1Z9DA

Crystal structure of a putative uridylate kinase (ump-kinase) from streptococcus pyogenes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
b'EPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNGVDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGNIQRVVFGEHIGTTVSNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uridylate kinase
publication title Crystal structure of a putative uridylate kinase (UMP-kinase) from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
total genus 64
structure length 238
sequence length 238
chains with identical sequence B, C
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 1z9dA00
3C1NA 3ZZFA 4NDPB 3AB2A 3QUOA 3AB4A 2JI5A 4F6TB 2BRIA 3NWYA 2AKOA 2J4LA 3D40A 3QUNA 3K56A 2J0WA 2WE4A 3L76A 3K52A 3QVFA 2J0XA 2OGXA 2J4KA 3S6HA 3LL9A 2BNDA 2V4YA 2JJ4A 2IJ9A 2CDQA 4JZ9A 4JZ7A 4NDRB 1OH9A 3LKKA 3C1MA 3B8GA 2V5HA 1GS5A 4NDPA 4NDOA 3U6UA 2BRXA 2X2WA 3L86A 3QVHA 3D2PA 3AAWA 4NDQA 3LL5A 3EK5A 3K4YA 2BNEA 3QURA 3S6GA 2VA1A 3C20A 4AB7A 1E19A 2J4JA 3S6KA 3D41A 3T7BA 2WE5A 2R8VA 4A7XA 2OGXB 2E9YA 2BNFA 2BUFA 3ZZGA 4I49A 4JZ8A 4USJA 3ZZIA 2J5TA 3K4OA 4Q1TA 1YBDA 1OHBA 3D2MA 2WXBA 4F6TA 4A7WA 4OLCA 4AXSA 1Z9DA 4NDRA 3WWNA 2R98A 4NDOB 3WWMA 2BMUA 2A1FA 2W21A 4NDQB 2JJXA 4KZTA 3KZFA 1B7BA 2AP9A 1GSJA 2BTYA 2HMFA 3EK6A 2J5VA 1OHAA 3TVIA 3ZZHA 2RD5A
chains in the Genus database with same CATH superfamily
3C1NA 3ZZFA 4NDPB 3AB2A 3QUOA 3AB4A 2JI5A 4F6TB 2BRIA 3NWYA 2AKOA 2J4LA 3D40A 3QUNA 3K56A 2J0WA 2WE4A 3L76A 3K52A 3QVFA 2J0XA 2OGXA 2J4KA 3S6HA 3LL9A 2BNDA 2V4YA 2JJ4A 2IJ9A 2CDQA 4JZ9A 4JZ7A 4NDRB 1OH9A 3LKKA 3C1MA 3B8GA 2V5HA 1GS5A 4NDPA 4NDOA 3U6UA 2BRXA 2X2WA 3L86A 3QVHA 3D2PA 3AAWA 4NDQA 3LL5A 3EK5A 3K4YA 2BNEA 3QURA 3S6GA 2VA1A 3C20A 4AB7A 1E19A 2J4JA 3S6KA 3D41A 3T7BA 2WE5A 2R8VA 4A7XA 2OGXB 2E9YA 2BNFA 2BUFA 3ZZGA 4I49A 4JZ8A 4USJA 3ZZIA 2J5TA 3K4OA 4Q1TA 1YBDA 1OHBA 3D2MA 2WXBA 4F6TA 4A7WA 4OLCA 4AXSA 1Z9DA 4NDRA 3WWNA 2R98A 4NDOB 3WWMA 2BMUA 2A1FA 2W21A 4NDQB 2JJXA 4KZTA 3KZFA 1B7BA 2AP9A 1GSJA 2BTYA 2HMFA 3EK6A 2J5VA 1OHAA 3TVIA 3ZZHA 2RD5A
chains in the Genus database with same CATH topology
3C1NA 3ZZFA 4NDPB 3AB2A 3QUOA 3AB4A 2JI5A 4F6TB 2BRIA 3NWYA 2AKOA 2J4LA 3D40A 3QUNA 3K56A 2J0WA 2WE4A 3L76A 3K52A 3QVFA 2J0XA 2OGXA 2J4KA 3S6HA 3LL9A 2BNDA 2V4YA 2JJ4A 2IJ9A 2CDQA 4JZ9A 4JZ7A 4NDRB 1OH9A 3LKKA 3C1MA 3B8GA 2V5HA 1GS5A 4NDPA 4NDOA 3U6UA 2BRXA 2X2WA 3L86A 3QVHA 3D2PA 3AAWA 4NDQA 3LL5A 3EK5A 3K4YA 2BNEA 3QURA 3S6GA 2VA1A 3C20A 4AB7A 1E19A 2J4JA 3S6KA 3D41A 3T7BA 2WE5A 2R8VA 4A7XA 2OGXB 2E9YA 2BNFA 2BUFA 3ZZGA 4I49A 4JZ8A 4USJA 3ZZIA 2J5TA 3K4OA 4Q1TA 1YBDA 1OHBA 3D2MA 2WXBA 4F6TA 4A7WA 4OLCA 4AXSA 1Z9DA 4NDRA 3WWNA 2R98A 4NDOB 3WWMA 2BMUA 2A1FA 2W21A 4NDQB 2JJXA 4KZTA 3KZFA 1B7BA 2AP9A 1GSJA 2BTYA 2HMFA 3EK6A 2J5VA 1OHAA 3TVIA 3ZZHA 2RD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1N A;  3ZZF A;  4NDP B;  3AB2 A;  3QUO A;  3AB4 A;  2JI5 A;  4F6T B;  2BRI A;  3NWY A;  2AKO A;  2J4L A;  3D40 A;  3QUN A;  3K56 A;  2J0W A;  2WE4 A;  3L76 A;  3K52 A;  3QVF A;  2J0X A;  2OGX A;  2J4K A;  3S6H A;  3LL9 A;  2BND A;  2V4Y A;  2JJ4 A;  2IJ9 A;  2CDQ A;  4JZ9 A;  4JZ7 A;  4NDR B;  1OH9 A;  3LKK A;  3C1M A;  3B8G A;  2V5H A;  1GS5 A;  4NDP A;  4NDO A;  3U6U A;  2BRX A;  2X2W A;  3L86 A;  3QVH A;  3D2P A;  3AAW A;  4NDQ A;  3LL5 A;  3EK5 A;  3K4Y A;  2BNE A;  3QUR A;  3S6G A;  2VA1 A;  3C20 A;  4AB7 A;  1E19 A;  2J4J A;  3S6K A;  3D41 A;  3T7B A;  2WE5 A;  2R8V A;  4A7X A;  2OGX B;  2E9Y A;  2BNF A;  2BUF A;  3ZZG A;  4I49 A;  4JZ8 A;  4USJ A;  3ZZI A;  2J5T A;  3K4O A;  4Q1T A;  1YBD A;  1OHB A;  3D2M A;  2WXB A;  4F6T A;  4A7W A;  4OLC A;  4AXS A;  1Z9D A;  4NDR A;  3WWN A;  2R98 A;  4NDO B;  3WWM A;  2BMU A;  2A1F A;  2W21 A;  4NDQ B;  2JJX A;  4KZT A;  3KZF A;  1B7B A;  2AP9 A;  1GSJ A;  2BTY A;  2HMF A;  3EK6 A;  2J5V A;  1OHA A;  3TVI A;  3ZZH A;  2RD5 A; 
#chains in the Genus database with same CATH topology
 3C1N A;  3ZZF A;  4NDP B;  3AB2 A;  3QUO A;  3AB4 A;  2JI5 A;  4F6T B;  2BRI A;  3NWY A;  2AKO A;  2J4L A;  3D40 A;  3QUN A;  3K56 A;  2J0W A;  2WE4 A;  3L76 A;  3K52 A;  3QVF A;  2J0X A;  2OGX A;  2J4K A;  3S6H A;  3LL9 A;  2BND A;  2V4Y A;  2JJ4 A;  2IJ9 A;  2CDQ A;  4JZ9 A;  4JZ7 A;  4NDR B;  1OH9 A;  3LKK A;  3C1M A;  3B8G A;  2V5H A;  1GS5 A;  4NDP A;  4NDO A;  3U6U A;  2BRX A;  2X2W A;  3L86 A;  3QVH A;  3D2P A;  3AAW A;  4NDQ A;  3LL5 A;  3EK5 A;  3K4Y A;  2BNE A;  3QUR A;  3S6G A;  2VA1 A;  3C20 A;  4AB7 A;  1E19 A;  2J4J A;  3S6K A;  3D41 A;  3T7B A;  2WE5 A;  2R8V A;  4A7X A;  2OGX B;  2E9Y A;  2BNF A;  2BUF A;  3ZZG A;  4I49 A;  4JZ8 A;  4USJ A;  3ZZI A;  2J5T A;  3K4O A;  4Q1T A;  1YBD A;  1OHB A;  3D2M A;  2WXB A;  4F6T A;  4A7W A;  4OLC A;  4AXS A;  1Z9D A;  4NDR A;  3WWN A;  2R98 A;  4NDO B;  3WWM A;  2BMU A;  2A1F A;  2W21 A;  4NDQ B;  2JJX A;  4KZT A;  3KZF A;  1B7B A;  2AP9 A;  1GSJ A;  2BTY A;  2HMF A;  3EK6 A;  2J5V A;  1OHA A;  3TVI A;  3ZZH A;  2RD5 A; 
#chains in the Genus database with same CATH homology
 3C1N A;  3ZZF A;  4NDP B;  3AB2 A;  3QUO A;  3AB4 A;  2JI5 A;  4F6T B;  2BRI A;  3NWY A;  2AKO A;  2J4L A;  3D40 A;  3QUN A;  3K56 A;  2J0W A;  2WE4 A;  3L76 A;  3K52 A;  3QVF A;  2J0X A;  2OGX A;  2J4K A;  3S6H A;  3LL9 A;  2BND A;  2V4Y A;  2JJ4 A;  2IJ9 A;  2CDQ A;  4JZ9 A;  4JZ7 A;  4NDR B;  1OH9 A;  3LKK A;  3C1M A;  3B8G A;  2V5H A;  1GS5 A;  4NDP A;  4NDO A;  3U6U A;  2BRX A;  2X2W A;  3L86 A;  3QVH A;  3D2P A;  3AAW A;  4NDQ A;  3LL5 A;  3EK5 A;  3K4Y A;  2BNE A;  3QUR A;  3S6G A;  2VA1 A;  3C20 A;  4AB7 A;  1E19 A;  2J4J A;  3S6K A;  3D41 A;  3T7B A;  2WE5 A;  2R8V A;  4A7X A;  2OGX B;  2E9Y A;  2BNF A;  2BUF A;  3ZZG A;  4I49 A;  4JZ8 A;  4USJ A;  3ZZI A;  2J5T A;  3K4O A;  4Q1T A;  1YBD A;  1OHB A;  3D2M A;  2WXB A;  4F6T A;  4A7W A;  4OLC A;  4AXS A;  1Z9D A;  4NDR A;  3WWN A;  2R98 A;  4NDO B;  3WWM A;  2BMU A;  2A1F A;  2W21 A;  4NDQ B;  2JJX A;  4KZT A;  3KZF A;  1B7B A;  2AP9 A;  1GSJ A;  2BTY A;  2HMF A;  3EK6 A;  2J5V A;  1OHA A;  3TVI A;  3ZZH A;  2RD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...