1Z9DA

Crystal structure of a putative uridylate kinase (ump-kinase) from streptococcus pyogenes
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
EPKYQRILIKLSGEALAGEKGVGIDIPTVQAIAKEIAEVHVSGVQIALVIGGGNLWRGEPAADAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAIPMQNVAEPYIRGRALRHLEKNRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNGVDGVYNADPKKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGNIQRVVFGEHIGTTVSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uridylate kinase
publication title Crystal structure of a putative uridylate kinase (UMP-kinase) from Streptococcus pyogenes
rcsb
source organism Streptococcus pyogenes
molecule tags Transferase
total genus 64
structure length 238
sequence length 238
chains with identical sequence B, C
ec nomenclature ec 2.7.4.22: UMP kinase.
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00696 AA_kinase Amino acid kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1160.10 Alpha Beta 3-Layer(aba) Sandwich Carbamate kinase Acetylglutamate kinase-like 1z9dA00
2E9YA 3LL5A 2J4LA 4JZ8A 4KZTA 3S6KA 4AB7A 4JZ7A 3D41A 3QUOA 2BNFA 3K4YA 2R8VA 2CDQA 2AP9A 2VA1A 2WXBA 2J5TA 3AAWA 3QVHA 2BUFA 3S6GA 3T7BA 3D40A 1Z9DA 3C20A 3ZZFA 3K4OA 1GSJA 3L86A 4NDPB 2BNEA 4I49A 2V4YA 3NWYA 2J0WA 2J4KA 3EK5A 2BNDA 2OGXA 2J0XA 2R98A 2AKOA 4USJA 4A7XA 4AXSA 3EK6A 3D2PA 2W21A 2RD5A 3U6UA 4NDOA 3LL9A 2A1FA 3LKKA 1E19A 2J5VA 3QURA 4NDQA 4F6TA 4Q1TA 2BTYA 2JJ4A 3C1MA 1OHAA 4NDRB 3ZZIA 1YBDA 4JZ9A 2OGXB 3K56A 3TVIA 1OHBA 1GS5A 2X2WA 4A7WA 3B8GA 3D2MA 3K52A 3WWMA 2J4JA 4NDOB 4NDRA 2HMFA 2WE4A 1B7BA 2JI5A 3S6HA 2WE5A 4NDQB 4F6TB 2JJXA 2BMUA 3C1NA 3WWNA 3QUNA 3AB4A 3QVFA 3AB2A 2BRIA 3KZFA 3L76A 1OH9A 4NDPA 3ZZHA 3ZZGA 4OLCA 2V5HA 2BRXA 2IJ9A
chains in the Genus database with same CATH superfamily
2E9YA 3LL5A 2J4LA 4JZ8A 4KZTA 3S6KA 4AB7A 4JZ7A 3D41A 3QUOA 2BNFA 3K4YA 2R8VA 2CDQA 2AP9A 2VA1A 2WXBA 2J5TA 3AAWA 3QVHA 2BUFA 3S6GA 3T7BA 3D40A 1Z9DA 3C20A 3ZZFA 3K4OA 1GSJA 3L86A 4NDPB 2BNEA 4I49A 2V4YA 3NWYA 2J0WA 2J4KA 3EK5A 2BNDA 2OGXA 2J0XA 2R98A 2AKOA 4USJA 4A7XA 4AXSA 3EK6A 3D2PA 2W21A 2RD5A 3U6UA 4NDOA 3LL9A 2A1FA 3LKKA 1E19A 2J5VA 3QURA 4NDQA 4F6TA 4Q1TA 2BTYA 2JJ4A 3C1MA 1OHAA 4NDRB 3ZZIA 1YBDA 4JZ9A 2OGXB 3K56A 3TVIA 1OHBA 1GS5A 2X2WA 4A7WA 3B8GA 3D2MA 3K52A 3WWMA 2J4JA 4NDOB 4NDRA 2HMFA 2WE4A 1B7BA 2JI5A 3S6HA 2WE5A 4NDQB 4F6TB 2JJXA 2BMUA 3C1NA 3WWNA 3QUNA 3AB4A 3QVFA 3AB2A 2BRIA 3KZFA 3L76A 1OH9A 4NDPA 3ZZHA 3ZZGA 4OLCA 2V5HA 2BRXA 2IJ9A
chains in the Genus database with same CATH topology
2E9YA 3LL5A 2J4LA 4JZ8A 4KZTA 3S6KA 4AB7A 4JZ7A 3D41A 3QUOA 2BNFA 3K4YA 2R8VA 2CDQA 2AP9A 2VA1A 2WXBA 2J5TA 3AAWA 3QVHA 2BUFA 3S6GA 3T7BA 3D40A 1Z9DA 3C20A 3ZZFA 3K4OA 1GSJA 3L86A 4NDPB 2BNEA 4I49A 2V4YA 3NWYA 2J0WA 2J4KA 3EK5A 2BNDA 2OGXA 2J0XA 2R98A 2AKOA 4USJA 4A7XA 4AXSA 3EK6A 3D2PA 2W21A 2RD5A 3U6UA 4NDOA 3LL9A 2A1FA 3LKKA 1E19A 2J5VA 3QURA 4NDQA 4F6TA 4Q1TA 2BTYA 2JJ4A 3C1MA 1OHAA 4NDRB 3ZZIA 1YBDA 4JZ9A 2OGXB 3K56A 3TVIA 1OHBA 1GS5A 2X2WA 4A7WA 3B8GA 3D2MA 3K52A 3WWMA 2J4JA 4NDOB 4NDRA 2HMFA 2WE4A 1B7BA 2JI5A 3S6HA 2WE5A 4NDQB 4F6TB 2JJXA 2BMUA 3C1NA 3WWNA 3QUNA 3AB4A 3QVFA 3AB2A 2BRIA 3KZFA 3L76A 1OH9A 4NDPA 3ZZHA 3ZZGA 4OLCA 2V5HA 2BRXA 2IJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E9Y A;  3LL5 A;  2J4L A;  4JZ8 A;  4KZT A;  3S6K A;  4AB7 A;  4JZ7 A;  3D41 A;  3QUO A;  2BNF A;  3K4Y A;  2R8V A;  2CDQ A;  2AP9 A;  2VA1 A;  2WXB A;  2J5T A;  3AAW A;  3QVH A;  2BUF A;  3S6G A;  3T7B A;  3D40 A;  1Z9D A;  3C20 A;  3ZZF A;  3K4O A;  1GSJ A;  3L86 A;  4NDP B;  2BNE A;  4I49 A;  2V4Y A;  3NWY A;  2J0W A;  2J4K A;  3EK5 A;  2BND A;  2OGX A;  2J0X A;  2R98 A;  2AKO A;  4USJ A;  4A7X A;  4AXS A;  3EK6 A;  3D2P A;  2W21 A;  2RD5 A;  3U6U A;  4NDO A;  3LL9 A;  2A1F A;  3LKK A;  1E19 A;  2J5V A;  3QUR A;  4NDQ A;  4F6T A;  4Q1T A;  2BTY A;  2JJ4 A;  3C1M A;  1OHA A;  4NDR B;  3ZZI A;  1YBD A;  4JZ9 A;  2OGX B;  3K56 A;  3TVI A;  1OHB A;  1GS5 A;  2X2W A;  4A7W A;  3B8G A;  3D2M A;  3K52 A;  3WWM A;  2J4J A;  4NDO B;  4NDR A;  2HMF A;  2WE4 A;  1B7B A;  2JI5 A;  3S6H A;  2WE5 A;  4NDQ B;  4F6T B;  2JJX A;  2BMU A;  3C1N A;  3WWN A;  3QUN A;  3AB4 A;  3QVF A;  3AB2 A;  2BRI A;  3KZF A;  3L76 A;  1OH9 A;  4NDP A;  3ZZH A;  3ZZG A;  4OLC A;  2V5H A;  2BRX A;  2IJ9 A; 
#chains in the Genus database with same CATH topology
 2E9Y A;  3LL5 A;  2J4L A;  4JZ8 A;  4KZT A;  3S6K A;  4AB7 A;  4JZ7 A;  3D41 A;  3QUO A;  2BNF A;  3K4Y A;  2R8V A;  2CDQ A;  2AP9 A;  2VA1 A;  2WXB A;  2J5T A;  3AAW A;  3QVH A;  2BUF A;  3S6G A;  3T7B A;  3D40 A;  1Z9D A;  3C20 A;  3ZZF A;  3K4O A;  1GSJ A;  3L86 A;  4NDP B;  2BNE A;  4I49 A;  2V4Y A;  3NWY A;  2J0W A;  2J4K A;  3EK5 A;  2BND A;  2OGX A;  2J0X A;  2R98 A;  2AKO A;  4USJ A;  4A7X A;  4AXS A;  3EK6 A;  3D2P A;  2W21 A;  2RD5 A;  3U6U A;  4NDO A;  3LL9 A;  2A1F A;  3LKK A;  1E19 A;  2J5V A;  3QUR A;  4NDQ A;  4F6T A;  4Q1T A;  2BTY A;  2JJ4 A;  3C1M A;  1OHA A;  4NDR B;  3ZZI A;  1YBD A;  4JZ9 A;  2OGX B;  3K56 A;  3TVI A;  1OHB A;  1GS5 A;  2X2W A;  4A7W A;  3B8G A;  3D2M A;  3K52 A;  3WWM A;  2J4J A;  4NDO B;  4NDR A;  2HMF A;  2WE4 A;  1B7B A;  2JI5 A;  3S6H A;  2WE5 A;  4NDQ B;  4F6T B;  2JJX A;  2BMU A;  3C1N A;  3WWN A;  3QUN A;  3AB4 A;  3QVF A;  3AB2 A;  2BRI A;  3KZF A;  3L76 A;  1OH9 A;  4NDP A;  3ZZH A;  3ZZG A;  4OLC A;  2V5H A;  2BRX A;  2IJ9 A; 
#chains in the Genus database with same CATH homology
 2E9Y A;  3LL5 A;  2J4L A;  4JZ8 A;  4KZT A;  3S6K A;  4AB7 A;  4JZ7 A;  3D41 A;  3QUO A;  2BNF A;  3K4Y A;  2R8V A;  2CDQ A;  2AP9 A;  2VA1 A;  2WXB A;  2J5T A;  3AAW A;  3QVH A;  2BUF A;  3S6G A;  3T7B A;  3D40 A;  1Z9D A;  3C20 A;  3ZZF A;  3K4O A;  1GSJ A;  3L86 A;  4NDP B;  2BNE A;  4I49 A;  2V4Y A;  3NWY A;  2J0W A;  2J4K A;  3EK5 A;  2BND A;  2OGX A;  2J0X A;  2R98 A;  2AKO A;  4USJ A;  4A7X A;  4AXS A;  3EK6 A;  3D2P A;  2W21 A;  2RD5 A;  3U6U A;  4NDO A;  3LL9 A;  2A1F A;  3LKK A;  1E19 A;  2J5V A;  3QUR A;  4NDQ A;  4F6T A;  4Q1T A;  2BTY A;  2JJ4 A;  3C1M A;  1OHA A;  4NDR B;  3ZZI A;  1YBD A;  4JZ9 A;  2OGX B;  3K56 A;  3TVI A;  1OHB A;  1GS5 A;  2X2W A;  4A7W A;  3B8G A;  3D2M A;  3K52 A;  3WWM A;  2J4J A;  4NDO B;  4NDR A;  2HMF A;  2WE4 A;  1B7B A;  2JI5 A;  3S6H A;  2WE5 A;  4NDQ B;  4F6T B;  2JJX A;  2BMU A;  3C1N A;  3WWN A;  3QUN A;  3AB4 A;  3QVF A;  3AB2 A;  2BRI A;  3KZF A;  3L76 A;  1OH9 A;  4NDP A;  3ZZH A;  3ZZG A;  4OLC A;  2V5H A;  2BRX A;  2IJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...