1ZA4A

Crystal structure of the thrombospondin-1 n-terminal domain in complex with arixtra
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
b'SVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin 1
molecule tags Cell adhesion
source organism Homo sapiens
publication title The Structures of the Thrombospondin-1 N-terminal Domain and its Complex with a Synthetic Pentameric Heparin
pubmed doi rcsb
total genus 47
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2005-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1za4A00
2GDFA 1G9CA 4XJUA 2UWAA 3ZXJA 3ZXKA 5DZGA 1W6MB 3IPVB 1LGBA 1W0OA 1GSLA 2JECA 1LU1A 4P14A 4Y24A 5CBLA 1Q8QA 3OPZA 3N7KA 5H9PA 2KM2A 5F9TA 2RHPA 2YZ4A 1VAMA 1AZDA 2VW0A 1DIWA 3W59A 1MACA 5KXCA 4LBNA 2E51A 4K1YA 3ZSMA 2ARXA 3WNXA 3LSEA 4UW4A 4YG6A 4Y22A 4U2AA 1HDKA 1UL9A 2D6LX 1APNA 4XMAA 5IK4A 1N3OA 1FATA 3OY8A 3POYA 2AR6A 2UWBA 2DVBA 3M2MA 3V0BA 1W6NB 2ZZJA 1S0EA 1DHKB 3AXDA 1SACA 3MPPG 4FPLA 1V6IA 5DUXA 1JYIA 4YG0A 3ZYRA 3GNEA 1AX1A 1FYUA 1SCSA 1SLCA 2DVGA 4YGBA 1UX6A 4Y1YA 1CJPA 1LOAA 1MZ6A 1DGLA 2AH2A 3V0AB 4YW2A 2UU8A 3W58A 1HKDA 2JE9A 4FP2A 2R1DA 4ITCA 4P9XA 5HCFA 1AJOA 2DVAA 3ASIA 2OUHA 1N1SA 1HQWA 4Y1ZA 1JYCA 2ZGTA 3AZYA 4M3CB 4AVTA 1KRIA 4XXAA 1W6MA 1ULCA 1NXD1 2OW4A 4JRAA 3V64A 3B69A 3L2YA 3NWKA 4DRRA 3M3CA 4AYUA 3DGTA 4F83A 1MVEA 2WT2A 1WBFA 1CQ9A 4LBQA 1Q8PA 4XZPA 1C4RA 3JUUA 2DU0A 1BYHA 1DQ1A 2G4IA 1LCLA 2ZMKA 2A75A 2GMEA 2FHRA 3ILRA 1YYNA 1H30A 1N3QA 3AJYA 2E53A 1LJ7A 2B7YA 3N36A 3MEPA 2ZGMA 4FPCA 1LOBA 1Q8OA 1SBFA 2PHWA 3RMXA 1SFYA 3HMYA 4XE9A 2D6KA 4UW3A 2BQPA 3ZSJA 4FVVA 3BODA 3NV3A 4AGRA 1G9BA 1MS8A 1PZ8A 1LODA 4BLIA 1WW5A 1VIWB 2VY0A 4FP3A 3OBTA 5DZFA 3MW4A 5T52A 3N35A 1Z78A 2DV9A 4YG3A 1CIWA 1UPSA 4HL0A 2GMPA 1VAVA 3D4KA 2R1BA 5FREA 2WT0A 1BJQA 1V6NA 1LEMA 2ZMNA 4FQ4A 3PJQA 2E7QA 4YM0A 1FX5A 2EAKA 2NM1A 1UZYA 2VW2A 4XTPA 5FRAA 2W08A 4YFWA 1MS0A 3R05A 2AUYA 2FMDA 4GWMA 2D43A 5CNAA 4XJWA 2YY1A 1H9WA 2ZGOA 4FPJA 3WUDA 3IN9A 3WHUA 5DXDA 2OUJA 3QLQA 4IQPA 3POSA 1S0CA 2D6MA 5JOYA 3V0BB 2NN8A 4R9AA 4Q1PA 3BTAA 3ILFA 3TAYA 3VKFC 2UWCA 1ZM1A 1DQ4A 2PHTA 5GM0A 1LHOA 1SLIA 4YZ1A 1MS3A 3N7JA 5CB7A 3R4UA 4Q1RA 1LOEA 5SV8A 3ZXFA 3PVNA 2CWSA 5JOZA 2ARBA 2EXJA 3T1LA 1JUIA 1LECA 2TEPA 3AYDA 3AYAA 1ENRA 3O0VA 2OVUA 4ISRA 4XILA 4ZKTB 3B9CA 1GKBA 5GLUA 1W6PB 3N7MA 1F5FA 4XIKA 2A3WA 1Y7BA 4AVVA 4D69A 3SLIA 1QNWA 3ZSLA 5BYNA 2DURA 2A70A 1DBNA 1OKQA 4Y1XA 2DUPA 1Z0HA 1AJKA 3SH3A 3ATGA 3D6EA 3WDYA 1S0JA 1IKQA 1QKQA 2WKKA 3H0OA 1C57A 1LULA 2A3XA 1QDOA 1LOGA 2ZGNA 5EYXA 2ERFA 3IMNA 4XMIA 1PZ7A 2P37A 1N3PA 3OGGA 5GZCA 2EXIA 4YW4A 3WG1A 2ZHMA 3A4UA 4FQZA 3SH4A 2DWRA 3BIWE 4WV8A 3O5SA 5KXBA 4GALA 5T5OA 5H9RA 2EXKA 3HR9A 1FV2A 3OJBA 1C1LA 1UN1A 1IS3A 1S0BA 2SBAA 3D5OA 2I2SA 3OY8B 1UAIA 3RMYA 4DS0A 2GNTA 3HN1A 2CTVA 1W6NA 2ZBJA 5IK8A 1SLTA 2EF6A 1KDKA 1GNZA 3M1HA 5GZDA 3UJOA 4Y20A 3ZYPA 4CRQA 1GZCA 4RA0A 2R0HA 4TYSA 1DZQA 4L8QA 4WVVA 2ZGSA 4Y1UA 2WSUA 4XYXA 1FV3A 1VALA 2D3PA 4LBOA 4DRVA 3WZ1A 4Q27A 3QCWA 2VH9A 4GKXA 2GN3A 1KJRA 2D3SA 3ILNA 2AREA 1BZWA 4KBBA 4R9DA 4NOTA 4YW5A 2P3JA 4XHBA 3NV2A 3WG4A 1AX0A 3A0NA 5T54A 2ZHLA 2CNAA 1RITA 1GZWA 2DU1A 2VW1A 4P9YA 4UW6A 5E88A 4YW1A 1WBLA 2R0FA 4PQ9A 3UL2A 2GNBA 5EYYA 3ZPYA 1MZ5A 2ZACA 5EWSA 1QOOA 2CY6A 3MW2A 3KQRA 1PZ9A 1N1VA 2PHUA 4HANA 2DTWA 3AP7A 3KM5A 4XHXA 3T2TA 4PCRA 4FPYA 4MYEA 5GZGA 1S1AA 5AVAA 5H9SA 2P3KA 4XIOA 2XG3A 1BXHA 4W65A 4Q2FA 4XDQA 1ULFA 1GZWB 1JXNA 4FPGA 1OFSA 3WLUA 4LBQD 1MS4A 2Q5TA 4GA9A 3U4XA 5T5LA 4FPKA 1AX2A 1LHVA 1SBDA 2C9AA 4FPFA 4FPHA 1H9PA 4RL7A 1JW6A 4ZXKA 2A7AA 3RS6A 1V6KA 1WLWA 2JE7A 3WDWA 1KITA 4CTEA 3WUCA 3N3HA 1W6QB 4PBPA 5HCBA 5L73A 2A71A 1N1TA 2ENRA 4K21A 4Y1VA 1WLDA 4U36A 1ULDA 5IUQA 1DLLA 1R1ZA 1CN1A 5EXOA 1MS9A 3AP9A 1J1TA 1TEIA 1QF3A 1WUVA 2P34A 2NYYA 4XTMA 2DVDA 5F5QA 2A6XA 3WDXA 5DUWA 5JDBA 1W6OB 2E6VA 2NMNA 4FOQA 4WZFA 1MVQA 4YM2A 5IK7A 2VXRA 1AXKA 2ZABA 1JOJA 1V6LA 1ULGA 2H0BA 3USUA 1GANA 5T5JA 4YFZA 5JOXA 1QOTA 1JN2P 4FPOB 2EALA 1LHUA 1EPWA 4R9CA 3VKMA 1GYKA 2ZA9A 3APBA 4FOYA 5DUVA 1U0AA 4FOVA 4Y20B 3RRDA 4LBJA 1MS1A 3ZVXA 2R49A 3LSDA 4PBOA 4WVWA 5E89A 1DYPA 1FNYA 4UW5A 2PHRA 5JVVA 3VUOA 4YLZA 3AK0A 5KXDA 3Q9OA 1W6PA 1ZA4A 4DPNA 3AYEA 1UMZA 4Y26A 3M3EA 5DG1A 2AGSA 2XB6C 2YXSA 4Q8KA 1QOSA 2VUAA 3ZXLA 1QDCA 2JKBA 2ZAAA 1G9AA 4M3CA 5JOWA 1CR7A 1DQ2A 4Y22B 4BMBA 1LGCA 1VLNA 3AJZA 3USUB 2E7TA 1KQRA 1V6JA 2P2KA 4Q26A 1YXWA 3T1MA 3AZXA 3ZSKA 1LEDA 3B01A 1B09A 1IS6A 1GLHA 3O12A 2DUQA 3VKNA 1WD3A 1I3HA 3VKOA 4ASMB 1YIFA 5IT6A 2GN7A 3AP4A 3CNAA 3OBRA 2R16A 3WHTA 1F31A 2WLQA 4AVSA 4XJAA 4BMEA 4NO4A 3O0XA 3B00A 1W6OA 1A8DA 2A6YA 3FLTA 5GZFA 5E8AA 1C1FA 2DYCA 2D6PA 3VV1A 3AFKA 3SH5A 2AYHA 3AZWA 3GALA 1XQNA 4Q8LA 3WOGA 4BQ1A 3PVEA 4XJ8A 1V00A 1AXYA 2JDZA 4ATFA 1LESA 1YRZA 4DFSA 1DQ0A 1SLAA 4AGGA 2W39A 1G8WA 1LOCA 4M01A 2ZGRA 5JMCA 1S0IA 2PHFA 4XBNA 1DQ6A 1IOAA 4H55A 4M3CE 2D44A 1S0FA 3B3QE 4YZ2A 1YI7A 3WV6A 3AYCA 1JHNA 2YROA 1IKPA 5GZEA 3RQ0A 3WDTA 4ATEA 5JLVA 2D6NA 5HCAA 1WD4A 1YO8A 4SLIA 4XXPA 2ZGKA 3UJQA 1MS5A 1S0DA 3R4SA 1F9KA 1OQ1A 3OYWA 2Z42A 3PVOA 4YM3A 5KXEA 2NZ9A 5LK5A 3UK9A 2YV8A 1WW6A 3MW3A 3DUIA 2ZKNA 3FFZA 1ONAA 1V6MA 4ISQA 2VU9A 4TZDA 1CPNA 4XOGA 3AZZA 2ZGLA 4XBQA 1N1YA 5T55A 1AF9A 4CZSA 3LCPA 3AP5A 4BLJA 1D2SA 1CVNA 2D6OX 2WQZC 1JBCA 1GNHA 1A78A 3FLRA 4GKYA 3WVJA 1GV9A 2ZHNA 3JU9A 4YZ5A 2V5YA 2D7FA 5GJ6A 1QGLA 2DTYA 4M00A 2UURA 4R9BA 4PF5A 1UZZA 1QNYA 4C1XA 3FBYA 2GALA 1QU0A 5CAZA 2CWMA 1WW4A 5H9QA 1BQPA 1LOFC 3O0WA 2GNMA 4XJZA 1URXA 3I4IA 4YGDA 2AENA 1G7YA 4OZXA 2EXHA 2W52A 4GWNA 1A3KA 1DQ5A 1W6QA 1V6OA 2C5DA 1WCSA 2GMMA 4M3CF 1SLLA 4FOWA 4AWDA 4BOWA 1HLCA 1ENSA 4AGVA 1Q8SA 4JCKA 4LBQB 2A3YA 3WG2A 3WDUA 4Z8BA 1IS5A 2DVFA 1LHWA 2PELA 5T50A 2HYKA 5DG2A 2CYFA 2ZHKA 1N47A 3OYWB 3SNMA 2A6WA 1LENA 5DZEA 2A6VA 4XBLA 3TB0A 3AZVA 1GBGA 3SITA 1RINA 1LHNA 2CL2A 2WNEA 4LBMA 4YM1A 3V65A 3FUOA 3WCSA 1SBEA 3AX4A 1LU2A 5GLZA 4K1ZA 3INAA 2WT1A 1AXZA 3AXEA 3BOPA 1Q56A 3M3OA 2ZGPA 1CESA 1MR5A 4YGEA 1GZ9A 2ZMLA 5GLTA 4BPZA 4I30A 3AP6A 1RIRA 1G86A 2SLIA 2EIGA 3IM0A 3SISA 4YZ3A 2V73A 1CPMA 1ENQA 3IPVA 1Q8VA 1O4YA 2GNDA 3V0AA 3I8TA 3C2UA 1FNZA 5IK5A 4LBLA 1AVBA 1LGNA 2A5ZA 1KDMA 3M3QA 4YW3A 3FLPA 1BKZA 2NMOA 4JC1A 2D3RA 5GALA 3WG3A 3FUQA 3IKWA 4DQAA 1ULEA 4BM8A 1D0HA 1DFQA 4YZ4A 2LALA 4C1WA 1X50A 1HQLA 4LBKA 2PHXA 4P9WA 3VKLA 3NV1A 3PMEA 4XJ9A 2ZGUA 1WW7A 2ZGQA 1UKGA 3A0KA 5CA6A 1GICA 2JJ6A 3NV4A 2JD4A 2A6ZA 3POWA 2P3IA 3WDVA 1DYKA 1LTEA 2WJSA 1G9DA 1IS4A 2DUOA 2YMZA 5T5PA 1LOFA 1CONA 4FPEA 1NLSA 1QMJA 3ZXEA 3N7LA 1SCRA 1O4ZA 3WCRA 2ES3A 1FAYA 1W0PA 1S0GA 5GLVA 3RSJA 4K20A 2WSVA 4GXLA 1G9FA 1SLBA 1I1EA 4YGCA 1KJLA 3ENRA 2LTNA 2W68A 5DUUA 2NP0A 1WLCA 5GLWA 3RG0A
chains in the Genus database with same CATH superfamily
1G9CA 3KB5A 4XJUA 2UWAA 4QGMA 3DPRC 2P4EA 1RUI2 2XBO2 3AB0A 4LITA 4GWJA 2QQMA 1YHFA 2J42A 3BU0A 4EZ4A 1W2NA 5H9PA 4NIAA 4XUQA 2QQOA 3JD71 1O59A 3POGA 4CDXB 5F9TA 2YZ4A 3W59A 1VAMA 1AZDA 4DB5A 4DINB 5A6YA 2RS32 2FDJA 3FN9A 4CU7A 4QDSA 3ZSMA 5BY5A 1CGPA 4CEYC 4Q4Y3 4Y22A 2WWUA 5A3PA 1ZYBA 1VRBA 2D6LX 2QBXA 1PO21 4XMAA 1XSQA 3CU7A 4IXLA 2P3YA 5IK4A 2AR6A 2DFBA 4P00B 2RS53 1JOPA 2B9VA 4UWDA 5LEJA 2ZZJA 1S0EA 4N9IA 4AI8A 1MEC1 1SACA 2JG8B 5JPNB 4IV3B 5EFUA 5IATA 2RDSA 1C8M2 1R092 4YG0A 4RN5A 4DUVA 5FUPA 2JEMA 4YNIA 2BGPA 3NAPC 4YGBA 4A7KA 4CP2A 3RZGA 2XLAA 2HKXA 1CJPA 1ZBA3 5FZ9A 2XWJB 4Z07A 4CDQA 5BNNB 3AFGA 2UU8A 4NMIA 2HWF3 2BPA2 3UT0A 1GP5A 1RVF1 5HCFA 2OUHA 1W90A 4JGYB 2WQ4A 3H3UA 4XUTA 3MIDA 1HQWA 1B35C 3I2HA 4Y1ZA 1JYCA 3AZYA 2VUDA 1RUC2 2VL4A 2OIIA 5JSOA 2VZ3A 1NXD1 2R043 4MGKE 3NWKA 3H8OA 2MEV3 4EROA 4DEQA 5IVFA 3DGTA 2WFF3 1CQ9A 2JDAA 4LE3A 2W1SA 3PUAA 2RDRA 4XC9A 3WQ0A 1PVC3 3H8RA 4KG8A 1GWKA 3MF6A 1A6CA 3CMGA 1ZRRA 4XF9A 3MV01 3K48A 2NLRA 1RJ7A 2VMGA 1DZTA 2ZGMA 5JSRA 1IGOA 5K4LA 1SBFA 3W5NA 4AEMA 1G6NA 1HB1A 1SFYA 4MGYE 3HMYA 1H6XA 1VBC2 3POBA 1HRV3 1JU4A 4L11A 1H2MA 4Q4W2 4XF1A 3ZSJA 2BRTA 4LEJA 2WS91 1J59A 3PUQA 2BFUS 5A32A 4QWNA 1VIWB 2KR2A 4KNCA 2QFEA 1BK0A 2PLV1 5T52A 2J1EA 3VBRA 1Z78A 1AR83 2DV9A 5FP4A 4CDUC 2YBKA 3FJSA 4LHKA 3TNQA 1V6NA 1BVVA 3Q8EA 1C3HA 2PN5A 3I2FA 3PJQA 1C5IA 5EQUA 1H2NA 5FZ1A 1WKYA 4JX0A 4Q4W1 4YM0A 2EAKA 2VW2A 4FTSA 1Q3EA 1PGL1 2W08A 3LQCA 4OQ9A 4MVTA 4IEZA 3I54A 1HW5A 4YFWA 1OQEA 5ABJA 1MS0A 1O6UA 5DAVA 1TNFA 2FMDA 2GAUA 4DUWA 4AE2A 5CNAA 3M4FA 5LZ6A 4KG0A 1XNBA 1H9WA 4MXWA 4QM9A 3WUDA 5DXDA 2OUJA 1PO12 4UAPA 4CU6A 1H0BA 4JKKA 3V0BB 4I0BA 2JD9A 1PK6A 4EWEA 1L3JA 2VCAA 1ZM1A 4NAMA 5GM0A 4YZ1A 4L92A 2JENA 5CB7A 4Q1RA 3ZXFA 4OVEA 4D7TA 3PVNA 2KXLA 1OH4A 2Y38A 3CBNA 3T1LA 3MGUA 5JOZA 1W28A 1X8MA 1LECA 4BHPA 4EJRA 4ISRA 4ZKTB 1U5ZA 1ST8A 1W6PB 1F5FA 4N90A 5FOJB 4IV3C 4AVVA 1XYOA 4ZU4A 3SLIA 1QNWA 4WM7C 4Y1XA 5T3NA 2DUPA 5FQ0B 1AJKA 1PGL2 3ZYIB 4CXXA 4OI0A 1ND3C 2BVVA 5F6KA 5K0UA 5F3GA 2HEVF 1C28A 3WDYA 2WZR1 1LAJA 1S0JA 1IKQA 3BTZA 2ET1A 4A41A 3H0OA 4BJ0A 3FHIB 4A3ZA 5LY1A 3DEMA 3KWVA 1QDOA 5EYXA 4ET7A 1VBA3 2WA4A 5IJRA 1XNDA 5A70A 1UYPA 2Q1FA 2I07B 3M7AA 3OGGA 5GZCA 2EXIA 2VOWA 4AEKA 3ABZA 2W1UA 2X8KA 3UGHA 1PO22 3RJ2X 1NKGA 3SH4A 4AFAA 1COV1 1DGWA 3LE0A 4W8JA 1GQHA 5T5OA 3NNMA 1UZWA 5FZOB 3WSOA 2ZX1A 4WBBA 4AVBA 1ZZ6A 5I0TA 1S0BA 2YFUA 3LFMA 4DS0A 1UAIA 1YJLA 5JWPA 2VUJA 3U4SA 4IUGA 1AR61 1SLTA 5GZDA 3D82A 4D6RA 5FO7B 4BYYA 4R4ZA 4Y20A 5FPUA 5JXHA 3WP5A 1GZCA 2VOKA 4MGQA 4TYSA 3ZIXA 2HWF2 4CA9A 1UD1A 2VCBA 3NVCA 1M06G 4Y1UA 1K5MA 2WSUA 4DO0A 3ZLIA 4QD2A 2WFPA 3WZ1A 4Q27A 4ZU5A 5C71A 4QKFA 3U10A 2GN3A 4IESA 5DAWA 5J48A 4WM8C 1ZRCA 1LNSA 4ZZ8A 1FPN2 1UYYA 1AYM2 3S6PA 1HIXA 4HFSA 5E16A 3WP6A 1AX0A 4XF0A 1HN0A 1J83A 4WVMB 2ZHLA 1ODNA 2DF7A 3AKSA 1PM7A 3NJZA 2PXJA 1WBLA 2GC1A 4QHOA 2GNBA 1WA4A 3MBWA 3W5MA 2WZ8A 1POV1 1PZ9A 4GQ7A 2XUMA 2TNFA 4E8DA 2FMYA 4PCRA 4FPYA 5GZGA 1NCRC 1UY3A 2E63A 2Y0OA 1H2LA 5FY1A 3M3IA 1X9TA 5H9SA 3ZFFA 4IEPA 2RMU3 3FC0A 3UGGA 3SKJE 1O3RA 4Q2FA 2QCSB 4FPGA 3WF2A 3GZUC 2QZ3A 2PA7A 4XF3A 4CUBA 1BHGA 5J09A 5T5LA 3C7OA 3WF4A 5HXVA 1H9PA 1BCXA 2Y6LA 3AMPA 2B46X 2VNVA 3AC0A 5JZGA 3RZKA 1MEC3 1QH6A 1NAEA 1V6KA 1WLWA 1JMUB 3OD0A 5FK7A 4WVZA 3N9PA 2YDEA 4QPGA 1H8TC 2AACA 4FI9A 4CTEA 1T6GC 3N3HA 5KWRA 1ND2B 4E4SA 5L73A 4D8MA 4UBGA 2A71A 1UOJA 1YUDA 2ENRA 4K21A 4QX7A 2XR4A 4CXYA 2WNUB 5J36A 2WNVB 2RR12 1GOHA 4XCAA 1PGW2 1CN1A 1DGRN 3KSCA 3NKGA 2WZPP 2EICA 2Y60A 3EHKA 4CP0A 2BNMA 3GDBA 1X36A 2A6XA 2Y6JA 4CP9B 2RM23 4UBHA 3GBGA 2PMWB 1QY4A 4WZFA 1MVQA 2FZ1A 2R041 3UGFA 2ORZA 5IK7A 2K9ZA 1Y4WA 5A3WA 2XQXA 2ZABA 3UYJA 1ULGA 5F3EA 5T5JA 5JOXA 2RDNA 1GFF2 5TSWA 4JGYC 1REEA 1NLQA 1YNAA 1LHUA 2IFWA 2QQNA 5CVRA 4PHZA 2RS52 4AEDC 1GYKA 3WY6A 3APBA 5DUVA 4FOVA 2ID4A 4C0BA 2J7MA 3IDCB 4LBJA 4RR3B 4HVQA 2R49A 3LSDA 3BIEA 3DV8A 1KXGA 2VVEA 3GXUA 4WVWA 1FNYA 2WYSA 2PHRA 4YVSB 3VHOA 3DL3A 5FKCA 2Q8CA 4XVHA 4YLZA 3AK0A 5JXGA 1VAKA 4LKEA 1LR5A 3J8F2 3M3EA 1QQP3 5DG1A 3C7GA 1F2NA 1WMXA 2XB6C 2YXSA 2OQ7A 2VUAA 4K9SA 5FAXA 2ZAAA 3U78A 1RUH1 4CCOA 4HMZA 4MX3A 1G9AA 2ATFA 4XUNA 4JKMA 1XU1A 1LGCA 4CDQC 2FDIA 1O5UA 3FMGA 3NMBA 4Y4RA 3AZXA 4KQ7A 5I8TA 2QQUA 3B01A 5A1LA 3C8XA 3O12A 3PIGA 3OGRA 1TQ5A 1I3HA 1WD3A 3FWEA 1VBB3 2GN7A 2VBDA 1JYVA 2R16A 5IFPA 5J3UA 1PMHX 3NJYA 4XJAA 3RVHA 1DYOA 5FPLA 2OKXA 5FYSA 1VRH1 4W6WA 1A8DA 2ORXA 4FFIA 2WNUC 5IVEA 2HH9A 3T2OA 1AYN1 2VMCA 2F17A 1D4VB 3BYWA 5A7NA 1LESA 4E4DX 3VBUB 2Y26A 1DQ0A 2YPDA 2W39A 5A80A 3I3DA 1VMHA 1ZZ7A 4XBNA 2ZX2A 1IOAA 2C9KA 3GJBA 3CJIA 3HOBA 1ALYA 3WV6A 2MEV1 3U1XA 2CDOA 4DXTA 2OQ6A 3H9AA 3THCA 4XXPA 2ZGKA 1UOGA 1OOPB 1PK6C 4XFCA 1S0DA 4JTOA 1F9KA 4RD7A 5D8AC 4D94A 4BQ4A 3OEBA 4GZ9A 2L9LA 2QQIA 2RDQA 4PIYA 2BTVC 3FX3A 3EJKA 3VBRC 2DCZA 2WZR3 1VMJA 4YVSC 1RUG3 5CYYA 2ZKNA 2DBNA 1CAUB 4TZDA 2XJVA 4XOGA 1ZA7A 4XBQA 5T55A 3O1RA 1D4M2 2FQPA 1I6XA 3RI8A 2WQZC 1JBCA 4QAWA 4GKYA 3O1OA 1L7QA 2ZHNA 3I2KA 4FT8A 1RUI1 2XBO1 3BVCA 5A7OA 2V5YA 2VZRA 2FCUA 3D3AA 3OSDA 4OHWA 1ACCA 3VBHA 1YFXA 4PF5A 3VZMA 2YU1A 2ZJCA 3ZSEA 2Y6KA 3GHNA 4K8RB 4N53C 2XH6A 4GMP1 3HN3A 5H9QA 3KGLA 1LOFC 5LWBA 2GNMA 1HB2A 1GQGA 3I4IA 4M4RA 1OUSA 2AENA 1NE6A 4Q4X2 3SCFA 3OEAA 5FPBA 1DQ5A 1GU3A 1W6QA 2C5DA 1WCSA 1HXS1 1OD5A 3FFQA 3OCPA 4FOWA 4V2WA 3SEPA 1ENSA 4UI9L 3AMHA 4AGVA 4OULA 3WNOA 1VJ2A 2WNUA 1Q8SA 4HKOA 4JCKA 4LBQB 2UYAA 2IXKA 3H42B 1IS5A 4AHXA 1JH5A 3WD5A 2P1BA 2BOIA 5T50A 2ZS6B 3BALA 3T2QA 5DG2A 3BU7A 4BE3A 1N47A 3SNMA 1LENA 4BH9A 4E2GA 3TB0A 2CDPA 3ZDSA 1KS5A 1K5MC 1RINA 3POEA 1LHNA 1OT5A 3KMHA 2VZPA 2VZUA 4K1ZA 3BOPA 3AXEA 3M3OA 1Q56A 5C6CA 3H8UA 5GLTA 4DXZA 4BPZA 2DCKA 2ETEA 3JBG3 2VQTA 3WQ7A 1OPOA 2W47A 4QPGC 1A34A 4YZ3A 1KEXA 4B8EA 3T0BA 2RVAA 1NY72 1O3TA 3N9NA 1Q8VA 2LROA 2BVBA 1OA3A 3CIHA 4GULA 5FP8A 1BLZA 3LF7A 5LA9A 5G05L 3VBSC 5IVJA 4LBLA 1KDMA 1CZVA 1D4M3 1HV1A 1PNFA 2X5IB 4IEXA 4YW3A 3FLPA 5KHIA 1EV13 2R7EB 1NE4A 1H1IA 3H50A 5GALA 3VBOB 1POV3 1ULEA 1VBE3 4B1MA 1EYBA 5ACA3 5JIUA 1OLME 1DCSA 2XPJA 1DFQA 3OTFA 4I01A 1R1A2 2LALA 1Y3TA 3AKRA 4YZ4A 3ZFEA 3MIFA 5HCHA 1C8M3 1R093 2EA7A 1QWRA 3R0RA 4KGGA 3KF5A 3MICA 4YWAA 3DYMA 3HAGA 4IEVA 1F8VA 2ZGQA 5FFOC 1UKGA 1GICA 2KD7A 2JD4A 5EHDA 1PM4A 2PQQA 3I2DA 3LA3A 2XKOA 3ACIA 1DYKA 4UYBA 1BEV2 5F2SA 2YMZA 1CX4A 1NLSA 3PNAA 4TLGA 5FV3A 1EY2A 3PUSA 5I0UA 1FAYA 3RSJA 2Y33A 3E6CC 4K20A 2WSVA 2WIIB 1SLBA 1YFYA 2O8OA 1F35A 2V72A 2X53S 1FOD2 1I1EA 3OBZA 1MPXA 1GZTA 1YIPA 2BFUL 2LTNA 1Q43A 2W68A 3ES4A 3IDEA 1AL23 4QX3A 4ASLA 3SKVA 5GLWA 1PX3A 2JDPA 4CEWB 1AYN2 3K75B 1QJY2 1W6MB 1LGBA 2BNNA 3OPWA 1GSLA 1LU1A 5CBLA 1OLMA 1Q8QA 2BYVE 4EWAA 3PIJA 1NCQB 2GP3A 3T0DA 1F15A 3U14A 4AHWA 2VZVA 2RHPA 3I7DA 3K46A 2VW0A 4N53B 1DIWA 5EZWA 3WF0A 4OFGA 1ZZCA 5FXWA 4K1YA 2WABA 2ARXA 3WNXA 3K3OA 1O8SA 1H8TA 4RQPC 3VBFA 3I59A 2YC4A 2Y0IA 5FY4A 3EBRA 4HXCA 5C3RA 1PNGA 4NAOA 3NJXA 1W8ZA 5LBEA 1UL9A 3ZN4A 1APNA 4YVWB 1FATA 2BW8A 4XFAA 5L9RA 3URFA 4LORA 4HVOA 2DVBA 3LZZA 5ANQA 2JX9A 1CAXA 5DUXA 3AXDA 1DHKB 4IV1B 2Y34A 3J8F3 3MPPG 3HT1A 5CG8A 1GWMA 4Q4Y2 1AYM3 2ZOEB 4QB2A 1PX4A 4JHTA 3ZYRA 4JGZB 3H1YA 1YJKA 3HQUA 3TEZA 1DG6A 1VBC3 1HN1A 3QBQA 3ZN5A 1RUE1 2WN2A 1LOAA 4MHUA 4QXKA 5JAXA 4YW2A 1HKDA 2WA3A 4ITCA 5DAPA 1HJGA 3KVBA 2VCMA 1ASJ2 3OG2A 3UKNA 2DVAA 4QX5A 4COYA 4DZGA 1N1SA 2H6BA 3BPZA 2JXAA 2OZJA 4H7MA 1FXZA 3LB9A 5CFDB 4M3CB 3TNPB 3HD8B 2JG8C 1JTZX 2XKPA 4CVUA 2GC0A 3B69A 4E4ZA 2FDKA 4FTEA 3ZOIA 4F83A 1Y9QA 1VBB1 3LOIA 1IHMA 5EV7A 4XZPA 3A22A 2DU0A 3OBAA 1UU6A 2YBSA 1W9TA 1VRH3 2A75A 2FHRA 1NA1B 2GMEA 3LA2A 3NNLA 1ND3A 5K0UC 1VB4A 1W06A 2RE9A 1RUG1 5C3OA 1LOBA 1Q8OA 4KU8A 3IAPA 1OI6A 2PHWA 3KT1A 4WM8B 2FD8A 4UOJA 1UY1A 4A6OA 4E8CA 4XDOA 5F32A 3JXSA 2YG0A 1UKRA 4B4PA 1RHI2 3BODA 3K3NA 3Q8AA 4AGRA 1BMV2 4UFKA 1WW5A 2LRPA 2VY0A 4J1WA 3OBTA 4IE7A 3OGJA 1RUI3 2XBO3 5FZKA 4A42A 5AC93 1JYWA 2GMPA 5FY8A 2CGNA 5FREA 4MGSA 4IETA 4FQ4A 3UESA 1QJU1 3Q8FA 3U75A 2NM1A 4D6QA 5JR2A 4XTPA 1B35B 1JZ5A 1JZ8A 4RFT0 3TN93 2HWD2 5FRAA 2ZCWA 5C3SA 1X7NA 4DEVA 4OUEA 2CSGA 2GZWA 2OYZA 3KCYA 1RYYA 4W6YA 1VP6A 4FBFA 3I97A 1UIJA 4X6RB 4H3WA 2HWE2 3IN9A 3AM2A 4ARYA 1VBE1 3VD7A 1KFXL 3QLQA 4HK9A 4IQPA 1W0NA 1A8MA 3LA7A 4KBZA 4EV0A 4R9AA 4XF4A 4JDNA 4KU7A 1OOPA 1K5JA 3FL7A 1IG0A 1NA1A 3BTAA 3KQ4B 5DAXA 1GWLA 1XU2A 2UWCA 2WO1A 1FPN1 5BV6A 1LHOA 5C4WC 3ZMOA 5JPMB 1FI2A 1K45A 1NQDA 3IMMA 3N7JA 4N43B 5SV8A 5G04L 4S2HA 4A44A 2C6SA 3VBSA 1YQ2A 4Q4V1 4GMP3 3KVAA 5I8YA 3VBSB 3B9CA 3ETQA 4G9SB 5GLUA 5IWFA 4QX1A 4XETA 4BQ2A 3ZX7A 5FP3A 5B4XA 4L2NA 3VBUA 4D69A 3GYDA 3ME2A 4IE6A 2JDUA 3ZSLA 4GB33 5FMDA 2DURA 2UY8A 2YBPA 4C0HA 3MDPA 1O4TA 2O14A 4B7KA 2HWD1 2VZOA 5LY2A 2LW8A 1FMD3 3D6EA 3D8CA 3B7MA 1U5YA 2IVJA 2V5DA 2GH2A 1VPHA 3ZXAC 1QJX3 3UETA 2WNOA 4OMDA 1C57A 1J1LA 1LULA 1H8VA 2A3XA 2ZGNA 1RUD2 2ERFA 4P9JA 3IDBB 1PZ7A 2HJIA 1RVF3 3VL8A 2JWPA 4ZONA 5HBAA 1N3PA 3TEYA 3O1MA 1E5RA 3OGVA 1GOFA 3TBDA 2ZHMA 4FQZA 5FWJA 3ZFGA 1XBFA 4MSVA 3RI9A 1SZBA 4NN0A 4WV8A 4FCAA 4A7YA 5KXBA 5H9RA 2ZX3A 2VGDA 3O7OA 2W1QA 3HR9A 1FMD2 4YVWA 4OCTA 3D5OA 4JV4A 2VO5A 4E4HA 3RMYA 4NRQA 5A1AA 2GNTA 3ORJA 1XNAA 1IQAA 3HN1A 1PO11 1W6NA 2CTVA 2ZBJA 4QMAA 2XVLA 2VBBA 5F6LB 2RG4A 5CFCB 2YC0A 1EV12 2R071 3ZYPA 4ZS3A 2ZEWA 2VNRA 4QB1A 4A7ZA 1SMVA 4WVVA 4L8QA 1JODA 5LASA 1JZ2A 3E5XA 3WQBA 4XYXA 3BB6A 2Z2SB 2G1MA 3J8F1 3U0ZA 4KH9A 1T6BX 3PUHA 1W8NA 3KV4A 3MFCA 1D0GA 1BZWA 4KBBA 4R9DA 4NOTA 1RUJ1 2FDFA 1UW8A 4XHBA 5C8CC 4QHBA 5T54A 3RZMA 4IGPA 4RGAA 4CEWA 3PLQA 3CLPA 1GZWA 3QOPA 5E88A 4YW1A 4CDWC 2JE8A 1RL3A 2VJXA 1ASJ1 4QPYA 4MADA 3ZDVA 5EWSA 3GCWA 1QOOA 2CY6A 2G9GA 3KQRA 1OFNA 1N1VA 1DZRA 2PHUA 5FZMA 5BNOB 1RUE2 3AP7A 1CX1A 3HJRA 2YGMA 3T2TA 5BUVA 1UZ0A 5FY0A 4N7UA 1DP0A 3LIHA 2BBAA 3JBG1 5C9AC 2P3KA 2XG3A 1QH7A 3SMHA 3VDBA 1I9RA 1GZWB 1H1AA 4NHLA 2WYFA 3WLUA 3FBMA 4IW3A 2JG9C 1NCQC 4EN9B 4NRPA 5A7SA 2PQSA 3RZLA 4QX2A 4FPKA 2OT7A 2C9AA 2OS2A 1JW6A 4LIVA 3MLLA 2VNGA 3RS6A 2G19A 3OUHA 2JE7A 3LFIA 5FO9B 3WUCA 3IDAA 1VBC1 4YYOA 4OI1A 4PBPA 4WZCA 4BK4A 4CYDA 1N1TA 2J1VA 1H4HA 4Q0PA 5L19A 4YSFA 1ULDA 4UT5A 1E5HA 3HEIA 1R1ZA 3OF1A 5EXOA 1MS9A 5A3OA 3RWKX 1W9SA 3ZFFB 3SHRA 5FZHA 2BGCA 4NUBA 2XLFA 1ODMA 1NQJA 1GMMA 3ZR6A 1NG0A 3DN7A 1IPKA 5JDBA 3PL0A 1W6OB 2E6VA 1S2BA 1X8EA 3OOXA 3HPNA 2V09A 1L7RA 1AXKA 4YFZA 1JOJA 1RUC3 1V6LA 1GOGA 4LO8A 2Y8KA 4NPRA 4KWLA 5HV0A 2ADDA 3NSTA 2BU9A 3KS7A 4FPOB 2K46A 3T08A 2BV4A 1EPWA 4R9CA 5CG9A 1U0AA 1STMA 4XUPA 5FXVA 3ACHA 4XDPA 1MS1A 1XC6A 1HXS2 3ZVXA 2MNGA 4PBOA 1DYPA 2QJVA 4LHNA 3VUOA 2WNVC 3Q9OA 1KFUL 1POV0 3KV5A 2W5FA 3AYEA 1UMZA 1VBD3 4Y26A 2AGSA 3K4AA 4CP1A 2CV6A 1QOSA 5ABJC 1QXRA 3LIGA 3T30A 3E5UA 1ZRIA 3E6DA 1UU4A 4CU9A 2I74A 3POFA 4RS5C 3MHZA 4M3CA 5AC91 5JOWA 4OLLA 4Y22B 3VLBB 4INDA 4BMBA 3ACGA 3AJZA 4OZOA 4ES9A 2JDHA 4IE4A 4CPBA 1V6JA 2PFWA 4Q26A 1HV0A 2F4LA 1XNTA 1VMFA 3ZSKA 4BIFA 3MLJA 5FPXA 3OB8A 1GLHA 4H2AA 2DUQA 5JZGC 1AL22 3O1VA 5CKNA 2JDNA 4BU2A 2HWC3 1K3IA 1YLLA 2D98A 2RJLA 3AP4A 1JUHA 5FZCA 3VDCA 5IT6A 2WLQA 4AVSA 1C5HA 4NO4A 5L7OB 3O0XA 4AHZA 3WF1A 1H4GA 5A7WB 1W6OA 2A6YA 4MGZE 3FLTA 4FFFA 5GZFA 2PAMA 2WS93 2DYCA 2UY9A 5E8AA 4YPJA 3VV1A 1VB2A 4LUMA 5C3PA 4Q8LA 4I3PA 4XJ8A 3HT2A 1V00A 4KMQA 5C70A 5SV5A 5FYVA 3SXWA 2VNOA 1S2KA 4DFSA 1H6YA 4Y4YA 3I59B 4CCCA 1QJZA 1S0IA 2PHFA 4H55A 4QQOA 2D44A 3B3QE 3WNPA 4YZ2A 5LBBA 4OHVA 4CUCA 4ATEA 2J1UA 4XEZA 5A7QA 5JLVA 2D6NA 3PHMA 1WD4A 5HCAA 1YO8A 4SLIA 4CCJA 3UJQA 4K6BA 3BI3A 4LO6B 1MS5A 3IIIA 3IB3A 4UFHA 4RFRB 3PVOA 4H7LA 3BOWA 3VBFC 1OVSA 5LK5A 1H2KA 1OA2A 1RUOA 1DF0A 1DLCA 3MW3A 2Q8EA 3FFZA 3NL1A 5IHRA 1V6MA 2BDRA 4CUGA 2CAUA 2XL7A 1AR71 3J9SA 1AF9A 1CAWA 2B45X 3NJVA 2EVXA 3KD4A 4BLJA 1D2SA 4Z1VA 4GB32 1IQDC 2Y64A 3WVJA 3X29B 1OXCA 4EWDA 4AI0A 1YEWA 4JQTA 4QKBA 3RYPA 1VBA2 2WO3A 4AFDA 2W91A 2VTXJ 2DTYA 4FO9A 4R9BA 3VBRB 1JYTA 3WF3A 2BZDA 1SEFA 2VTXA 5E1RA 4C1XA 5KBFA 3FBYA 4PLMA 2G9FA 4FXGB 5CAZA 2HWC2 5A32B 1OOPC 1REFA 1WW4A 2O1QA 3O0WA 1XPWA 2P6HA 3NO8A 4TXWA 4YGDA 3T4HB 4AQ2A 4E2SA 1W8HA 1W99A 2EXHA 3AVSA 4GWNA 4IE0A 5FWEA 3K4ZA 3OUIA 1V6OA 3THDA 2WS92 1UCXA 3N9OA 1SLLA 4V2VA 4AXOA 4Q0SA 1UMHA 5KC6A 2A3YA 3WDUA 2ZX4A 1CAXB 4Z8BA 2J22A 2PELA 2O8QA 1K42A 3VZOA 1GP6A 2CYFA 4BA6A 4K8FA 2A6WA 2A6VA 5D2AA 3AZVA 1ZBA1 1PHMA 2XONA 2AEZA 5FYYA 3RGBA 1RB8G 4LJHA 3T2PA 2CL2A 1W2AX 2B42B 4LHLA 4Q4X3 4X8PA 2O0OA 3CEWA 2J1TA 3WCSA 3AX4A 3CF6E 5FXXA 3INAA 3NNJA 1W04A 1WMDA 2ZGPA 4YGEA 2ZMLA 4JGYA 4CEYA 1CAWB 2VUCA 1RIRA 2SLIA 2XQRA 3IM0A 3LEIA 4XABA 3CZUA 1WCDJ 4NVPA 1PMIA 3ITQA 2OZ6A 1RUJ2 1YQCA 2ILMA 1O4YA 2GNDA 4XAAA 5BNNA 1W2UA 1FNZA 3M8LA 1S2EA 5A3UA 4IV1C 2DCYA 2IXCA 3W9AA 2BERA 3E5QA 5GKAC 5K9YA 5ISLA 2D3RA 3HQXA 3WG3A 3FUQA 5AFEA 4LE4A 1NOVA 1SPPA 4CDUB 5IVCA 1HQLA 4LBKA 1ULPA 2JIJA 3IZOA 3LEMA 4P9WA 3VKLA 2A1XA 2ZGUA 2ET7A 1MQTA 5DAQA 4AZZA 1YQ5A 5T5PA 3KV9A 1CONA 2FZ2A 2Q1ZB 4MOAA 4CDWA 1QMJA 2P6CA 1O4ZA 1W0PA 3EXUA 1RUD1 2WFF2 2W2IA 4YGCA 1KJLA 3ENRA 1POQA 3KT7A 5FZBA 1DDLA 1TG7A 3NQHA 3ETPA 2W94A 4CCDA 1UY0A 4NIIA 4B29A 1RUJ3 2GDFA 2PHDA 4WVMA 3KHCA 4HPKA 1RGSA 1YFWA 4S2GA 3ZXKA 3RFRA 5BNPC 2E26A 4P5HA 4P14A 4Y24A 5CEHA 3JQWA 4QU2A 1ASJ3 4LKSA 3N7KA 3WP3A 2CGPA 1W2TA 4ZPIA 4I0AA 1NY71 2XHKA 3H3ZA 2Z79A 4Z2AA 2BBVA 1MACA 5KXCA 4LLFA 3S57A 2E51A 4HOOA 4LA3A 2AEYA 1CZSA 1SPPB 3DPRB 3AVRA 3LSEA 3NNFA 2VMDA 4YG6A 4COZA 2C26A 4CEWC 2K0GA 2XVKA 1TMF2 3Q8CA 4NE9A 3CDZB 3GZTB 1HXS3 5LA1A 5FZ7A 1N3OA 3POYA 3GZAA 2UWBA 4BQ5A 3WXPA 2E31A 5AC92 1LB2A 1REDA 2IWGB 1ULOA 2XOMA 5C7GA 4QXHA 5HXMA 4FPLA 2WC2A 4QGNA 1V6IA 1EUTA 1YCIA 2ZKLA 3ALQA 3JB8A 1J84A 3FHAA 1JYIA 4JHZA 2JDMA 3GNEA 1AX1A 1FYUA 2DVGA 1SLCA 4UFMA 3LGRA 4MHRA 4RS5A 3AKQA 4Y1YA 1PVC2 5FMOS 4RQPB 5A6XA 3V0AB 3IT8A 2J1RA 4IGQA 1W8FA 4FP2A 4P9XA 4BISA 1UX7A 1NZCA 1RUH3 3AL5A 1CWPA 3RZHA 2PAEA 2VQUA 3P6BA 3C7FA 2ZGTA 3HNYM 4AVTA 1KRIA 1L7LA 2VC9A 5JMOA 1ULCA 3THPA 4JRAA 5ACA2 4EN7B 4BZ4A 4KGQA 1HQNA 3M3CA 4R4XA 5FPVA 4AI1A 4AYUA 2WT2A 1RTVA 1UOBA 1WBFA 1Q8PA 3AKTA 1AR63 3OD4A 3VBUC 1RUG2 4MH0E 2VCCA 1DQ1A 1D4M1 2G4IA 1DGWX 2VOXA 3PTRB 2JKXA 1LCLA 1ZBA2 2ZMKA 3ILRA 4LOTA 4LR4A 3WINE 1H30A 3ZR5A 1N3QA 1XE7A 1IPSA 3BUCA 2E53A 1LJ7A 3MUY1 2R062 2YYOA 5FZFA 2RS11 1ZX5A 2B4KA 2EIDA 3ZYBA 2K2SA 4OI4A 4XE9A 1QJEA 4AR2A 3WW2A 4NWWA 2D6KA 4UW3A 2BQPA 1GR3A 1MS8A 4BLIA 3J7MA 1UU5A 3GJAA 4XACA 4FP3A 4CPBD 4P9LA 1XNCA 3MW4A 3DXUA 1JI6A 4XFGA 1HX6A 1CIWA 1VAVA 4CXWA 2R1BA 3LAGA 2GH8A 5F3IA 2WNVA 5IVBA 1UZYA 5J98B 3O1PA 3GF6A 4RHV1 2XGXA 4HLTA 4MGIE 5LK7B 3DYPA 3P5BA 2IFRA 4L97A 2GU9A 2J1SA 3RNSA 3R05A 4QPGB 1W8WA 2AUYA 1NX9A 2WR9A 3KF3A 2D43A 2LM3A 4L0PA 5FPAA 4CCLA 1O3SA 2X29A 4XJWA 2YY1A 2ZGOA 5FUNA 4FPJA 2D93A 2BNOA 5FZDA 1PGW1 5EJZB 4NR1A 5FZ0A 3WHUA 4E9KA 3I2JA 5LCWL 3BKZA 1JHJA 5JOYA 5A1FA 4QQLA 1YC61 4XFHA 5IVVA 4Q1PA 2BGOA 4XQDA 3P3NA 3ILFA 5KC5A 2PAKA 1BK1A 3KT4A 2DDUA 1DQ4A 1OMIA 2PHTA 1SLIA 3M70A 5APAA 2QE3A 5CISA 1UWWA 1J3QA 4QQ2A 3R4UA 1FOD3 3HNBM 2CWSA 4BDVB 5BNOC 2EXJA 1IZ3A 1JUIA 2AC1A 3O0VA 2FCVA 1ENRA 4X8NA 1PO23 1EAH3 2OVUA 5F39A 3TYJA 4KI5M 2Q8DA 4XUOA 3N7MA 3AL6A 2A3WA 1WZXA 3ZFFC 1Y7BA 1JZ7A 1QJY3 5I93A 4D3WA 1RUF3 2VZSA 2X5IA 5BYNA 1BVP1 1DBNA 1OKQA 2A70A 4KWKA 2X05A 4CCEA 5L7OA 2FDGA 1Z0HA 1RMU1 1UOFA 3G7DA 4RHV2 3SH3A 1G9DA 1WWYA 3ATGA 3WX5A 2VECA 3WEZA 4EN6B 2F4PA 1QKQA 1JZ4A 1AL0G 4LIUA 2B5HA 2WKKA 4R52A 5FK8A 2VVFA 4MXWB 3WP4A 3PVBB 4AQTA 1PMJX 1LOGA 1MEC2 2Q0AA 3EQEA 4XMIA 5FJKA 2HBTA 2P37A 3U11A 1VR3A 3IBMA 5E6HA 5FY9A 4NHMA 2G9ZA 2W0XA 3BIWE 4CP9A 4PQQA 3O5SA 4RQPA 5FYHA 5JXJA 3MZHA 1Y9MA 1TMF1 4RS5B 4L99A 5F1RA 1FV2A 3OJBA 1C1LA 1UN1A 2ZAHA 2KA3A 4O7XA 2RR13 3J7NA 3VHRA 2E9QA 1JYNA 1OC1A 4LLOA 1QQP1 2Y6GA 3PU8A 3M1HA 4IEWA 4LOSA 1GNZA 1S55A 3UJOA 4XURA 3IIAA 1R082 3JD72 3HVDA 1U12A 3ZPOA 5HPOA 2R0HA 5A3TA 5FYIA 1PGSA 1UY4A 2HBUA 4LBOA 1VALA 2D3PA 3D0SA 5FLJA 5IYYA 1AR91 1QQP2 4GKXA 2FCTA 2R6QA 5ACA1 2AREA 4K7JA 4YW5A 4NJ4A 4AVAA 5FDBA 4IDZA 1W3VA 3WG4A 4TTGA 1SFPA 1B35A 1VE0A 2H0VA 2D5FA 2W46A 5A6ZA 4META 4QB6A 2CNAA 1RITA 2DU1A 2VW1A 3KGZA 4P9YA 4UW6A 5LBCA 5FQ0A 4GWIA 5BNNC 2R0FA 4PQ9A 3PURA 3LEKA 4NWVA 5EYYA 5I8SA 3UL2A 2B8MA 3SC7X 1ZBE1 4SBVA 5A3NA 3MW2A 1D2QA 3RPQA 4QQPA 4CE8A 4C91A 4DY3A 2DTWA 2VPVA 3KM5A 4QPWA 4FFHA 4XHXA 1UYXA 3A21A 1QJU3 2B9UA 1S1AA 5AVAA 1NT0A 3PUIA 4W50A 4LXLA 1WCQA 3G6JB 3MO4A 4XIOA 4W65A 1SDDB 1ULFA 2A73B 1VBD2 2XMLA 4LNVA 1Y43B 5C8CB 5CFDC 1OH3A 4LBQD 1NXMA 2Q5TA 4FPHA 1AX2A 1LHVA 1SBDA 5J7MA 4FPFA 3O1UA 4ZXKA 5FKBA 1MQTB 3N9MA 3GCXA 4AL9A 2C1FA 2VE1A 4EYUA 3NRUA 3WDWA 2JG8A 2RS31 4JGZC 5LRSA 5FZEA 1W6QB 2B39A 2JB8A 2VAUA 3TOJA 2D97A 4CDUA 3DECA 4I2OA 2X09A 3A7QA 4U36A 4Y1VA 3HBKA 1DU3D 2BEOA 1W03A 5IUQA 2BWCA 5JIAA 3T3YA 3AP9A 1J1TA 1ZVFA 1TEIA 1QF3A 1AR62 2IXHA 1EAH2 2BJSA 4HKLA 2ZEZA 4XTMA 1UY2A 4URTA 2YPJA 4J1XA 3S7EA 3DKWA 1QXPA 4MXVA 5F5QA 5DUWA 4RR3C 1TE1B 4DOUA 4NIHA 4Q4Y1 4M0NA 3VDDA 4XFIA 4EN8B 2H0BA 2ZX0A 4LMFA 5FP7A 1GANA 5F8PA 3USUA 5I91A 4X6QB 3UNPA 4G4FA 5BXXA 3VKMA 1NA1C 1KGYA 1V9U3 2ZA9A 4JQRA 4LO5B 4WM7B 4RYDA 5K0UB 5M0TA 3OPTA 5HV4A 3VDAA 3RZJA 2JIGA 5E89A 1KD7A 2XXZA 4D6SA 4UW5A 1UXXX 3RYKA 1UXZA 2XJTA 1FPN3 3PU3A 1W6PA 1WCUA 3DXTA 1ZA4A 3IAQA 2P17A 5FP9A 2NQYA 2RS12 1PO13 1NCRA 2XJRA 4Q8KA 4FAHA 3B94A 5HI0A 4OQ8A 5FUIA 3ZFGB 3CL1A 3AMMA 5DDJ2 4BXFA 5FZ3A 5EP9A 3LD8A 1CR7A 1DQ2A 1VLNA 3USUB 2E7TA 1KQRA 1NCQA 3PJYA 3VDDB 5BNQA 2IUWA 1YXWA 4COWA 2VD7A 4QT6A 2DBIA 4UFJA 1W8UA 2VOVA 3VKNA 1I5PA 3VKOA 1W8TA 4MUVA 2Z69A 3OBRA 2RS13 4KL1A 3D0JA 1US2A 2VZQA 3SCHA 4BMEA 5JXIA 1UO9A 2R063 4OI2A 4Y5TA 1V70A 1YQ8A 5ABJB 5J37A 4PIZA 2E7AA 4ZS2A 3B00A 4CCMA 1ZRDA 1C1FA 4IL7A 1RUNA 4HN0A 3S5QA 3VGIA 3AMNA 4CSWA 3GALA 4BQ1A 3EO6A 1U5XA 3PVEA 1XNKA 1AXYA 2JDZA 5CIRA 2YHJA 3I49A 1SLAA 4JDMA 5FMOL 2XJUA 1TME3 1G8WA 1LOCA 1Z7S2 4M01A 4QX8A 5JMCA 3MIEA 5KHJA 1C8M1 1R091 1FOD1 1T2XA 4BIOA 5FTTC 3MI8A 4OHXA 2GSYA 2ADEA 2YROA 1IKPA 3RQ0A 2R073 3WDTA 1PIV3 2XHNA 2QQWA 3LWCA 4E27A 1V9U2 5JZGB 4LUKA 3RJRA 1OBNA 3OYWA 4LO4B 2RS51 5KXEA 1UMIA 1W9WA 3UK9A 2XDVA 1WW6A 5D21A 1J3RA 5CKMA 2YU2A 2QDRA 3DUIA 4PI2A 1X33A 2LUWA 1ONAA 2WUHA 1SDWA 1ENXA 1MZFA 4L9BA 2VU9A 3LDBA 3POIA 5FY5A 1CPNA 3N9LA 3P3PA 2X10A 3GBWA 1OLQA 5EIYB 3LCPA 1W05A 3AP5A 3DYOA 5LW9A 5FO8B 1OA4A 5L7OC 2D6OX 4AF9A 1EAH1 2WN3A 3ZFEC 5A7WA 1GV9A 3WNLA 2HEWF 4ZZ5A 2W1WA 4I09A 3JU9A 1ZREA 2D7FA 5GJ6A 2RM21 2JDYA 2RR11 4HZFA 2UURA 1BBT3 5LB6A 1JYXA 1UZZA 4WM8A 2GALA 1V0AA 1RUC1 3VHPA 4EQVA 1NZIA 3NKTA 1OF4A 4RHV3 3S7IA 3MLKA 3OUJA 4XJZA 1W2OA 1URXA 5F3CA 3WT3A 4QDRA 4B3NA 4DUXA 5LA0A 2W52A 4HT1T 1A3KA 1ND2A 1RC6A 2Z4FA 4M3CF 5C5UA 1BMV1 1K5MB 1PVC1 1HLCA 5JR7B 3SEEA 3HWJA 4PDWA 5K8SA 4P5YA 3WG2A 2RS33 2VQAA 2HYKA 3PTYA 1VBD1 1J58A 2PYTA 3VN4A 2ZHKA 3MV11 4HONA 4JKLA 5DZEA 1HRV1 5CFDA 2WBKA 3NNGA 3T09A 1GBGA 4CUAA 3ZYGA 3VBHB 3I2IA 2ARAA 2WNEA 5DMYA 2XJPA 4J25A 4LBMA 5F5CA 4YM1A 1XOYA 3V65A 1COV3 1YFUA 4LULA 5F7UA 1Q5OA 4DNYA 4DIQA 1ZBE2 5GLZA 5C5TA 1AXZA 1F4AA 3MYXA 1RJ8A 1MR5A 1R083 3QACA 4Y3OA 3GM8A 3LPFA 5C8CA 1NLRA 4ORFA 2VM9A 1BBT2 5D1IA 3VHNA 1YWKA 1ENQA 5FLIA 1LKNA 2VTFA 4I0WB 4O9EA 5CU1A 2JDKA 1CAUA 2CHHA 2JG9B 2BP6A 4JAAA 2RJ2A 3VZNA 2RM22 2PHLA 1WMEA 4IEQA 5IK5A 3KCCA 3WW1A 1V9U1 2A5ZA 3VBOA 1UPIA 1BKZA 4BK5A 1EP0A 3KZ4C 4DQAA 3MIBA 1D0HA 4F8AA 4IERA 1XE0A 4M4PA 2E32A 1W8OA 3I3BA 4C1WA 1X50A 1Z7S1 3O1SA 3TEXA 2OA2A 3CJIB 4NPMA 4OHYA 3JBG2 1CAVA 1F5JA 3A0KA 4XQ4A 3ZMNA 2JJ6A 1M4WA 3NV4A 3DKQA 3HNMA 4B4RA 5KHGA 2A6ZA 3POWA 2P3IA 1LTEA 4CCNA 1PIV2 4M0HA 1LOFA 3WQ1A 4ZHNA 1ND3B 2Q30A 2EIEA 3N7LA 1SCRA 1AR81 5FYMA 5FZOA 2ES3A 4QGLA 1S0GA 5GLVA 3WNNA 4GXLA 1TVGA 2HWC1 1P8JA 4DXSA 2FBEA 1AUYA 4UXAA 1EPZA 5DUUA 2IVIB 4PT6A 4DY5A 2NP0A 1WLCA 4XFFA 3J7HA 3TN91 3T0AA 4CEYB 4D7SA 1RMU2 3ZXJA 5DZGA 5DN2A 3IPVB 5IFTA 2FDHA 3HIFA 1OHFA 1I5ZA 1W0OA 4KWUA 1PVXA 2JECA 5D8AB 1QJFA 5FXZA 3TWIA 4MO3M 3BTXA 3OPZA 5BPXA 1RUH2 4B1LA 2ZZQA 5DQ0A 1CD3G 1UNBA 3MF9A 4PLOA 3I2GA 1ZBE3 3H1MA 4W6XA 2EAAA 2KM2A 4C8DA 5I0DA 5FCCA 5C8WA 2ZEYA 2LS6A 4NHYA 3ZM8A 3JCIA 3K2OA 4LBNA 4Q0VA 5A3LA 5FYZA 5FIXA 4UW4A 3CJXA 2R30A 4JGZA 2XWBB 5FZ4A 4U2AA 5KR7A 1HDKA 4AQ6A 4GAZA 4YVSA 1W3XA 3OY8A 4GH4A 3A23A 5DDJ3 3ZN6A 2CGOA 2V4AA 4LHSA 3M2MA 3ZXDA 4EN0A 1PK6B 1WMFA 5JCTA 2QQJA 3VB9A 3V0BA 1W6NB 4HETA 4XPVA 4YW6A 4I02A 1OVPA 4KWJA 2VMFA 2AZ5A 4D0QA 5FZ6A 3K51A 4NIDA 1SCSA 1H8TB 3I3EA 4AK3A 1UX6A 1AR73 3NW4A 3BTYA 3VZKA 1KS4A 1AHSA 3CJIC 4AFMA 1QJX1 2JG9A 3QD6A 1MZ6A 1DGLA 2AH2A 4Y33A 1SG3A 3VDDC 1WA6X 2IXIA 4AFBA 3W58A 2JE9A 2R1DA 4GD4A 4QKDA 4XFBA 4Y5SA 4LPLA 3USSA 4ARXA 1AJOA 1E5IA 3ASIA 1CZTA 4AEDA 5IW0A 4YRDA 1BBT1 3RWNA 1BEV3 1S4CA 1R1A3 4XXAA 1W6MA 5C9AB 2OW4A 3V64A 2WWJA 3CZJA 2JICA 3L2YA 1W39A 5F5AA 4DRRA 1MVEA 1ZNPA 2CAVA 3CQOA 4LBQA 3KLSA 3JQXA 4IV3A 3F95A 1C4RA 2R061 3JUUA 1BYHA 1U5IA 5J96B 3POJA 1EV11 2R072 4Q0UA 4C90A 1YYNA 3DPRA 3KCXA 2CU5A 3AJYA 5FZIA 1X9PA 4Z92B 1D7PM 2B7YA 1WGPA 4TLFA 4N43A 3N36A 3MEPA 3ZYHA 4FPCA 4N9HA 1QIQA 4JVAA 1O91A 2WAAA 3RMXA 3B9IA 5LATA 3UKTA 1TME1 3R4DB 4FVVA 3NV3A 1G9BA 3H8XA 1JU3A 4H14A 1PZ8A 1LODA 4A2UA 5FYUA 1WCKA 4Q4X1 4NPLA 5DZFA 3VBOC 1GUIA 3N35A 5FYBA 4O65A 4YG3A 4HL0A 1UPSA 4OHZA 4EZHA 3D4KA 2J1AA 2WT0A 1BJQA 2ZMNA 1LEMA 3AMQA 3HQRA 2H6CA 4GH4C 3RDIA 5F37A 4OUMA 2E7QA 2YB7A 1OPMA 5I0SA 1FX5A 1X82A 1OSGA 4Q0QA 4MV2A 3ECQA 3LOBA 3OGSA 1DGRA 2VR4A 4LO7A 1AR92 4GJYA 3S30A 4EE2A 3RYRA 4TWTA 4AG4A 2WQ8A 2BUKA 4BB3A 2V4VA 1R64A 2HWE3 4GWMA 5FYTA 3K4DA 3W20A 2UYBA 1RHI3 3P1IA 2N7GA 5F5IA 2YC2A 2E33A 4UF0B 3E97A 4CDXC 2XVGA 3POSA 1S0CA 1UQXA 2D6MA 2Z5WA 2NN8A 2WO2A 3GBFA 3H1WA 4O9GA 4AFCA 3SCGA 3THTA 2GC3A 3E1F1 3TAYA 2QKDA 3VKFC 4AAXA 1Y9GA 1TNRA 4DMIA 1MS3A 1LOEA 2ARBA 5KHKA 1CIYA 2TEPA 2Y6HA 3AYDA 3AYAA 4XILA 2XLGA 2IC1A 2XL9A 3ACFA 1GKBA 4IEYA 2TBVA 2ZPXA 4Y5Z0 4XIKA 1JS9A 1K12A 5AVPA 5FPZA 4XW3A 2QUOA 1R081 2HWB2 4AQSA 2Q8OA 1ZZ9A 5C4WB 2PTMA 1QJX2 5BNPA 2QTWB 3E6BA 2NPIA 5KHHA 3VBHC 5JSPA 1OLRA 2DFCA 2XJQA 4Z82A 5FBJA 4RGGA 1MQTC 1COV2 1OD3A 4P9GA 3IMNA 1GQPA 1VRH2 1HRI2 4Q5OA 2JB4A 3UV9A 4IE5A 4YW4A 3WG1A 2TUNA 3A4UA 4UFLA 2DWRA 4HPKB 3ST7A 4GALA 2EXKA 1TME2 1Z7S3 2W95A 3EMRA 3MFAA 3MIGA 3ZN6B 1IS3A 1SQ4A 1ZZ8A 2SBAA 2I2SA 3OY8B 4GH4B 4JTNA 4XQWA 1OF3A 4GJZA 1E57A 2GC2A 4IV1A 2YGLA 3FE5A 1FT9A 2VQ0A 4AI9A 5IK8A 4HSJA 1NCRB 1CJDA 1KDKA 2EF6A 5FLHA 5FOBB 2QNKA 2RJKA 5FZLA 3DCQA 2HLEA 4HN1A 1XE8A 5DDJ1 2QVSB 4CRQA 4QHZA 4RA0A 4LTAA 1DZQA 2OXBA 2ZGSA 1O3QA 3BCWA 1FV3A 3KHBA 3VBFB 5FZAA 4DRVA 3BGAA 1VBB2 4RSUA 3QCWA 2VH9A 1XB9A 1KJRA 2D3SA 1XJAA 3DF0A 2W87A 4JZRA 4PF1A 3ILNA 4PLNA 3TN92 5C3QA 3JZVA 2P3JA 4N53A 1JZ3A 3NV2A 4CU8A 1SHWB 3A0NA 4A6SA 4B4QA 5BNPB 2RMU2 4COUA 1ND2C 4IGOA 1NUKA 2HYXA 3ON7A 3U37A 3ZPYA 4MLOA 1MZ5A 2ZACA 3JD73 4S2DA 4PDWC 4HANA 4QPIB 1BEV1 1MZEA 1NYWA 4QPIA 1AYN3 1GP4A 4MYEA 3K77A 4QDQA 5J1XA 4HVRA 5ANNA 2X5IC 3V56A 3TEWA 2OPKA 1BXHA 4AEDB 5AFBA 5LRRA 4XDQA 3NAPA 4AI2A 1JXNA 4BWOA 4BXSV 1OFSA 4N8MA 1OKOA 4ZXEA 1MS4A 1IPJA 3ROUA 2HWB1 1XSRA 1JOBA 4GA9A 3U4XA 4LKFA 2I45A 2PLV2 4RL7A 1HRI3 4S2FA 2VXJA 4Q4V2 2A7AA 2YFZA 4URAA 4HBNA 1KITA 3LKJA 1W9FA 3BPSA 2ZXQA 5HCBA 4J6GA 3ZKYA 3ZFEB 4YARA 4GMP0 4JRLA 2MHFA 1EUUA 1WLDA 1HJFA 3VL9A 3HBZA 1DLLA 3VD9A 1VBE2 1RVF2 2MPFA 4AI3A 4ONUA 4V1PA 1QEXA 4ZU7A 1WUVA 1QJY1 2P34A 2NYYA 2VVDA 4HSLA 5LBFA 4GB31 1RXGA 2DVDA 2ZTNA 4NHXA 5C33A 3H7YA 3WDXA 2Y6FA 1FMD1 2WRAA 2NMNA 3AKPA 4FOQA 1AR72 4YM2A 4CDQB 1QXJA 3ZO0B 1UF2C 2VOTA 2VXRA 3I3QA 4AOCA 1QJU2 1SFNA 2DCTA 5DABA 2VZTA 3CHXA 1QOTA 4G3YC 1JN2P 3EB7A 1UZVA 4IEUA 1H1MA 2EALA 4NRMA 5D8AA 2D5HA 5L9BA 4FOYA 3I3MA 2D40A 5EJ3A 4Y20B 2WWSA 3RRDA 3WNMA 5C4WA 2WLPA 4ASKA 4FFGA 5JUVA 1AYM1 2WO7A 1TMF3 5FR3A 4PDWB 3S0MA 3QH7A 5JVVA 4FXKB 3U07A 2OX0A 5KXDA 5A6QA 1R1A1 2EIBA 4DPNA 2VBPA 4PIXA 2XJSA 2QZ2A 4Z2WA 1RXFA 2HWF1 4LA2A 1XYNA 4QXCA 3SQOA 4K40A 1QDCA 2JKBA 3WNKA 5CZKA 3ZXLA 4AVCA 1OQDA 3GHMA 1E5SA 3FZ3A 5FMBA 3L2HA 4MG2A 3WR0A 2DCJA 1LRHA 3F2ZA 2P2KA 1O7FA 2YUEA 4PJYA 1RMU3 5A33B 2WDBA 3T1MA 3R6SA 4UF0A 1LEDA 2XUEA 1B09A 1IS6A 3C3VA 5L36A 3RZZA 5L9VA 1O5LA 4ASMB 1YIFA 2WFF1 3CNAA 3KV6A 3WHTA 1F31A 3LDKA 5IVYA 4BCUA 5CFCC 2C24A 2HWE1 1AL21 3C7HA 4ZY9A 2F6BA 4Q29A 1OURA 5I0RA 4AHYA 2D6PA 2HEYF 5FZGA 3AFKA 3SH5A 5FJHA 4A3XA 4MGTA 2AYHA 3AZWA 1HB3A 1XQNA 3WOGA 3LEGA 1HRV2 5A33A 2WZR2 2OPWA 4TN7A 5JI7A 3B5LB 4ATFA 2W3JA 3J7LA 1YRZA 4OUSA 2MEV2 3FHQA 4AGGA 5B2GB 2ZGRA 3ZXGA 3VZLA 3WW4A 1DQ6A 1OUXA 2R32A 4M3CE 4HKWA 1S0FA 4CDWB 4D7YA 1YI7A 5JI9A 3AYCA 1JHNA 3N9QA 4NHKA 4UFIA 3CO2A 5GZEA 5FZ8A 3MUZ1 1JZ6A 3H7JA 3QH6A 5LA2A 2IXLA 3VD4A 1XRUA 2VZ1A 3R4SA 1OQ1A 1RHI1 2GP5A 2VG9A 2Z42A 4YM3A 3ACLA 3VD3A 2QQVA 3S5AA 4W4ZA 2NZ9A 5EJ1B 2YV8A 1RUD3 5IAVA 4XAEA 3WW3A 5BNOA 4LQRA 4ISQA 5CKQA 4N7IA 3AZZA 4AEJA 2ZGLA 4AAPA 1N1YA 1C8NA 2P5BA 4P08A 4R8HA 3ZIWA 4P9IA 4CZSA 3PMSA 5FY7A 3CKHA 1CVNA 2VMIA 3GGLA 2QQPA 1GNYA 3FLRA 5C9AA 1A78A 1GNHA 4QM8A 4LK7A 3ZYFA 5CADA 3Q8BA 4YW7A 2PLV3 4BQYA 3MPBA 4YZ5A 4JDOA 3GZEA 2ARCA 1QGLA 2QDNA 4M00A 1RUF1 4NIGA 1QNYA 1XXNA 1WLTA 3J26N 1QU0A 2QQLA 4GIQA 4HG6B 2CWMA 4BQ3A 1W9YA 1ZRFA 2C4XA 1YQ6A 1BQPA 1AR82 1QHDA 1G7YA 1UIKA 2VMEA 3C7EA 4OZXA 4I3GA 4QQHA 4AWDA 3PDQA 4OYUA 2GMMA 4BOWA 3ZYJB 5ERLA 3ES1A 3L9JT 4F7ZA 2HWD3 2BWAA 1US3A 2VULA 4PI0A 3ZKUA 4BQWA 5K7PA 4FTBA 2Q1MA 4QPIC 2DVFA 1LHWA 2VMHA 3VD5A 2WINB 4WM7A 4LKDA 2C0ZA 3OYWB 5FYCA 1VBA1 4NROA 4XBLA 1IG3A 1RUE3 4K3UA 4N43C 5B4NA 3SITA 4RR3A 3J4UH 3NAPB 4QXBA 4A4AA 4XZUG 1J3PA 1F4HA 5A3MA 3FUOA 1SBEA 1LU2A 2WZEA 2WT1A 2Q4SA 4COVA 1O8PA 1CESA 1GZ9A 4IEOA 3LPGA 3VZJA 2RMU1 4I30A 3AP6A 4E2QA 4FAGA 1G86A 3N4MA 4TSVA 2EIGA 1AR93 3SISA 5LEKA 2V73A 4BQXA 4Q4W3 4DXRA 1CPMA 3O1TA 2ZEXA 3IPVA 2QQKA 4QKNA 4XCBA 1RUF2 3V0AA 4LT5A 3I8TA 2IZWA 3C2UA 4HK8A 5IAXA 1XYPA 3IWZA 4B7EA 1AVBA 1LGNA 3W21A 3M3QA 3H3LA 4LK6A 3I2OA 1UYZA 4A45A 5A7PA 2NMOA 4JC1A 3IKWA 4RGKA 4MZUA 4BM8A 3T4VA 3JB4C 2W9XA 4FSJA 3ELNA 1ZZBA 3LDRA 2PHXA 2IXJA 3NV1A 3PMEA 4AW7A 4XJ9A 5DPNA 3MIHA 3BN6A 1WW7A 2BOJA 4CDXA 5CA6A 4QU1A 1PIV1 4ES8A 1CAVB 3B93A 3WDVA 4F3JA 1HB4A 5FMCA 4CCKA 2WJSA 3B02A 1IS4A 2DUOA 4Q4V3 4QX0A 2HWB3 2RV9A 2WL1A 1YI9A 4FPEA 4OMCA 5FBZA 5EPAA 3TRSB 3ZFGC 3ZXEA 5CFCA 5F2WA 3WCRA 4O61A 1HRI1 2W92A 1G9FA 3O14A 4YVWC 1TZOA 2R042 2WAOA 3EYPA 3UKVA 4P02B 3RG0A
chains in the Genus database with same CATH topology
1G9CA 3KB5A 4XJUA 2UWAA 4QGMA 3DPRC 1RUI2 2XBO2 3AB0A 1YHFA 5H9PA 3JD71 4CDXB 5F9TA 2YZ4A 3W59A 1VAMA 1AZDA 4DB5A 4DINB 2RS32 3ZSMA 5BY5A 1CGPA 4CEYC 4Q4Y3 4Y22A 1ZYBA 2D6LX 1PO21 4XMAA 5IK4A 3CU7A 4IXLA 2AR6A 2DFBA 2RS53 5LEJA 2ZZJA 1S0EA 4N9IA 4AI8A 1MEC1 1SACA 2JG8B 5JPNB 4IV3B 5EFUA 1C8M2 1R092 4YG0A 2JEMA 4YNIA 3NAPC 4YGBA 4A7KA 4CP2A 2XLAA 2HKXA 1CJPA 1ZBA3 2XWJB 4Z07A 4CDQA 5BNNB 3AFGA 2UU8A 2HWF3 2BPA2 5HCFA 1RVF1 2OUHA 4JGYB 2WQ4A 3H3UA 3MIDA 1HQWA 1B35C 4Y1ZA 1JYCA 3AZYA 1RUC2 2OIIA 5JSOA 1NXD1 2R043 4MGKE 3NWKA 2MEV3 4EROA 3DGTA 2WFF3 1CQ9A 4LE3A 3WQ0A 1PVC3 4KG8A 3MF6A 1A6CA 1ZRRA 4XF9A 3K48A 2NLRA 1RJ7A 2VMGA 1DZTA 2ZGMA 5JSRA 1IGOA 1SBFA 4AEMA 1G6NA 1SFYA 4MGYE 3HMYA 1VBC2 1HRV3 4L11A 1H2MA 4Q4W2 4XF1A 3ZSJA 4LEJA 1J59A 2WS91 2BFUS 5A32A 1VIWB 4KNCA 2QFEA 2PLV1 5T52A 3VBRA 1Z78A 1AR83 2DV9A 4CDUC 3FJSA 4LHKA 3TNQA 1V6NA 1BVVA 1C3HA 2PN5A 3PJQA 1C5IA 1H2NA 4Q4W1 4YM0A 2EAKA 2VW2A 4FTSA 1Q3EA 1PGL1 2W08A 4MVTA 4IEZA 3I54A 1HW5A 4YFWA 1OQEA 5ABJA 1MS0A 1TNFA 2FMDA 2GAUA 4AE2A 5CNAA 3M4FA 4KG0A 1XNBA 1H9WA 4MXWA 4QM9A 3WUDA 5DXDA 2OUJA 1PO12 1H0BA 3V0BB 4I0BA 1PK6A 4EWEA 1L3JA 1ZM1A 5GM0A 4YZ1A 4L92A 2JENA 5CB7A 4Q1RA 3ZXFA 4OVEA 4D7TA 3PVNA 2KXLA 2Y38A 5JOZA 3T1LA 3MGUA 1X8MA 1LECA 4BHPA 4EJRA 4ISRA 4ZKTB 1U5ZA 1W6PB 1F5FA 4N90A 5FOJB 4IV3C 4AVVA 1XYOA 4ZU4A 3SLIA 1QNWA 4WM7C 4Y1XA 5T3NA 2DUPA 5FQ0B 1AJKA 1PGL2 3ZYIB 4OI0A 1ND3C 2BVVA 5F6KA 5K0UA 2HEVF 1C28A 3WDYA 2WZR1 1S0JA 1IKQA 2ET1A 3H0OA 3FHIB 1QDOA 5EYXA 1VBA3 2WA4A 1XNDA 2I07B 3M7AA 3OGGA 5GZCA 2EXIA 2VOWA 4AEKA 2X8KA 4AFAA 1PO22 3RJ2X 3SH4A 1COV1 1DGWA 5T5OA 1GQHA 2ZX1A 4WBBA 4AVBA 1ZZ6A 5I0TA 1S0BA 4DS0A 1UAIA 1YJLA 5JWPA 2VUJA 1AR61 1SLTA 5GZDA 3D82A 5FO7B 4BYYA 4R4ZA 4Y20A 1GZCA 2VOKA 1M06G 4TYSA 3ZIXA 2HWF2 1UD1A 3NVCA 4Y1UA 1K5MA 2WSUA 4QD2A 2WFPA 3WZ1A 4Q27A 4ZU5A 3U10A 2GN3A 4IESA 5J48A 4WM8C 1ZRCA 1FPN2 1AYM2 3S6PA 1HIXA 4HFSA 5E16A 3WP6A 1AX0A 4XF0A 4WVMB 2ZHLA 2DF7A 3AKSA 1PM7A 3NJZA 1WBLA 2GC1A 2GNBA 1WA4A 1POV1 1PZ9A 4GQ7A 2XUMA 2TNFA 2FMYA 4PCRA 4FPYA 5GZGA 1NCRC 2Y0OA 2E63A 5H9SA 1H2LA 3ZFFA 3M3IA 4IEPA 2RMU3 3FC0A 1O3RA 4Q2FA 2QCSB 4FPGA 3GZUC 2QZ3A 2PA7A 4XF3A 5J09A 5T5LA 5HXVA 1H9PA 1BCXA 3AMPA 2B46X 5JZGA 1MEC3 1QH6A 1V6KA 1WLWA 3OD0A 4WVZA 4QPGA 2YDEA 1H8TC 4CTEA 1T6GC 3N3HA 5KWRA 1ND2B 4E4SA 5L73A 4UBGA 2A71A 1YUDA 2ENRA 4K21A 2WNUB 5J36A 2WNVB 2RR12 1PGW2 1CN1A 1DGRN 3KSCA 3NKGA 2WZPP 3EHKA 4CP0A 2BNMA 1X36A 2A6XA 2RM23 4UBHA 3GBGA 1QY4A 4WZFA 1MVQA 2FZ1A 2R041 5IK7A 2K9ZA 2ZABA 1ULGA 5T5JA 5JOXA 1GFF2 5TSWA 4JGYC 1REEA 1YNAA 1LHUA 2IFWA 5CVRA 4AEDC 2RS52 1GYKA 3WY6A 3APBA 5DUVA 4FOVA 4C0BA 3IDCB 4LBJA 4RR3B 4HVQA 2R49A 3LSDA 3DV8A 1KXGA 2VVEA 4WVWA 1FNYA 2PHRA 4YVSB 3VHOA 3DL3A 4YLZA 3AK0A 1VAKA 1LR5A 3J8F2 3M3EA 1QQP3 5DG1A 1F2NA 2XB6C 2YXSA 2VUAA 4K9SA 5FAXA 2ZAAA 1RUH1 1G9AA 4HMZA 4MX3A 2ATFA 1XU1A 1LGCA 4CDQC 1O5UA 3FMGA 3AZXA 4KQ7A 5I8TA 3B01A 3O12A 1TQ5A 1I3HA 1WD3A 3FWEA 1VBB3 2GN7A 2R16A 5J3UA 4XJAA 1VRH1 4W6WA 1A8DA 2WNUC 1AYN1 1D4VB 4E4DX 1LESA 3VBUB 2Y26A 1DQ0A 2W39A 1ZZ7A 4XBNA 2ZX2A 1IOAA 3CJIA 1ALYA 3WV6A 2MEV1 3H9AA 4XXPA 2ZGKA 1OOPB 1PK6C 4XFCA 1S0DA 4JTOA 1F9KA 4RD7A 5D8AC 4D94A 4PIYA 2BTVC 3FX3A 3EJKA 3VBRC 2DCZA 2WZR3 4YVSC 1RUG3 2ZKNA 1CAUB 4TZDA 2XJVA 4XOGA 4XBQA 5T55A 1D4M2 2FQPA 1I6XA 3RI8A 2WQZC 1JBCA 4GKYA 4FT8A 2ZHNA 1RUI1 2XBO1 2V5YA 4OHWA 3VBHA 1YFXA 4PF5A 3VZMA 2ZJCA 3ZSEA 3GHNA 4N53C 2XH6A 4GMP1 5H9QA 3KGLA 1LOFC 2GNMA 1GQGA 3I4IA 2AENA 1NE6A 4Q4X2 3SCFA 1DQ5A 1W6QA 2C5DA 1HXS1 1OD5A 1WCSA 3FFQA 3OCPA 4FOWA 1ENSA 3AMHA 4AGVA 4OULA 1VJ2A 2WNUA 1Q8SA 4HKOA 4JCKA 4LBQB 2UYAA 2IXKA 4AHXA 1IS5A 1JH5A 3WD5A 5T50A 2ZS6B 3BALA 5DG2A 3BU7A 4BE3A 1N47A 3SNMA 1LENA 4BH9A 4E2GA 3TB0A 3ZDSA 1KS5A 1K5MC 1RINA 1LHNA 3KMHA 4K1ZA 3BOPA 3AXEA 3M3OA 1Q56A 5C6CA 3H8UA 5GLTA 4DXZA 4BPZA 2DCKA 2ETEA 3JBG3 3WQ7A 1OPOA 4QPGC 4YZ3A 4B8EA 1NY72 1O3TA 1Q8VA 2BVBA 1OA3A 4GULA 3VBSC 4LBLA 1KDMA 1D4M3 1PNFA 1HV1A 2X5IB 4IEXA 4YW3A 3FLPA 5KHIA 1EV13 5GALA 1NE4A 1H1IA 3H50A 3VBOB 1POV3 1ULEA 1VBE3 5ACA3 1EYBA 5JIUA 2XPJA 1DFQA 3OTFA 4I01A 1R1A2 2LALA 3AKRA 1Y3TA 4YZ4A 3ZFEA 3MIFA 1C8M3 1R093 2EA7A 1QWRA 3R0RA 4KGGA 3MICA 3HAGA 4IEVA 1F8VA 2ZGQA 5FFOC 1UKGA 1GICA 2JD4A 3I2DA 2PQQA 3LA3A 2XKOA 1DYKA 1BEV2 2YMZA 1CX4A 1NLSA 3PNAA 1EY2A 5I0UA 1FAYA 3RSJA 3E6CC 4K20A 2WSVA 2WIIB 1SLBA 1YFYA 2O8OA 2X53S 1I1EA 1FOD2 1YIPA 2BFUL 2LTNA 1Q43A 2W68A 3ES4A 3IDEA 1AL23 4ASLA 5GLWA 4CEWB 1AYN2 1QJY2 1W6MB 1LGBA 2BNNA 1GSLA 1LU1A 5CBLA 1Q8QA 2BYVE 4EWAA 1NCQB 4AHWA 2RHPA 3I7DA 2VW0A 4N53B 1DIWA 5EZWA 4OFGA 1ZZCA 4K1YA 2ARXA 3WNXA 1H8TA 4RQPC 3VBFA 3I59A 2Y0IA 3EBRA 1PNGA 3ZN4A 1UL9A 1APNA 4YVWB 1FATA 2BW8A 4XFAA 3URFA 4HVOA 2DVBA 3LZZA 2JX9A 1CAXA 5DUXA 3AXDA 1DHKB 4IV1B 3MPPG 3J8F3 3HT1A 5CG8A 4Q4Y2 1AYM3 2ZOEB 3ZYRA 4JGZB 3H1YA 1YJKA 1DG6A 1VBC3 3QBQA 3ZN5A 1RUE1 1LOAA 4QXKA 5JAXA 4YW2A 1HKDA 2WA3A 4ITCA 1ASJ2 3UKNA 2DVAA 4QX5A 4COYA 4DZGA 1N1SA 2H6BA 3BPZA 2JXAA 2OZJA 4H7MA 1FXZA 3LB9A 5CFDB 4M3CB 3TNPB 3HD8B 2JG8C 1JTZX 2XKPA 2GC0A 3B69A 4E4ZA 4FTEA 4F83A 1Y9QA 1VBB1 3LOIA 1IHMA 5EV7A 4XZPA 2DU0A 1UU6A 1VRH3 2A75A 2FHRA 1NA1B 2GMEA 3LA2A 1ND3A 5K0UC 1VB4A 2RE9A 1RUG1 1LOBA 1Q8OA 4KU8A 1OI6A 2PHWA 3KT1A 4WM8B 1UKRA 4B4PA 1RHI2 3BODA 4AGRA 1BMV2 1WW5A 2VY0A 4J1WA 3OBTA 3OGJA 1RUI3 2XBO3 5AC93 2GMPA 2CGNA 5FREA 4IETA 4FQ4A 1QJU1 2NM1A 4XTPA 1B35B 4RFT0 3TN93 2HWD2 5FRAA 2ZCWA 1X7NA 2GZWA 2OYZA 3KCYA 4W6YA 1VP6A 4FBFA 1UIJA 4X6RB 4H3WA 2HWE2 3IN9A 3AM2A 1VBE1 1KFXL 3QLQA 4HK9A 4IQPA 1A8MA 3LA7A 4EV0A 4R9AA 4XF4A 4JDNA 4KU7A 1OOPA 1NA1A 3BTAA 1XU2A 2UWCA 1FPN1 5BV6A 1LHOA 5C4WC 3ZMOA 5JPMB 1FI2A 3N7JA 1NQDA 4N43B 5SV8A 4S2HA 3VBSA 4Q4V1 4GMP3 5I8YA 3VBSB 3B9CA 3ETQA 4G9SB 5GLUA 4XETA 3ZX7A 4L2NA 3VBUA 4D69A 3GYDA 3ME2A 3ZSLA 4GB33 2DURA 2UY8A 4C0HA 3MDPA 1O4TA 4B7KA 2HWD1 1FMD3 3D6EA 3D8CA 3B7MA 1U5YA 2GH2A 3ZXAC 1QJX3 1C57A 1J1LA 1LULA 1H8VA 2A3XA 2ZGNA 1RUD2 2ERFA 4P9JA 3IDBB 1PZ7A 2HJIA 1RVF3 3VL8A 5HBAA 1N3PA 3TBDA 2ZHMA 4FQZA 3ZFGA 4A7YA 4MSVA 3RI9A 4NN0A 4WV8A 5KXBA 4FCAA 5H9RA 2ZX3A 2VGDA 3O7OA 3HR9A 1FMD2 4YVWA 3D5OA 4JV4A 3RMYA 2GNTA 1IQAA 3HN1A 1PO11 1W6NA 2CTVA 2ZBJA 4QMAA 2XVLA 5F6LB 5CFCB 2YC0A 1EV12 2R071 3ZYPA 2VNRA 4A7ZA 1SMVA 4WVVA 4L8QA 3E5XA 4XYXA 3BB6A 2Z2SB 3J8F1 3U0ZA 4KH9A 3MFCA 1D0GA 1BZWA 4KBBA 4R9DA 4NOTA 1RUJ1 1UW8A 4XHBA 5C8CC 4QHBA 5T54A 4RGAA 4CEWA 3PLQA 3CLPA 1GZWA 3QOPA 5E88A 4YW1A 4CDWC 1RL3A 1ASJ1 4QPYA 5EWSA 1QOOA 2CY6A 2G9GA 3KQRA 1OFNA 1N1VA 1DZRA 2PHUA 5BNOB 3AP7A 1RUE2 2YGMA 3T2TA 5BUVA 4N7UA 3JBG1 5C9AC 2P3KA 2XG3A 1QH7A 3SMHA 1I9RA 1GZWB 1H1AA 4NHLA 3WLUA 3FBMA 2JG9C 1NCQC 4EN9B 4FPKA 2C9AA 1JW6A 3MLLA 2VNGA 3RS6A 2JE7A 5FO9B 3WUCA 1VBC1 4YYOA 4OI1A 4PBPA 4WZCA 4CYDA 1N1TA 4Q0PA 1H4HA 5L19A 4YSFA 1ULDA 1R1ZA 3OF1A 5EXOA 1MS9A 3ZFFB 3SHRA 2BGCA 2XLFA 1NQJA 1NG0A 3DN7A 1IPKA 5JDBA 1W6OB 2E6VA 1S2BA 1X8EA 2V09A 1AXKA 4YFZA 1JOJA 1RUC3 1V6LA 4LO8A 4NPRA 4KWLA 3NSTA 3KS7A 4FPOB 1EPWA 4R9CA 5CG9A 1U0AA 1MS1A 3ZVXA 1HXS2 2MNGA 4PBOA 1DYPA 2QJVA 4LHNA 3VUOA 2WNVC 3Q9OA 1KFUL 1POV0 3AYEA 1UMZA 1VBD3 4Y26A 2AGSA 4CP1A 2CV6A 1QOSA 5ABJC 1QXRA 3E5UA 3E6DA 1UU4A 2I74A 4RS5C 4M3CA 5JOWA 5AC91 4OLLA 4Y22B 3VLBB 4INDA 4BMBA 4ES9A 3AJZA 1V6JA 2PFWA 4Q26A 1HV0A 3ZSKA 4BIFA 3MLJA 5FPXA 1GLHA 2DUQA 5JZGC 1AL22 2HWC3 1YLLA 3AP4A 2D98A 2RJLA 1JUHA 5IT6A 2WLQA 4AVSA 1C5HA 4NO4A 5L7OB 3O0XA 4AHZA 1H4GA 1W6OA 2A6YA 4MGZE 3FLTA 5GZFA 2PAMA 2WS93 2DYCA 2UY9A 5E8AA 3VV1A 1VB2A 4LUMA 4Q8LA 4I3PA 4XJ8A 3HT2A 1V00A 5SV5A 3SXWA 2VNOA 1S2KA 4DFSA 4Y4YA 3I59B 1QJZA 1S0IA 2PHFA 4H55A 4QQOA 2D44A 3B3QE 4YZ2A 4OHVA 4ATEA 4XEZA 5JLVA 2D6NA 3PHMA 1WD4A 5HCAA 1YO8A 4SLIA 3UJQA 4K6BA 4LO6B 1MS5A 3PVOA 4H7LA 3BOWA 3VBFC 5LK5A 1H2KA 1OA2A