1ZA4A

Crystal structure of the thrombospondin-1 n-terminal domain in complex with arixtra
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
SVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRTEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structures of the Thrombospondin-1 N-terminal Domain and its Complex with a Synthetic Pentameric Heparin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Thrombospondin 1
total genus 47
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2005-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1za4A00
2P2KA 1G9AA 1CQ9A 1LOCA 5T5PA 3V0AB 2C9AA 1Q8VA 2VY0A 1CONA 4ITCA 4CZSA 5GZCA 1V6NA 2HYKA 3DGTA 2JD4A 1Q8PA 1MS3A 5GALA 4C1WA 2ZGSA 2VUAA 4LBKA 1GKBA 4YLZA 3WDUA 3WZ1A 5GLZA 1WBLA 2DVFA 3FBYA 4XTPA 1ULFA 1AXZA 4XHBA 5GZDA 3W59A 1G8WA 2SLIA 3H0OA 1W0OA 4M00A 3RMXA 3USUA 1QNWA 1AJOA 1OQ1A 4YGCA 1AF9A 1ULCA 3AYAA 2ZHNA 4XJZA 4YZ4A 2A3XA 5DZEA 3QCWA 1DQ0A 4YW2A 2ZGOA 2PHXA 3RQ0A 3BODA 3FUOA 2ZGUA 5DUVA 4YZ5A 1JHNA 2KM2A 5GLVA 1N3OA 1QMJA 1LU2A 2ZGPA 3BIWE 3O0VA 3VKLA 1KJRA 4K1YA 4RA0A 2ZMKA 1GNZA 1LTEA 2NYYA 3SITA 1SLLA 4FPLA 4YGBA 4P14A 2OUHA 4ASMB 4XOGA 4Q8LA 1IKQA 1LOBA 3AP5A 3N7LA 1FAYA 2AH2A 4R9CA 2DVBA 3VUOA 5T55A 3HMYA 3ASIA 2GN3A 2D44A 5GLTA 3C2UA 4LBQA 2W68A 4YG3A 1AX2A 3GNEA 4ZKTB 2P34A 4FQ4A 4XMIA 3APBA 3VKNA 4MYEA 2LALA 2DV9A 4XBQA 5JOZA 2SBAA 4XJ8A 2WSVA 1D0HA 2VU9A 3M3CA 2JDZA 1JXNA 1UMZA 4DFSA 2D3RA 3OY8B 1RINA 1CPMA 2AR6A 2ZA9A 4Y22B 1S0GA 1OFSA 1FATA 1UZYA 4Y1UA 3AK0A 1LOFC 2V73A 3WV6A 4KBBA 2JE7A 3SH3A 5T5JA 5H9PA 4AVVA 2A71A 4XXPA 3AJYA 1ZA4A 2A6ZA 1VAVA 2D3PA 3MEPA 3HR9A 1LULA 1JOJA 5BYNA 3SLIA 1H9PA 1N47A 4FPCA 4R9DA 1JN2P 1SCRA 3FLRA 5KXBA 3AJZA 1X50A 2E6VA 2ZACA 1BQPA 1O4YA 1FV2A 1QOTA 3AZWA 1JUIA 3PMEA 1LEMA 4YG0A 1SFYA 2E53A 4U36A 2E51A 3AP7A 4HANA 5T54A 3N7MA 4AGVA 2DUPA 1LGCA 3OJBA 3SH4A 1Y7BA 2VW1A 1HQLA 3RMYA 4ATFA 1MS8A 3D4KA 3IMNA 3UL2A 1IKPA 2FMDA 2CWMA 4FPGA 4M3CB 4DS0A 2Q5TA 3POYA 1UX6A 4FP3A 5JLVA 2D7FA 4FPHA 4DRVA 2OVUA 3GALA 2D6KA 5EYXA 1KJLA 1SACA 4FPJA 3WHUA 3D6EA 1S1AA 3ZVXA 2V5YA 2PHWA 1URXA 4YM0A 1XQNA 1APNA 2ZMNA 2ZGQA 3V64A 2ZHLA 3V65A 3O12A 5LK5A 1CESA 2CWSA 2FHRA 2ZGMA 2TEPA 2VH9A 1SLAA 1MS5A 4YG6A 5GZFA 2Z42A 2W52A 5GLUA 3LSDA 2EALA 1FNYA 1W0PA 1MVEA 2GMPA 4LBMA 3WG2A 4OZXA 1W6OA 2R1BA 2WLQA 2W39A 3D5OA 3JU9A 4BPZA 1MACA 4PCRA 4UW3A 1QOOA 3NV3A 4YW4A 4DPNA 2NN8A 2DUQA 3WOGA 4ISRA 5DUUA 2JECA 3CNAA 1UPSA 3WG3A 4YM1A 2JE9A 2A5ZA 4Y24A 4Y26A 2DWRA 4P9YA 4XDQA 3ZPYA 5DG2A 2JKBA 2GDFA 3DUIA 5JOXA 4BM8A 1DBNA 2DTYA 1W6QA 2D6PA 2XB6C 3ZXLA 3PJQA 4UW6A 1FNZA 4NO4A 5E8AA 1HDKA 1G9CA 3M3QA 4TZDA 4XBNA 1ULDA 4Q26A 4GALA 3V0BA 3IKWA 2A3WA 2CL2A 2DVAA 2DTWA 2GNBA 4DQAA 1LOFA 4ISQA 1MZ5A 3WCSA 1LECA 3ZSLA 3AZVA 2ZHMA 4AWDA 3WNXA 3TB0A 1AZDA 3FUQA 1H30A 1B09A 4XJWA 3WDYA 1UZZA 2PHRA 5CAZA 3A0NA 1W6NA 3ZXEA 5DUXA 5JMCA 2GNDA 3VKMA 2E7TA 2WQZC 3KM5A 5JVVA 4UW4A 4XMAA 3WVJA 1SBDA 1LCLA 1GSLA 1CVNA 3ENRA 1OKQA 1WW4A 5GZEA 1GNHA 1N1SA 3ZSKA 1FX5A 1W6MB 1WW5A 3AXEA 3OGGA 4FOYA 2UWAA 2NMOA 5DZGA 5IK5A 1DQ1A 1V6JA 1CN1A 1N1YA 1QDOA 4Q2FA 5EWSA 4YW5A 3V0AA 2EIGA 1LOGA 1KRIA 3N36A 1GZWA 1I3HA 2ZHKA 3WUCA 2NP0A 5JOWA 2ZGTA 4BOWA 2H0BA 3ZXFA 1ULGA 1DZQA 1CIWA 3I8TA 4R9AA 2YXSA 1JYCA 3PVEA 1DLLA 3N3HA 3FLTA 2A6YA 3AP6A 1V6MA 4LBQB 1V6IA 4XHXA 5CB7A 1DQ6A 5H9QA 3ILRA 2P3IA 2WT0A 2VXRA 3JUUA 1GV9A 3NV4A 1IS5A 1ENQA 2A6XA 1GYKA 2WT2A 2R0HA 4R9BA 1JYIA 3QLQA 1I1EA 3AXDA 1DGLA 1Q8SA 1W6OB 1N1VA 1FYUA 1KDMA 1SCSA 5DZFA 1LU1A 2OW4A 1G9FA 3ZYRA 1QOSA 2ARXA 2D3SA 2DVGA 2ERFA 2GNMA 2I2SA 2ZAAA 3NV1A 4FPEA 1MR5A 1W6NB 2UWCA 1AX1A 3SISA 3AYDA 1AX0A 3VKOA 1YYNA 1BYHA 3O0WA 4JCKA 4K1ZA 1ENSA 5FREA 3ZXJA 3ZYPA 5F5QA 1YIFA 4LBLA 4Z8BA 5DUWA 2GALA 5KXCA 4U2AA 5T5OA 1CR7A 3MPPG 2WNEA 1W6MA 4XTMA 1LESA 1MS9A 3M3EA 3O0XA 2AUYA 1PZ7A 2D43A 4GKYA 4K20A 4SLIA 1GZ9A 4ATEA 3ATGA 1R1ZA 1SLTA 3R4UA 5EXOA 4YZ3A 2GMEA 2P3JA 2PHFA 4I30A 3KQRA 5T5LA 4PF5A 5AVAA 3UJQA 2RHPA 5IK8A 4XIOA 1GZCA 1H9WA 3OY8A 4Q8KA 1GANA 4AGRA 1BZWA 2ES3A 1WLDA 1DHKB 4P9XA 1G9DA 1C4RA 4Y1VA 2DUOA 1V6KA 1S0BA 2ARBA 4BQ1A 3MW3A 3WG4A 5CA6A 1Q8OA 1WW7A 4L8QA 4IQPA 2EAKA 2ENRA 2P37A 3R05A 3ZXKA 4GA9A 4F83A 2CY6A 1V6OA 4FOQA 4GWMA 5HCFA 2D6NA 1JBCA 1N3QA 3WLUA 4GKXA 4FPYA 1C1LA 3AYEA 3B9CA 3FLPA 4FVVA 1WD3A 4XILA 5GLWA 5SV8A 1DQ2A 1DIWA 2EF6A 1LHWA 2AREA 1DYPA 2GMMA 2NMNA 3N35A 1AVBA 1LOEA 3AZXA 2A6VA 2DU0A 4FQZA 5FRAA 4XXAA 2GNTA 1JW6A 1SLIA 3U4XA 4K21A 1MS0A 3M1HA 4NOTA 3WHTA 2WT1A 1C57A 2VW0A 1S0FA 1UL9A 3WCRA 1N3PA 1SBEA 1W6PA 4AVSA 2CTVA 1LGNA 2ZZJA 1IS6A 3L2YA 5E89A 3N7JA 4YW1A 4JRAA 3T1MA 3WG1A 2ZBJA 1UN1A 2R16A 1DFQA 4W65A 1KITA 2ZGLA 4Q1RA 4FP2A 4BLIA 2D6OX 1F31A 1J1TA 1S0DA 4AGGA 3RRDA 3WDWA 4YM2A 3OPZA 1ULEA 1HQWA 4Y1XA 5IT6A 4FPKA 3PVOA 3IN9A 5DG1A 1F9KA 1SBFA 3BOPA 4JC1A 3WDTA 3ZSMA 4M3CE 1WLWA 1BXHA 1DQ4A 4YGEA 1YRZA 4WZFA 3INAA 3VV1A 2XG3A 2ZGKA 2YROA 4XBLA 3ILNA 2EXJA 1HLCA 1UKGA 1GZWB 2CNAA 3TAYA 3WDXA 3B69A 2AENA 3N7KA 1GICA 3MW4A 4CTEA 3V0BB 4HL0A 3WDVA 4XJAA 4XIKA 2B7YA 1KQRA 1LHVA 1A8DA 1AJKA 1C1FA 3ZSJA 1PZ9A 3RSJA 3Q9OA 4YM3A 4FOWA 3IM0A 5DXDA 4LBNA 1NLSA 1A78A 1V6LA 1SLBA 1VALA 3IPVB 1Q8QA 4XE9A 3OBTA 1LJ7A 1VLNA 1V00A 5F9TA 1ENRA 1QU0A 2YV8A 1WW6A 1EPWA 2D6MA 4XJ9A 3POSA 2BQPA 2UU8A 2R1DA 3OBRA 3W58A 4YZ1A 1LEDA 1LOAA 1LENA 1TEIA 1GLHA 1RIRA 2A6WA 4Y20A 2YY1A 1DQ5A 1KDKA 1IS3A 4XJUA 5T52A 2DU1A 2NZ9A 3USUB 5T50A 4BLJA 1A3KA 1W6QB 1QGLA 5H9SA 1LGBA 1S0EA 5CBLA 3SNMA 1WBFA 4Q1PA 2E7QA 2LTNA 2YZ4A 3OYWA 2W08A 5E88A 3AZYA 2A7AA 4GWNA 1HKDA 2ZGRA 2GN7A 1DYKA 3AFKA 1CPNA 2R0FA 2ZABA 2ZGNA 5EYYA 1WLCA 3B01A 4FPOB 4GXLA 4RL7A 4WVVA 3VKFC 4D69A 4ZXKA 1BKZA 1LODA 1U0AA 3WUDA 2VW2A 4BMEA 1AXKA 2AYHA 1VIWB 1CJPA 1MS1A 2G4IA 1FV3A 4YGDA 5GJ6A 4AYUA 3NV2A 3AX4A 2PELA 4DRRA 1ONAA 3O5SA 4UW5A 2EXKA 1YXWA 3A4UA 2PHUA 3SH5A 4AVTA 2WJSA 2A3YA 4H55A 1LHOA 1Q56A 4XYXA 3IPVA 5H9RA 1QDCA 1MS4A 1O4ZA 2WKKA 3R4SA 3B00A 4PBOA 5HCBA 2PHTA 3POWA 1AXYA 1D2SA 1IS4A 2CYFA 5JOYA 1YO8A 2DURA 3LCPA 4CRQA 1S0IA 1LHUA 2A70A 1GBGA 3UK9A 1IOAA 2YMZA 1G86A 2C5DA 4YW3A 1S0CA 4Y20B 3M3OA 5HCAA 1Z78A 1MVQA 1N1TA 1QNYA 1WCSA 3MW2A 4PQ9A 4Q27A 4C1XA 2P3KA 4Y1YA 3RS6A 2DYCA 1WUVA 4M3CA 1W6PB 4FOVA 1YI7A 3HN1A 4P9WA 3B3QE 4WVWA 4PBPA 2R49A 3NWKA 3I4IA 2EXIA 3UJOA 1WD4A 1BJQA 2AGSA 1G7YA 1VAMA 3AYCA 4LBOA 3T1LA 3BTAA 3A0KA 4YFZA 4FPFA 1LHNA 1UAIA 2EXHA 4Y1ZA 2ZMLA 5GM0A 2JJ6A 3AZZA 3LSEA 5GZGA 2WSUA 1Z0HA 1NXD1 5IK7A 2OUJA 1G9BA 5IUQA 4Y22A 4BMBA 4M01A 1MZ6A 2DVDA 3ILFA 1PZ8A 2UURA 3PVNA 3AP4A 4XZPA 5L73A 3T2TA 1F5FA 1QF3A 3RG0A 3AP9A 5KXDA 3FFZA 5JDBA 4YFWA 2D6LX 2NM1A 5IK4A 5KXEA 4M3CF 1RITA 2ZKNA 4WV8A 1ZM1A 3OYWB 3M2MA 1S0JA 5CNAA 4TYSA 2A75A 1QKQA 4YZ2A 1SLCA 4LBJA 4LBQD 2UWBA
chains in the Genus database with same CATH superfamily
1UCXA 1G9AA 4XFFA 5ABJC 4AL9A 1W04A 3I3QA 1QY4A 1LKNA 1HRI1 3NVCA 2JDYA 2PA7A 4AFMA 2YGLA 2Y8KA 5C8CA 5KWRA 3QD6A 5FZ6A 2LM3A 5F7UA 1GKBA 3OEAA 4FFHA 4KL1A 4YLZA 1WBLA 3WZ1A 4LIVA 4XPVA 1XNBA 5FOBB 4XHBA 1CJDA 4IV3A 3TNQA 3SKVA 4F7ZA 4YRDA 1HXS2 3USUA 4PIXA 1QNWA 2FCVA 4EN0A 2WA4A 1AJOA 2Q8EA 2CAVA 1XSRA 5K0UA 4MGZE 1AF9A 3T0BA 1ULCA 2HWD1 2WFF1 4P9IA 2XJRA 4XCBA 2ZZQA 2PHXA 3POIA 3NJYA 3OG2A 2Y34A 2WO2A 1W0NA 4TWTA 2HEWF 2Y6KA 2ETEA 4Q4Y1 5BNOC 5GLVA 4LHSA 3O0VA 1R64A 4RA0A 2GAUA 4L11A 3NNMA 1ODMA 4XURA 5AFBA 1LTEA 2OPKA 4OI4A 3WQ1A 3GZUC 4CPBA 2YDEA 5DDJ1 4FPLA 4ASMB 1EAH3 1UNBA 2XKPA 5I0TA 4Q8LA 3AP5A 2XONA 4PLNA 3ZYFA 1D0GA 1WMDA 1Z7S3 1C5HA 2DVBA 2D44A 3O1PA 4QMAA 3MUZ1 4O9GA 2VZPA 3HT1A 1WCKA 2VCAA 2W68A 5A1LA 1PO23 3MLKA 2V09A 4XAEA 4UFIA 3DPRA 3P3NA 5L7OC 1ZVFA 2G9ZA 2VCCA 1PGW1 3KV4A 4L2NA 5A32B 5LZ6A 5JOZA 5KR7A 3X29B 4OI0A 2JDAA 4IE4A 1D0HA 4OUSA 4NPLA 4BZ4A 5C70A 1UMZA 1W05A 4GMP1 2PAMA 3OY8B 3DXUA 5FDBA 3KGLA 1XE8A 1FATA 2WIIB 2F4LA 3VBOA 3EXUA 3K4ZA 4Y1UA 1TQ5A 2VVFA 4HN1A 2V73A 3PHMA 3WV6A 3ACFA 2JE7A 4BE3A 2G19A 5LBEA 2HBTA 2O8OA 4XXPA 3M8LA 1UOJA 2HWE1 4RR3A 5FZ7A 4PJYA 3HR9A 3IT8A 1JOJA 1H9PA 1JN2P 1SCRA 3LE0A 3AKTA 4NRQA 1RUH3 1X50A 3AJZA 2P6CA 2P3YA 2Y38A 2PLV3 4NN0A 2I74A 1BQPA 5J09A 5LRSA 1JUIA 4YVSC 5D21A 5DABA 4OQ8A 3RZJA 1BBT3 2E53A 2QFEA 3P5BA 2E51A 4IEVA 4K6BA 4YVSB 1WMEA 4DEVA 1RUOA 4JKKA 4IEUA 2YC0A 3O7OA 1FOD2 4HXCA 5FMOL 3VD7A 4LT5A 4HANA 3N7MA 4JDOA 3S7IA 4CEYB 2DUPA 3OJBA 3SH4A 3ZPOA 4R52A 1REEA 4KWKA 4E8CA 1HQLA 4RD7A 3ZFGB 4ATFA 3D4KA 5I8TA 2RM22 1IKPA 1S4CA 5LB6A 4BQXA 5FZ0A 3UGFA 4F8AA 2OA2A 2WAOA 4DS0A 3PVBB 3FMGA 4FPHA 1NYWA 4INDA 4WM7A 1VJ2A 1Y3TA 3LPFA 4I09A 3JBG3 4W50A 4LLOA 4QXHA 3I3BA 4FPJA 3D3AA 2PYTA 3WHUA 3S57A 3BIEA 2BBVA 2PHWA 4YM0A 1XQNA 3V64A 2CGOA 4EZHA 2BGPA 5LK5A 4FXGB 2D5FA 2CDPA 1SLAA 5GZFA 2VZRA 1OH3A 5GLUA 1ND2B 1FNYA 4WZCA 2WNUC 3MIEA 5E6HA 4A2UA 3TN93 1RUG2 3S7EA 4CUCA 4LBMA 4M0HA 3CQOA 3IDEA 3GBFA 2W39A 3ZN5A 2RS12 1EV13 2C0ZA 1H8VA 3KV5A 4UFKA 1GP6A 4UW3A 3WW4A 5C3SA 4MGTA 1QOOA 3RZLA 3NV3A 2JDNA 5BXXA 4XF9A 2RJKA 1HXS1 1XNKA 1W99A 1ZZ8A 1XPWA 3WOGA 1AYN3 1UPSA 2YB7A 2YU2A 2BFUS 1GOGA 2A5ZA 2JE9A 2JG9B 3TEWA 2ZTNA 1OURA 5KC6A 5IYYA 5DG2A 3O1VA 4NHLA 4KGGA 5FMOS 4KH9A 3H50A 2EIBA 3JZVA 3PJQA 1FNZA 1ND3A 5CISA 4CUGA 5A3NA 5A3LA 1YQ8A 2ATFA 5C4WB 4WM8A 1W3XA 1NQDA 5JAXA 5FY4A 4GD4A 2CL2A 3LDKA 1Y9MA 1LOFA 5B4NA 4MADA 1PIV2 3ACHA 2YFZA 1AZDA 4DEQA 4UYBA 3LKJA 1H30A 2R32A 1PIV3 2YPDA 2VBPA 1E57A 2XH6A 5DUXA 5JMCA 3HAGA 3IDCB 3NNJA 4LHLA 1GOFA 4XMAA 3LIHA 3WP5A 4N53C 2QE3A 1OA3A 4HMZA 3VBSB 4IE6A 4QAWA 5CYYA 1WW4A 4QXBA 1N1SA 3NQHA 1FX5A 3F95A 1WW5A 4BQ3A 5DAXA 4E9KA 5DZGA 1KXGA 2NMOA 1ZRRA 3H9AA 3WY6A 4URTA 4CP2A 1V6JA 3V0AA 3GHMA 3BKZA 1LOGA 4AQTA 3T0DA 5FBJA 1DG6A 1GZWA 5APAA 1BVVA 5JOWA 2ZGTA 1PGL2 2OQ6A 1DZQA 1CIWA 4R9AA 1GZTA 1RHI2 2R042 4XW3A 1EV12 3N3HA 2K9ZA 2Z79A 4DO0A 4DIQA 4UFHA 3DKQA 2OT7A 3VBOC 3ILRA 4CDQB 1B35C 3JUUA 5F5IA 4BH9A 3K48A 1GV9A 3GBWA 3ACLA 2GP5A 2A6XA 4HLTA 4UBHA 1NCRB 1UMIA 1Q8SA 1RUE3 3MI8A 4I0WB 3WR0A 1EY2A 3H8OA 1UYZA 1KDMA 2ORXA 3JD73 4TXWA 3VN4A 4AOCA 1G9FA 3ZYRA 5FBZA 2ERFA 2ZAAA 3CDZB 4QQ2A 4UFMA 1MR5A 2XLAA 5I8YA 4IV1B 5J36A 4BDVB 3KB5A 3VKOA 5JMOA 3PUHA 4Z82A 2OYZA 4JCKA 4N7IA 4K1ZA 4UFJA 1ENSA 2JENA 4QM9A 5FREA 3ZXJA 1JYWA 5JZGC 1QJU1 2GALA 3VGIA 1CR7A 1NZCA 4AFDA 4JDMA 2VOKA 3RZKA 2FQPA 1LESA 2AUYA 1FOD3 3N9OA 1CZVA 2D97A 4G4FA 4K20A 4ATEA 1JU3A 1NOVA 1OVPA 1R1ZA 1SLTA 2VMGA 5FAXA 2QUOA 4FTEA 2PHFA 2P3JA 3NMBA 4I30A 4Q5OA 2C6SA 4A4AA 3UJQA 4LQRA 5AVAA 4CEWC 1GZCA 3FC0A 3ZMOA 5D8AB 2BWCA 1RUH2 1W2OA 3DPRC 3OY8A 5FUPA 1OOPB 1CX1A 1OMIA 1BZWA 1RUI3 1YQ6A 3BU7A 4Y4YA 5F39A 1AR71 1RUG1 2ZOEB 1UU6A 5FY8A 2CY6A 4FOQA 5HCFA 4ARYA 2JE8A 3AB0A 4L0PA 2WO1A 3AYEA 3B9CA 3J7NA 2IXCA 4A41A 4P9GA 3LEKA 4LA3A 1DIWA 2B39A 4MZUA 5FY7A 4YWAA 4CXYA 5J48A 2RVAA 2D93A 3GZTB 4D0QA 2GC1A 3DYPA 2DU0A 3PDQA 4FQZA 3OGVA 4XXAA 1F5JA 5FY9A 5ABJA 3U4XA 4B29A 1ND2A 3TYJA 2J1UA 5HV0A 4QKDA 2OIIA 2A73B 1C57A 2RS11 3WCRA 1UL9A 3ST7A 4AVSA 1LGNA 2HWC3 3EBRA 5EJ1B 4YW1A 3E6DA 4P02B 1ASJ2 2L9LA 4R4XA 3BU0A 3EYPA 1O8PA 4W65A 3LEIA 5CFCC 5ISLA 2G1MA 5CKQA 5I0SA 2QQKA 4CSWA 2OX0A 1ULPA 2VUDA 4Q4V3 4AHWA 3RRDA 3IBMA 4IEOA 4YM2A 1H4GA 3ZN6B 5JUVA 1V9U1 4Y33A 2XJSA 3E6BA 4E4SA 1A34A 2XVGA 3PVOA 3IN9A 2C4XA 2VD7A 3LAGA 2K46A 3SC7X 4P9LA 1I6XA 4WZFA 3WW2A 5A7WB 1BMV2 4LO7A 3LDRA 1RUF1 1O4TA 1SDDB 2XVKA 3WDXA 4NHXA 3LFIA 4IV1C 3I49A 1AYM2 1Y43B 1AR81 4Z2WA 3N7KA 3BUCA 3MW4A 4J1XA 1ZBA3 5F6LB 3FN9A 1GFF2 1LHVA 2WZEA 1VBE1 1VMFA 4AK3A 1A8DA 1AJKA 1VP6A 2QQUA 1VBB2 2Y6LA 1PZ9A 2WINB 3KV9A 3RSJA 3BTXA 3AKRA 1VR3A 1W8NA 3H1MA 5FZ3A 1A78A 3ON7A 1SLBA 1W9WA 1RHI1 1VALA 2R041 3TNPB 3VBFB 3IPVB 4E4ZA 5IVFA 3T2PA 3KVAA 1V00A 1DF0A 1ENRA 1WA4A 2YV8A 1WW6A 5D1IA 2D6MA 2BQPA 1COV3 3ACGA 3R6SA 2VQAA 3W58A 4JGZB 4LULA 4DXTA 5JSRA 2HH9A 1TEIA 1RIRA 2IXKA 2A6WA 4W4ZA 2YY1A 1KDKA 2C24A 3C7HA 3G7DA 2VZQA 2FDKA 2KR2A 2NZ9A 2UY8A 3USUB 5L9VA 1A3KA 1QGLA 3UV9A 2RS52 1LGBA 1S0EA 5FZOA 4JRLA 3SNMA 1WBFA 4Q1PA 4HPKA 4QWNA 5A70A 2E7QA 4OVEA 3HEIA 4RFRB 5C71A 2VJXA 4CUBA 2XBO1 5E88A 1SFPA 3EO6A 4GWNA 1JZ5A 2ZGRA 4XFIA 2WUHA 2ZEZA 2BV4A 3AFKA 3LIGA 3ZFGC 4RL7A 4D69A 4ZXKA 1BKZA 1LODA 1QJZA 1U0AA 4RS5B 3WUDA 4BMEA 2AYHA 3BTZA 1D4M2 1VIWB 1ZNPA 4N7UA 5GJ6A 3I59A 4AZZA 2WR9A 3N9LA 3NO8A 1PK6B 1XC6A 2P6HA 1RC6A 3WD5A 1BVP1 4BQ2A 4DRRA 5IAXA 3ZFFB 5J96B 5FMCA 1G6NA 4LK7A 4UW5A 3A4UA 2PHUA 2ZS6B 3LPGA 1AYN1 4Q0VA 4QB2A 3RZMA 3NW4A 1LHOA 4KG8A 4XYXA 3UGGA 3UKNA 1E5IA 1W03A 5A3WA 1MS4A 4B4QA 3THDA 1SZBA 2ZCWA 4QXCA 2WKKA 2O8QA 4E2QA 2PHTA 5BNNA 1RXFA 3TN91 5JOYA 4LUKA 2DBIA 4CYDA 1RVF1 1S0IA 5JR7B 1GBGA 3UK9A 2WS93 2J42A 3MIBA 1G86A 2WZPP 4Y20B 5D2AA 1UQXA 3B93A 3VHRA 4QQHA 4BXFA 5M0TA 1QNYA 4Q27A 1RGSA 4C1XA 1NAEA 4CA9A 3PU3A 1XBFA 1YJLA 5FV3A 5G04L 1XB9A 3RS6A 2WS91 1WUVA 5KHHA 1W6PB 4FOVA 3HN1A 3CLPA 3U10A 5JZGB 3KZ4C 2J1SA 1NE4A 3ZYGA 4JTNA 5CFDB 3UJOA 2ARCA 4LTAA 3VB9A 1FXZA 4EWEA 3OOXA 4EWAA 4IV1A 1PMIA 3RZZA 1J84A 1WGPA 1TNFA 2VE1A 4FAGA 1H2MA 1JZ8A 2QKDA 3CO2A 4YFZA 2JDHA 2BOIA 3A0KA 5FYYA 4FPFA 1LHNA 3MV01 3KCXA 4UI9L 1UOBA 5FZ9A 5GM0A 4M0NA 1MZFA 4Q4W2 3RWNA 2X29A 1Q43A 4S2FA 1NY72 5LBCA 1GNYA 1G9BA 1FT9A 4M01A 3H8XA 2UURA 4JKMA 5L73A 4C0HA 4PIYA 1POV0 3KD4A 3RWKX 2IVJA 3ZN4A 2CGPA 2W2IA 2D6LX 2NM1A 5IK4A 2HKXA 5KXEA 4M3CF 4WV8A 2VOTA 2B5HA 5KHJA 4A45A 1AYM1 2A75A 1GOHA 3OEBA 3USSA 4IDZA 2PAEA 1O91A 3MIDA 3Q8AA 4M4RA 4QKBA 3BTYA 2P2KA 1C8NA 1KS5A 3ABZA 3DXTA 3MBWA 5K4LA 4CUAA 1ZBA2 2QNKA 3A21A 3BALA 1V6NA 3DPRB 2WWUA 3DGTA 4QX2A 1Q8PA 2NPIA 5ACA3 3CZJA 2ZGSA 3H3ZA 2VUAA 3WDUA 5GLZA 2DVFA 3N9PA 4QHBA 4XTPA 1R083 1ULFA 5A7NA 5GZDA 3CZUA 1MEC1 3W59A 3KGZA 3ZXDA 4IGQA 4KQ7A 2B42B 4FCAA 4LKDA 5FUIA 3SMHA 2P5BA 4CEYA 5JPNB 3ZDSA 2O0OA 3DL3A 4YGCA 5I8SA 3FHIB 3NJZA 3OD4A 4NHYA 5KHIA 1ZRFA 4XJZA 1W3VA 1L7QA 5L9RA 2VC9A 3EB7A 2Z4FA 2ZGOA 5FK8A 5FO7B 1HV0A 4H3WA 1ASJ3 5KC5A 1EAH1 5DUVA 5FYTA 5EP9A 4XF0A 5KBFA 1LR5A 4AAPA 5C8WA 1JHNA 2PQQA 1NA1B 2WL1A 3DEMA 3KF5A 4GWIA 2BEOA 5CU1A 5A33B 1ZX5A 4LR4A 4LHNA 1LU2A 2ZGPA 1R082 2Q0AA 1J1LA 4QQOA 1W28A 1ND3B 1OQEA 1OLMA 1IQAA 1GNZA 1TVGA 4IEYA 2YFUA 2HLEA 3IDBB 2XL7A 4A7KA 1S2EA 1VRBA 3I3DA 2H6CA 4P14A 3UT0A 1PVC2 1V70A 1YFXA 2VQ0A 5B2GB 1RMU3 1NG0A 4R9CA 4ZPIA 4Q4W3 5T55A 3ASIA 4ZHNA 5LWBA 2HWD3 2WFF3 4HBNA 3THTA 1X7NA 2RR13 4COVA 4EN7B 2XUMA 4JVAA 5EJZB 2JB4A 4AQ2A 3GNEA 4XCAA 3VBHA 4CU6A 1QJU2 3VKNA 2BP6A 4XBQA 1GUIA 2SBAA 2IXHA 3QBQA 4XJ8A 2RM21 4CP9B 3CJIB 1JXNA 4CP1A 5EIYB 4DFSA 4FAHA 5CFCB 4Y22B 1RINA 1CPMA 5IHRA 2ZA9A 1RJ7A 1S0GA 4IL7A 4V2WA 3VZKA 2ZX0A 4ZS2A 3U37A 3OD0A 1VMHA 3O1UA 1LOFC 3E1F1 2VTXJ 4KBBA 1U5IA 3ZFEC 4RHV1 5C4WA 4ARXA 4FT8A 4GJYA 5IATA 1QXRA 1CWPA 2D3PA 4QGMA 1UY3A 4ZZ8A 1LULA 1GP4A 1N47A 1RUD3 4R9DA 5LA2A 5IVEA 1VB4A 3PUQA 1CGPA 3WNPA 3FLRA 4F3JA 1JMUB 1OA4A 3WF0A 3LOBA 1JZ7A 5F3GA 1JI6A 1QOTA 1QIQA 1IZ3A 4XUNA 3D8CA 3DYMA 1RMU1 1SFYA 4U36A 2LW8A 2IFRA 3WT3A 2XJTA 3B94A 3TWIA 4NIDA 4N53A 3WEZA 4AGVA 3SHRA 1RUC2 2RMU2 1OD5A 1QXJA 1VAKA 4LOTA 3AKPA 3UETA 3TOJA 3VD3A 4UXAA 1J3PA 2WO3A 2XDVA 4D7SA 5FLJA 1KD7A 2FMDA 4MH0E 1JH5A 4OI1A 4EE2A 2VOWA 2WABA 1NCQA 1ST8A 1UX6A 2X5IA 5JLVA 1ASJ1 1GWMA 2JDUA 1UXZA 1CAWA 5HBAA 3GALA 2D6KA 3H3LA 4PI2A 1HRV1 4ZONA 1SACA 3D6EA 4XFBA 2YC4A 4FO9A 3V65A 3OTFA 4MHRA 4WM7C 3O12A 4Q4W1 1ND3C 4BLIA 1CESA 4PIZA 2RS53 1WKYA 2VH9A 4NE9A 4PDWC 5FYMA 5BNNB 3BN6A 2Z42A 2W52A 1D4M3 1MEC3 3NAPA 4W6YA 1W0PA 1DYOA 1UY4A 4CCJA 1MVEA 1UZVA 3K4AA 3J8F3 4OUEA 3D5OA 3JU9A 3C8XA 3MUY1 1MACA 4D7TA 1GP5A 2J1VA 4P5HA 3MPBA 4MO3M 5DDJ2 2NN8A 1D7PM 2DUQA 4YW4A 4DPNA 4EV0A 5DUUA 3CNAA 1NLQA 2QQWA 4TSVA 2LS6A 4RSUA 4UOJA 3I2OA 3W9AA 2IUWA 1XU1A 2JDPA 4YVWC 2VCBA 3ITQA 1UMHA 3BB6A 3E97A 4RN5A 3WSOA 1XOYA 1DBNA 4GIQA 1O6UA 4JDNA 2FDJA 2C1FA 4TZDA 4QU1A 4XBNA 2XWBB 5FKBA 2NLRA 4Z92B 3K75B 1ZZ6A 1R081 3A22A 3V0BA 1RL3A 3IKWA 2CDOA 4DQAA 2DTWA 5LA1A 3WCSA 4XFGA 1EUUA 4NUBA 1QJEA 2ADEA 2ZHMA 3TB0A 3NNLA 1ZBE3 4I0AA 2WO7A 3ZYIB 5F5CA 1H6XA 2CGNA 1UZZA 5FPZA 1IGOA 3VD4A 3PJYA 2GNDA 3VBUC 2E7TA 2WQZC 3KM5A 1OPMA 4QQLA 2PHDA 5LCWL 1O3QA 3WVJA 1SBDA 4CVUA 5L7OA 3AL5A 1J58A 2HWF3 5A80A 3PIJA 1GSLA 1DGWA 2EIEA 3BOWA 2B46X 3SKJE 3CIHA 1B35B 2MEV1 3T4VA 1PX3A 4EWDA 4RGGA 2E63A 4Q2FA 1PVC1 5EWSA 3H42B 2VMHA 5FYVA 3N36A 5LASA 2IXIA 4A6OA 4IEWA 4IERA 2ZHKA 2NP0A 3HVDA 4AF9A 1MQTC 2ILMA 2H0BA 3GJAA 1RVF3 3ZXFA 4RS5C 1BLZA 3NNGA 2ARAA 4FBFA 1J59A 4TTGA 3V56A 1AR92 1OF3A 3PVEA 2RS32 3LEGA 3LOIA 4MUVA 3FLTA 4AEDC 1QQP2 4JKLA 1V6MA 3ZXGA 1WZXA 1DLCA 4YPJA 2B9VA 2WT0A 2W5FA 4LKSA 5GKAC 3RJ2X 3ZKYA 3VBRC 2YG0A 3W5MA 3Q8BA 2JDKA 1NQJA 5I0UA 4XF3A 5CFCA 1W6OB 1PNFA 1AL23 4NAMA 2OW4A 4CEWB 3NV1A 3I3EA 4IV3C 3GYDA 3WNNA 4FFGA 2HYXA 3AYDA 1MQTB 4C0BA 2R30A 1VE0A 3H7JA 5FZKA 2HWF1 2W1SA 4QX1A 5F5QA 4XDPA 5DUWA 3O14A 2WNEA 4XTMA 4XVHA 2VNGA 1MS9A 3M3IA 3RJRA 3ROUA 1NCQC 4KWLA 1PZ7A 3HD8B 1Q5OA 5CKNA 4SLIA 3AM2A 3ATGA 3AMHA 4IUGA 4YZ3A 1OLRA 1R1A2 3HNMA 1LAJA 1OHFA 1H0BA 4RYDA 5A1FA 2OS2A 1JYVA 5IK8A 1XSQA 2ZX3A 2W46A 3NL1A 1PK6A 1H9WA 3JD72 4IEZA 1WCDJ 4AGRA 1J3QA 2PXJA 4Y1VA 5FTTC 4BHPA 1E5HA 5A7WA 1DGRN 1V6KA 1S0BA 2MEV3 2VNVA 3WG4A 5CA6A 4NRMA 2P37A 3R05A 1H8TA 1OUXA 1PO22 5F5AA 4BXSV 1V6OA 4NHMA 5FXWA 4AFBA 2D6NA 3WF4A 2OXBA 2OQ7A 3WLUA 4GKXA 3Q8EA 5SV8A 3FLPA 1Z7S2 3RVHA 3MV11 1DQ2A 2XQXA 2ZXQA 1UY1A 1ND2C 3DECA 5JXGA 1C8M1 2GMMA 3N35A 1BCXA 4YYOA 3MHZA 1RUF3 4LMFA 4AEDA 4EJRA 1OOPC 4AHYA 1YC61 3VHNA 2GNTA 1VBC3 3KS7A 2D40A 5C3QA 1UY0A 4NRPA 4DINB 5FK7A 3J8F1 4D8MA 2EICA 3ACIA 4JZRA 4NOTA 5FZ1A 3WHTA 1S0FA 1COV1 2J1TA 1W6PA 3R4DB 3T0AA 1RUF2 3U4SA 4CU7A 5JZGA 2JG9C 3WG1A 1US2A 2ZBJA 1RHI3 2R043 3VBUB 4YARA 4FP2A 3VBHC 2BWAA 1F31A 1TME2 4B4PA 5A3MA 1J1TA 5L9BA 3ZXKA 4QX8A 1C28A 2BVBA 3WX5A 2RG4A 1O5LA 3OPZA 1ULEA 1CAWB 2VOVA 3HQXA 4Y1XA 4COWA 4CCNA 5FJKA 4FPKA 5IT6A 1F2NA 3HJRA 5DG1A 3BOPA 5J98B 3RGBA 3OBZA 1AHSA 1DQ4A 1WLWA 4Y5SA 1H2KA 4N8MA 3INAA 3U1XA 2XG3A 3HQRA 4AEJA 5L19A 4RS5A 2CNAA 2ZPXA 2WFPA 1POQA 5FIXA 4R4ZA 3B69A 3NAPB 2PHLA 4CTEA 1K3IA 3V0BB 3D0SA 4PT6A 4HL0A 5FXVA 1D4M1 3CF6E 4JHZA 1KQRA 4OHWA 5BNPC 5KHKA 3AMPA 5IWFA 1CAXA 5CFDA 1DP0A 3ZYBA 4BQ4A 2R071 4GH4A 1FI2A 4FOWA 3IM0A 2VZUA 2HWE2 2BUKA 3WP4A 1A6CA 2R7EB 2TUNA 1Q8QA 4XE9A 5F9TA 1SQ4A 1QU0A 3K51A 3CL1A 3HBKA 4XJ9A 5A7OA 4B7EA 1OBNA 4YZ1A 2RS13 1LENA 1AR93 2Y60A 4X8NA 1AL22 4SBVA 1H4HA 1UYXA 3TN92 4Y20A 1L7RA 4OHYA 1IS3A 1HRI3 2Y26A 2YUEA 5T52A 4MXVA 1HB4A 1W6QB 4PDWB 1UWWA 5DQ0A 5H9SA 3FZ3A 2ZJCA 1PNGA 2BTVC 3WQBA 2BOJA 2PAKA 4AAXA 4Q29A 3C7GA 1AYN2 2XJQA 5CG9A 2YZ4A 2W08A 3ME2A 3JBG2 2FDIA 2RDSA 2ID4A 2W87A 1DYKA 3VHPA 2R0FA 2QDNA 2WAAA 3DF0A 2Q8CA 5LY1A 2BPA2 4FPOB 3L2HA 1POV1 2R063 4QX5A 1AR73 1RVF2 4XACA 2VW2A 1AXKA 4Q0QA 1CJPA 1TNRA 3NV2A 3AX4A 2PELA 2JIGA 3KLSA 3LDBA 3O5SA 3N9MA 1YQCA 1HRI2 1YXWA 3SEPA 1V0AA 4AVTA 1CIYA 3FBMA 2WJSA 3K4DA 3JB4C 5FZBA 4GAZA 4IE7A 4ASLA 1CAUA 1T2XA 4QX7A 4J25A 3AMQA 5FUNA 2WWJA 5A6XA 4QX3A 3R4SA 3B00A 5HCBA 2F4PA 3POWA 1U5ZA 4KU8A 1YO8A 2DURA 4CRQA 4N9HA 5J37A 3E5QA 4CP9A 1ZBE2 2WYSA 2YMZA 5IVYA 1VBA3 3HPNA 2C5DA 4BWOA 1U5XA 1OH4A 3NAPC 4XQ4A 3WINE 5JIAA 4CCEA 4KU7A 1N1TA 4QQPA 2B45X 3ZIXA 4UWDA 4UFLA 3BGAA 1W8HA 3WNLA 4S2DA 4LO8A 4LEJA 2IC1A 1GQPA 4M3CA 4OLLA 3RNSA 3TEZA 2XGXA 3ETPA 3JB8A 4WVWA 4XFAA 1O3RA 1OA2A 2BNMA 3NWKA 5C4WC 4KMQA 4W8JA 1UD1A 3CJXA 5C3OA 4CDXB 3M7AA 1VAMA 2Y0IA 3KT4A 3AYCA 4LBOA 2VMIA 3I2HA 3W20A 3T1LA 3MF6A 2GH8A 3I2FA 2PN5A 4AI3A 4Y1ZA 5K7PA 1CAVA 2WNUA 3OB8A 1YCIA 2JJ6A 1X82A 5FY1A 3SCHA 5C5TA 1NXD1 4HVOA 2OUJA 3D82A 4H2AA 4Y22A 4N53B 1CZTA 1MZ6A 3LFMA 3OPTA 3AP9A 1GWLA 5KXDA 5CFDC 3OBAA 4AE2A 1MEC2 4NWVA 2Y6GA 2J1AA 1RTVA 3VDCA 1F4AA 1H6YA 1SFNA 2N7GA 3KCCA 5K0UC 3OSDA 5LEJA 3OYWB 1ALYA 2XJUA 2X5IB 1S0JA 3UKVA 4LORA 1QKQA 4RQPB 2WRAA 3BPSA 2AACA 1SLCA 3A23A 3OGRA 2Q8DA 1YIPA 1TZOA 3LZZA 3OPWA 1CQ9A 1LOCA 3VHOA 3V0AB 5EJ3A 3KCYA 2C9AA 4CZSA 1CONA 4ITCA 3NNFA 1EAH2 2DCJA 3PL0A 4MSVA 2HYKA 5HV4A 2ZEXA 4JX0A 5GALA 1CD3G 4LBKA 1UOFA 4OI2A 5HXMA 1K5MA 4ZU7A 2MEV2 3M70A 3CJIA 2QQIA 4IW3A 5T3NA 3MF9A 5AFEA 4CDUB 3GXUA 3H0OA 1W0OA 4MLOA 3LD8A 1OQ1A 4XZUG 5ERLA 4MG2A 2W94A 1AL21 3AYAA 4YZ4A 4COUA 5FQ0B 3QCWA 2V72A 1DQ0A 1X9PA 4RGKA 2HJIA 1YFUA 3RQ0A 5FZIA 2DF7A 3GHNA 5HXVA 1HXS3 5F2SA 5LK7B 2BERA 3UYJA 1AR62 1N3OA 1QMJA 4I3PA 1KJRA 4K1YA 1NX9A 1QHDA 2IXLA 3J7MA 4RGAA 4EN9B 5FO8B 4HK9A 4GWJA 4C90A 1R092 3Q8FA 3S5AA 3T09A 4BCUA 3NKGA 1SLLA 5I93A 4OCTA 2OUHA 4D6RA 4AI0A 2KXLA 1IKQA 1IQDC 1D2QA 1LOBA 3N7LA 1FAYA 3B9IA 1RMU2 1I5ZA 1DCSA 4ZZ5A 2QDRA 2MHFA 3HMYA 4HSLA 5FPXA 1PVC3 1PHMA 1UU4A 2GN3A 3B7MA 1RUH1 3C2UA 4YG3A 5C8CB 1AX2A 4AVBA 2P34A 5FXZA 2Y6JA 3APBA 2WA3A 4MYEA 2XVLA 3B5LB 4D6QA 4J1WA 2VMCA 1MPXA 3K77A 3M3CA 1UPIA 2IFWA 2RR12 2JDZA 2FBEA 1QQP3 4GULA 5BY5A 4WM7B 1HJFA 4CXXA 2VXJA 3PUIA 2D3RA 1ZZBA 3GJBA 2AR6A 5FMDA 2VGDA 4AG4A 4QX0A 3AK0A 1ZBE1 1GQHA 1DZTA 4LO6B 5BNPB 5I91A 5A32A 3SH3A 5A3OA 1GMMA 2A71A 4WBBA 4XF1A 3AJYA 1ZA4A 2A6ZA 4HVRA 2HEVF 4CCMA 4FSJA 3MEPA 5BYNA 4CDXC 2VZSA 3PUAA 5FWJA 2P4EA 1PO21 2VTFA 5DN2A 5LRRA 5LW9A 1VB2A 2XLGA 4COYA 5ACA2 5I0DA 2E6VA 4MX3A 3MO4A 3AZWA 4FXKB 1HRV2 1HB2A 4FTSA 4ZXEA 2VL4A 2WQ4A 5FZEA 3U78A 3WXPA 4XFCA 1ZBA1 1W2TA 1H1MA 1YQ5A 1LGCA 1MZEA 2KD7A 3M4FA 4CEWA 3F2ZA 3HT2A 1MS8A 1SG3A 4GZ9A 3IMNA 5J1XA 1YI9A 4Y5TA 5AVPA 2WWSA 2CWMA 4FPGA 2HBUA 4Q4Y2 5DPNA 4M3CB 1JOBA 1MQTA 1UU5A 3IAQA 2D7FA 3O1SA 3PTRB 1V9U3 5C6CA 2OVUA 4B4RA 5FO9B 1AR82 1QJFA 3TEYA 2X10A 1KJLA 4IGPA 1O7FA 4AI9A 2YBSA 1WLTA 3AVRA 3ZVXA 2Q4SA 1OXCA 1URXA 4DZGA 1APNA 2DCZA 4MGKE 3ZMNA 1VBA1 3FHAA 1VBE2 2W0XA 1VBE3 2CWSA 4QKNA 4YG6A 4EZ4A 2FZ2A 1MS5A 3UESA 4RR3B 2YC2A 3FE5A 3LSDA 1ZRIA 3N9QA 4QPYA 2XMLA 4A6SA 4RQPC 5A1AA 1OKOA 3LF7A 3WG2A 2RE9A 1W6OA 2R1BA 4BPZA 3HN3A 2RV9A 5F2WA 3ELNA 2W91A 3TEXA 3OGSA 5JXJA 3U75A 2XQRA 4Q4Y3 2HWB2 5JCTA 5FWEA 1XXNA 3QACA 4E8DA 1O59A 3ETQA 4XETA 2AC1A 2XJPA 4Y24A 5FZ4A 1YJKA 2DWRA 2FDFA 2KA3A 4P9YA 4JQTA 3ZPYA 2BZDA 2GDFA 5JR2A 1UZWA 4BM8A 5JOXA 3ZFGA 1UIJA 3GF6A 1GQGA 2D6PA 2XR4A 4NWWA 1TG7A 4UW6A 3ZXLA 4AHXA 4DNYA 1HDKA 1G9CA 4NPMA 3AMMA 3M3QA 2HWC1 2K2SA 1ULDA 4GJZA 2J1RA 4Q26A 2K0GA 3FFQA 4GALA 1K5MB 5DMYA 4JGYB 3ECQA 2A3WA 2GNBA 3MLJA 3PMSA 5FZFA 4I02A 4ISQA 5FZCA 1JZ4A 2VG9A 1LECA 2GZWA 3AZVA 4RHV3 5FZHA 4AWDA 4ES8A 2CSGA 3NJXA 2QZ3A 1B09A 3SQOA 4XJWA 3WDYA 3BPZA 3A0NA 2DCKA 3VBUA 4BYYA 3LA7A 1JU4A 1AR91 4JTOA 4UW4A 4QPGC 1XYNA 1LCLA 3IIAA 5FZMA 5JIUA 1CVNA 3IB3A 2O1QA 3J7HA 5GZEA 5FP7A 4KNCA 2AEZA 2JXAA 3ZR5A 2UWAA 4XDOA 2RR11 3FJSA 3JCIA 1VBD3 1DU3D 1CN1A 1N1YA 2W95A 5FYHA 5FYBA 2EIGA 4MOAA 4UAPA 1XE0A 5FP8A 3WUCA 3H1WA 4BOWA 4AEMA 4QPIB 4X6RB 1DLLA 5J7MA 3MLLA 4YVWA 3VDDB 2PTMA 1OOPA 4QDRA 1S2BA 3N4MA 4HKOA 3AP6A 4W6WA 1UKRA 1D4VB 5CVRA 1R093 4WM8B 1DQ6A 5H9QA 4NMIA 3U07A 1J3RA 1QJU3 3VBSC 2VXRA 4LE4A 2JEMA 1OPOA 3NV4A 4HVQA 2HEYF 1ENQA 2Y6HA 4CDQC 1JYIA 3P1IA 3QLQA 4LIUA 2HWD2 1H8TC 2WFF2 2XKOA 3KT1A 3EJKA 1RUJ2 1SCSA 1I5PA 1LU1A 1QJX2 5J3UA 1W06A 1XE7A 1QOSA 2ARXA 5FPBA 4AFCA 2GNMA 4YM3A 2FMYA 5BNQA 3JD71 3RZGA 1W6NB 2UWCA 4HONA 3SISA 3IWZA 2JG8B 4WVMA 1NY71 1YYNA 4BQ5A 3O0WA 1YFWA 4URAA 2YYOA 2MPFA 2V4AA 3AVSA 5F32A 4Z8BA 2YHJA 1BMV1 1RJ8A 2XWJB 5ANQA 2E26A 5T5OA 3DYOA 3MPPG 2CV6A 1W6MA 3SEEA 1GR3A 3LWCA 1KS4A 2ZX1A 2XL9A 5KHGA 1AL0G 1ZZ7A 2D43A 4Q0SA 2XPJA 1C8M3 1JHJA 2BFUL 4Q4V2 2UY9A 4NIAA 5FJHA 2GMEA 1U12A 3NJVA 4JQRA 3KQRA 4AI1A 1AYM3 1UF2C 3C7EA 1VBB1 4PF5A 5F3CA 4XIOA 2C26A 3D0JA 3H1YA 1GANA 4Q8KA 1W2AX 2ES3A 1NUKA 4CP0A 1G9DA 4P9XA 4QHZA 3DN7A 2ARBA 4OYUA 2DCYA 3MW3A 1WW7A 2XLFA 3C7OA 3JXSA 4L8QA 4MHUA 2EAKA 3EHKA 4Y5Z0 3UKTA 4UBGA 1W2UA 1OI6A 1YEWA 4GA9A 3RFRA 2AZ5A 2JX9A 4GWMA 2WZR3 2OKXA 1N3QA 1NCRA 4LKFA 1C1LA 1HB3A 3THPA 5GLWA 1YFYA 2YBPA 2J1EA 4L97A 5LA0A 4X8PA 1HQNA 2QQLA 5BPXA 2EF6A 1LHWA 2AREA 1DYPA 1OC1A 2QJVA 2WNOA 3RZHA 2Y6FA 4OUMA 3S0MA 1AVBA 4FTBA 3WP6A 2A6VA 3GZAA 4E2GA 3W5NA 3ORJA 4HZFA 2R072 4IEPA 5FRAA 3J4UH 1JW6A 4O65A 4BJ0A 5HI0A 4Y3OA 4K21A 1MS0A 1JZ3A 1ZRCA 1OSGA 2E32A 3ZN6A 1W9YA 3GCXA 4KBZA 1N3PA 3UNPA 3OUHA 1RUI2 1SBEA 2FZ1A 2CTVA 3PUSA 3RI8A 5C3RA 5CG8A 2VQUA 5JPMB 3L2YA 3N7JA 3T1MA 4QPWA 4HG6B 2TBVA 1JS9A 1DFQA 4I3GA 4Q1RA 4QB1A 2D6OX 3OCPA 4LJHA 2W9XA 2WDBA 2VZVA 3GDBA 1S0DA 1ZZCA 3MFCA 2QQNA 4AGGA 3WP3A 1JYXA 5FP9A 3WDWA 1K5MC 5LBBA 1YLLA 3DKWA 1HQWA 5FYCA 4D3WA 1CAVB 4AXOA 2VAUA 3UGHA 5IAVA 3T4HB 3ZSMA 2QVSB 2VZOA 2VMDA 4UT5A 1L3JA 2ZGKA 1FMD1 4QU2A 1R091 4CXWA 3KHCA 4XBLA 3ILNA 5CZKA 1CZSA 1HLCA 1UKGA 2QBXA 3ZYHA 2X09A 1GICA 1OT5A 1QWRA 1W9FA 2E9QA 4I01A 4YW7A 4XJAA 3WDVA 4XIKA 2JWPA 1BBT1 1NE6A 2BVVA 2VPVA 1JODA 3ZSJA 4I2OA 4MV2A 2B4KA 2Y0OA 5FP4A 2WS92 4LBNA 1NLSA 3E6CC 1V6LA 1CAUB 1VBD1 5JI9A 3OBTA 2ET1A 3CEWA 1PO12 1VLNA 3JBG1 5FZOB 1AR72 4XUTA 2R062 2Q1ZB 4CDWA 5IVJA 1H2LA 3RPQA 3T30A 2R1DA 4CCLA 1PMJX 1LEDA 1LOAA 3T3YA 4E27A 1SDWA 2ET7A 4EYUA 4JGZC 4UF0A 1GLHA 4IGOA 5DAPA 3MICA 1RUE2 2JG8C 2DU1A 4BLJA 5T50A 4ZY9A 2GSYA 3BCWA 1WMXA 5CBLA 1NT0A 4GMP3 3PU8A 1RYYA 4DXZA 1ENXA 1HW5A 3H8UA 1M4WA 3ZYJB 3OYWA 1WCUA 1K42A 4JAAA 3ZIWA 4B1MA 4COZA 2IXJA 4HN0A 2GN7A 3GGLA 3P3PA 1CPNA 3T2OA 2ZGNA 1ODNA 1QXPA 5EYYA 3THCA 3B01A 3WF2A 4WVVA 3VKFC 4QGNA 3ZLIA 4A44A 3ALQA 1PM7A 4ET7A 1PX4A 4LNVA 4HPKB 1MS1A 3S5QA 1RUJ1 1NLRA 3POJA 2HWE3 1BEV3 3J9SA 3I3MA 4L99A 5FZDA 1ONAA 5A7SA 1LNSA 4QPGA 4DUVA 3SH5A 4J6GA 3QH7A 3IPVA 5H9RA 4PLMA 1L7LA 2X05A 4D7YA 5JI7A 5A6YA 2JG8A 1O4ZA 2J7MA 5FLHA 2NQYA 4PBOA 4TLFA 2CHHA 1D2SA 4JGZA 1IS4A 4K40A 5JXHA 2OZJA 3T08A 3ZFFA 3NSTA 3BVCA 4IETA 2I45A 3S6PA 2A70A 3L9JT 2CAUA 3FX3A 1IOAA 2JICA 2WNVB 2VMFA 1VBA2 4AHZA 5EHDA 4YW3A 1S0CA 2ZEYA 1Z78A 2WN2A 1MVQA 1IPSA 2BU9A 1VMJA 4BISA 3RI9A 2JD9A 3ZKUA 3EMRA 1US3A 2H0VA 4Y1YA 1SPPB 2VZ1A 1RXGA 5FXXA 4GB32 3B3QE 4XUQA 5F3EA 4GQ7A 4PBPA 2R49A 1JZ6A 3GZEA 5BUVA 4DXRA 3E5XA 3I4IA 3ZFEA 5EQUA 4P00B 4L9BA 2P1BA 1BJQA 5JSOA 2AGSA 5FR3A 4QDQA 1TMF3 3I97A 1VBC2 1NCRC 2YPJA 3I2JA 4N43A 1UAIA 2ZMLA 2VULA 2XJVA 1VRH1 2WNVC 1T6GC 1BEV1 2Z5WA 3AZZA 3LSEA 2VM9A 5IJRA 2WSUA 3IMMA 5GZGA 5EPAA 5FY5A 5F6KA 5F1RA 1O5UA 1O3TA 2DVDA 2HWC2 4H7MA 1RUG3 1F5FA 1QF3A 4HOOA 4LKEA 3FFZA 2BDRA 5FYIA 5FYZA 2VUCA 5BNPA 1ZRDA 3PURA 5A7QA 1RITA 1ZM1A 2Q1FA 2DBNA 3M2MA 4XAAA 5CNAA 5E16A 2QTWB 2R6QA 4ZS3A 4TYSA 2PQSA 3SXWA 4LBJA 4LBQD 1IPKA 4H7LA 2X8KA 1KEXA 4IE0A 3TRSB 1BBT2 5T5PA 2BGCA 1FOD1 1Q8VA 2VY0A 3HNBM 2ZX4A 1QJY1 5GZCA 4QT6A 4N90A 2JD4A 2PLV2 1MS3A 3VZOA 1OVSA 5FPAA 4LLFA 4META 2RM23 2WBKA 3J7LA 1AR61 1OUSA 1WCQA 4C1WA 3FBYA 1FMD2 1AXZA 3LQCA 1G8WA 1PGSA 2GC2A 2QZ2A 2SLIA 4NPRA 3KMHA 3VBOB 5JWPA 1X8MA 1HN0A 1NA1A 4M00A 3RMXA 3HBZA 3C3VA 1JYNA 4O61A 1UY2A 3AMNA 4BK4A 4BIOA 2ZHNA 1NXMA 5DZEA 1UW8A 2A3XA 3RYRA 5IVCA 4YW2A 1UX7A 4OHXA 5ABJB 4BIFA 1RUC1 2RMU1 1WWYA 3FWEA 3OF1A 4BQWA 1EYBA 3LB9A 3BODA 3FUOA 2VVDA 4LK6A 2ZGUA 3AL6A 4R8HA 3BI3A 4YZ5A 5BNOA 1PO11 2KM2A 3BIWE 1FMD3 5E1RA 3VKLA 2DFBA 4DXSA 2ZMKA 4CDUC 2QQPA 1KGYA 4OQ9A 3OUIA 4L92A 2ZKLA 1X9TA 3ES1A 2NYYA 3CHXA 3MFAA 4YGBA 1PMHX 5FMBA 3SITA 4XOGA 1QJX1 1TME3 3U0ZA 5DAVA 1C5IA 5B4XA 1EUTA 3KF3A 2RS33 3CU7A 4UF0B 2AH2A 1R1A1 3VUOA 4B1LA 4JHTA 1XNCA 1A8MA 1U5YA 2TNFA 2GC3A 5GLTA 4CCCA 4LBQA 4TN7A 3VDAA 1OQDA 2JKXA 1RUNA 4HKWA 4ZKTB 2GC0A 1ACCA 4FQ4A 1PK6C 4XMIA 2JIJA 2DV9A 2LALA 3R0RA 4K8FA 5JXIA 1UOGA 3SCFA 4K9SA 4YW6A 1W8FA 1UXXX 2VZ3A 1QEXA 1WA6X 2VU9A 2WSVA 4AVAA 4YSFA 5ACA1 2FCUA 3OUJA 1BK1A 3ZR6A 4NIGA 1XYOA 3ZSEA 2X53S 1OFSA 2VTXA 1UZYA 3DCQA 4GB33 4MXWB 1NZIA 1PIV1 4AI2A 5IFTA 5FZLA 5K0UB 3T2QA 3VLBB 4CU8A 4Q0UA 2V5DA 3VBHB 5T5JA 1C8M2 1GWKA 3MIFA 5H9PA 4AVVA 5L36A 1TMF2 5A3TA 4JGYA 1VAVA 3POGA 2WZR1 3SLIA 4E4DX 3NKTA 4FPCA 1PGW2 1YUDA 4E2SA 3KWVA 4LO5B 1KFXL 4A7ZA 3KSCA 3VZLA 4NHKA 4IE5A 4Q4X1 3VDDA 5KXBA 2YGMA 2Q8OA 3LEMA 4DB5A 2D98A 3WF3A 4EQVA 2ZACA 1O4YA 3KQ4B 3LGRA 1FV2A 4LHKA 4QPIC 4CDXA 5K8SA 1Y9QA 4KWJA 1R1A3 5HCHA 3PMEA 1LEMA 1X33A 4FI9A 4QKFA 4YG0A 5IW0A 4FFFA 5BNNC 3CJIC 1W8OA 1QJX3 1TME1 2HWB1 1X36A 2E7AA 4XQDA 3AP7A 2VNOA 4IEXA 4BB3A 5T54A 3O1OA 3VBFC 3ZM8A 1Y7BA 3VD5A 5C5UA 2XOMA 2VW1A 3ZOIA 4A3ZA 3PIGA 3RMYA 1W8TA 4K7JA 1EV11 1REDA 4LE3A 4QHOA 3H8RA 3UL2A 2IVIB 5DAWA 3POEA 4ONUA 2F6BA 2Q5TA 3POYA 4E4HA 3EQEA 4FP3A 4WVMB 3HIFA 3MIHA 4DRVA 4AFAA 4FFIA 4B3NA 5AC92 5EYXA 1ZYBA 4DY3A 1C3HA 2WC2A 5SV5A 2VMEA 1S1AA 2V5YA 4XQWA 2ZMNA 2ZGQA 3H7YA 2ZHLA 2CU5A 1VRH2 3ZFFC 1BEV2 3HNYM 2Y64A 2FHRA 2OPWA 2ZGMA 2BBAA 2TEPA 4Z07A 2EALA 4OHZA 3VZMA 2WNVA 4QD2A 2GMPA 1H1AA 5FPVA 1SEFA 1HB1A 2LRPA 2ADDA 5FPLA 4QB6A 2AEYA 4OZXA 2WLQA 2ORZA 4OULA 2Z69A 4XF4A 4CU9A 4ZU4A 4PCRA 1DDLA 1XYPA 1ZA7A 1B35A 3URFA 1UZ0A 3I2DA 3MYXA 5FKCA 1PO13 4ISRA 3K46A 2JECA 5D8AC 4DMIA 3WG3A 1CX4A 4YM1A 5LY2A 3O1TA 4A42A 2Y33A 4QPIA 4Y26A 1RUC3 2RMU3 4WM8C 1QJY2 2VQTA 4RHV2 4XDQA 1W8WA 2F17A 2JKBA 3DUIA 4HT1T 1JOPA 3K3OA 4PI0A 4YVWB 2DTYA 1W6QA 2XB6C 4PDWA 1WMFA 1K45A 4NO4A 3RYKA 2R061 2RDRA 4XABA 5E8AA 2HWF2 4NIHA 4N43B 2BNOA 1NCQB 4MGYE 2XBO3 1F15A 4ES9A 5HPOA 1BK0A 2DVAA 4EN6B 4LITA 5L7OB 1MZ5A 1RUD2 5EV7A 3ZSLA 3WNXA 3IZOA 1W2NA 1ZZ9A 3KVBA 3FUQA 1P8JA 3QH6A 3WF1A 4D94A 4N9IA 1EPZA 2PHRA 2EIDA 3SCGA 5CAZA 1W6NA 4PF1A 4I0BA 3WNOA 3ZXEA 3ZO0B 4O9EA 2QQMA 1VPHA 2VBDA 3B02A 5G05L 5JVVA 3VKMA 2QQOA 1ZREA 1W9TA 1F4HA 4CCKA 5BV6A 2VUJA 3ENRA 1OKQA 2DCTA 3VBRB 1GNHA 3ZSKA 5A3UA 3CKHA 1W6MB 3AXEA 3CMGA 3OGGA 3JQWA 4KGQA 4NR1A 3MZHA 1REFA 2W92A 5IVBA 4FOYA 3VDBA 5IK5A 3O1RA 2I07B 4MGIE 2W47A 1DQ1A 4NAOA 1QDOA 4YW5A 2W1QA 1Z7S1 1SHWB 2VZTA 4PHZA 4AI8A 2R073 3PNAA 4B7KA 1KRIA 2B8MA 1I3HA 2VBBA 5FP3A 1JZ2A 1ULGA 2RDNA 5DDJ3 1FPN2 2Z2SB 3I8TA 3C7FA 4OMCA 2YXSA 1AR83 3WQ0A 4CE8A 4LXLA 1JYCA 5LATA 2RDQA 5IFPA 1V9U2 1Y4WA 1TMF1 2A6YA 3J8F2 4LA2A 4LUMA 3JQXA 1W8UA 3H3UA 4LBQB 1V6IA 5C3PA 2GH2A 4XHXA 5CB7A 5F37A 3LA2A 4GMP0 2P3IA 3U14A 3I2KA 2PMWB 2QQJA 4S2HA 1IS5A 1Y9GA 4R9BA 1GYKA 2WT2A 2R0HA 4CDWB 2BYVE 1DZRA 5A6QA 2MNGA 1I1EA 3AXDA 1HIXA 1W39A 1DGLA 4Q4V1 4QGLA 3WQ7A 5A6ZA 1QH6A 1N1VA 3AKQA 4CDWC 1FYUA 4BU2A 5K9YA 1IG3A 5DZFA 1M06G 2GU9A 2D3SA 2I2SA 2DVGA 2PFWA 5A33A 4FPEA 5FOJB 4LO4B 1PVXA 4JV4A 4C8DA 1AX1A 3ES4A 2E33A 4GH4C 2WZR2 3AKSA 3W21A 1AX0A 2FCTA 2JDMA 1BYHA 4D6SA 2EA7A 5C9AC 1O8SA 3KT7A 2UYAA 4Q4X2 3U11A 1YIFA 4LBLA 3WW1A 3ZYPA 5KXCA 3GBGA 4U2AA 3A7QA 3E5UA 1XRUA 5TSWA 3M3EA 1VBC1 2P17A 3O0XA 3POBA 2VO5A 4AR2A 4GKYA 2VECA 1GZ9A 4IEQA 1XNTA 1OLQA 2H6BA 1QH7A 3R4UA 5EXOA 2FDGA 5FY0A 5T5LA 2LROA 2FDHA 2RHPA 3G6JB 4DY5A 5C9AA 2WYFA 4EN8B 4OHVA 1X8EA 1RUJ3 2BNNA 5FZAA 2ZX2A 1YQ2A 2Q30A 4HSJA 2B9UA 1WLDA 1DHKB 1HJGA 2WN3A 4Z1VA 2RJ2A 1C4RA 4NIIA 4CCOA 2DUOA 5CADA 3GCWA 4BQ1A 1Q8OA 1RUI1 4IQPA 2ENRA 3NRUA 5AC91 4F83A 1XNDA 2JG9A 1JBCA 1UO9A 4OZOA 4FPYA 5F3IA 4FVVA 1WD3A 4XILA 1HV1A 2QCSB 4NVPA 4IESA 2XHKA 4JGYC 4CPBD 2NMNA 4EROA 3POFA 4HFSA 4Q0PA 1JUHA 1YNAA 2GP3A 2UYBA 1LOEA 3AZXA 3PLQA 4ORFA 4W6XA 5FQ0A 1NKGA 5FZGA 1H8TB 1SLIA 2VCMA 4PLOA 2Q1MA 3M1HA 1QQP1 3OGJA 1HX6A 5FLIA 2WT1A 2VW0A 2EAAA 4AW7A 3CBNA 4S2GA 1T6BX 2ZZJA 1IS6A 2C9KA 1BHGA 4QPGB 5E89A 4JRAA 2VR4A 4XFHA 1DGWX 4AQSA 1UN1A 2R16A 4M4PA 1PM4A 1KITA 1XJAA 2ZGLA 4MGSA 1JTZX 4AEDB 4G3YC 4CEYC 1SMVA 4QDSA 4XEZA 4CDQA 3RDIA 1RUE1 1LB2A 3FHQA 3VBSA 2XXZA 4BQYA 5EFUA 3WNKA 5FFOC 5IVVA 3IDAA 1VBD2 5C8CC 3KHBA 2LUWA 1F9KA 1SBFA 1XU2A 4IV3B 4JC1A 3WDTA 3HQUA 4M3CE 5C33A 1BXHA 4YGEA 2A1XA 4GH4B 1YRZA 2BRTA 3VV1A 5ANNA 2YROA 3HWJA 4MGQA 2EXJA 3TAYA 4P9JA 1GZWB 4KG0A 1S55A 3J26N 4DUXA 2AENA 1SPPA 3I2IA 2VVEA 2BW8A 2B7YA 4DOUA 3QOPA 2E31A 4AEKA 4PQQA 3I2GA 4G9SB 2G9GA 1K5JA 1C1FA 5FYSA 3FL7A 3Q9OA 5FZ8A 4XC9A 5DXDA 1OFNA 1IHMA 3K2OA 1I9RA 4Q4X3 2WQ8A 3PTYA 1LJ7A 1W90A 2ZEWA 2QQVA 3MIGA 5I0RA 3TBDA 2XUEA 1EPWA 4XUPA 3POSA 1NA1C 2UU8A 3AC0A 3OBRA 1JYTA 3VZNA 1OLME 2YBKA 1EP0A 4RFT0 3VBRA 4C91A 1OD3A 1IG0A 2DDUA 1FPN3 5C7GA 5CEHA 1DQ5A 4XJUA 2J22A 4YNIA 1AUYA 1XNAA 2WLPA 4OFGA 1FPN1 2IZWA 2VNRA 3VD9A 2JB8A 3I7DA 1YHFA 2LTNA 2HWB3 1F35A 1KFUL 4A7YA 2EVXA 4H14A 3AZYA 5FCCA 2A7AA 3VL9A 3ZFEB 1HKDA 3AFGA 2ZABA 1COV2 4TLGA 1WLCA 5CKMA 4NJ4A 4GXLA 4AQ6A 3IAPA 1HN1A 1Q3EA 1OF4A 4P5YA 2G4IA 4YGDA 1FV3A 5LA9A 4AYUA 5D8AA 3I54A 1DGRA 1CAXB 1VBB3 3HOBA 2G9FA 2EXKA 2ZAHA 5FYUA 4HETA 1PGL1 2A3YA 4H55A 1Q56A 5CIRA 4GB31 4N43C 1QDCA 2RJLA 3VBFA 4X6QB 1UYPA 3ZX7A 1TE1B 4QM8A 4A3XA 1AXYA 2CYFA 3LCPA 5FPUA 4YVSA 3O1MA 1LHUA 4AVCA 4Z2AA 3S30A 4KWUA 1IPJA 4RQPA 5LBFA 5BNOB 2RS51 5A3PA 5HCAA 3M3OA 3MDPA 3VDDC 3MW2A 1WCSA 4PQ9A 2D5HA 4XUOA 2P3KA 3ZDVA 1E5SA 2RS31 2XBO2 1HRV3 3IIIA 2DYCA 5C9AB 1UYYA 4P9WA 1S2KA 1YI7A 4RR3C 4B8EA 2W3JA 1GU3A 1E5RA 2WNUB 5A7PA 2FD8A 4O7XA 4P08A 2EXIA 1YWKA 1WD4A 2IWGB 1ULOA 4QXKA 4V2VA 3GM8A 2WZ8A 3P6BA 1QJY3 4Y4RA 2W1WA 1G7YA 1H1IA 4CCDA 5F8PA 1RB8G 3MGUA 4WVZA 1W8ZA 3WW3A 1UIKA 3BTAA 3DV8A 2XHNA 2W1UA 1K12A 2OZ6A 3I59B 2EXHA 3VZJA 3Q8CA 4MVTA 3N9NA 3ZXAC 5EZWA 2YU1A 1O3SA 4K3UA 4KI5M 4BA6A 2VOXA 1Z0HA 4HK8A 3WNMA 4BK5A 5AC93 5LEKA 1LRHA 2PLV1 4ASKA 5IK7A 5IUQA 4BMBA 3BYWA 3ILFA 1H2NA 1PZ8A 3PVNA 1POV3 3AP4A 4IXLA 4MXWA 4LOSA 4XZPA 4ZU5A 3RG0A 3T2TA 1F8VA 1J83A 5JDBA 2O14A 4NROA 4YFWA 1STMA 2BGOA 3K3NA 1W9SA 5DAQA 1RUD1 3VL8A 2ZKNA 4V1PA 3RYPA 4DUWA 4HKLA 1VRH3 1AR63 3LA3A 4K8RB 2DFCA 2V4VA 4OMDA 4YZ2A 4LPLA 2BJSA 2X5IC 5JSPA 4CDUA 2UWBA 3KV6A
chains in the Genus database with same CATH topology
1UCXA 1G9AA 4XFFA 5ABJC 1QY4A 1LKNA 1HRI1 3NVCA 2PA7A 4AFMA 2YGLA 5C8CA 5KWRA 3QD6A 2LM3A 1GKBA 4YLZA 4KL1A 3WZ1A 1WBLA 4XPVA 1XNBA 5FOBB 4XHBA 1CJDA 4IV3A 3TNQA 4F7ZA 4YRDA 1HXS2 3USUA 4PIXA 1QNWA 4EN0A 2WA4A 1AJOA 2CAVA 5K0UA 4MGZE 1AF9A 1ULCA 2HWD1 2WFF1 4P9IA 2XJRA 2ZZQA 2PHXA 4TWTA 2HEWF 2ETEA 4Q4Y1 5BNOC 5GLVA 3O0VA 4RA0A 2GAUA 4L11A 5AFBA 1LTEA 2OPKA 4OI4A 3WQ1A 3GZUC 2YDEA 5DDJ1 4FPLA 4ASMB 1EAH3 2XKPA 5I0TA 4Q8LA 3AP5A 4PLNA 1D0GA 1WMDA 1Z7S3 1C5HA 2DVBA 2D44A 4QMAA 4O9GA 3HT1A 1WCKA 2W68A 1PO23 3MLKA 2V09A 5L7OC 3DPRA 3P3NA 1ZVFA 5A32B 1PGW1 4L2NA 5JOZA 3X29B 4OI0A 1D0HA 4OUSA 4BZ4A 1UMZA 4GMP1 2PAMA 3OY8B 5FDBA 3KGLA 1XE8A 1FATA 2WIIB 3VBOA 3EXUA 4Y1UA 1TQ5A 2VVFA 4HN1A 2V73A 3PHMA 3WV6A 4BE3A 2JE7A 2O8OA 4XXPA 3M8LA 2HWE1 4RR3A 4PJYA 3HR9A 3IT8A 1JOJA 1H9PA 1JN2P 1SCRA 3AKTA 1RUH3 1X50A 3AJZA 2Y38A 2PLV3 4NN0A 2I74A 1BQPA 5J09A 5LRSA 1JUIA 4YVSC 1BBT3 2E53A 2QFEA 4K6BA 2E51A 4IEVA 4YVSB 1RUOA 1WMEA 4IEUA 2YC0A 3O7OA 1FOD2 5FMOL 4LT5A 4HANA 3N7MA 4JDOA 3S7IA 4CEYB 2DUPA 3OJBA 3SH4A 4R52A 1REEA 4KWKA 1HQLA 4RD7A 3ZFGB 4ATFA 3D4KA 5I8TA 2RM22 1IKPA 4F8AA 2OA2A 4DS0A 3PVBB 3FMGA 4FPHA 1NYWA 4INDA 4WM7A 1VJ2A 1Y3TA 4I09A 3JBG3 4LLOA 4FPJA 2PYTA 3WHUA 2BBVA 2PHWA 4YM0A 1XQNA 3V64A 2CGOA 5LK5A 4FXGB 2D5FA 1SLAA 5GZFA 5GLUA 1ND2B 1FNYA 4WZCA 2WNUC 3MIEA 4A2UA 3TN93 1RUG2 3S7EA 4LBMA 4M0HA 3IDEA 3ZN5A 3GBFA 2W39A 2RS12 1EV13 2C0ZA 1H8VA 4UW3A 3WW4A 1QOOA 3NV3A 5BXXA 4XF9A 2RJKA 1HXS1 1XNKA 1ZZ8A 3WOGA 1AYN3 1UPSA 2BFUS 2JE9A 2A5ZA 2JG9B 2ZTNA 5KC6A 5DG2A 4NHLA 4KGGA 5FMOS 4KH9A 3H50A 3JZVA 3PJQA 1FNZA 1ND3A 5A3LA 2ATFA 5C4WB 4WM8A 1NQDA 5JAXA 2CL2A 1LOFA 1PIV2 1AZDA 3LKJA 1H30A 2R32A 1PIV3 1E57A 2XH6A 5DUXA 5JMCA 3HAGA 3IDCB 4LHLA 4XMAA 3WP5A 4N53C 2QE3A 1OA3A 4HMZA 3VBSB 1WW4A 1N1SA 1FX5A 1WW5A 5DZGA 1KXGA 2NMOA 1ZRRA 3H9AA 3WY6A 4URTA 4CP2A 1V6JA 3V0AA 3GHMA 1LOGA 4AQTA 1DG6A 1GZWA 1BVVA 5JOWA 2ZGTA 1PGL2 1DZQA 1CIWA 4R9AA 4XW3A 1RHI2 2R042 1EV12 3N3HA 2K9ZA 2Z79A 3VBOC 3ILRA 4CDQB 1B35C 3JUUA 4BH9A 3K48A 1GV9A 3GBWA 3ACLA 2A6XA 4HLTA 4UBHA 1NCRB 3WR0A 1Q8SA 1RUE3 3MI8A 4I0WB 1EY2A 1KDMA 3JD73 3VN4A 1G9FA 3ZYRA 5FBZA 2ZAAA 2ERFA 4QQ2A 1MR5A 2XLAA 5I8YA 4IV1B 5J36A 3KB5A 3VKOA 4Z82A 2OYZA 4JCKA 4N7IA 4K1ZA 1ENSA 2JENA 4QM9A 5FREA 3ZXJA 5JZGC 1QJU1 2GALA 3VGIA 1CR7A 1NZCA 4AFDA 4JDMA 2VOKA 2FQPA 1LESA 2AUYA 1FOD3 4G4FA 2D97A 4K20A 4ATEA 1NOVA 1R1ZA 1SLTA 2VMGA 5FAXA 2QUOA 4FTEA 2PHFA 2P3JA 4I30A 4CEWC 2XPJA 3UJQA 5AVAA 1GZCA 3FC0A 3ZMOA 5D8AB 2BWCA 1RUH2 3DPRC 3OY8A 1OOPB 1OMIA 1BZWA 1RUI3 3BU7A 4Y4YA 1AR71 1RUG1 2ZOEB 1UU6A 2CY6A 4FOQA 5HCFA 3AB0A 3AYEA 3B9CA 2IXCA 4P9GA 4LA3A 1DIWA 2B39A 4MZUA 5J48A 2D93A 3GZTB 2GC1A 2DU0A 4FQZA 4XXAA 1F5JA 5ABJA 3U4XA 4B29A 1ND2A 3TYJA 2A73B 2OIIA 1C57A 2RS11 3WCRA 1UL9A 3ST7A 4AVSA 1LGNA 2HWC3 3EBRA 4YW1A 3E6DA 1ASJ2 4R4XA 4W65A 5CFCC 5I0SA 4Q4V3 3RRDA 3IBMA 4IEOA 4YM2A 1H4GA 3ZN6B 1V9U1 2XJSA 3E6BA 4E4SA 2XVGA 3PVOA 3IN9A 3LAGA 4P9LA 1I6XA 4WZFA 3WW2A 1BMV2 4LO7A 1RUF1 1O4TA 2XVKA 3WDXA 4IV1C 1AYM2 1Y43B 1AR81 4Z2WA 3N7KA 3MW4A 4J1XA 1ZBA3 5F6LB 1GFF2 1LHVA 1VBE1 4AK3A 1A8DA 1AJKA 1VP6A 1VBB2 1PZ9A 2WINB 3RSJA 3AKRA 1VR3A 3H1MA 1A78A 1SLBA 3VBFB 1RHI1 1VALA 2R041 3TNPB 3IPVB 4E4ZA 1V00A 1DF0A 1ENRA 1WA4A 2YV8A 1WW6A 5D1IA 2D6MA 2BQPA 1COV3 3R6SA 3W58A 2VQAA 4JGZB 4LULA 5JSRA 1TEIA 1RIRA 2A6WA 2IXKA 2YY1A 1KDKA 3G7DA 3USUB 2NZ9A 2UY8A 1A3KA 1QGLA 3UV9A 2RS52 1LGBA 1S0EA 4JRLA 3SNMA 1WBFA 4Q1PA 4HPKA 2E7QA 4OVEA 2XBO1 5E88A 3EO6A 4GWNA 2ZGRA 4XFIA 3AFKA 3ZFGC 4RL7A 4D69A 4ZXKA 1BKZA 1LODA 1QJZA 1U0AA 4RS5B 3WUDA 4BMEA 2AYHA 1D4M2 1VIWB 1ZNPA 4N7UA 5GJ6A 3I59A 3NO8A 1PK6B 1RC6A 3WD5A 1BVP1 4DRRA 3ZFFB 5J96B 1G6NA 4UW5A 3A4UA 2PHUA 2ZS6B 4Q0VA 1AYN1 3NW4A 1LHOA 4KG8A 4XYXA 3UKNA 1MS4A 4B4QA 2ZCWA 2WKKA 2O8QA 4E2QA 2PHTA 5BNNA 3TN91 5JOYA 4LUKA 4CYDA 1RVF1 1S0IA 5JR7B 1GBGA 3UK9A 2WS93 3MIBA 1G86A 2WZPP 4Y20B 3B93A 3VHRA 4QQHA 1QNYA 4Q27A 1RGSA 4C1XA 1YJLA 3RS6A 2WS91 1WUVA 5KHHA 1W6PB 4FOVA 3HN1A 3CLPA 3U10A 5JZGB 3KZ4C 1NE4A 3ZYGA 4JTNA 5CFDB 3UJOA 4LTAA 1FXZA 4EWEA 4EWAA 4IV1A 1PMIA 3RZZA 1WGPA 1TNFA 4FAGA 1H2MA 2QKDA 3CO2A 4YFZA 3A0KA 4FPFA 1LHNA 3KCXA 5GM0A 4M0NA 1MZFA 4Q4W2 3RWNA 2X29A 1Q43A 4S2FA 1NY72 1G9BA 1FT9A 4M01A 2UURA 5L73A 4C0HA 4PIYA 1POV0 3KD4A 3ZN4A 2CGPA 2D6LX 2NM1A 5IK4A 2HKXA 5KXEA 4M3CF 4WV8A 2B5HA 5KHJA 1AYM1 2A75A 3USSA 2PAEA 1O91A 3MIDA 2P2KA 1C8NA 1KS5A 1ZBA2 2QNKA 3BALA 1V6NA 3DPRB 3DGTA 1Q8PA 2NPIA 5ACA3 2ZGSA 3H3ZA 2VUAA 3WDUA 5GLZA 2DVFA 4XTPA 4QHBA 4AHWA 1R083 1ULFA 3ZXDA 5GZDA 4E9KA 1MEC1 3W59A 3KGZA 4KQ7A 2B42B 4FCAA 3SMHA 4CEYA 5JPNB 3ZDSA 2O0OA 3DL3A 4YGCA 5I8SA 3FHIB 3NJZA 3OD4A 5KHIA 1ZRFA 4XJZA 2ZGOA 5FO7B 1HV0A 4H3WA 1ASJ3 5KC5A 1EAH1 5DUVA 4XF0A 5KBFA 1LR5A 5C8WA 1JHNA 2PQQA 1NA1B 2WL1A 5CU1A 5A33B 2BEOA 1ZX5A 4LR4A 4LHNA 1LU2A 2ZGPA 1R082 2Q0AA 1J1LA 4QQOA 1ND3B 1OQEA 4IEYA 1IQAA 1GNZA 3IDBB 2XL7A 4A7KA 2H6CA 4P14A 1PVC2 1V70A 1YFXA 2VQ0A 5B2GB 1RMU3 1NG0A 4R9CA 5T55A 4Q4W3 3ASIA 2HWD3 2WFF3 4HBNA 3THTA 1X7NA 2RR13 4COVA 4EN7B 2XUMA 4JVAA 4AQ2A 3GNEA 3VBHA 1QJU2 3VKNA 4XBQA 2SBAA 2IXHA 3QBQA 4XJ8A 2RM21 3CJIB 1JXNA 4CP1A 4DFSA 4FAHA 5CFCB 4Y22B 1RINA 1CPMA 2ZA9A 1RJ7A 1S0GA 4IL7A 3VZKA 2ZX0A 3OD0A 1LOFC 4KBBA 1U5IA 3ZFEC 4RHV1 5C4WA 4FT8A 1QXRA 2D3PA 4QGMA 1LULA 1N47A 1RUD3 4R9DA 1VB4A 1CGPA 3FLRA 4F3JA 1OA4A 3LOBA 1QOTA 1IZ3A 3D8CA 1RMU1 1SFYA 4U36A 3WT3A 2IFRA 2XJTA 3B94A 3TWIA 4N53A 4AGVA 3SHRA 1RUC2 2RMU2 1OD5A 1QXJA 1VAKA 3AKPA 3TOJA 4UXAA 1J3PA 4D7SA 5FLJA 1KD7A 2FMDA 4MH0E 1JH5A 4OI1A 2VOWA 2X5IA 1NCQA 1UX6A 5JLVA 1ASJ1 1CAWA 5HBAA 3GALA 2D6KA 1HRV1 1SACA 3D6EA 4XFBA 4FO9A 3V65A 3OTFA 4WM7C 3O12A 4Q4W1 1ND3C 1CESA 4PIZA 2RS53 4PDWC 2VH9A 5BNNB 4W6YA 2Z42A 2W52A 1D4M3 1MEC3 3NAPA 1W0PA 1MVEA 3J8F3 3D5OA 3JU9A 1MACA 4D7TA 4P5HA 4YW4A 5DDJ2 3MPBA 4DPNA 2NN8A 2DUQA 4EV0A 5DUUA 3CNAA 4TSVA 4RSUA 3W9AA 1XU1A 4YVWC 3E97A 3BB6A 1DBNA 4GIQA 4JDNA 2C1FA 4TZDA 4XBNA 2XWBB 2NLRA 4Z92B 1ZZ6A 1R081 3V0BA 1RL3A 3IKWA 4DQAA 2DTWA 3WCSA 4XFGA 2ZHMA 3TB0A 1ZBE3 4I0AA 3ZYIB 5FPZA 2CGNA 1UZZA 1IGOA 3PJYA 2GNDA 3VBUC 2E7TA 2WQZC 3KM5A 1OPMA 4QQLA 2PHDA 1O3QA 3WVJA 1SBDA 5L7OA 1J58A 2HWF3 1GSLA 1DGWA 3BOWA 2B46X 1B35B 2MEV1 4EWDA 4RGGA 2E63A 4Q2FA 1PVC1 5EWSA 2VMHA 3N36A 2IXIA 4IEWA 4IERA 2ZHKA 2NP0A 4AF9A 1MQTC 2ILMA 2H0BA 1RVF3 3ZXFA 4RS5C 4FBFA 1J59A 3V56A 1AR92 3PVEA 2RS32 3LOIA 4MUVA 3FLTA 4AEDC 1QQP2 1V6MA 3ZXGA 2WT0A 5GKAC 3RJ2X 3VBRC 1NQJA 5I0UA 4XF3A 5CFCA 1W6OB 1PNFA 1AL23 2OW4A 4CEWB 3NV1A 4IV3C 3GYDA 3AYDA 1MQTB 4C0BA 2R30A 3H7JA 2HWF1 5F5QA 5DUWA 3O14A 2WNEA 4XTMA 2VNGA 1MS9A 3M3IA 3RJRA 3ROUA 1NCQC 4KWLA 1PZ7A 3HD8B 1Q5OA 4SLIA 3AM2A 3ATGA 3AMHA 4YZ3A 1OLRA 1R1A2 1OHFA 1H0BA 5IK8A 2ZX3A 3NL1A 1PK6A 1H9WA 3JD72 4IEZA 1WCDJ 4AGRA 1J3QA 5FTTC 4Y1VA 4BHPA 1DGRN 1V6KA 1S0BA 2MEV3 3WG4A 5CA6A 2P37A 3R05A 1H8TA 1PO22 1V6OA 4NHMA 4AFBA 2D6NA 3WLUA 4GKXA 5SV8A 3FLPA 1Z7S2 1DQ2A 1ND2C 1C8M1 2GMMA 3N35A 1BCXA 4YYOA 1RUF3 4AEDA 4EJRA 1OOPC 4AHYA 3VHNA 2GNTA 1VBC3 3KS7A 2D40A 4DINB 3J8F1 4NOTA 3WHTA 1S0FA 1COV1 1W6PA 3R4DB 1RUF2 5JZGA 2JG9C 3WG1A 2ZBJA 1RHI3 2R043 3VBUB 4YARA 4FP2A 3VBHC 2BWAA 1F31A 1TME2 4B4PA 5A3MA 1J1TA 1C28A 2BVBA 3WX5A 1O5LA 3OPZA 1ULEA 1CAWB 2VOVA 3HQXA 4Y1XA 4COWA 5IT6A 4FPKA 1F2NA 5DG1A 3BOPA 5J98B 1AHSA 1DQ4A 1WLWA 1H2KA 3INAA 2XG3A 4AEJA 5L19A 4RS5A 2CNAA 2ZPXA 2WFPA 4R4ZA 3B69A 3NAPB 2PHLA 4CTEA 3V0BB 3D0SA 4HL0A 1D4M1 3CF6E 1KQRA 4OHWA 5BNPC 5KHKA 3AMPA 1CAXA 5CFDA 2R071 4GH4A 1FI2A 4FOWA 3IM0A 2HWE2 2BUKA 3WP4A 1A6CA 2TUNA 1Q8QA 4XE9A 5F9TA 1SQ4A 1QU0A 3K51A 3CL1A 4XJ9A 4B7EA 4YZ1A 2RS13 1LENA 1AR93 4X8NA 1AL22 4SBVA 1H4HA 3TN92 4Y20A 4OHYA 1IS3A 1HRI3 2Y26A 2YUEA 5T52A 4MXVA 1W6QB 4PDWB 5H9SA 3FZ3A 2ZJCA 1PNGA 2BTVC