DYKA 3SCVA 1R9XA 2A3BA 2FKPA 3N2BA 4I5RA 3FN9A 1DWFM 3PULA 1V6YA 1ISWA 2BNJA 4NI8A 5FL1A 2VR2A 4LCSA 1QWKA 4CN1A 5LNRA 2CBUA 3ITYA 3G1FA 1QHOA 4E2BA 3SUUA 4AB4A 1ZZMA 1AW1A 1IXOA 4UCFA 3GU1A 4H9UA 3IK2A 1LDCA 3CUGA 2WMFA 3S0CA 2A21A 3GBDA 2ZA1A 4GVHA 1QI3A 2IW0A 4GG9A 1FHDA 3WLSA 4GKTA 3PZNA 3XIMA 3EWBX 1QI0A 3GR7A 3UF9A 3THAA 1MW2A 1W9XA 1A4LA 3P14A 1M03A 2Z6IA 1JD9A 3T1GA 4DUWA 2VEMA 3G5EA 5EBUA 4XO7A 3GNPA 4L5ZA 2PZNA 3L5LA 4FOKA 3O05A 1RZMA 1LCOA 5H8PA 3JU2A 4LW7A 3EYPA 2QJHA 4G8TA 3W7NA 3VIOA 2WB5A 4JKKA 3LHZA 3UJFA 1H2JA 1NQ6A 3BCFA 1JG9A 1CXIA 3PTKA 3TYEA 1EHAA 1LLWA 4AD2A 3T0TA 3QR0A 1KFWA 2VFDA 4MAZA 4GQBA 3AS3A 3EZ4A 2X2GA 3BW2A 1XJBA 3NYDA 1B3ZA 4D6IA 4LS1A 4RXGA 1EO5A 2PGFA 4IMAA 3VNMA 1VFTA 4W89A 2OX4A 5D33A 1VYRA 4AXKA 4U2YA 3WLQA 3AROA 1I0DA 2RKXA 5K3VA 2O56A 5AN7A 2NW0A 4F0RA 1UKPA 3K8MA 4RV3A 3VKCA 2QW5A 4OECA 3GKFA 3M47A 1M68A 4A3RA 3RO8A 3G6MA 4JQ4A 5J04A 4ENLA 5E9XA 1E0UA 4S3JA 3GNOA 2XINA 1VPYA 4HNVA 1OD0A 2VP8A 1XBZA 4CCEA 4Q32A 1GVOA 3GXIA 5I3IA 1PHWA 3OA3A 5C55A 1FWJC 2DZTA 5T91A 3RX4A 4C6IA 4Q4QA 1JXJA 4PFMA 3PG8A 5HR7A 4U5IA 3W24A 4MJZA 1V3MA 2DQXA 2AMXA 2O9TA 2WVUA 3OGVA 3A4JA 1YE6A 4GK8A 1D7KA 4X3ZA 3MY9A 5HATA 3DAQA 1GG0A 2VR4A 2WMHA 3AIBA 3ARUA 3L2MA 5TAOA 1Z6KA 1O95A 4OBRA 1KLZA 3S5YA 1R3YA 4DJFD 2Y6ZA 1Q85A 1U2YA 1A49A 4W86A 4KWWA 5EMMA 1EJ7L 2OCZA 2E77A 4P7LA 1JZ7A 3N2MA 1J93A 1F6YA 3WH9A 3N25A 3ZMRA 4HA1A 3TJIA 4KEUA 3TYAA 3VNDA 4RPQA 1U1HA 3AHYA 3DG6A 5I77A 4XISA 1UB3A 3FXGA 5H2ZA 1Y65A 4LF1A 4D6CA 1DJWA 1I60A 2UY3A 1HKJA 4C90A 1F61A 1A5KC 3FGCB 2VURA 4GO9A 4JIHA 4WLCA 5G2WA 3AS1A 3JUGA 1GPWA 4XD4A 3TWAA 2W0UA 1G7VA 2PODA 4W7UA 3EX4A 2PF0A 4J3SA 3CAKA 3BWWA 5D9NA 1UR1A 4FK9A 3CV7A 3R1ZA 4ZZ9A 5CG7A 3NZRA 2XIMA 3CBWA 1DJGA 2ODOA 3S2MA 4QGCA 1E56A 2D2JA 1IWPA 1KCZA 1D3CA 3UERA 1EBHA 4I9AA 2XSBA 5LA1A 1XIBA 2ZVIA 3R2GA 1YNYA 2DSZA 5M17A 2Q71A 1CLXA 3KS5A 1VQTA 1V3KA 2H9AB 1OABA 1UA7A 3W88A 5J5RA 1HGWA 3SGZA 5A3HA 3GIYA 2QV4A 1UJPA 3E5BA 1P7TB 4LX4A 3FX4A 4HCDA 8XIAA 1KCXA 3FEMA 3UXKA 3RU8X 2BY1A 3NSXA 1DIEA 3NNTA 4GQQA 3R6IA 4AVFA 5JH2A 1H63A 4L1XA 2YGYA 4MWAC 4HZ8A 4KKXA 1OINA 3I4EA 4F4RA 1BRLA 2IPGA 4C6PA 1NDZA 4H41A 5HOSA 1ECEA 2A7PA 2GJRA 3IIOA 1THFD 4M56A 5CGTA 1VH7A 3QVQA 3VKJA 4CEXC 4HQVA 3KTCA 3PAOA 4US5A 4IUOA 1SGJA 3AIWA 4BWLA 3ES8A 4FAMA 5HMEA 3R79A 5AYYA 3W7RA 2OEJA 1QVBA 5I3FA 3W1TA 2PI6A 2GUUA 4ZEPA 1N8IA 1M1BA 1ZJAA 2Y88A 3SJNA 1HT6A 3P5ZA 3UCDA 3BMXA 4JQ3A 2ZXQA 3CO4A 2NV9A 4GABA 2CCRA 1E5NA 4ACYA 4LS0A 4QNEA 3SCOA 3AJXA 3TW9A 3KWSA 5TF0A 2PDQA 4AZGA 4GY1A 1AW2A 4F9DA 1UD6A 2PTYA 1QPKA 4GJIA 3GNNA 2VVSA 1JVNA 4LF2A 2VOMA 1F6PA 1HGYA 1TVNA 2JKPA 4NAEA 1LOQA 5A8OA 2VT0A 4B2DA 1S5TA 1US2A 4MMWA 2QCNA 1AJ0A 4TV6A 1QDSA 3B97A 4FLSA 2JGQA 2CETA 1WDQA 4GNJA 5DBTA 3K1GA 1H7OA 1QAPA 3TN3A 3VKAA 4JDBA 3DZ1A 1EYEA 4GO8A 3V16A 3V35A 1WNOA 4S2CA 2XIQA 4MHBA 5BZAA 5CPOA 1H7XA 3VM5A 1GKRA 4LC6A 3IUHA 1WKFA 1EJRC 2V9DA 4O17A 3SY8A 4J28A 3BDKA 3PBVA 3WMBA 1N8WA 2IKGA 3W7IA 2GSJA 3GDTA 4A3UA 3CYVA 4ZFCA 3WQCA 2L5HA 1E4NA 3H6OA 2J8FA 4XZHA 5D04C 3VINA 3LPGA 5TD4A 4K68A 4HOXA 4KRUA 2QYGA 1O5RA 1KFEA 2YBUA 4JIEA 3ZO9A 2ASHA 3TFXA 2OYLA 1GOMA 4XZLX 3WN6A 2WO5A 1M7PA 1DOSA 2QF8A 2WHMA 1ZGDA 2WMGA 1G9HA 4HNOA 1D2KA 3P5YA 3REQA 3T2QA 1OB0A 1V77A 2FDSA 1FDYA 2D73A 2OZ0A 4MPQA 1KR0A 3UWZA 1RA5A 2ZRUA 4YHGA 1WZKA 2VXNA 3SCSA 2X41A 4UQ9A 2P0IA 2YBVA 3KFTA 1D8WA 4H7CA 4UR7A 3M7SA 4LUSB 1FX6A 4LUIA 4NYYA 2QZRA 4AIBA 2ACRA 1UG6A 2WM1A 5FL0A 5E9AA 1UWIA 2VWSA 4FOJA 3BANA 2B7NA 5C9ZA 1XD1A 5BRBA 3P62A 2WK2A 5DQPA 1EP1A 3L66A 4NJIA 4DI9A 3SQLA 3UCCA 1SYTA 3UBPC 3BLKA 1NFPA 4A8LA 3MP3A 5IBXC 2XSXA 3VGGA 2XU2A 3DBPA 4Y7EA 5LIXX 1LRTA 4DBWA 4Q4RA 2ZRVA 1S2TA 1B57A 3IRSA 4B3LA 5A8MA 3KUMA 1HJVA 1Z9AA 3SCPA 3AUOA 1XKJA 1RK5A 2NUXA 1ZP4A 3QC0A 4M51A 2AMGA 1PKLA 1H41A 5ABEA 3QOKA 4HPHA 1JI1A 2HVOA 2TSYA 3U2OA 4DO5A 2YW4A 5CGQA 3S5SA 3W22A 3W02A 4PUWA 4IXHA 2PCEA 1OFPA 2CZEA 1Q63A 3PZIA 2V3DA 4AIUA 4M1RA 3URNA 2FZMA 2V6AA 3SM0A 3OPSA 3CMFA 1JYNA 3SGUA 1XXXA 3NJ3A 1BD0A 3OA5A 3OYZA 4HHPA 4G9PA 3WQOA 2DW7A 1NJJA 4JFVA 2DEPA 3E0FA 3WF1A 4KWUA 1E0XA 4QLKA 2J7DA 1KV5A 3E74A 1ADDA 3FKKA 3WL1A 3MUAA 4JTSA 4J3UA 2VGGA 4H2HA 1BVZA 1O7AA 3NPWA 1C9DA 1JPIA 1WB0A 4NRRA 4ZQRA 1PX3A 3VOJA 4LBUA 4G1KA 3VX0A 1V0LA 2C0AA 3PY2A 5CSSA 1NM9A 5GJPA 4DN1A 1KGXA 3CTTA 2ZFAA 4X63A 3AALA 4Y9OA 4YMZA 5ABFA 2Z1WA 4XKMA 1UC5A 3H2MA 2XH7A 4WXZA 2V68A 1RUSA 3DFNA 4KFPA 4TMCA 2PGRA 4HZ6A 2GUBA 2PWHA 5FSEC 2MANA 2E7FA 3H53A 4FNUA 4D6EA 4DWSC 1TTQA 5D09A 2F61A 2V69A 2DUXA 3RHGA 2XG9A 1TVPA 3UG3A 4QM1A 3N3MA 2D0FA 4PFHA 4K8GA 4TUFA 4DYEA 3M64A 1JUEA 4QJ5B 2VWTA 3GUWA 1TYGA 3QEZA 1H7WA 2Q01A 3I6RA 4AD0A 1JGIA 3UNTA 2E3ZA 4F0HA 3E2RA 1EDGA 1MNSA 4DYJA 1XLHA 3ABSA 3BQ6A 1W5MA 5GVJA 3EWZA 3B8SA 5CAHA 3ZM8A 3MI2A 4V15A 1OBAA 1A5UA 3RPTA 4F79A 1ISZA 1RBAA 2VJXA 4P61A 2WZHA 4B90A 1AJZA 1FWCC 3QGKC 1LWHA 4PBEA 3RFAA 1TJRA 3B4UA 4JNMA 4REQA 3JZEA 4HSNA 1JPHA 5I07A 4S3AA 1KKRA 3A23A 2WW5A 2P1FA 2BVYA 4J2PA 3AJ7A 3LSCA 3T2OA 3FY1A 3C2VA 3FV9A 4M6UA 2HK0A 3PWGA 2E1DA 1VBJA 4MFDA 1HO4A 2VKZG 3UU0A 5PTDA 1GW1A 2EPNA 2FPYA 2ZE0A 2WLYA 4RE0A 3TXVA 3PUOA 2ATSA 1R7OA 3AC0A 3EXTA 1AW5A 4IOTA 4W5ZA 2X0HA 3RK8A 1HUVA 2VUYA 2WSQA 3LI1A 1S2AA 2QIIA 4JFTA 3UXDA 4DJEA 3A3WA 1QNSA 2HWGA 2OR2A 1FHUA 1Z32X 1TJ0A 3I7RA 1YTDA 4Q4SA 4RNHA 2YCLA 3GKAA 2ZX6A 4ATDA 1TPEA 5AYXA 3M0HA 3N6JA 2POTA 4NG3A 1UR8A 4C6JA 3HBLA 4HU8A 4NVTA 1WQ5A 1I8JA 2NQHA 2EJAA 3IS4A 1TPUA 1JRCA 5A8PA 2BXZA 3F2DA 1NQKA 3C52A 3IGXA 2NQZA 4RDYA 2YYUA 1F8IA 3MDUA 4U31A 2DZPA 3SRDA 3KHJA 4U10A 2EJ1A 1Q6GA 4YYCA 2YL8A 2ALDA 2PTXA 3B05A 3W76A 1EBGA 1EEXA 3WH6A 2FGBA 1V79A 4H83A 3N13A 1V02A 2ZRZA 2OOGA 4QG9A 5ABHA 2NT1A 3TTOA 1FCUA 4GC3A 2C7FA 5HANA 1R6WA 3GD6A 3VGFA 2B0MA 4F0SA 4BR1A 3S42A 5K4XA 4IGMA 4CQAA 4A8NA 1W1B1 3L65A 4CQ9A 4NILA 4ADSA 5JIPA 1J6OA 3SCQA 3NQVA 3ARVA 1H62A 1E40A 3A4AA 3KAOA 2CLOA 3PUEA 4FXRA 1J6PA 1KGWA 4JTGA 1Q6LA 1EC9A 4IX0A 3RCMA 2DVTA 4JYDA 2IUZA 4HHLA 3C2OA 3LHVA 2DSKA 3B04A 3S2JA 3ZT5A 1O1ZA 2R1PA 4AF0A 4JAWA 1V6TA 5HJXA 3GTXA 4F9JA 1PWLA 1B30A 5H1WA 3AISA