1ZA4A

Crystal structure of the thrombospondin-1 n-terminal domain in complex with arixtra
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
SVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of the Thrombospondin-1 N-terminal Domain and its Complex with a Synthetic Pentameric Heparin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Thrombospondin 1
total genus 47
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2005-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1za4A00
1LHVA 1DQ2A 1LHWA 1GZ9A 5HCBA 1LTEA 1KJLA 3IN9A 4Y26A 1RINA 2GMPA 1UKGA 3UK9A 3VKNA 1QMJA 1MS1A 2C9AA 3AK0A 2P2KA 3D4KA 3AX4A 3LSDA 1G9BA 5KXBA 1WLDA 2YY1A 1HDKA 3AZWA 4SLIA 2A71A 5GM0A 3ZXLA 5DZFA 3WCRA 2PHTA 1AXYA 3WUDA 2WKKA 4GWNA 1WLCA 1C4RA 5FREA 2ZGUA 2C5DA 2GMMA 2VW2A 3WDVA 1VLNA 3OJBA 3LCPA 1IS4A 5KXCA 5CNAA 4I30A 2DU1A 3W58A 4AVSA 2AGSA 1H30A 5HCAA 4CZSA 3WHUA 5E8AA 1CESA 2VXRA 5T5JA 3AJZA 4XIOA 1GNHA 3WVJA 4BMEA 1CR7A 5GZCA 2VU9A 1Z78A 5DG1A 3DUIA 4XDQA 4FP2A 3IMNA 3OBRA 2EIGA 1WW5A 2DVAA 2W52A 2WLQA 3N3HA 1JOJA 5F5QA 2JECA 1D0HA 2AR6A 4JCKA 1G9DA 4YM3A 4XXPA 1AVBA 2WQZC 1WLWA 3NV4A 3T2TA 4Y1VA 3WNXA 1G9AA 1JBCA 1DFQA 1N1SA 4Q1PA 1LEDA 1BXHA 3POWA 1PZ8A 3W59A 1LOBA 1I1EA 5JOZA 1A8DA 2D3RA 3WLUA 2CTVA 2DV9A 2DVFA 1W6MA 2H0BA 3RRDA 1IS3A 4YZ5A 5IUQA 1S1AA 2EXKA 2A75A 4NO4A 4K1YA 3N35A 1U0AA 1HQLA 4Z8BA 1GZWB 1QOTA 1LESA 1W0PA 2SBAA 1FATA 4Q27A 3RMYA 4XZPA 3ZSLA 3ZXFA 2LTNA 5GLTA 3WG4A 3ZYPA 4Q8KA 2OVUA 4BLIA 3FBYA 3RS6A 3A0NA 3ZVXA 1KJRA 4OZXA 2Z42A 5DUVA 1V6JA 2LALA 1V6OA 2EAKA 3QCWA 2V5YA 2ZGTA 2SLIA 4CTEA 2DVGA 1QU0A 2ZGSA 4WVWA 4M00A 1DQ0A 3A0KA 4HL0A 1V6IA 4XTMA 3I4IA 5CB7A 3R05A 3WDXA 4F83A 1YIFA 1SCSA 3WV6A 5GLWA 2P3JA 1V6KA 2VUAA 1I3HA 2ZGRA 4ATFA 4DRRA 1SLCA 1JHNA 2ZHLA 1N1TA 4YG0A 5H9RA 2E7QA 3VUOA 5IK7A 1N47A 3A4UA 3R4UA 4YZ2A 1LENA 2A6ZA 2CY6A 2DUPA 2GNMA 5GZDA 3TAYA 3B01A 1RIRA 1DLLA 1LJ7A 1ENSA 1V6LA 3N7MA 4XBLA 1YYNA 2GNTA 5LK5A 2D6PA 1SFYA 1MVEA 3L2YA 3O0WA 2WT0A 4IQPA 4YFZA 1QNYA 4H55A 4Y1UA 3B9CA 4K20A 4Q2FA 4PQ9A 3BOPA 4PCRA 1C1LA 1QOSA 2CNAA 4Y20B 4DFSA 3ZXKA 3HR9A 3OGGA 3LSEA 2A5ZA 3OY8B 3N36A 4YFWA 2GALA 3WG1A 1GANA 3AZXA 2CYFA 4FOVA 3ZXEA 1W6PA 2AUYA 4K1ZA 4YGDA 2P34A 1MR5A 1HLCA 2VY0A 2JKBA 3IPVB 1ULEA 4XILA 4R9CA 1DYKA 1Q8QA 5SV8A 1QF3A 1AX1A 4Y24A 4ZKTB 2NZ9A 4YZ4A 3PVNA 1GNZA 3OBTA 3V0BB 4DRVA 5T5OA 1XQNA 4FPEA 1CJPA 4XIKA 3SLIA 1W6QA 3AYDA 5KXDA 3VKFC 1ENQA 1AX2A 1S0DA 4FPHA 3BIWE 1SBDA 4FP3A 2NP0A 3ILRA 3OY8A 2ZACA 4YLZA 3WOGA 4XXAA 4DQAA 4ITCA 4AVVA 2DTWA 2D6MA 3NWKA 1BJQA 5DZGA 4DPNA 2W68A 5E88A 1Q8SA 1GYKA 4XJWA 5EYYA 2GNDA 2CWMA 3MEPA 2GN7A 4UW4A 2ZGNA 4P9YA 1V6NA 1LOFA 1IS6A 3N7KA 2UU8A 2GMEA 1BKZA 1BQPA 1V00A 1DHKB 1S0BA 1F31A 3DGTA 4LBQD 1GICA 4GKYA 1DYPA 3KQRA 4LBKA 4UW6A 4ZXKA 3V64A 4BPZA 1FYUA 5T55A 3T1MA 1AF9A 3WCSA 1MACA 2DURA 1W6NA 3O12A 1N3OA 3JU9A 4Y22B 3GNEA 5KXEA 3USUB 4FOWA 2D43A 2ZGLA 4XMIA 1S0JA 1VAVA 3B3QE 5T54A 5CA6A 1S0EA 1CVNA 1TEIA 3AXEA 3M3QA 1LGBA 2OUHA 4FQ4A 3WDYA 2ARXA 4XJUA 5IK8A 3AYEA 4XHXA 3AJYA 5H9SA 3NV1A 4M3CF 2ZMLA 1Y7BA 2ZGOA 5F9TA 2EF6A 4R9BA 3M1HA 2B7YA 1MS3A 2WJSA 2ZA9A 3FFZA 2OW4A 3NV2A 4FPYA 3M3EA 1BZWA 2EALA 2YV8A 3OYWB 2OUJA 3RQ0A 1J1TA 1OQ1A 4XYXA 3USUA 4Y1XA 1SLLA 4FPOB 4FPCA 4BM8A 1F9KA 2A6YA 3UJQA 5E89A 1G8WA 3N7LA 4Y1YA 5DZEA 4YW4A 3MW3A 3O0XA 1JW6A 3PJQA 4LBMA 1V6MA 2R0FA 5JOWA 4XTPA 2DUOA 2TEPA 1QGLA 2G4IA 5GJ6A 1KDMA 1YO8A 4XE9A 1SBEA 2RHPA 1IS5A 2CWSA 1GZWA 1MVQA 2UURA 5DXDA 1S0IA 5GZFA 2E7TA 5T52A 3ENRA 1JUIA 3BTAA 1SLBA 1N3PA 2NM1A 1KDKA 3PMEA 2W39A 1CIWA 3OYWA 2R1DA 2ZGKA 1Q56A 2DTYA 1LOEA 1S0FA 3UL2A 4Q8LA 3WUCA 5DUXA 4XBQA 5DUUA 3R4SA 2DYCA 1WW4A 4R9DA 3IPVA 2A6VA 3ZYRA 3U4XA 5JOYA 4FPLA 1KITA 4PBPA 3HN1A 4PF5A 1FNYA 4PBOA 4FPKA 3POYA 2DVDA 1YRZA 1IKQA 3QLQA 4HANA 1CPNA 1DQ6A 1DIWA 2YMZA 2DU0A 1LHOA 3JUUA 1W6PB 4XJZA 4YG3A 4RL7A 5EYXA 2EXHA 1APNA 4YW3A 3ZXJA 1AJKA 3N7JA 5JLVA 3AP5A 3MPPG 1UZZA 1LOAA 4L8QA 2Q5TA 4UW3A 2ES3A 2JJ6A 4XOGA 4C1WA 4FPFA 2CL2A 1OKQA 3VV1A 2UWBA 1LGCA 4Q26A 4C1XA 1QOOA 3AP6A 3B00A 3SNMA 2BQPA 3SITA 2A7AA 4LBQB 1ULCA 2A3WA 4YG6A 5FRAA 1Q8OA 3WDWA 3Q9OA 3WDTA 2P3IA 4ATEA 1ZM1A 1MS0A 1DGLA 2A6XA 1LOCA 3AXDA 4XBNA 2GN3A 2ZKNA 1G7YA 3AP9A 5H9PA 1N1VA 1LHUA 1JN2P 4LBJA 2PHWA 4Y1ZA 1LGNA 3KM5A 1GLHA 1LODA 1S0CA 1DQ4A 1LHNA 4AGGA 2P3KA 4KBBA 4FOQA 3V0BA 3M3CA 4FOYA 1ENRA 2E53A 3CNAA 4LBLA 2R1BA 2YZ4A 1G9CA 2A70A 1YI7A 2WSVA 4GWMA 1DQ5A 1DZQA 1G9FA 4LBNA 1FV3A 4MYEA 1MS4A 1WBFA 4Y22A 1H9WA 1AX0A 1UN1A 4P14A 1ONAA 3MW2A 1WBLA 3I8TA 4YZ3A 3UJOA 4CRQA 4YGEA 2NYYA 2R0HA 1O4ZA 4XJAA 2EXJA 4K21A 3RSJA 1LCLA 3ZSKA 1F5FA 1LOGA 4M3CA 2D44A 1N1YA 4XMAA 4YZ1A 1DBNA 1FAYA 1D2SA 1UAIA 2YROA 1A3KA 3WZ1A 4BOWA 5T50A 4BMBA 2WT1A 5T5LA 2JE9A 3WG2A 1B09A 2ZZJA 4M3CB 2D7FA 1VALA 1O4YA 3VKMA 3AFKA 5GZGA 1G86A 4LBOA 1PZ7A 1FNZA 2D6LX 1PZ9A 4BQ1A 3VKOA 2PHRA 1CONA 1N3QA 2UWAA 1QDOA 2UWCA 1SLIA 2AH2A 4YW2A 3SH3A 3AZYA 4YW5A 1JXNA 3H0OA 3WG3A 5CBLA 1MS5A 2A3XA 3D6EA 4W65A 2PHFA 3APBA 4M3CE 1W0OA 3FUQA 2KM2A 1SCRA 2ZABA 3TB0A 3ZSMA 4FQZA 1NLSA 1CQ9A 2D6NA 1AJOA 4XHBA 2ZBJA 5BYNA 1JYIA 1GBGA 4FPJA 2NN8A 3AP7A 1W6QB 2ZGPA 4U36A 1MZ5A 5JVVA 3T1LA 3V65A 1W6OB 1WW7A 2AREA 1AZDA 3V0AA 1QNWA 3RMXA 4WV8A 4P9WA 2WSUA 1UZYA 2ZGQA 1HKDA 1LEMA 5DG2A 2ZGMA 3V0AB 4RA0A 2DVBA 2ZHKA 1WD3A 2GNBA 2NMNA 4NOTA 5EXOA 1Q8VA 2PELA 3AZVA 3IM0A 2VH9A 4GXLA 4AVTA 3O5SA 4AGRA 1VAMA 4FPGA 1X50A 4FVVA 1ULDA 4XJ9A 1Z0HA 2E6VA 2DUQA 2R16A 4YW1A 1AXKA 5GLUA 4AGVA 4P9XA 5IK5A 4TZDA 1QDCA 1S0GA 2D6OX 3C2UA 3SISA 1EPWA 2W08A 2ZMKA 4YGCA 4Q1RA 2V73A 5DUWA 2GDFA 1IOAA 1HQWA 3MW4A 4JRAA 2NMOA 2PHXA 3HMYA 4M01A 2FMDA 4YM0A 1CPMA 2D6KA 3ILFA 4JC1A 1W6OA 1FV2A 5JDBA 1C1FA 3POSA 5T5PA 4GA9A 4AWDA 4GALA 2AYHA 4WZFA 5GZEA 3PVEA 5CAZA 5JMCA 1R1ZA 1AXZA 1LOFC 1H9PA 2WNEA 3ILNA 1VIWB 4AYUA 1UMZA 2VW1A 3ATGA 2PHUA 2HYKA 3SH4A 4UW5A 5IT6A 3PVOA 4R9AA 4YGBA 1WCSA 2I2SA 1BYHA 1GSLA 3M3OA 4GKXA 4YM2A 3FLTA 2D3SA 3RG0A 3FLRA 3WHTA 1WUVA 5JOXA 1SACA 1WW6A 1SLAA 1MS9A 1GV9A 1KRIA 3INAA 3D5OA 2ERFA 4ISQA 2YXSA 1ZA4A 1ULGA 1Q8PA 3O0VA 1DQ1A 3FLPA 5EWSA 1LU2A 1QKQA 3GALA 4WVVA 5GLZA 1UX6A 3FUOA 1A78A 2ZHMA 5AVAA 3ASIA 2JD4A 2FHRA 4YM1A 1RITA 1YXWA 2JDZA 2XB6C 3ZPYA 4ISRA 4ASMB 2R49A 1W6NB 3VKLA 3AP4A 1UL9A 1SBFA 3AZZA 4XJ8A 1UPSA 3NV3A 1MZ6A 5IK4A 1FX5A 1LULA 2JE7A 2P37A 2VW0A 1C57A 2XG3A 1LU1A 4Y20A 1LECA 1OFSA 2E51A 5GLVA 4DS0A 1GZCA 1W6MB 5GALA 3WDUA 2EXIA 2ZHNA 2ARBA 5HCFA 1SLTA 5L73A 1IKPA 1ULFA 1WD4A 4U2AA 4D69A 1JYCA 4BLJA 3ZSJA 1NXD1 3IKWA 3AYAA 3M2MA 1URXA 3OPZA 1GKBA 1MS8A 2DWRA 1KQRA 3AYCA 3B69A 1CN1A 2ZAAA 2ZMNA 2A6WA 3BODA 2AENA 2D3PA 4TYSA 4LBQA 5H9QA 3SH5A 2A3YA 2ENRA 2WT2A
chains in the Genus database with same CATH superfamily
4GJZA 4AAXA 5I0UA 2EVXA 1KJLA 3J9SA 2BGCA 2VNOA 2W91A 2GMPA 3MPBA 4KGGA 4OHXA 4Y26A 3RYPA 3UK9A 1NA1C 4A7KA 1QMJA 3C7GA 1QJEA 3H7YA 3Q8CA 4LE3A 5KHHA 3VHNA 3ZXGA 1W8WA 1ZREA 3AX4A 4WM7C 4Y3OA 5A1LA 3CEWA 1WLDA 1G9BA 3AZWA 1HDKA 2Y8KA 1HW5A 5GM0A 1GOGA 1FXZA 2PHTA 4GWNA 3TWIA 1C4RA 3KVBA 3AMNA 2RDSA 3JD73 5IJRA 2X53S 3WF0A 4FXGB 4L11A 1IGOA 4PLOA 5FYIA 4J1WA 4QGNA 3BIEA 4NROA 4BQYA 4UFJA 4FCAA 1L7RA 4AQSA 2O1QA 4QHOA 3J7MA 3W58A 2AGSA 1OA3A 5HCAA 2C26A 3K51A 1CESA 1ZBE1 1WMEA 1MPXA 3WP3A 5A7OA 4OMCA 4G9SB 3N9NA 2K0GA 1NOVA 4BB3A 2XWBB 4FP2A 3IMNA 3OBRA 2Y6HA 4UOJA 2EIGA 1WW5A 2DVAA 3N3HA 2JECA 5FWJA 5FPUA 5I0RA 2VO5A 1PX3A 3HNMA 2O8QA 4LMFA 1CD3G 4XXPA 4CDXA 3WNXA 4Z2WA 4Y1VA 1DFQA 3NKTA 1PO11 4PDWC 1BXHA 2VOXA 2XBO2 3GJAA 4B1LA 3CLPA 3ITQA 1RVF3 2C0ZA 2D3RA 2VQTA 2CTVA 4UXAA 2Q1ZB 5CKMA 1AR63 5F2SA 3WD5A 3WLUA 1AYN1 1W9SA 2BNMA 1W99A 3RRDA 4YZ5A 4WBBA 2EXKA 3VGIA 1H0BA 4QQLA 4Z8BA 1HQLA 2YFZA 3BALA 3GHMA 4LO5B 1W0PA 3PU3A 4DNYA 2SBAA 1FATA 4Q27A 3ZSLA 1VE0A 4GIQA 3RZMA 4LOTA 3WG4A 3ZYPA 4Q8KA 5FY4A 3RS6A 3A0NA 2VVEA 4CDWC 2Z42A 1V6OA 2EAKA 4LA2A 3PMSA 4LA3A 4H7LA 4RSUA 3VZKA 4QD2A 2CGOA 3HQUA 4UBHA 4XTMA 5F3IA 4PHZA 1NYWA 1VB4A 2NLRA 4I0WB 5D8AB 5ACA2 1COV2 3N9QA 1PVC3 3U37A 2Y60A 4XUNA 2JXAA 2ORZA 2BUKA 2VUAA 4H3WA 4BXSV 1D4VB 1SFPA 2G19A 5FBZA 4DRRA 4DUXA 1DGRA 2WQ8A 5H9RA 1ZX5A 5JR2A 4XCAA 2IXIA 4HBNA 5GKAC 3VUOA 1BMV2 3A4UA 3I7DA 4YZ2A 1LENA 3TAYA 2P5BA 5GZDA 1QJU3 4CP0A 1RIRA 4YVSA 1D4M1 5KWRA 1ENSA 2IUWA 4R52A 2XDVA 5CIRA 2ZEZA 3IDAA 4O65A 2JDPA 5A3WA 5DDJ1 5CU1A 1QJZA 2VZVA 2JDYA 3L2YA 2QQWA 5FMOL 3B9CA 5A70A 2ZKLA 4HVRA 3ST7A 1RUC1 1X7NA 1GP4A 4NVPA 1W8NA 3X29B 1RUJ3 3DPRA 3ZFFA 1QOSA 2CNAA 1NA1B 4IGPA 3WY6A 3P3NA 4YRDA 3OUIA 3DPRB 4CYDA 3B93A 3VBRC 4CUBA 2VOTA 4F7ZA 3ZXEA 1W6PA 3D0SA 5DPNA 2DFBA 2P34A 5F7UA 2VY0A 2X8KA 2JKBA 3IPVB 4Q4X1 1DYKA 1X9PA 1K5MB 5CZKA 4K8FA 3T2PA 4ASKA 4FT8A 5IATA 2G9FA 2HWD2 2JD9A 3S7IA 1QH6A 3T0AA 4GH4A 4XIKA 3SLIA 3UKNA 5KXDA 1ENQA 1S0DA 5FPBA 4AI1A 4RQPA 5FUPA 4A7ZA 3OY8A 3VZNA 4BK4A 2HWC3 5C3RA 4P9LA 3VBSA 4IE6A 3LWCA 4CCKA 5DAPA 1R64A 1VRH3 1ZZ6A 3OUJA 4JTOA 1OVSA 4LUMA 1O3QA 3NJVA 3THDA 4CCEA 1OXCA 1RUNA 2JB4A 3MEPA 3VBHC 1QJY3 4IV3A 2ZGNA 5IHRA 1UU4A 2VCCA 2P1BA 2A1XA 3Q8FA 3B9IA 1MEC3 4ZXKA 4BPZA 4EN0A 3U75A 2AEZA 1Q5OA 5FYCA 1MACA 4OUMA 4AVAA 5FMDA 3O12A 1XNKA 3JU9A 1F35A 5CISA 1YQ6A 4FOWA 5G05L 4XMIA 1AL22 1H4HA 5T54A 1VBA3 5AC91 1B35C 4JGZB 2ID4A 4N53A 3LEKA 1GOHA 3BVCA 1PIV2 1CX1A 4BIOA 4AL9A 5IFPA 5B4XA 4OYUA 3QACA 1HN0A 2P6CA 2PFWA 4WM7A 3S30A 1ZRIA 4HSJA 2PMWB 4M3CF 2PTMA 2ZMLA 1Y7BA 4HFSA 3S5AA 2RMU1 2WJSA 2RR12 2HEWF 2OW4A 2Y33A 2ZCWA 3HNBM 5BNNA 3OYWB 1GWKA 1OQ1A 4BQ5A 1JZ8A 3H1MA 4FPOB 2WNUC 1RXFA 1HJFA 5FZGA 1KS4A 3LA7A 4N8MA 4X8PA 4BM8A 3KZ4C 1PVXA 3CBNA 1G8WA 3TEYA 2WZPP 4Q4Y1 5TSWA 2J1SA 4OQ9A 5DMYA 2MPFA 3MW3A 4QX3A 1JW6A 4TXWA 4ZONA 1VBA2 5DN2A 4BXFA 3VD4A 4XTPA 4NMIA 1POV3 1QGLA 1US2A 1JYVA 2G4IA 2QBXA 2PA7A 1ZZ7A 1YO8A 1Z7S1 4V2WA 3RYRA 2W9XA 1MVQA 1YUDA 3CIHA 1TG7A 4Q4V3 5FZMA 1HRI3 5DXDA 2E7TA 3ENRA 1Y4WA 5DAWA 3ZR6A 1RUE3 1W8UA 2OT7A 2GH8A 1PO22 4B4RA 1C28A 1Y9QA 1LOEA 1S0FA 5FJHA 2WZR1 3UL2A 4QT6A 3UKTA 3WUCA 1DCSA 3R4SA 3ZXAC 5FZ1A 3VN4A 4C0BA 2LUWA 4QPGB 1W2OA 5JOYA 2DCKA 2VNRA 3T09A 4JZRA 5FO7B 1KITA 1UOBA 4EN8B 2YG0A 3HN1A 2CAVA 2RS52 1XU1A 3RYKA 1RB8G 2K9ZA 4FPKA 5FWEA 5BNPA 5A7SA 1TVGA 2DVDA 1IKQA 3KV4A 1O6UA 1WCKA 1CPNA 2C9KA 3O1VA 4CDUA 4Z1VA 5IVBA 2Y0OA 2BP6A 1W6PB 4LORA 3ES1A 5A1FA 3H8OA 3THTA 1Z7S2 1SPPA 2EXHA 2RM23 1AJKA 3DYOA 3GXUA 3ZXJA 1UD1A 4BE3A 5FPLA 1I5ZA 3GJBA 1LOAA 1S2KA 1JMUB 1C3HA 5EJ3A 2X29A 4FPFA 1QHDA 2HWC1 5A3MA 3VV1A 3KV5A 1LGCA 3MI8A 3ZPOA 1QOOA 3AP6A 3ZSEA 2QQOA 4OVEA 3SNMA 1ULCA 4NRQA 4CEYA 2A3WA 4YG6A 5FMBA 1J3QA 4XCBA 3Q9OA 5LATA 2YGLA 3EHKA 3WDWA 1UYPA 2P3IA 3AC0A 3E6DA 4ATEA 4UAPA 1MS0A 4ZXEA 3BU0A 2GN3A 1GNYA 2VULA 2ZKNA 2HBUA 3FN9A 1G7YA 4PDWA 5FY1A 4DXTA 1RUG3 5H9PA 3ZYBA 1LHUA 1DGWX 1DGRN 4Y1ZA 1GP5A 2ZX4A 2WNUB 1S0CA 1LHNA 4AZZA 4NIAA 4DUWA 4FOQA 3VBSB 4LBLA 1ENRA 2ATFA 1PVC2 1PIV1 5FKBA 2WZR3 1RJ8A 4QB6A 4WM8C 2ZOEB 3NNGA 1G9FA 2GC0A 1GOFA 1EV11 4MYEA 1MS4A 1XSQA 2OXBA 3PLQA 1AX0A 4LHNA 3FZ3A 4CXXA 1ONAA 3A7QA 3LEIA 4YZ3A 5D2AA 1H2NA 4J25A 3WQBA 4OQ8A 4ZU5A 5F37A 4N53B 3S57A 2Z69A 2PLV2 3BKZA 1RUC3 5K8SA 1F5FA 4YZ1A 5C6CA 1RHI3 2HBTA 2WWUA 1FAYA 1UWWA 5FKCA 1U5XA 2Z79A 2XOMA 5T50A 4BMBA 5A7WA 5JWPA 1VALA 2WZEA 4IEPA 3U11A 1NQDA 3RGBA 4IXLA 5LWBA 2D6LX 2QUOA 1PZ9A 4QU2A 1OFNA 3ABZA 4BQ1A 4HONA 5CADA 2G1MA 3E1F1 1RVF2 4PLNA 1ASJ3 1RHI2 3SH3A 1W2TA 2JEMA 1JXNA 2R062 2H6CA 5BNPC 1MS5A 2A3XA 3E5UA 3JBG3 3MYXA 3OD4A 5CBLA 1WMFA 2KM2A 2ZABA 3TB0A 3U78A 2BEOA 3SMHA 3ZSMA 4I02A 1BEV3 5FLJA 1STMA 1CQ9A 2D6NA 3GCXA 2XLGA 3J26N 2ZBJA 4CDUC 5BYNA 2NN8A 2WT2A 3AP7A 2ZGPA 5JVVA 2WFF1 4U36A 3OBZA 3T1LA 4AAPA 2JDAA 1RGSA 5K0UC 1AZDA 4FAHA 2LROA 4NAMA 4UI9L 1LAJA 1UZYA 1LEMA 1J1LA 3WSOA 4RA0A 1AR61 1SZBA 1Y9MA 4NOTA 1RUC2 5EXOA 2VPVA 3GZEA 1NLQA 3IM0A 4XUOA 4AEKA 5C5TA 4RR3C 4DOUA 2E31A 1SQ4A 2WZR2 4XJ9A 4D6RA 2AZ5A 4AGVA 4TZDA 1S0GA 3C2UA 2D6OX 2FDFA 4MHRA 1XBFA 2WIIB 5FP8A 4ASLA 4MUVA 4Q1RA 5LRSA 2VQUA 3EMRA 2J1EA 1ZBE3 1HB4A 4N7UA 2WNVC 5FBJA 1UY1A 2X09A 3KWVA 4M01A 2FDHA 4HVOA 2FMDA 3T0DA 1W6OA 2AC1A 3LE0A 5T5PA 5C7GA 2RE9A 3MZHA 3WINE 4PJYA 3VDDB 2Y0IA 4XF9A 5FLIA 4ZU7A 1HXS2 2CV6A 3BB6A 2JDMA 5JZGC 1JYNA 1GWLA 1RJ7A 1LOFC 2WNEA 1E5RA 3ILNA 2EAAA 1KGYA 2Q8CA 1UMZA 3SCHA 4UW5A 3SH4A 4CSWA 4ZZ8A 3HJRA 2X5IA 4R9AA 4P5HA 4QPWA 2PHLA 4YGBA 1WCSA 4GKXA 4EROA 3FLTA 2JG9C 1ODMA 3I2IA 1WUVA 3NO8A 1WW6A 2YC4A 1UCXA 1SLAA 5KC5A 3VL8A 1FOD1 1NXMA 3INAA 2ERFA 4F3JA 1DDLA 3B94A 2BERA 3CKHA 4RGKA 3T3YA 5SV5A 3E5XA 4IGOA 3ZFGA 2BWCA 3O0VA 4AHZA 1H6YA 2IXJA 3VHPA 1K3IA 3VZJA 1QKQA 1K42A 4K8RB 5HXVA 3FUOA 1YQ2A 3T1MA 5BNNC 4YM1A 2JDZA 1YXWA 4NHXA 1TMF2 4ISRA 5FZKA 2R49A 3LOBA 3KCXA 2QZ2A 5FY5A 4XURA 1GQHA 2E63A 2WNUA 4TLGA 1W6NB 4IEWA 1UL9A 1SBFA 3AZZA 3MLLA 4FFGA 3T2OA 3ZN6A 1UOGA 1UPSA 4XVHA 1YFYA 5IK4A 1FX5A 4PDWB 2WS93 2WNOA 2XG3A 4CUAA 2QQJA 4DS0A 1H8VA 1NE6A 3ACGA 2EXIA 1OI6A 5IVEA 1DYOA 3PNAA 5K7PA 5FPVA 3RDIA 1SLTA 3DN7A 5E1RA 3I49A 4A45A 5F5CA 5FFOC 1H8TA 2E33A 1VBE2 3ZSJA 3C3VA 2RG4A 4XFFA 2DCJA 5CFCB 4LQRA 2DBIA 4RHV2 1ZRDA 1MS8A 4ZS3A 1EYBA 5A7NA 2ZAAA 2FDGA 3D3AA 4AOCA 4RFRB 1ZRFA 1VBD3 2D3PA 5H9QA 4LBQA 1H4GA 4LIVA 5FJKA 2A3YA 4R8HA 1PGSA 1OOPC 2VMDA 4B29A 1LHWA 3JQXA 4WM7B 2VBBA 1YFUA 3DCQA 3ON7A 5HCBA 2P17A 1GQGA 1BVVA 4A44A 2H0VA 1NY71 1VR3A 3V56A 3TBDA 1UKGA 2IXKA 4XAAA 2R073 2WNVA 3UGGA 3VKNA 3DKWA 3WNNA 2RS12 2HH9A 4M4RA 1UYZA 3AK0A 4NE9A 4QXHA 4LXLA 1OD3A 3D4KA 3LSDA 3NJXA 4UFLA 5KXBA 2YY1A 3I3DA 4SLIA 3VZMA 4DINB 5C70A 3ZXLA 4AI8A 4XF3A 3POEA 1TME1 5FPZA 3RI8A 3WUDA 2WKKA 4NPRA 4QKNA 1WLCA 4IEVA 5FREA 1BHGA 2D97A 2WS91 1AL23 2VW2A 2WAAA 3AMHA 2RS32 3K2OA 4QX0A 2HYXA 1OD5A 5CNAA 5KXCA 4E4HA 1UKRA 4FBFA 4NAOA 1W03A 1VBB3 4MHUA 3RZZA 1O5UA 4IV1A 3SCFA 4AVSA 1S55A 3MUY1 4CZSA 1VBE3 4AFCA 3Q8AA 2VXRA 4UF0B 1O3RA 1ENXA 1GNHA 2R061 1CR7A 5BNOA 5FZOB 3NMBA 5DG1A 2ZJCA 3AM2A 2KA3A 1RVF1 1YFXA 1CX4A 1QXJA 2W52A 2WLQA 3EQEA 4HMZA 1D0HA 2VCAA 4YM3A 4HETA 3ZN5A 2WQZC 2QQMA 1WLWA 1OPMA 2HWD3 1XNCA 2QKDA 3NV4A 4LO6B 3T2TA 1N1SA 4A7YA 3WP6A 3M8LA 1PZ8A 4GMP3 5B4NA 2VZOA 5L7OC 1A8DA 2F6BA 5L36A 5G04L 4Z92B 1W6MA 5KHIA 1O5LA 1NLRA 1VRH1 1OH3A 1AL0G 2XJTA 4AHXA 4XACA 5HV0A 2LRPA 1ND2A 1QOTA 3K3OA 3VD5A 3UETA 3ZOIA 1EV12 4QPGA 5EFUA 2VXJA 3IDCB 5FZCA 2G9ZA 3I59B 1WLTA 5IVJA 3C7HA 2Y64A 3ME2A 5GLTA 1PMIA 1E57A 2IXCA 3I2OA 1ST8A 3FBYA 2HWE2 4XDPA 4YW7A 3JD71 1KJRA 2BZDA 4OZXA 3ZVXA 1RL3A 1V6JA 4N43A 4E2SA 4L9BA 3QCWA 4QPIA 3OGRA 2Q8EA 4AR2A 3LD8A 3ZFGB 4CUCA 3NRUA 2JG9A 2ZX2A 4K3UA 4NWVA 1SDDB 1SPPB 2XUEA 3UYJA 1BBT2 5A32B 1HQNA 1NKGA 1CAUB 1OLQA 3J8F2 5CB7A 3T08A 1HJGA 5FOJB 4F83A 1YIFA 1SCSA 3K4DA 4KU8A 3HEIA 1V6KA 2R071 1PGW1 1SLCA 5JZGB 2ZHLA 3IB3A 4I01A 1OOPB 2E7QA 5FZ8A 1WWYA 3O1RA 4IUGA 2XVGA 3R4UA 4DXSA 5IK7A 2A6ZA 2CY6A 1PHMA 1ZBE2 2DUPA 1AR83 1GR3A 2GZWA 2XXZA 3MGUA 5FYUA 5ISLA 2R32A 1VP6A 3OGSA 5FZLA 2KR2A 3H8RA 1W9TA 2VZTA 3GZTB 3VLBB 1V6LA 5FZ9A 3AVSA 4COWA 3GDBA 2GNTA 3RJ2X 3WQ0A 4COZA 1QJY1 2WT0A 2VOKA 3SC7X 4OCTA 3K46A 4Y1UA 4Q2FA 4YYOA 4E2GA 3HN3A 3RVHA 1QQP3 4PCRA 3U14A 5FK8A 1PK6A 4D3WA 2A5ZA 3OY8B 3ZDSA 3WG1A 1RUF2 3AZXA 1ZBA3 4PI2A 1PM4A 1W39A 2Q1MA 5F3CA 2VTFA 4E4DX 4XILA 3BTZA 4EWAA 2O14A 3O14A 1QF3A 4MO3M 1AX1A 2WO3A 4JQTA 2NZ9A 4ORFA 3B02A 4YZ4A 4KU7A 5FO9B 3OBTA 4RS5A 4E8CA 3V0BB 5I8SA 1QWRA 5T5OA 1GFF2 1YQCA 2BOIA 2R041 3SCGA 5CFCA 3DXTA 4N9IA 4GMP1 1AX2A 3B5LB 4FPHA 4FP3A 1OQDA 2BNOA 1BEV1 4A3XA 3E97A 3ILRA 2GC2A 4X6RB 1VBB2 4HVQA 1WCUA 3U10A 3KQ4B 4LHSA 2R072 2OYZA 5BUVA 4DQAA 3TEWA 2DTWA 2VMIA 2WC2A 3TN91 4HN0A 1H6XA 4DPNA 1FI2A 5DZGA 3BGAA 1AYM1 1UU6A 1Q8SA 2W68A 2Y34A 2VG9A 2Q1FA 4XJWA 5E88A 3DL3A 2VBPA 3AMQA 1RMU2 1LOFA 1OA4A 2UU8A 5C5UA 1BKZA 1SDWA 1V00A 1DHKB 3AB0A 2YFUA 3GHNA 1RYYA 5C33A 1FT9A 1HRI1 1TNFA 3HT2A 2DFCA 2FBEA 3KQRA 2JKXA 3MFCA 5A6XA 2X5IC 4HZFA 1FYUA 1HV1A 1SFNA 4BQ3A 1VMHA 3HPNA 4CE8A 3I2JA 1DGWA 1N3OA 4O61A 3GNEA 2BOJA 4HXCA 5KC6A 1A6CA 2ADDA 3LFIA 1NCRA 2D43A 2XJPA 5FYYA 1S0JA 4UF0A 4CCMA 5C8WA 1CAWA 1H1AA 3ZDVA 4D0QA 4PIYA 3N9PA 2HWF2 1TEIA 3EXUA 1VBD2 1LGBA 3IIAA 3J7NA 2V4VA 2ARXA 2XR4A 4FQ4A 3AYEA 4LIUA 3TNQA 3OBAA 1AYN2 4CCDA 1RXGA 4HPKA 5J7MA 4NHKA 5C9AB 1DU3D 2ZGOA 4QX5A 2HWB3 2OIIA 3HD8B 4BA6A 4R9BA 2XBO1 1XRUA 4WM8B 5FZOA 3LOIA 5EZWA 1X8EA 4MVTA 1RUG2 1V9U1 4XYXA 3VD9A 3NJZA 1SLLA 1L3JA 4OMDA 5D8AA 5I8TA 1JU3A 2W87A 4QB1A 4CU7A 4LNVA 4OI2A 2OX0A 3N7LA 3TNPB 4GMP0 5DZEA 2WYFA 4YW4A 5A6ZA 5I0DA 3O0XA 4Q4V1 3VDCA 1WKYA 1H2MA 1V6MA 2CHHA 2R0FA 4QGLA 4MLOA 1ODNA 2DUOA 3PURA 2RJKA 4QAWA 2WN3A 3ZYHA 2VZUA 1ZBA1 5GJ6A 1CAVB 3ALQA 3MHZA 5APAA 4YPJA 3CHXA 3ZIWA 2UURA 3AL5A 1S0IA 2BV4A 5GZFA 5BNPB 3MO4A 1AR71 5T52A 1X9TA 1HB2A 4XAEA 1OOPA 1JUIA 3BTAA 5FY0A 2NP0A 3PMEA 2XL7A 3LEGA 4QX8A 3KCYA 2IXHA 4CCNA 1MQTA 1CIWA 5IAXA 1DLCA 1TQ5A 2Q4SA 4QDRA 2DTYA 1UXZA 1R1A1 3PUAA 3DYMA 1S2BA 1YJKA 4PQQA 2J1VA 5T3NA 3ZYIB 5ABJC 3ETQA 1NY72 1WW4A 1W05A 3LDRA 3IPVA 2A6VA 4QX1A 1CWPA 3ETPA 3U4XA 1PO21 2W1SA 4PBPA 1GP6A 4PF5A 2HWB2 1XE0A 2XHNA 4PBOA 4TN7A 2BGPA 3LA2A 2RMU3 4Q4Y3 2YC0A 3NKGA 5C8CA 4LPLA 1AYN3 4QMAA 2WN2A 4HSLA 3JCIA 3I2HA 4Q29A 3OEAA 1J59A 2XVLA 2VZPA 5FPAA 2VZ1A 1APNA 4Q4W2 2QFEA 1ACCA 4YW3A 1F4HA 3HOBA 3N7JA 1CZSA 1WMXA 4OHVA 2OZJA 3AP5A 2JICA 1F15A 2Q0AA 1UZZA 2RJ2A 3MPPG 2Q5TA 3VBFC 2ES3A 4B7KA 1VBA1 1AR81 1E5IA 1OBNA 1OKQA 1WMDA 3U4SA 4FTBA 2UWBA 4DO0A 1UOFA 3WQ1A 2CDPA 2VCMA 3B00A 3SITA 3HNYM 4AVCA 4LBQB 4DMIA 3W5NA 2BJSA 3FJSA 5FRAA 1Q8OA 3ZX7A 1RMU3 3NQHA 4K9SA 1DGLA 2A6XA 3AXDA 4RS5B 4UBGA 4XFCA 3ZYJB 3HWJA 3ZR5A 2IVIB 2Y6LA 1JN2P 5C3SA 4GB33 1GLHA 2RV9A 2B4KA 1SG3A 2DBNA 1QXPA 3UNPA 4GWJA 4KBBA 4MGIE 3V0BA 4XDOA 2QQIA 2R1BA 5JUVA 2WNVB 2A70A 1W06A 1YI7A 2WSVA 4IEXA 4MGZE 3ROUA 4OHYA 3OEBA 3GBWA 5AC92 1DQ5A 4LBNA 2CSGA 1FV3A 5I0TA 2LS6A 4ES8A 1H9WA 2VQAA 2X05A 1UN1A 4YVWB 4AEDA 2R063 3I3MA 3MW2A 3I8TA 5FP9A 3UJOA 5L9VA 3K4ZA 3CJIC 4W8JA 3BPZA 3UESA 4BH9A 3I97A 3J4UH 5E16A 2ADEA 2BRTA 1JOBA 4D7TA 1LCLA 1RUJ1 4DY3A 4M3CA 3GM8A 4XMAA 3LKJA 1D2SA 1C8M1 1UAIA 2RJLA 1A3KA 2X10A 4OZOA 4LJHA 4GULA 2C1FA 1NCRC 2WT1A 3AKPA 2JE9A 2ZZJA 1MQTC 4M3CB 2D98A 2D7FA 5IVYA 4LEJA 3ZYFA 4AK3A 3IAQA 5J36A 4LBOA 3D0JA 2IFWA 4P00B 4CDQA 4LOSA 3VKOA 2PHRA 2PXJA 2WA4A 1N3QA 3VHOA 4JGYB 5LCWL 4GB31 4YWAA 2HWC2 4X8NA 1AR82 1NAEA 1J58A 1W0OA 4C0HA 5FZ6A 5C3PA 1KXGA 2W0XA 3BN6A 1DF0A 2VZQA 3ORJA 4FPJA 3ZN4A 4IEQA 1W6QB 3RZKA 1O91A 1VRBA 1W6OB 3PIGA 4DEQA 4CEWC 5JSOA 2DF7A 1W9WA 1JS9A 4JHTA 1RUF1 4QM9A 2X5IB 1PO13 5BPXA 1QNWA 1O8SA 3G6JB 4O7XA 4IEYA 1YIPA 2QQLA 1TME2 5HI0A 3RZJA 4NHYA 4BCUA 2NMNA 3OF1A 2EICA 1UX7A 2WFF3 3AZVA 3MUZ1 2QE3A 4GXLA 4JDNA 3RWKX 4AGRA 4CPBD 4CU8A 1VAMA 4MXWB 1X50A 2OKXA 1Z0HA 2D93A 2DUQA 2E6VA 2XH6A 1AXKA 3QBQA 2RDQA 4YW1A 3T2QA 3WW4A 2GP3A 2WQ4A 3I3QA 1DZTA 1MZFA 2WR9A 4OHWA 3SISA 4MGTA 1IQAA 1UYYA 2VZRA 1V70A 1ZZ8A 4LKDA 3I2FA 3NAPC 4B7EA 1IOAA 1QXRA 3OOXA 4YNIA 3QH7A 1NA1A 2WWSA 1JZ6A 4MSVA 4NHLA 1ZVFA 4KWKA 4QHBA 1C1FA 1EPZA 4G4FA 4GA9A 4GALA 4NRMA 5JPMB 1BBT1 1EAH2 1UOJA 2IFRA 1VBC3 2I45A 2W47A 3FMGA 4P9JA 1VPHA 3D8CA 3PVEA 3NSTA 4XUQA 5GZEA 1COV3 3WNLA 1UNBA 1AXZA 3CO2A 3RFRA 4Q4V2 4IE4A 4AYUA 3KHCA 3ATGA 2PHUA 2HYKA 3I3EA 3PVOA 3VBUC 1IPJA 2I2SA 1BYHA 1EY2A 5FYBA 4YM2A 4URAA 2D3SA 1NCQA 3FLRA 5JSPA 3S7EA 1D0GA 5FXZA 1XE8A 1XU2A 4N90A 4K40A 4CDWB 1MS9A 1PK6B 2PAMA 3WXPA 3D5OA 5LBBA 3MF9A 1ZA4A 5FV3A 3VBOB 2FQPA 4JTNA 2FZ1A 4CU6A 3FLPA 5EWSA 5EQUA 1JZ7A 1AR73 2DCYA 4QQPA 3K77A 1JH5A 4WVVA 4BHPA 4DB5A 1V9U3 3JQWA 1UX6A 5AVAA 1A78A 2ZHMA 5GLZA 3ZPYA 4C91A 4IEOA 1AL21 5EIYB 1K5MC 2PQSA 3QOPA 2OQ6A 1S2EA 5D8AC 2HJIA 3VKLA 3AP4A 3NAPA 5BV6A 3NV3A 5HXMA 5FZBA 1LULA 2JE7A 1OA2A 1W9YA 3AKRA 3ZFFC 2RS33 3H50A 4URTA 3TEXA 3OG2A 4B4PA 5BNNB 1GZCA 2B46X 3WDUA 4HLTA 3VL9A 5KHJA 2VTXA 3T4VA 2ARBA 4YVWA 1AYM2 3P6BA 4CP1A 2Q8DA 4META 1JYCA 5FZEA 4D69A 1I6XA 4AQTA 1NXD1 3IKWA 3AYAA 1URXA 1ULOA 3BCWA 2DWRA 1KQRA 3AKSA 3Q8BA 4HKLA 2D5FA 1CN1A 4A4AA 1VMJA 2QDNA 5CG8A 4JKMA 2AENA 4S2DA 1DG6A 4TYSA 2RS51 4AEDB 2WZ8A 4FAGA 1LHVA 1DQ2A 1GZ9A 2ZEYA 1JUHA 3O1UA 1BLZA 4A6OA 2VR4A 1RINA 3KT4A 5FMOS 4H2AA 4BYYA 2RS11 4XEZA 4IV1B 1RUF3 1MS1A 2YDEA 2P2KA 3FHQA 4I0AA 1QH7A 1FPN2 4LLOA 1MZEA 5DZFA 2B5HA 3WT3A 4QB2A 1AXYA 4XQDA 3T30A 3POGA 1IPSA 2C5DA 4K7JA 2EIEA 3OJBA 3LCPA 3FFQA 1YLLA 5FYVA 4LTAA 1VBC2 1NZCA 1RC6A 4I30A 4CP9A 5DDJ2 1ND2B 2JDNA 3AMMA 3MV11 2J1RA 3TN93 1H30A 4Y5TA 3WHUA 5A80A 4BMEA 3AJZA 4KG0A 4XIOA 1WCDJ 3MBWA 4Y4RA 3WNOA 3ZFFB 3VBRA 1OUSA 2VU9A 2ZTNA 1JZ5A 2WO7A 3OSDA 3W5MA 1JOJA 1W04A 5F5AA 1RUH2 2ZEWA 3HT1A 4AFAA 2Y6GA 1QJX1 1AVBA 1D4M3 3GZAA 4JKLA 2Q30A 1G9AA 2AEYA 4Q1PA 1CAUA 4CXWA 1K5MA 3POWA 1C5HA 1LOBA 3KGZA 3W59A 4CEWB 4D6SA 4AHWA 5JOZA 1W2AX 2DVFA 3GGLA 4GH4B 4CEWA 3THPA 1IS3A 5I91A 5IUQA 1S1AA 4L0PA 2A75A 3USSA 3N35A 4ZY9A 1U0AA 1XNTA 1GZWB 3Q8EA 3RZHA 4FFIA 4NRPA 2VD7A 4XETA 1Y43B 1ALYA 2B42B 2HEYF 4HOOA 4MX3A 5FP7A 3LA3A 5LY1A 4XZPA 1W8FA 1YCIA 2LTNA 2A73B 1LR5A 2OVUA 3LIHA 1PVC1 2FD8A 4CDWA 1MEC1 4RGGA 2QZ3A 3KCCA 4UT5A 3N4MA 1M06G 5LBFA 2ZGTA 4NPMA 1UF2C 2SLIA 2W2IA 2YB7A 2DVGA 2YHJA 3WW1A 5KHKA 1T6GC 4M00A 5KR7A 1DQ0A 4M0NA 3GBFA 3NVCA 2C6SA 1O8PA 2OZ6A 3FX3A 2BBVA 3WDXA 3PUQA 2ET1A 1CZVA 4N53C 3WV6A 5GLWA 2P3JA 1RUH1 2YBSA 4UFIA 5FMCA 2GC3A 2ZGRA 3LGRA 4K6BA 4ATFA 1JHNA 1BEV2 3OPWA 5FIXA 4UWDA 1N47A 1PMHX 2W46A 4IV3C 3LQCA 2DCTA 2GNMA 2QQNA 2VUJA 3B01A 1DLLA 3VD3A 1LJ7A 3S5QA 2HWD1 4XBLA 1AR91 1YYNA 4JGZA 5ANNA 1JHJA 5JSRA 2JDUA 3O0WA 3VBUA 1MVEA 4AI9A 1D2QA 4IQPA 4YFZA 3TOJA 4PQ9A 1CIYA 1SMVA 3BOPA 4P9IA 4DFSA 1U5YA 3OGGA 4AEJA 3LEMA 3LSEA 2XKOA 4YFWA 2OPKA 2GALA 4QQHA 1GANA 5J98B 2JG8C 4O9EA 1FPN1 5JXJA 2AUYA 2E9QA 2WA3A 4K1ZA 4QKFA 4YGDA 5D21A 1MR5A 3H1YA 4CEYC 1Q8QA 2WO2A 2XGXA 2XUMA 4Y24A 4ZKTB 2VZSA 1GNZA 3N9OA 2BPA2 3NJYA 1XQNA 2WLPA 3IDEA 1O3TA 2XKPA 3AYDA 3VKFC 2ZXQA 1LKNA 3PHMA 4TSVA 2JWPA 1POV0 1SBDA 3BIWE 5FZAA 2WL1A 1O4TA 1ZRCA 3H3ZA 4XXAA 4ITCA 4AVVA 2E26A 2B39A 2D6MA 3NWKA 1R083 5FUNA 4NUBA 4WM8A 1GYKA 2ZAHA 3UGFA 1Q43A 4LHKA 3MICA 4P9YA 1ULPA 2J22A 1HB3A 1IS6A 4ZZ5A 5JIAA 3N7KA 2EA7A 4QKDA 4MOAA 4YVSC 5LZ6A 1ZRRA 3DGTA 3HVDA 2GSYA 2OA2A 2PLV1 3AKTA 4Q4Y2 4XFIA 3N9MA 1DYPA 4LBKA 2VECA 4QQOA 4UW6A 5C4WA 4AG4A 5C4WC 4FO9A 3M3IA 1TMF3 1AF9A 2PQQA 5JR7B 1RUOA 2XLFA 3ECQA 3LDBA 4Y22B 3P1IA 2IZWA 5A3OA 2RVAA 2YYOA 4HKOA 4CDUB 3D82A 3KT7A 1W90A 2RMU2 1JYXA 1US3A 1OT5A 1S0EA 4EZ4A 3AXEA 3H8UA 4QXKA 2KD7A 3WDYA 4JDMA 4MV2A 4XJUA 2JG9B 3OGJA 3AJYA 5DQ0A 1ZNPA 1NX9A 4BWOA 4D6QA 3NV1A 2BU9A 1VBD1 1FOD2 4N43B 2RS53 5F9TA 2EF6A 3P5BA 3ZYGA 4CDXC 3M1HA 3LB9A 2B7YA 1MS3A 2ZA9A 3NV2A 2XJQA 4FPYA 3SEPA 3WF4A 2P6HA 3THCA 2B45X 2EALA 2YV8A 3HBZA 2OUJA 2W1QA 5FZFA 2PHDA 4HN1A 3USUA 1JZ3A 1ND3A 2RM21 5FYZA 4AHYA 1Z7S3 4NIHA 4B4QA 3NW4A 2VMFA 1F9KA 2A6YA 3UJQA 3ZN6B 4KI5M 4XFGA 4OUEA 2P4EA 3H1WA 1O59A 4AFMA 5LBEA 4BQ2A 4NIGA 2YU1A 4LBMA 4LULA 4FTEA 2PAKA 5JOWA 2V09A 2WUHA 2TEPA 1NG0A 1W9FA 1EAH1 2UY9A 4IEUA 5FZDA 5C9AC 1QY4A 1KDMA 4ZS2A 1SBEA 3JB4C 1PX4A 3SKVA 5J3UA 3TN92 2FDJA 2RHPA 2ZPXA 1IS5A 4COVA 2CWSA 4LKFA 1GZWA 4BDVB 1XXNA 1OMIA 2JB8A 1XNAA 3WR0A 3I2KA 5EHDA 4FFFA 3ZKYA 3WNKA 1UY0A 2NM1A 1KDKA 4RQPC 2VMHA 4PIXA 4FTSA 1RUE2 2IC1A 3VD7A 4AVBA 1OF4A 3WX5A 2MHFA 3FHAA 1RUI2 2E32A 1H1MA 2R1DA 2ZGKA 4LUKA 4MG2A 2BGOA 1W3XA 5FZ0A 1CZTA 4Q8LA 1REDA 1QQP1 4XBQA 5JI7A 1T2XA 4AEMA 3SEEA 2DYCA 3KS7A 1RUI1 3C8XA 3ZYRA 5EV7A 1R093 1RUE1 1AYM3 1H8TB 4FPLA 2ORXA 5K9YA 4UFHA 2AACA 1FMD1 1HRV3 4NIIA 3ZIXA 4QX2A 1YRZA 2XPJA 5F32A 2Z5WA 4HANA 1IG3A 5F6KA 1O7FA 5KBFA 1C8M3 1D7PM 1W3VA 4YG3A 3UT0A 2N7GA 3VDBA 4G3YC 5JLVA 3MIHA 1NE4A 1REEA 1ASJ2 4UW3A 3MV01 5K4LA 5FDBA 4XUTA 4XOGA 5FZHA 4I0BA 4C1WA 2RR13 2F17A 3I54A 4WVMB 4Q26A 4C1XA 2V72A 1J84A 1UQXA 4KWLA 4A2UA 2A7AA 1H1IA 1SHWB 4RR3A 1NZIA 3CQOA 3POBA 3POFA 5LY2A 2XLAA 3T0BA 4OUSA 4DIQA 4CVUA 4GQ7A 4FXKB 4IESA 4D7YA 2BYVE 1YWKA 2Y6KA 2GP5A 1XB9A 3CJIB 1R1A3 3J8F1 3KGLA 4Q5OA 2CDOA 3CZJA 5IVCA 2J1TA 4QHZA 1N1VA 4XF4A 1NCRB 3AKQA 5EJ1B 1LGNA 4XZUG 4LO8A 5A33A 3KHBA 5L7OA 3A21A 1PGL2 1DQ4A 1R091 2B9VA 4JDOA 4AGGA 5I8YA 3LZZA 4AE2A 1YEWA 4LKEA 4BQXA 2ZS6B 4C8DA 1MEC2 4FOYA 2E53A 5KHGA 2Y6JA 2YZ4A 5F3GA 4NR1A 1JYTA 4EZHA 2Z2SB 4IE7A 5FYHA 5C9AA 4YVWC 3AVRA 2LM3A 4MADA 1EUUA 4Y22A 4Y33A 3ACFA 3HAGA 1AHSA 1E5SA 2WINB 3I2GA 2QNKA 4LHLA 4KWUA 4XC9A 3BPSA 3ACHA 3GBGA 4YGEA 1VRH2 2R0HA 2Y26A 3B7MA 5CEHA 4YVSB 2Y38A 1F8VA 3VDAA 3MF6A 2LW8A 2K2SA 4E8DA 2D44A 4QM8A 1DBNA 3O1PA 2VBDA 1U12A 3WZ1A 5E6HA 4EN6B 4BOWA 2PN5A 1Y3TA 2TBVA 4RD7A 1RUH3 3WG2A 5C4WB 5F39A 4ZU4A 5GZGA 4JVAA 1G86A 3ZM8A 3M70A 3QH6A 3U07A 5A7QA 4MXWA 5FK7A 1VBB1 2UWAA 1BBT3 1QDOA 1YQ5A 2UWCA 2VM9A 1SLIA 2AH2A 3I59A 4IDZA 3M7AA 4MZUA 3VBHA 1JZ4A 4YW2A 3WF2A 3AZYA 4YW5A 2NQYA 3H0OA 3ZFEA 4B3NA 1QJU2 1UXXX 3OCPA 5L9RA 3ZFEC 3APBA 5DDJ3 2ETEA 3FUQA 4FFHA 4FQZA 1B35B 4JGZC 3ZFEB 4XF1A 3CF6E 1E5HA 2WWJA 4CEYB 1HIXA 1X82A 1AJOA 2VOWA 4JAAA 4Q4W1 5C71A 1GBGA 5J96B 1U5IA 1A34A 1OLRA 1MZ5A 1EV13 3V65A 2AREA 1UY4A 2ZEXA 4PLMA 2FDIA 3V0AA 2JX9A 4TLFA 2WO1A 5LW9A 4WV8A 1CAXB 4P9WA 4DUVA 2WSUA 4D7SA 2ZGQA 1HKDA 1UW8A 2VC9A 5DG2A 3V0AB 2JG8A 4KMQA 4CP2A 3VZLA 1VAKA 2ZHKA 1WD3A 2GNBA 5FZ3A 1UMHA 2FMYA 1H8TC 2KXLA 2W5FA 1HX6A 3PIJA 3O5SA 2JG8B 3ZMNA 4IETA 5FAXA 1ZA7A 4FPGA 4FVVA 4I09A 5ABJB 1R1A2 2YPDA 5GLUA 4W4ZA 4MGSA 1IPKA 2UYBA 4P9XA 2EIBA 4PF1A 3WEZA 2QTWB 4CCCA 4YARA 4QPYA 2ET7A 4RFT0 5EP9A 2ZMKA 1DP0A 3H42B 1RHI1 3PTYA 4YGCA 3VHRA 5CKNA 3O1MA 4HG6B 2DCZA 4V1PA 2XONA 4BISA 1HQWA 2R043 1W8HA 3MW4A 4IE5A 4JRAA 2PHXA 4JKKA 5C3OA 2OQ7A 2W3JA 4L2NA 3JB8A 4KGQA 1CPMA 3ILFA 4JC1A 2BVBA 1NQJA 4QXCA 4S2HA 5JDBA 5FY9A 5LA2A 3POSA 5A7WB 4IV3B 4AWDA 3TYJA 2AYHA 2CAUA 4COYA 4OLLA 5JPNB 4WZFA 3RPQA 3CDZB 1BK0A 1C8M2 4LITA 4EWEA 1VIWB 4ET7A 1PM7A 2Y6FA 2QQKA 5IT6A 2HWE1 3EBRA 4OULA 4J6GA 2IWGB 2XMLA 1RUG1 1OC1A 1V9U2 4XF0A 3FBMA 5JOXA 1SACA 3MIBA 4LO7A 1PNGA 1XSRA 3SQOA 1G6NA 1YC61 1KRIA 1RTVA 3IWZA 5LA9A 1K45A 1JOPA 1K5JA 2YXSA 5AC93 1ULGA 4E27A 3LFMA 1XE7A 4ONUA 1R092 4O9GA 5A33B 1DQ1A 5L7OB 1H2LA 3CZUA 4D8MA 2J1AA 2HWF1 2V4AA 3GALA 1BK1A 1ZZ9A 2RS13 3RNSA 5FXWA 1OHFA 3KT1A 5JXIA 2JDHA 1ND3C 1OSGA 3O1SA 4L97A 4Q4W3 3CMGA 4LO4B 4XJ8A 3ZXDA 2FCUA 4BJ0A 4BZ4A 3DPRC 1POV1 2HLEA 1RUI3 3EJKA 3RJRA 1CJDA 5CKQA 5A6YA 5FYMA 4Y20A 2E51A 1OFSA 2QQUA 5GLVA 1W6MB 3F2ZA 5BNOC 2ZHNA 1ND2C 1BCXA 4E2QA 3OTFA 4U2AA 4IEZA 3FE5A 1IG0A 4C90A 3IAPA 1YQ8A 2JDKA 3BU7A 3FHIB 2RS31 3B69A 2XQRA 3E5QA 2WS92 3WNMA 2ZMNA 1L7LA 1J3RA 2A6WA 3BODA 4QX7A 4A3ZA 4AFDA 4B8EA 2VJXA 2HWB1 4CU9A 1W8OA 4Q0SA 2XJUA 3VBRB 1LTEA 1O3SA 3IN9A 1POQA 4PT6A 3MIGA 1TNRA 4GWIA 1XJAA 3CL1A 3S6PA 1VMFA 2C9AA 4CDQC 3MIFA 5FR3A 3H3LA 3NL1A 3PVBB 4BQWA 3U1XA 2A71A 1WGPA 4F8AA 2OS2A 3WCRA 1UY2A 5JZGA 5FXXA 4UFKA 3E6CC 1CAXA 1W0NA 2ZGUA 2GMMA 2XL9A 3QD6A 2VCBA 3I3BA 1VLNA 4N43C 4TWTA 3WDVA 4RHV1 2WFF2 3KV6A 3WNPA 1IS4A 4NN0A 3W21A 3MIEA 5JMOA 2DU1A 1KFUL 1GU3A 3OGVA 1B35A 1ZZBA 4AF9A 2MEV2 2Z4FA 5E8AA 4JRLA 5T5JA 5LBCA 3GZUC 5BNQA 3WVJA 3BTYA 5GZCA 1Z78A 4Z82A 3DUIA 3R0RA 4XDQA 4Y5SA 4Q4X3 5F5QA 1W2UA 3ZFGC 3C7OA 4ARXA 2GAUA 2XJRA 5FY7A 1W2NA 1TZOA 2AR6A 4JCKA 3KB5A 1G9DA 5F3EA 2ARCA 5C8CB 2BW8A 1JBCA 5ACA1 1LEDA 1XYNA 3PJYA 1R082 4IGQA 3W9AA 5K0UB 1I1EA 5A6QA 4NWWA 3H9AA 4NJ4A 2WBKA 2DV9A 2DDUA 5JCTA 1ZZCA 5JXHA 1UZ0A 2H0BA 2UY8A 2W94A 5K0UA 2CGNA 4NO4A 4K1YA 5LEJA 4XABA 1LESA 4AQ6A 5CYYA 3HQXA 4XPVA 1EUTA 1UYXA 4KH9A 4RN5A 4DEVA 3VB9A 4JHZA 3RMYA 3ZXFA 5LRRA 5M0TA 1UU5A 3VBUB 4ZHNA 5FYTA 2IVJA 4AI0A 4BLIA 4Q0VA 2VAUA 4E9KA 5BXXA 1A8MA 1U5ZA 5DUVA 1K12A 2LALA 5I93A 1HV0A 3MLKA 2UYAA 2VOVA 2V5YA 2OPWA 4CTEA 1W8ZA 2VMGA 5FZ7A 1QU0A 4RYDA 2ZGSA 4WVWA 3UKVA 1TE1B 3A0KA 4HL0A 3ZMOA 1V6IA 1W28A 3I4IA 1HN1A 5ANQA 4NIDA 1GWMA 2E7AA 3ZKUA 4KBZA 3R05A 1UIJA 1Y9GA 1H2KA 3JBG2 1I3HA 4I2OA 1OUXA 5FTTC 3GF6A 1N1TA 3LIGA 4YG0A 2JE8A 5F8PA 1OLMA 2QVSB 2R042 2ZX3A 5FZ4A 5JIUA 2PLV3 3HQRA 2YC2A 2YBKA 5FUIA 3POIA 2VZ3A 3N7MA 1WCQA 2BVVA 3G7DA 5DAQA 4ES9A 5LK5A 1L7QA 2D6PA 1SFYA 1WA6X 1QIQA 1F5JA 1QNYA 1OURA 4Q4X2 3IMMA 4H55A 4OHZA 5CFDA 1P8JA 4K20A 4B1MA 5A3UA 5L19A 4HKWA 5BNOB 5F1RA 4Y20B 1C1LA 3H7JA 2ILMA 2GU9A 5LEKA 1UZWA 1YFWA 3URFA 3HR9A 3VBFA 3ZXKA 4EWDA 4W6XA 3N36A 4V2VA 3R6SA 2CGPA 2GC1A 4Q0QA 2CYFA 1KFXL 2YBPA 4FOVA 2VGDA 3NNFA 4XFBA 1OH4A 3NNMA 3VDDA 1HLCA 2XJVA 4EQVA 1ULEA 2I74A 1QQP2 2EIDA 3DXUA 4R9CA 5SV8A 5J48A 3IIIA 2FCVA 5IVFA 3O1OA 1J83A 3PVNA 1D4M2 3H3UA 5HBAA 4DRVA 4A6SA 4FI9A 2QCSB 4FPEA 5J09A 5CFCC 1CJPA 2QJVA 3WW2A 1W6QA 5IFTA 4MGQA 3H8XA 3SXWA 4XUPA 2D40A 2ZACA 4YLZA 3TRSB 3WOGA 3IZOA 1W8TA 2TUNA 5I0SA 1MQTB 1VBE1 1BJQA 1COV1 5A32A 4CUGA 4EV0A 2BFUL 1JTZX 2PYTA 5EYYA 2GNDA 2CWMA 2GN7A 4UW4A 5D1IA 4QPGC 4GAZA 3DECA 2VQ0A 1V6NA 3BOWA 4QPIB 3J8F3 2GMEA 1BQPA 1S0BA 1RUD3 4Y4YA 4LT5A 1F31A 4LBQD 5C8CC 3FL7A 1GICA 4GKYA 2BFUS 4PIZA 3O1TA 5IAVA 2QQVA 3M4FA 3V64A 1QJX3 1XNBA 4HK9A 4KNCA 2ZZQA 5T55A 2RM22 4H7MA 3WCSA 2DURA 3E6BA 1W6NA 3DF0A 4RGAA 1FPN3 2VNVA 2YUEA 4QKBA 3USUB 5KXEA 3CJXA 2ZGLA 3ACIA 3IBMA 2NPIA 1JI6A 1VAVA 2R7EB 2RR11 3B3QE 5AFEA 5CA6A 1RUD1 1T6BX 3LPGA 3KD4A 4AQ2A 2YPJA 3OD0A 1CVNA 3I2DA 5IK8A 3M3QA 4AW7A 2OUHA 3S0MA 2HWF3 4XHXA 1PO23 1PGL1 5H9SA 3POJA 2C4XA 3VBOA 4DZGA 4QU1A 4W6WA 3VBOC 4H14A 1LB2A 4INDA 2K46A 5IYYA 3FFZA 4RS5C 3L9JT 4Q0UA 3M3EA 4IW3A 4A42A 1BZWA 3KSCA 3RQ0A 3SHRA 1J1TA 2VE1A 2WDBA 4Y1XA 5L9BA 1NUKA 4COUA 4FPCA 3UV9A 5E89A 2IXLA 3U0ZA 1HRI2 1CGPA 3PU8A 4IV1C 4Y1YA 5LASA 3PJQA 1JODA 1IHMA 4PI0A 1ASJ1 4QWNA 1XYPA 1NT0A 4IERA 4XFAA 2ARAA 3VDDC 4AXOA 5HCHA 4AEDC 4XE9A 1ZYBA 1VB2A 3RI9A 5A3LA 4S2FA 4MGKE 3PUHA 2G9GA 5IVVA 2BNNA 4QDSA 2W1WA 4MH0E 4P02B 1XNDA 5FP3A 4RR3B 5FY8A 4OI0A 1PNFA 3NAPB 1N3PA 1SLBA 5F6LB 3IT8A 4BK5A 4EN7B 2V5DA 2W39A 3FWEA 3A22A 4NHMA 1JYWA 1WA4A 2O8OA 1HRV2 3OYWA 4EJRA 1Q56A 3K3NA 4HK8A 2CU5A 5AVPA 2B8MA 3DEMA 4BU2A 3ACLA 3T4HB 5DUXA 5DUUA 5C3QA 3PUSA 4R9DA 4L92A 2XHKA 5DAVA 3KMHA 5FYSA 3DKQA 4NPLA 3A23A 5F5IA 5BY5A 1FNYA 1PIV3 1YNAA 1AR72 3C7FA 5FZIA 3MIDA 1Q3EA 3POYA 1UIKA 5J1XA 4P5YA 3QLQA 2O0OA 1OLME 2JIGA 2Q8OA 3HIFA 1DQ6A 2VTXJ 1DIWA 1OKOA 2HEVF 2YMZA 1UPIA 1LHOA 2DU0A 3JUUA 2D5HA 2J7MA 4RL7A 4XJZA 5EYXA 1QJY2 3WQ7A 3OUHA 1ZBA2 3KF3A 1AR92 1YHFA 1S4CA 2RDRA 2VL4A 4IE0A 4RHV3 1NCQC 2WYSA 4L8QA 1PK6C 4M0HA 1X36A 2JJ6A 1LNSA 4P08A 5DABA 3JXSA 2WFPA 2CL2A 4OFGA 3ELNA 4GJYA 5CFDB 1KEXA 3C7EA 3WP4A 4YW6A 1EAH3 2BQPA 4OI4A 1REFA 4CP9B 4I3PA 2VVDA 3WDTA 3F95A 2GH2A 3UGHA 4JV4A 1ZM1A 2JIJA 5EJZB 1LOCA 2XVKA 2P3YA 4XBNA 3AP9A 2J1UA 1CAVA 4FSJA 5JAXA 4LBJA 2PHWA 5JI9A 3KM5A 5FP4A 4L99A 1LODA 1V0AA 1RUJ2 4XQ4A 2BDRA 5FXVA 4KG8A 5CFDC 2P3KA 2BBAA 1FOD3 3M3CA 3CNAA 1KD7A 4WZCA 5FQ0B 1G9CA 3VBSC 4GWMA 1RUD2 2BTVC 2ZX1A 1DZQA 4XFHA 1WBFA 4Z2AA 5A1AA 3W20A 4MGYE 3EYPA 1IQDC 4P14A 2XQXA 5FO8B 4CRQA 1WBLA 4XQWA 4LE4A 2NYYA 3KLSA 2HWE3 1O4ZA 4XJAA 2EXJA 4K21A 2VNGA 3RSJA 3MFAA 3PDQA 4R4XA 5ERLA 1XYOA 3ZSKA 1LOGA 1N1YA 2PAEA 1QJFA 1TME3 2YROA 2YU2A 3K75B 3MLJA 3OB8A 4GZ9A 4DXRA 1KS5A 5HV4A 1JZ2A 2J42A 3DYPA 1PO12 4IL7A 4SBVA 5FCCA 4QXBA 1IZ3A 1B09A 4GD4A 5T5LA 3WF1A 4DY5A 5LA1A 1HXS3 1O4YA 2FCTA 3AFKA 3VKMA 2VMEA 1PZ7A 1WZXA 1GQPA 5EPAA 1NCQB 2RDNA 4N9HA 1FNZA 4LLFA 5ABJA 1UZVA 4J1XA 4E4ZA 1CONA 4ZPIA 3K4AA 4RQPB 1OQEA 1EP0A 3GYDA 3MDPA 1OPOA 4JQRA 4CCJA 1C8NA 3WG3A 1AR93 4Q0PA 3D6EA 4CPBA 4W65A 2PHFA 2XWJB 4M3CE 3SKJE 3CU7A 3NNLA 1SCRA 2MEV1 3AFGA 2FDKA 5LA0A 1NLSA 1F4AA 4AI3A 4QDQA 3ES4A 2W95A 4XHBA 1JYIA 4JGYC 1VBC1 5FPXA 4R4ZA 4P9GA 4EN9B 1WW7A 4KQ7A 4N7IA 4UFMA 5CG9A 2TNFA 3BUCA 4W50A 4BIFA 4EE2A 1AR62 3RMXA 1X8MA 5IW0A 1PMJX 1UMIA 4WVZA 3AMPA 3RWNA 3EO6A 2XBO3 5A3NA 2ZGMA 2DVBA 3BTXA 3P3PA 1JU4A 4DXZA 2VUDA 1Q8VA 4KL1A 2PELA 4Z07A 3ZLIA 2VH9A 4LK6A 4AVTA 2FZ2A 5DAXA 1HB1A 5A3TA 2VUCA 1ULDA 3OPTA 2F4PA 4W6YA 2R16A 2VMCA 3TEZA 5IK5A 4CDXB 1HRV1 3IDBB 1QDCA 1C5IA 2B9UA 1I5PA 1QJU1 1YJLA 2WABA 1EPWA 2W08A 3DV8A 4CA9A 4GB32 3JZVA 4UYBA 2V73A 2L9LA 3N9LA 2GDFA 5DUWA 1BMV1 1PGW2 2NMOA 3PTRB 4WVMA 4I3GA 1CAWB 3HMYA 5LK7B 3JBG1 5ACA3 3KV9A 4YM0A 5B2GB 1XOYA 3J7LA 2D6KA 5F2WA 2QQPA 3RZGA 1SEFA 2R30A 1FV2A 1DZRA 3WP5A 3O7OA 3K48A 1M4WA 4EYUA 4D94A 1VJ2A 5CAZA 1OVPA 1R1ZA 1QEXA 3CJIA 3WW3A 1H9PA 4JX0A 4CDQB 5JMCA 5JXGA 4YSFA 4TTGA 2VW1A 3VZOA 2JENA 3JD72 4QPIC 2F4LA 2WRAA 3NNJA 3KF5A 5LB6A 4JGYA 4LKSA 2VVFA 4X6QB 3M3OA 1GSLA 4HPKB 5HPOA 3RG0A 3WHTA 1TMF1 1UY3A 3KVAA 4M4PA 4CCLA 2C24A 3FC0A 1LRHA 3VBFB 1FMD3 1GV9A 1OF3A 4LR4A 4AI2A 3J7HA 3L2HA 2I07B 4Y5Z0 4QQ2A 4ISQA 4ARYA 1AUYA 1Q8PA 1X33A 5AFBA 1XC6A 1LU2A 2MNGA 3BI3A 2QDRA 1R081 2R6QA 4A41A 1BVP1 3PL0A 4HT1T 3ASIA 2JD4A 2FHRA 4KWJA 1RITA 1I9RA 2XB6C 5FQ0A 4OI1A 1J3PA 4ASMB 2MEV3 1UO9A 2ZX0A 1QJX2 3LAGA 5CVRA 5IWFA 4CCOA 1GUIA 2WAOA 3ZO0B 3EB7A 3VBHB 5J37A 1GZTA 4S2GA 3BYWA 1ND3B 1MZ6A 3LF7A 2P37A 1XPWA 2VW0A 1C57A 1LU1A 1F2NA 2H6BA 1LECA 2BWAA 2YGMA 1RMU1 4MXVA 5GALA 1HXS1 3HBKA 5FOBB 3LDKA 3R4DB 5HCFA 5FLHA 5L73A 1IKPA 1ULFA 1WD4A 4BQ4A 1GMMA 2XJSA 3AL6A 3LPFA 3PUIA 4BLJA 2W1UA 3OPZA 4QGMA 3WF3A 3M2MA 4E4SA 5A3PA 1GKBA 3AYCA 3GCWA 4LK7A 3RZLA 4XW3A 1YI9A 2HKXA 1FMD2 4GH4C 3SH5A 5A7PA 4CXYA 4AFBA 2ENRA 2W92A
chains in the Genus database with same CATH topology
5I0UA 2EVXA 1KJLA 3J9SA 2BGCA 2VNOA 3MPBA 2GMPA 4KGGA 4OHXA 4Y26A 3RYPA 3UK9A 1NA1C 4A7KA 1QMJA 3H7YA 4LE3A 5KHHA 3VHNA 3ZXGA 1ZREA 3AX4A 4WM7C 1G9BA 3CEWA 1WLDA 3AZWA 1HDKA 1HW5A 5GM0A 1FXZA 2PHTA 4GWNA 3TWIA 1C4RA 3AMNA 3JD73 2X53S 4FXGB 4L11A 1IGOA 4PLOA 4J1WA 4QGNA 4FCAA 4AQSA 2O1QA 3W58A 2AGSA 1OA3A 5HCAA 3K51A 1CESA 1ZBE1 1WMEA 3WP3A 4G9SB 2K0GA 1NOVA 2XWBB 4FP2A 3IMNA 3OBRA 3TNPB 2EIGA 1WW5A 2DVAA 3N3HA 2JECA 5I0RA 2O8QA 1CD3G 4XXPA 4CDXA 3WNXA 4Y1VA 1DFQA 3NKTA 1PO11 4PDWC 1BXHA 2VOXA 2XBO2 3CLPA 1RVF3 2C0ZA 2D3RA 3WD5A 2CTVA 4UXAA 2Q1ZB 3WLUA 1AR63 1AYN1 2BNMA 3RRDA 4YZ5A 4WBBA 2EXKA 3VGIA 1H0BA 4QQLA 4Z8BA 1HQLA 3BALA 3GHMA 4LO5B 1W0PA 4DNYA 2SBAA 1FATA 4Q27A 3ZSLA 4GIQA 3WG4A 3ZYPA 4Q8KA 3RS6A 3A0NA 2VVEA 4CDWC 2Z42A 1V6OA 2EAKA 4LA2A 3PMSA 4LA3A 4H7LA 4RSUA 3VZKA 4QD2A 2CGOA 4UBHA 4XTMA 1NYWA 1VB4A 2NLRA 4I0WB 5D8AB 5ACA2 1COV2 1PVC3 2JXAA 2BUKA 2VUAA 4H3WA 1D4VB 5FBZA 4DRRA 1DGRA 5H9RA 1ZX5A 2IXIA 4HBNA 5GKAC 3VUOA 1BMV2 3A4UA 3I7DA 4YZ2A 1LENA 3TAYA 5GZDA 1QJU3 4CP0A 1RIRA 4YVSA 1D4M1 5KWRA 1ENSA 4R52A 5CIRA 5DDJ1 5CU1A 1QJZA 3L2YA 5FMOL 3B9CA 2ZKLA 4HVRA 3ST7A 1RUC1 1X7NA 3ZFFA 4NVPA 3X29B 1RUJ3 3DPRA 1QOSA 2CNAA 1NA1B 3WY6A 3P3NA 4YRDA 3DPRB 4CYDA 3B93A 3VBRC 4F7ZA 3ZXEA 1W6PA 3D0SA 2DFBA 2P34A 2VY0A 2X8KA 2JKBA 3IPVB 4Q4X1 1DYKA 1K5MB 4K8FA 4FT8A 2G9FA 2HWD2 3S7IA 1QH6A 4GH4A 4XIKA 3SLIA 3UKNA 5KXDA 1ENQA 1S0DA 4AI1A 4RQPA 4A7ZA 3OY8A 3VZNA 2HWC3 4P9LA 3VBSA 3LWCA 1VRH3 1ZZ6A 4JTOA 4LUMA 1O3QA 1RUNA 3MEPA 3VBHC 1QJY3 4IV3A 2ZGNA 1UU4A 3B9IA 1MEC3 4ZXKA 4BPZA 4EN0A 1Q5OA 1MACA 4OUMA 4AVAA 3O12A 1XNKA 3JU9A 4FOWA 4XMIA 1AL22 1H4HA 5T54A 1VBA3 5AC91 1B35C 4JGZB 4N53A 1PIV2 4BIOA 3QACA 2PFWA 4WM7A 3S30A 4HSJA 4M3CF 2PTMA 2ZMLA 1Y7BA 4HFSA 2RMU1 2WJSA 2RR12 2HEWF 2OW4A 5BNNA 2ZCWA 3OYWB 1OQ1A 3H1MA 4FPOB 2WNUC 1KS4A 3LA7A 4X8PA 4BM8A 3KZ4C 1PVXA 1G8WA 2WZPP 4Q4Y1 5TSWA 2MPFA 3MW3A 1JW6A 1VBA2 4XTPA 1POV3 1QGLA 2G4IA 2PA7A 1ZZ7A 1YO8A 1Z7S1 3RYRA 1MVQA 1YUDA 4Q4V3 1HRI3 5DXDA 2E7TA 3ENRA 1RUE3 2GH8A 1PO22 4B4RA 1C28A 1Y9QA 1LOEA 1S0FA 2WZR1 3UL2A 4QT6A 3UKTA 3WUCA 3R4SA 3ZXAC 3VN4A 4C0BA 2LUWA 4QPGB 5JOYA 2DCKA 2VNRA 5FO7B 1KITA 4EN8B 1RB8G 3HN1A 2RS52 2CAVA 1XU1A 3RYKA 2K9ZA 4FPKA 5BNPA 2DVDA 1IKQA 1WCKA 1CPNA 4CDUA 4Z1VA 2Y0OA 1W6PB 3ES1A 3THTA 1Z7S2 2EXHA 2RM23 3ZXJA 1AJKA 4BE3A 1UD1A 1I5ZA 1LOAA 1S2KA 1C3HA 5EJ3A 2X29A 4FPFA 1QHDA 2HWC1 5A3MA 3VV1A 1LGCA 3MI8A 1QOOA 3AP6A 3ZSEA 4OVEA 3SNMA 1ULCA 4CEYA 2A3WA 4YG6A 3WDWA 1J3QA 3Q9OA 2YGLA 3EHKA 2P3IA 4ATEA 3E6DA 1MS0A 2GN3A 2VULA 4PDWA 2ZKNA 1G7YA 1RUG3 5H9PA 1LHUA 1DGWX 1DGRN 4Y1ZA 2ZX4A 2WNUB 1S0CA 1LHNA 4FOQA 3VBSB 4LBLA 1ENRA 2ATFA 1PVC2 1PIV1 2WZR3 1RJ8A 4WM8C 2ZOEB 1G9FA 2GC0A 4MYEA 1EV11 1MS4A 3PLQA 1AX0A 4LHNA 3FZ3A 1ONAA 4YZ3A 1H2NA 4ZU5A 4N53B 2Z69A 2PLV2 1RUC3 5K8SA 1F5FA 4YZ1A 5C6CA 1RHI3 1FAYA 1U5XA 2Z79A 5T50A 4BMBA 5JWPA 1VALA 4IEPA 3U11A 1NQDA 4IXLA 2D6LX 2QUOA 1PZ9A 4QU2A 1OFNA 4BQ1A 5CADA 1RVF2 4PLNA 1ASJ3 1RHI2 3SH3A 2JEMA 2R062 1JXNA 2H6CA 5BNPC 1MS5A 2A3XA 3E5UA 3JBG3 3MYXA 3OD4A 5CBLA 1WMFA 2KM2A 2ZABA 3TB0A 2BEOA 3SMHA 3ZSMA 4I02A 1BEV3 5FLJA 1CQ9A 2D6NA 2XLGA 3J26N 2ZBJA 4CDUC 5BYNA 2NN8A 3AP7A 2ZGPA 5JVVA 2WFF1 4U36A 3T1LA 1RGSA 5K0UC 1AZDA 4FAHA 1UZYA 1LEMA 1J1LA 4RA0A 1AR61 4NOTA 1RUC2 5EXOA 2VPVA 3IM0A 4AEKA 4RR3C 2WZR2 1SQ4A 4XJ9A 2AZ5A 4AGVA 4TZDA 1S0GA 3C2UA 2D6OX 2WIIB 4ASLA 4MUVA 4Q1RA 5LRSA 1ZBE3 4N7UA 2WNVC 4M01A 4HVOA 2FMDA 1W6OA 5T5PA 2RE9A 3MZHA 3WINE 4PJYA 3VDDB 2Y0IA 4XF9A 5FLIA 4ZU7A 1HXS2 2CV6A 3BB6A 5JZGC 1RJ7A 1LOFC 2WNEA 3ILNA 2EAAA 1UMZA 3SCHA 4UW5A 3SH4A 2X5IA 4R9AA 4P5HA 4YGBA 2PHLA 1WCSA 4GKXA 4EROA 3FLTA 2JG9C 1WUVA 3NO8A 1WW6A 1UCXA 1SLAA 5KC5A 3VL8A 1FOD1 1NXMA 3INAA 2ERFA 4F3JA 1DDLA 3B94A 5SV5A 3E5XA 3ZFGA 2BWCA 3O0VA 4AHZA 2IXJA 3VHPA 3VZJA 1QKQA 5HXVA 3FUOA 3T1MA 5BNNC 4YM1A 2JDZA 1YXWA 1TMF2 4ISRA 2R49A 3LOBA 3KCXA 2QZ2A 1GQHA 2E63A 2WNUA 1W6NB 4IEWA 1UL9A 1SBFA 3AZZA 3MLLA 3ZN6A 1UPSA 1YFYA 5IK4A 1FX5A 4PDWB 2WS93 2XG3A 4DS0A 1H8VA 1NE6A 2EXIA 1OI6A 3PNAA 5K7PA 3RDIA 1SLTA 3DN7A 5E1RA 5FFOC 1H8TA 1VBE2 3ZSJA 3C3VA 4XFFA 5CFCB 2DCJA 1ZRDA 4RHV2 1MS8A 1EYBA 2ZAAA 1ZRFA 1VBD3 2D3PA 5H9QA 4LBQA 1H4GA 4B29A 2A3YA 4R8HA 1PGSA 1OOPC 1LHWA 3JQXA 4WM7B 5HCBA 1YFUA 2P17A 1GQGA 1BVVA 2H0VA 1NY71 1VR3A 3V56A 3TBDA 1UKGA 2IXKA 3VKNA 2R073 2WNVA 3DKWA 2RS12 3AK0A 3D4KA 3LSDA 5KXBA 2YY1A 4DINB 4SLIA 3VZMA 3ZXLA 4AI8A 4XF3A 1TME1 5FPZA 3RI8A 3WUDA 2WKKA 4NPRA 1WLCA 4IEVA 5FREA 2D97A 2WS91 1AL23 2VW2A 3AMHA 2RS32 1OD5A 5CNAA 5KXCA 1UKRA 4FBFA 1VBB3 3RZZA 1O5UA 4IV1A 3SCFA 4AVSA 1S55A 4CZSA 1VBE3 4AFCA 2VXRA 1O3RA 1ENXA 1GNHA 2R061 1CR7A 5BNOA 5DG1A 2ZJCA 3AM2A 2KA3A 1RVF1 1YFXA 1CX4A 1QXJA 2W52A 2WLQA 3EQEA 4HMZA 1D0HA 4YM3A 4HETA 3ZN5A 2WQZC 1WLWA 1OPMA 2HWD3 1XNCA 2QKDA 3NV4A 4LO6B 3T2TA 1N1SA 4A7YA 3WP6A 3M8LA 1PZ8A 4GMP3 5L7OC 1A8DA 2F6BA 5L36A 4Z92B 1W6MA 5KHIA 1O5LA 1NLRA 1VRH1 1AL0G 2XJTA 4AHXA 1ND2A 1QOTA 1EV12 4QPGA 5EFUA 3IDCB 3I59B 1WLTA 3ME2A 5GLTA 1PMIA 1E57A 2IXCA 3FBYA 2HWE2 3ZVXA 3JD71 1KJRA 4OZXA 4E2SA 1RL3A 1V6JA 4N43A 4L9BA 3QCWA 4QPIA 3ZFGB 2JG9A 2ZX2A 4K3UA 4NWVA 1BBT2 5A32B 1HQNA 1OLQA 1CAUB 3J8F2 5CB7A 5FOJB 4F83A 1YIFA 1SCSA 4KU8A 1V6KA 2R071 1PGW1 1SLCA 5JZGB 2ZHLA 4I01A 1OOPB 2E7QA 4FSJA 2XVGA 3R4UA 5IK7A 2A6ZA 2CY6A 1PHMA 1ZBE2 2DUPA 1AR83 1GR3A 2GZWA 3MGUA 2R32A 1VP6A 3GZTB 3VLBB 1V6LA 4COWA 4COZA 2GNTA 3RJ2X 3WQ0A 1QJY1 2WT0A 2VOKA 4Y1UA 4Q2FA 4YYOA 4E2GA 1QQP3 4PCRA 1PK6A 4D3WA 2A5ZA 3OY8B 3ZDSA 3WG1A 1RUF2 3AZXA 1ZBA3 1W39A 2Q1MA 4E4DX 4XILA 4EWAA 3O14A 1QF3A 1AX1A 2NZ9A 4ORFA 3B02A 4YZ4A 4KU7A 5FO9B 3OBTA 4RS5A 3V0BB 5I8SA 1QWRA 5T5OA 1GFF2 2R041 3SCGA 5CFCA 4N9IA 4GMP1 1AX2A 3B5LB 4FPHA 4FP3A 1OQDA 2BNOA 1BEV1 4A3XA 3E97A 3ILRA 2GC2A 4X6RB 1VBB2 4HVQA 3U10A 5BUVA 2R072 2OYZA 4DQAA 2DTWA 2VMIA 2WC2A 3TN91 4HN0A 4DPNA 1FI2A 5DZGA 1AYM1 1UU6A 1Q8SA 2W68A 5E88A 2VG9A 4XJWA 3DL3A 3AMQA 1RMU2 1LOFA 1OA4A 2UU8A 1BKZA 1SDWA 1V00A 1DHKB 3AB0A 5C33A 3GHNA 1FT9A 1HRI1 1TNFA 3HT2A 2DFCA 2FBEA 3KQRA 3MFCA 2X5IC 4HZFA 1FYUA 1HV1A 1SFNA 1DGWA 1N3OA 3GNEA 5KC6A 1A6CA 1NCRA 2D43A 2XJPA 1S0JA 5C8WA 1CAWA 1H1AA 4PIYA 2HWF2 1TEIA 3EXUA 1VBD2 1LGBA 3IIAA 4FQ4A 5AFEA 2ARXA 3AYEA 3TNQA 1AYN2 4HPKA 5J7MA 4NHKA 5C9AB 1DU3D 2ZGOA 4QX5A 2HWB3 2OIIA 3HD8B 4BA6A 4R9BA 2XBO1 1XRUA 4WM8B 3LOIA 5EZWA 1X8EA 4MVTA 1RUG2 1V9U1 4XYXA 3NJZA 1SLLA 1L3JA 5D8AA 5I8TA 4LNVA 4OI2A 3N7LA 4GMP0 5DZEA 4YW4A 3O0XA 4Q4V1 1H2MA 1V6MA 4QGLA 2R0FA 4MLOA 2DUOA 2RJKA 1ZBA1 5GJ6A 1CAVB 3ALQA 3ZIWA 2UURA 1S0IA 5GZFA 5BNPB 1AR71 5T52A 1OOPA 1JUIA 3BTAA 2NP0A 3PMEA 2XL7A 3KCYA 2IXHA 1MQTA 1CIWA 2Q4SA 1TQ5A 2DTYA 1R1A1 1S2BA 1YJKA 3ZYIB 5T3NA 5ABJC 3ETQA 1NY72 1WW4A 3IPVA 2A6VA 3U4XA 1PO21 4PBPA 4PF5A 2HWB2 4PBOA 3LA2A 2RMU3 4Q4Y3 2YC0A 3NKGA 5C8CA 4QMAA 1AYN3 4HSLA 3JCIA 4Q29A 1J59A 2XVLA 1APNA 4Q4W2 2QFEA 4YW3A 3N7JA 4OHVA 2OZJA 3AP5A 2JICA 2Q0AA 1UZZA 3MPPG 3VBFC 2Q5TA 2ES3A 4B7KA 1VBA1 1AR81 1OKQA 1WMDA 4FTBA 2UWBA 3WQ1A 3B00A 4DMIA 3SITA 4AVCA 4LBQB 3FJSA 5FRAA 1Q8OA 3ZX7A 1RMU3 4RS5B 4K9SA 1DGLA 2A6XA 3AXDA 3ZYJB 4UBGA 4XFCA 3HWJA 1JN2P 4GB33 1GLHA 1QXPA 4KBBA 4MGIE 3V0BA 2R1BA 2WNVB 2A70A 4IEXA 1YI7A 2WSVA 4MGZE 3ROUA 4OHYA 5AC92 3GBWA 1DQ5A 4LBNA 1FV3A 5I0TA 4ES8A 1H9WA 2VQAA 1UN1A 4YVWB 4AEDA 2R063 3MW2A 3I8TA 3UJOA 3CJIC 3BPZA 4BH9A 3J4UH 5E16A 4D7TA 4DY3A 1LCLA 1RUJ1 4M3CA 4XMAA 3LKJA 1D2SA 1C8M1 1UAIA 2RJLA 1A3KA 4GULA 2C1FA 1NCRC 2WT1A 3AKPA 2JE9A 2ZZJA 1MQTC 4M3CB 2D98A 2D7FA 4LEJA 4AK3A 5J36A 4LBOA 3D0JA 2IFWA 4CDQA 3VKOA 2PHRA 3VHOA 2WA4A 1N3QA 4JGYB 4GB31 2HWC2 4X8NA 1AR82 1J58A 1W0OA 4C0HA 1KXGA 2W0XA 1DF0A 4FPJA 3ZN4A 4IEQA 1W6QB 1O91A 1W6OB 4CEWC 5JSOA 2DF7A 1RUF1 4QM9A 2X5IB 1PO13 5BPXA 1QNWA 3G6JB 4IEYA 1YIPA