1Z9DA

Crystal structure of a putative uridylate kinase (ump-kinase) from streptococcus pyogenes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
EPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNGVDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGNIQRVVFGEHIGTTVSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uridylate kinase
publication title Crystal structure of a putative uridylate kinase (UMP-kinase) from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
total genus 64
structure length 238
sequence length 238
chains with identical sequence B, C
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 1z9dA00
1OHAA 4JZ9A 1YBDA 1B7BA 4KZTA 3S6GA 2BTYA 3ZZHA 3NWYA 2HMFA 4NDPA 3KZFA 3B8GA 2WXBA 2BNFA 2E9YA 1Z9DA 3T7BA 3D2PA 3D2MA 3TVIA 2V5HA 3LL5A 3EK5A 2J5VA 4AXSA 4NDRB 2OGXB 2J4JA 2AKOA 2JI5A 4F6TB 1E19A 2CDQA 2BRIA 4NDRA 2OGXA 2R98A 3ZZGA 3C1NA 4OLCA 4A7XA 2J5TA 4F6TA 1GSJA 1GS5A 2AP9A 3QUOA 1OHBA 2WE4A 3AAWA 3U6UA 3LL9A 3AB2A 3WWMA 3ZZIA 3S6KA 2R8VA 2BRXA 2J0WA 3S6HA 2RD5A 3K56A 1OH9A 3L86A 2W21A 3QURA 3K4YA 4JZ8A 3K4OA 3D41A 3LKKA 3ZZFA 3C20A 2A1FA 3EK6A 2WE5A 4JZ7A 3C1MA 2IJ9A 3QVHA 2V4YA 2J0XA 4NDOB 2J4KA 2BNEA 2VA1A 2X2WA 2J4LA 2JJXA 4NDOA 4NDQB 4AB7A 4Q1TA 3QUNA 2BNDA 2BMUA 4NDQA 3D40A 3WWNA 3K52A 4NDPB 4USJA 3QVFA 3L76A 4A7WA 4I49A 3AB4A 2JJ4A 2BUFA
chains in the Genus database with same CATH superfamily
1OHAA 4JZ9A 1YBDA 1B7BA 4KZTA 3S6GA 2BTYA 3ZZHA 3NWYA 2HMFA 4NDPA 3KZFA 3B8GA 2WXBA 2BNFA 2E9YA 1Z9DA 3T7BA 3D2PA 3D2MA 3TVIA 2V5HA 3LL5A 3EK5A 2J5VA 4AXSA 4NDRB 2OGXB 2J4JA 2AKOA 2JI5A 4F6TB 1E19A 2CDQA 2BRIA 4NDRA 2OGXA 2R98A 3ZZGA 3C1NA 4OLCA 4A7XA 2J5TA 4F6TA 1GSJA 1GS5A 2AP9A 3QUOA 1OHBA 2WE4A 3AAWA 3U6UA 3LL9A 3AB2A 3WWMA 3ZZIA 3S6KA 2R8VA 2BRXA 2J0WA 3S6HA 2RD5A 3K56A 1OH9A 3L86A 2W21A 3QURA 3K4YA 4JZ8A 3K4OA 3D41A 3LKKA 3ZZFA 3C20A 2A1FA 3EK6A 2WE5A 4JZ7A 3C1MA 2IJ9A 3QVHA 2V4YA 2J0XA 4NDOB 2J4KA 2BNEA 2VA1A 2X2WA 2J4LA 2JJXA 4NDOA 4NDQB 4AB7A 4Q1TA 3QUNA 2BNDA 2BMUA 4NDQA 3D40A 3WWNA 3K52A 4NDPB 4USJA 3QVFA 3L76A 4A7WA 4I49A 3AB4A 2JJ4A 2BUFA
chains in the Genus database with same CATH topology
1OHAA 4JZ9A 1YBDA 1B7BA 4KZTA 3S6GA 2BTYA 3ZZHA 3NWYA 2HMFA 4NDPA 3KZFA 3B8GA 2WXBA 2BNFA 2E9YA 1Z9DA 3T7BA 3D2PA 3D2MA 3TVIA 2V5HA 3LL5A 3EK5A 2J5VA 4AXSA 4NDRB 2OGXB 2J4JA 2AKOA 2JI5A 4F6TB 1E19A 2CDQA 2BRIA 4NDRA 2OGXA 2R98A 3ZZGA 3C1NA 4OLCA 4A7XA 2J5TA 4F6TA 1GSJA 1GS5A 2AP9A 3QUOA 1OHBA 2WE4A 3AAWA 3U6UA 3LL9A 3AB2A 3WWMA 3ZZIA 3S6KA 2R8VA 2BRXA 2J0WA 3S6HA 2RD5A 3K56A 1OH9A 3L86A 2W21A 3QURA 3K4YA 4JZ8A 3K4OA 3D41A 3LKKA 3ZZFA 3C20A 2A1FA 3EK6A 2WE5A 4JZ7A 3C1MA 2IJ9A 3QVHA 2V4YA 2J0XA 4NDOB 2J4KA 2BNEA 2VA1A 2X2WA 2J4LA 2JJXA 4NDOA 4NDQB 4AB7A 4Q1TA 3QUNA 2BNDA 2BMUA 4NDQA 3D40A 3WWNA 3K52A 4NDPB 4USJA 3QVFA 3L76A 4A7WA 4I49A 3AB4A 2JJ4A 2BUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OHA A;  4JZ9 A;  1YBD A;  1B7B A;  4KZT A;  3S6G A;  2BTY A;  3ZZH A;  3NWY A;  2HMF A;  4NDP A;  3KZF A;  3B8G A;  2WXB A;  2BNF A;  2E9Y A;  1Z9D A;  3T7B A;  3D2P A;  3D2M A;  3TVI A;  2V5H A;  3LL5 A;  3EK5 A;  2J5V A;  4AXS A;  4NDR B;  2OGX B;  2J4J A;  2AKO A;  2JI5 A;  4F6T B;  1E19 A;  2CDQ A;  2BRI A;  4NDR A;  2OGX A;  2R98 A;  3ZZG A;  3C1N A;  4OLC A;  4A7X A;  2J5T A;  4F6T A;  1GSJ A;  1GS5 A;  2AP9 A;  3QUO A;  1OHB A;  2WE4 A;  3AAW A;  3U6U A;  3LL9 A;  3AB2 A;  3WWM A;  3ZZI A;  3S6K A;  2R8V A;  2BRX A;  2J0W A;  3S6H A;  2RD5 A;  3K56 A;  1OH9 A;  3L86 A;  2W21 A;  3QUR A;  3K4Y A;  4JZ8 A;  3K4O A;  3D41 A;  3LKK A;  3ZZF A;  3C20 A;  2A1F A;  3EK6 A;  2WE5 A;  4JZ7 A;  3C1M A;  2IJ9 A;  3QVH A;  2V4Y A;  2J0X A;  4NDO B;  2J4K A;  2BNE A;  2VA1 A;  2X2W A;  2J4L A;  2JJX A;  4NDO A;  4NDQ B;  4AB7 A;  4Q1T A;  3QUN A;  2BND A;  2BMU A;  4NDQ A;  3D40 A;  3WWN A;  3K52 A;  4NDP B;  4USJ A;  3QVF A;  3L76 A;  4A7W A;  4I49 A;  3AB4 A;  2JJ4 A;  2BUF A; 
#chains in the Genus database with same CATH topology
 1OHA A;  4JZ9 A;  1YBD A;  1B7B A;  4KZT A;  3S6G A;  2BTY A;  3ZZH A;  3NWY A;  2HMF A;  4NDP A;  3KZF A;  3B8G A;  2WXB A;  2BNF A;  2E9Y A;  1Z9D A;  3T7B A;  3D2P A;  3D2M A;  3TVI A;  2V5H A;  3LL5 A;  3EK5 A;  2J5V A;  4AXS A;  4NDR B;  2OGX B;  2J4J A;  2AKO A;  2JI5 A;  4F6T B;  1E19 A;  2CDQ A;  2BRI A;  4NDR A;  2OGX A;  2R98 A;  3ZZG A;  3C1N A;  4OLC A;  4A7X A;  2J5T A;  4F6T A;  1GSJ A;  1GS5 A;  2AP9 A;  3QUO A;  1OHB A;  2WE4 A;  3AAW A;  3U6U A;  3LL9 A;  3AB2 A;  3WWM A;  3ZZI A;  3S6K A;  2R8V A;  2BRX A;  2J0W A;  3S6H A;  2RD5 A;  3K56 A;  1OH9 A;  3L86 A;  2W21 A;  3QUR A;  3K4Y A;  4JZ8 A;  3K4O A;  3D41 A;  3LKK A;  3ZZF A;  3C20 A;  2A1F A;  3EK6 A;  2WE5 A;  4JZ7 A;  3C1M A;  2IJ9 A;  3QVH A;  2V4Y A;  2J0X A;  4NDO B;  2J4K A;  2BNE A;  2VA1 A;  2X2W A;  2J4L A;  2JJX A;  4NDO A;  4NDQ B;  4AB7 A;  4Q1T A;  3QUN A;  2BND A;  2BMU A;  4NDQ A;  3D40 A;  3WWN A;  3K52 A;  4NDP B;  4USJ A;  3QVF A;  3L76 A;  4A7W A;  4I49 A;  3AB4 A;  2JJ4 A;  2BUF A; 
#chains in the Genus database with same CATH homology
 1OHA A;  4JZ9 A;  1YBD A;  1B7B A;  4KZT A;  3S6G A;  2BTY A;  3ZZH A;  3NWY A;  2HMF A;  4NDP A;  3KZF A;  3B8G A;  2WXB A;  2BNF A;  2E9Y A;  1Z9D A;  3T7B A;  3D2P A;  3D2M A;  3TVI A;  2V5H A;  3LL5 A;  3EK5 A;  2J5V A;  4AXS A;  4NDR B;  2OGX B;  2J4J A;  2AKO A;  2JI5 A;  4F6T B;  1E19 A;  2CDQ A;  2BRI A;  4NDR A;  2OGX A;  2R98 A;  3ZZG A;  3C1N A;  4OLC A;  4A7X A;  2J5T A;  4F6T A;  1GSJ A;  1GS5 A;  2AP9 A;  3QUO A;  1OHB A;  2WE4 A;  3AAW A;  3U6U A;  3LL9 A;  3AB2 A;  3WWM A;  3ZZI A;  3S6K A;  2R8V A;  2BRX A;  2J0W A;  3S6H A;  2RD5 A;  3K56 A;  1OH9 A;  3L86 A;  2W21 A;  3QUR A;  3K4Y A;  4JZ8 A;  3K4O A;  3D41 A;  3LKK A;  3ZZF A;  3C20 A;  2A1F A;  3EK6 A;  2WE5 A;  4JZ7 A;  3C1M A;  2IJ9 A;  3QVH A;  2V4Y A;  2J0X A;  4NDO B;  2J4K A;  2BNE A;  2VA1 A;  2X2W A;  2J4L A;  2JJX A;  4NDO A;  4NDQ B;  4AB7 A;  4Q1T A;  3QUN A;  2BND A;  2BMU A;  4NDQ A;  3D40 A;  3WWN A;  3K52 A;  4NDP B;  4USJ A;  3QVF A;  3L76 A;  4A7W A;  4I49 A;  3AB4 A;  2JJ4 A;  2BUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...