1ZAAC

Zinc finger-dna recognition: crystal structure of a zif268-dna complex at 2.1 angstroms
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A.
pubmed rcsb
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1992-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zaaC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zaaC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zaaC03
1TF3A 2YTNA 1NCSA 2NABA 2JPAA 2E72A 1KJKA 2EMYA 1TF6A 2EOOA 2BB8A 2WBSA 1A1GA 2I13A 2YRKA 2YTJA 2EQ3A 2EPCA 2YU5A 3EPHA 3EPJA 1A1HA 2MKDA 2GLIA 2EM0A 2ENHA 1YUIA 2ELYA 2EN8A 1Z1BA 1YUJA 2EOJA 2EOSA 5KL5A 2EPAA 4R2AA 2EOIA 2EPXA 2EN7A 4R2PA 2M9AA 2EM7A 2DGCA 4R2EA 1DGCA 1RMDA 1G2FC 1LLMC 1X6EA 2EN6A 1A1JA 2ELZA 2MDGA 2YTDA 2YTGA 2LT7A 2EMKA 2PRTA 2GHFA 4IS1C 2EQ1A 2EMXA 2LO3A 2R1FA 1AAYA 2EPPA 2EOEA 2YRMA 2EMFA 2ENCA 4R2CA 2LV2A 5KL6A 1UN6B 2EOHA 2YSOA 3MHSC 4R2DA 2WBUA 2MKNA 2YTOA 2EORA 2EOQA 5KL7A 2D9HA 1X3CA 3MHHC 2CTDA 1G2DC 1P47A 1TN9A 2EMIA 2EPZA 2EM9A 2HGHA 1A1KA 2YTPA 2EMHA 1MEYC 4WSGA 2EP3A 2DLKA 1A1FA 2EMWA 1WJPA 2EMBA 2EL5A 2RPCA 1BB8A 3EPKA 5KL4A 2EOXA 2EOMA 2VRDA 4F2JC 4R2QA 4M9VC 5KL3A 1B69A 1F2IG 1A1IA 2EMGA 3EPLA 2YSPA 2EQ0A 2A25A 2CT1A 1ZU1A 2EPRA 4X9JA 4F6MA 1JK1A 2DLQA 2LCEA 2EOFA 4F6NA 2EMLA 4R2SA 2EN1A 1YSAC 1ZR9A 2J7JA 1X5WA 5KL2A 2YTQA 3M99B 2EE8A 2ENAA 2ADRA 2EPUA 2WCC3 2EM5A 2DMIA 2YTFA 2LVHA 4FK5C 2EM4A 2EM6A 4R2RA 4IJDA 2EMAA 2EN3A 2EL6A 2YTIA 2EM8A 2YRHA 2JP9A 2EOYA 2DRPA 1UBDC 2EMCA 1BBOA 2YU8A 3VHTB 2WBTA 2EOZA 2EM3A 2RSIA 2EJ4A 2EMZA 2YTEA 3UK3C 2EM2A 1X6FA 1JK2A 1ZAAC 1A1LA 4GZNC 1X6HA 2EN2A 2EL4A 2CSHA 2EN4A
chains in the Genus database with same CATH superfamily
1WHNA 1N33E 2B7VA 1GTKA 1HNZE 1KJKA 2G7HA 2WBSA 3T1YE 2EQ3A 4WXDA 2YU5A 4X62E 2MKDA 4LF7E 4JV5E 2EPMX 1YPNA 2EN8A 2EOJA 2EOSA 1J26A 3JU0A 4DV6E 1EH6A 4DR2E 2EOIA 2EN7A 2RQLA 1XNQE 2EM7A 1XMOE 4JI0E 1DGCA 4DV1E 1J5EE 1G2FC 4F9AB 3ADJA 4DR4E 1EH7A 2YTGA 2DSYA 3VYYA 3OTOE 1SFEA 2YT4A 4M30A 4O43A 2EPPA 5A6KA 2EOEA 2B7TA 2EMFA 2EOHA 5A6JA 3IWCA 4OOGC 2EORA 2EOQA 3LLHA 2D9HA 4LF9E 5IXMB 4JI1E 4L5NC 2I9IA 2ODRD 1A1KA 1WHQA 2EMHA 1MEYC 2JR1A 2UXDE 4LFAE 3QG5C 1WJPA 2EMBA 2LJUA 4LF8E 1BB8A 4DR6E 4DR7E 4OX9E 2EOXA 1DQ3A 2EOMA 2WZOA 1B69A 4LFBE 4B3RE 2JY9A 2K4VA 2MDRA 3J80C 4JI5E 1X49A 1YYKA 2EPRA 4F6MA 2L2KB 2HC5A 2EOFA 3ADLA 2EMLA 1PJTA 1YSAC 3TQMA 2LVHA 2EWLA 1STUA 2EL6A 3IWDA 2JVAA 2ODRC 4JI8E 1BBOA 4JI2E 3J7AG 4LU9A 4K0KE 2EJ4A 4NZVA 2EM2A 2LMZA 3C4TA 2L6MA 1A1LA 3JAMC 3AV0A 2CSHA 4B3SE 5A6AA 3BBGA 2L2MA 2L3JA 1L4SA 2EMYA 1TF6A 2EOOA 4M2ZA 2I13A 2YRKA 2YTJA 3EPHA 5A2QC 1A1HA 2ENHA 2E1MA 2M4IA 1Z1BA 4DR3E 4KWYA 5KL5A 3THOB 2M9AA 4GEQB 2V88A 3KZYA 4GKKE 1GQEA 4R03A 4DR1E 1T4NA 1LLMC 2KOUA 1X6EA 2E5LE 2RSMA 2ELZA 2MDGA 2LT7A 2PRTA 2LUQA 2B3TB 2LO3A 5IT9C 3MSWA 4RHBB 4M0VA 1WRJA 5KL6A 1UN6B 2YSOA 4N4RB 3AUZA 4WSPA 3J7Yp 2MKNA 2R76A 2JXPA 1T39A 3HQ1A 1T38A 3H09A 1PJQA 2UUAE 3MHHC 1G2DC 1TN9A 2EM9A 5AASA 1FKAE 3C6KA 2EMWA 4BBYA 3RMPA 1WXRA 2RPCA 4JI4E 4DV4E 1N36E 4DKKA 5KL4A 2LUPB 2V8QB 4HTGA 1SR9A 5AC5A 4DMIA 3THNA 2VRDA 2NA2A 1F2IG 2KONA 3K6QA 2A25A 4NHRA 2RS6A 1ZU1A 3F6HA 2DB2A 2LCEA 4DV3E 4LTYA 2EN1A 2IHR1 5KL2A 2YTQA 4TUIA 2DMYA 5AE3A 2EPUA 2EM5A 5T6JA 1I94E 2DRPA 1UBDC 3VK6A 3VYXA 5A6BD 4KHPE 4ZYEA 4NXNE 4MLQA 2EOZA 2RSIA 4X65E 2RS7A 2UU9E 1ZBQA 1N3GA 1X6FA 5LL6R 2YPNA 4BS9A 4TUGA 2JOXA 1PJSA 1TF3A 1ZBTA 2YTNA 2Q8UA 1EKZA 2HHHE 2FV4B 4KZSA 3C6MA 4BC7A 2EPCA 3EPJA 1DI2A 2GLIA 1YUIA 4ZYDA 1RQ0A 1IMUA 4O4KA 2L3CA 2CPNA 2EPXA 2B9DA 5AC4A 4O24A 4X66E 2L8TA 2EPKX 2L92A 1MGTA 3KZZA 1PKPA 4DV5E 2EMKA 4IS1C 1YYWA 1N32E 2LTSA 4YY3E 2LV2A 4WYQB 4R2DA 2YZTA 5LLQA 1T4OA 2YTOA 5FLXC 4WXCA 4GKJE 2JOBA 5KL7A 2HJJA 2NUEA 3T1HE 2EPNA 2CTDA 4O5GA 2F4VE 4B3ME 2HGHA 2VQEE 2MC5A 2YTPA 1XMQE 4WSGA 3EQ1A 4BHCA 1KYQA 2VQFE 1A1FA 1X48A 1YFHA 1O0WA 2EL5A 1NEIA 1X47A 4B3TE 3BF2A 4WX9A 5AE2A 2K7IA 1GZ6A 2NUGA 4JYAE 3DJWA 3F6GA 2VF1A 4BCAA 4L8NA 1UHZA 4F2JC 4R2QA 4M9VC 1HR0E 2EMGA 2H36X 3EPLA 2EQ0A 2UUCE 3HTXA 1FJGE 4F6NA 4ZYGA 2F8BA 1ZR9A 1X5WA 3J81C 2M1SA 2ENAA 2WCC3 2DMIA 4DV2E 5F3WA 4BC9A 4FK5C 2EM4A 1XNRE 4BHBA 2V87A 4X64E 4JI6E 2EZ6A 2EMAA 2YTIA 2YRHA 2EOYA 4WPYA 2L2NA 5AE1A 2JYAA 2EM3A 2EMZA 2N3HA 1EH8A 2YTEA 1JK2A 1AH5A 2V85A 3OMLA 2UUBE 4YHHE 2EN2A 2EN4A 4P7DA 1NCSA 2NABA 3FIGA 2JPAA 2E72A 2N3GA 4DUYE 5BR8E 5DNYA 3HPSA 4LFCE 5ADZA 2BB8A 1A1GA 2EM0A 1HNXE 2ELYA 3DF6A 1YUJA 3BIDA 3JTZA 4DUZE 3HPZA 2EPAA 4R2AA 1T4LB 3C4BA 1IBME 4R2PA 3BGHA 2DGCA 4R2EA 1RMDA 2VE7C 4F9BB 2EN6A 1BBGA 5LMNE 1A1JA 1YZ9A 2YTDA 2GHFA 2EQ1A 4BMJA 2EMXA 2LTRA 4ZYHA 2R1FA 4Q28A 2ZM6E 1AAYA 2M7QA 5IV8B 4JI3E 2YRMA 2ENCA 2EPOA 4R2CA 1RC7A 1IBKE 3KWRA 2V83A 3MHSC 3L00A 2WBUA 2UXBE 1YYOA 1N34E 4X8WA 4Q35B 1X3CA 1IQSA 4NXME 1P47A 2EMIA 2EPZA 1QNTA 4I8OA 2EP3A 5A69A 2DLKA 4JI7E 4F54A 4LF6E 2JWOA 2LRSA 2V86A 4HEIA 3ZOQB 3P1XA 3EPKA 2LJHA 2MC6A 1PDAA 2LBSB 3IWBA 4DR5E 4DV0E 4F9CB 5KL3A 1A1IA 2KHXA 3ADIA 2YSPA 2DIXA 2CT1A 2FGGA 2BBGA 2N8XA 2LE2A 4X9JA 4LF5E 2YWQA 4RH8A 2DLQA 1JK1A 3ECRA 4R2SA 2FTXB 2RTXA 5LMUE 1HNWE 2J7JA 2GPIA 3M99B 4AQYE 2EE8A 2ADRA 2YTFA 4WFTA 5IWAE 2EM6A 3ADGA 2UXCE 4R2RA 4IJDA 2EN3A 4R8OA 5TSEA 2EM8A 1IBLE 2JP9A 2EPLX 5A6BA 3LMLA 2NUFA 1QU6A 2V89A 4DV7E 1IQOA 2EMCA 4P78A 4J8ZA 2YU8A 3HXLA 3VHTB 4MLVA 2WBTA 1UILA 5CFFE 3UK3C 1ZAAC 4GZNC 4LF4E 2L33A 1X6HA 2EL4A
chains in the Genus database with same CATH topology
1TF3A 2YTNA 1NCSA 2NABA 2JPAA 2E72A 1KJKA 2EMYA 1TF6A 2EOOA 2BB8A 2WBSA 1A1GA 2I13A 2YRKA 2YTJA 2EQ3A 2EPCA 2YU5A 3EPHA 3EPJA 1A1HA 2MKDA 2GLIA 2EM0A 2ENHA 1YUIA 2ELYA 2EN8A 1Z1BA 1YUJA 2EOJA 2EOSA 5KL5A 2EPAA 4R2AA 2EOIA 2EPXA 2EN7A 4R2PA 2M9AA 2EM7A 2DGCA 4R2EA 1DGCA 1RMDA 1G2FC 1LLMC 1X6EA 2EN6A 1A1JA 2ELZA 2MDGA 2YTDA 2YTGA 2LT7A 2EMKA 2PRTA 2GHFA 4IS1C 2EQ1A 2EMXA 2LO3A 2R1FA 1AAYA 2EPPA 2EOEA 2YRMA 2EMFA 2ENCA 4R2CA 2LV2A 5KL6A 1UN6B 2EOHA 2YSOA 3MHSC 4R2DA 2WBUA 2MKNA 2YTOA 2EORA 2EOQA 5KL7A 2D9HA 1X3CA 3MHHC 2CTDA 1G2DC 1P47A 1TN9A 2EMIA 2EPZA 2EM9A 2HGHA 1A1KA 2YTPA 2EMHA 1MEYC 4WSGA 2EP3A 2DLKA 1A1FA 2EMWA 1WJPA 2EMBA 2EL5A 2RPCA 1BB8A 3EPKA 5KL4A 2EOXA 2EOMA 2VRDA 4F2JC 4R2QA 4M9VC 5KL3A 1B69A 1F2IG 1A1IA 2EMGA 3EPLA 2YSPA 2EQ0A 2A25A 2CT1A 1ZU1A 2EPRA 4X9JA 4F6MA 1JK1A 2DLQA 2LCEA 2EOFA 4F6NA 2EMLA 4R2SA 2EN1A 1YSAC 1ZR9A 2J7JA 1X5WA 5KL2A 2YTQA 3M99B 2EE8A 2ENAA 2ADRA 2EPUA 2WCC3 2EM5A 2DMIA 2YTFA 2LVHA 4FK5C 2EM4A 2EM6A 4R2RA 4IJDA 2EMAA 2EN3A 2EL6A 2YTIA 2EM8A 2YRHA 2JP9A 2EOYA 2DRPA 1UBDC 2EMCA 1BBOA 2YU8A 3VHTB 2WBTA 2EOZA 2EM3A 2RSIA 2EJ4A 2EMZA 2YTEA 3UK3C 2EM2A 1X6FA 1JK2A 1ZAAC 1A1LA 4GZNC 1X6HA 2EN2A 2EL4A 2CSHA 2EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TF3 A;  2YTN A;  1NCS A;  2NAB A;  2JPA A;  2E72 A;  1KJK A;  2EMY A;  1TF6 A;  2EOO A;  2BB8 A;  2WBS A;  1A1G A;  2I13 A;  2YRK A;  2YTJ A;  2EQ3 A;  2EPC A;  2YU5 A;  3EPH A;  3EPJ A;  1A1H A;  2MKD A;  2GLI A;  2EM0 A;  2ENH A;  1YUI A;  2ELY A;  2EN8 A;  1Z1B A;  1YUJ A;  2EOJ A;  2EOS A;  5KL5 A;  2EPA A;  4R2A A;  2EOI A;  2EPX A;  2EN7 A;  4R2P A;  2M9A A;  2EM7 A;  2DGC A;  4R2E A;  1DGC A;  1RMD A;  1G2F C;  1LLM C;  1X6E A;  2EN6 A;  1A1J A;  2ELZ A;  2MDG A;  2YTD A;  2YTG A;  2LT7 A;  2EMK A;  2PRT A;  2GHF A;  4IS1 C;  2EQ1 A;  2EMX A;  2LO3 A;  2R1F A;  1AAY A;  2EPP A;  2EOE A;  2YRM A;  2EMF A;  2ENC A;  4R2C A;  2LV2 A;  5KL6 A;  1UN6 B;  2EOH A;  2YSO A;  3MHS C;  4R2D A;  2WBU A;  2MKN A;  2YTO A;  2EOR A;  2EOQ A;  5KL7 A;  2D9H A;  1X3C A;  3MHH C;  2CTD A;  1G2D C;  1P47 A;  1TN9 A;  2EMI A;  2EPZ A;  2EM9 A;  2HGH A;  1A1K A;  2YTP A;  2EMH A;  1MEY C;  4WSG A;  2EP3 A;  2DLK A;  1A1F A;  2EMW A;  1WJP A;  2EMB A;  2EL5 A;  2RPC A;  1BB8 A;  3EPK A;  5KL4 A;  2EOX A;  2EOM A;  2VRD A;  4F2J C;  4R2Q A;  4M9V C;  5KL3 A;  1B69 A;  1F2I G;  1A1I A;  2EMG A;  3EPL A;  2YSP A;  2EQ0 A;  2A25 A;  2CT1 A;  1ZU1 A;  2EPR A;  4X9J A;  4F6M A;  1JK1 A;  2DLQ A;  2LCE A;  2EOF A;  4F6N A;  2EML A;  4R2S A;  2EN1 A;  1YSA C;  1ZR9 A;  2J7J A;  1X5W A;  5KL2 A;  2YTQ A;  3M99 B;  2EE8 A;  2ENA A;  2ADR A;  2EPU A;  2WCC 3;  2EM5 A;  2DMI A;  2YTF A;  2LVH A;  4FK5 C;  2EM4 A;  2EM6 A;  4R2R A;  4IJD A;  2EMA A;  2EN3 A;  2EL6 A;  2YTI A;  2EM8 A;  2YRH A;  2JP9 A;  2EOY A;  2DRP A;  1UBD C;  2EMC A;  1BBO A;  2YU8 A;  3VHT B;  2WBT A;  2EOZ A;  2EM3 A;  2RSI A;  2EJ4 A;  2EMZ A;  2YTE A;  3UK3 C;  2EM2 A;  1X6F A;  1JK2 A;  1ZAA C;  1A1L A;  4GZN C;  1X6H A;  2EN2 A;  2EL4 A;  2CSH A;  2EN4 A; 
#chains in the Genus database with same CATH topology
 1WHN A;  1N33 E;  2B7V A;  1GTK A;  1HNZ E;  1KJK A;  2G7H A;  2WBS A;  3T1Y E;  2EQ3 A;  4WXD A;  2YU5 A;  4X62 E;  2MKD A;  4LF7 E;  4JV5 E;  2EPM X;  1YPN A;  2EN8 A;  2EOJ A;  2EOS A;  1J26 A;  3JU0 A;  4DV6 E;  1EH6 A;  4DR2 E;  2EOI A;  2EN7 A;  2RQL A;  1XNQ E;  2EM7 A;  1XMO E;  4JI0 E;  1DGC A;  4DV1 E;  1J5E E;  1G2F C;  4F9A B;  3ADJ A;  4DR4 E;  1EH7 A;  2YTG A;  2DSY A;  3VYY A;  3OTO E;  1SFE A;  2YT4 A;  4M30 A;  4O43 A;  2EPP A;  5A6K A;  2EOE A;  2B7T A;  2EMF A;  2EOH A;  5A6J A;  3IWC A;  4OOG C;  2EOR A;  2EOQ A;  3LLH A;  2D9H A;  4LF9 E;  5IXM B;  4JI1 E;  4L5N C;  2I9I A;  2ODR D;  1A1K A;  1WHQ A;  2EMH A;  1MEY C;  2JR1 A;  2UXD E;  4LFA E;  3QG5 C;  1WJP A;  2EMB A;  2LJU A;  4LF8 E;  1BB8 A;  4DR6 E;  4DR7 E;  4OX9 E;  2EOX A;  1DQ3 A;  2EOM A;  2WZO A;  1B69 A;  4LFB E;  4B3R E;  2JY9 A;  2K4V A;  2MDR A;  3J80 C;  4JI5 E;  1X49 A;  1YYK A;  2EPR A;  4F6M A;  2L2K B;  2HC5 A;  2EOF A;  3ADL A;  2EML A;  1PJT A;  1YSA C;  3TQM A;  2LVH A;  2EWL A;  1STU A;  2EL6 A;  3IWD A;  2JVA A;  2ODR C;  4JI8 E;  1BBO A;  4JI2 E;  3J7A G;  4LU9 A;  4K0K E;  2EJ4 A;  4NZV A;  2EM2 A;  2LMZ A;  3C4T A;  2L6M A;  1A1L A;  3JAM C;  3AV0 A;  2CSH A;  4B3S E;  5A6A A;  3BBG A;  2L2M A;  2L3J A;  1L4S A;  2EMY A;  1TF6 A;  2EOO A;  4M2Z A;  2I13 A;  2YRK A;  2YTJ A;  3EPH A;  5A2Q C;  1A1H A;  2ENH A;  2E1M A;  2M4I A;  1Z1B A;  4DR3 E;  4KWY A;  5KL5 A;  3THO B;  2M9A A;  4GEQ B;  2V88 A;  3KZY A;  4GKK E;  1GQE A;  4R03 A;  4DR1 E;  1T4N A;  1LLM C;  2KOU A;  1X6E A;  2E5L E;  2RSM A;  2ELZ A;  2MDG A;  2LT7 A;  2PRT A;  2LUQ A;  2B3T B;  2LO3 A;  5IT9 C;  3MSW A;  4RHB B;  4M0V A;  1WRJ A;  5KL6 A;  1UN6 B;  2YSO A;  4N4R B;  3AUZ A;  4WSP A;  3J7Y p;  2MKN A;  2R76 A;  2JXP A;  1T39 A;  3HQ1 A;  1T38 A;  3H09 A;  1PJQ A;  2UUA E;  3MHH C;  1G2D C;  1TN9 A;  2EM9 A;  5AAS A;  1FKA E;  3C6K A;  2EMW A;  4BBY A;  3RMP A;  1WXR A;  2RPC A;  4JI4 E;  4DV4 E;  1N36 E;  4DKK A;  5KL4 A;  2LUP B;  2V8Q B;  4HTG A;  1SR9 A;  5AC5 A;  4DMI A;  3THN A;  2VRD A;  2NA2 A;  1F2I G;  2KON A;  3K6Q A;  2A25 A;  4NHR A;  2RS6 A;  1ZU1 A;  3F6H A;  2DB2 A;  2LCE A;  4DV3 E;  4LTY A;  2EN1 A;  2IHR 1;  5KL2 A;  2YTQ A;  4TUI A;  2DMY A;  5AE3 A;  2EPU A;  2EM5 A;  5T6J A;  1I94 E;  2DRP A;  1UBD C;  3VK6 A;  3VYX A;  5A6B D;  4KHP E;  4ZYE A;  4NXN E;  4MLQ A;  2EOZ A;  2RSI A;  4X65 E;  2RS7 A;  2UU9 E;  1ZBQ A;  1N3G A;  1X6F A;  5LL6 R;  2YPN A;  4BS9 A;  4TUG A;  2JOX A;  1PJS A;  1TF3 A;  1ZBT A;  2YTN A;  2Q8U A;  1EKZ A;  2HHH E;  2FV4 B;  4KZS A;  3C6M A;  4BC7 A;  2EPC A;  3EPJ A;  1DI2 A;  2GLI A;  1YUI A;  4ZYD A;  1RQ0 A;  1IMU A;  4O4K A;  2L3C A;  2CPN A;  2EPX A;  2B9D A;  5AC4 A;  4O24 A;  4X66 E;  2L8T A;  2EPK X;  2L92 A;  1MGT A;  3KZZ A;  1PKP A;  4DV5 E;  2EMK A;  4IS1 C;  1YYW A;  1N32 E;  2LTS A;  4YY3 E;  2LV2 A;  4WYQ B;  4R2D A;  2YZT A;  5LLQ A;  1T4O A;  2YTO A;  5FLX C;  4WXC A;  4GKJ E;  2JOB A;  5KL7 A;  2HJJ A;  2NUE A;  3T1H E;  2EPN A;  2CTD A;  4O5G A;  2F4V E;  4B3M E;  2HGH A;  2VQE E;  2MC5 A;  2YTP A;  1XMQ E;  4WSG A;  3EQ1 A;  4BHC A;  1KYQ A;  2VQF E;  1A1F A;  1X48 A;  1YFH A;  1O0W A;  2EL5 A;  1NEI A;  1X47 A;  4B3T E;  3BF2 A;  4WX9 A;  5AE2 A;  2K7I A;  1GZ6 A;  2NUG A;  4JYA E;  3DJW A;  3F6G A;  2VF1 A;  4BCA A;  4L8N A;  1UHZ A;  4F2J C;  4R2Q A;  4M9V C;  1HR0 E;  2EMG A;  2H36 X;  3EPL A;  2EQ0 A;  2UUC E;  3HTX A;  1FJG E;  4F6N A;  4ZYG A;  2F8B A;  1ZR9 A;  1X5W A;  3J81 C;  2M1S A;  2ENA A;  2WCC 3;  2DMI A;  4DV2 E;  5F3W A;  4BC9 A;  4FK5 C;  2EM4 A;  1XNR E;  4BHB A;  2V87 A;  4X64 E;  4JI6 E;  2EZ6 A;  2EMA A;  2YTI A;  2YRH A;  2EOY A;  4WPY A;  2L2N A;  5AE1 A;  2JYA A;  2EM3 A;  2EMZ A;  2N3H A;  1EH8 A;  2YTE A;  1JK2 A;  1AH5 A;  2V85 A;  3OML A;  2UUB E;  4YHH E;  2EN2 A;  2EN4 A;  4P7D A;  1NCS A;  2NAB A;  3FIG A;  2JPA A;  2E72 A;  2N3G A;  4DUY E;  5BR8 E;  5DNY A;  3HPS A;  4LFC E;  5ADZ A;  2BB8 A;  1A1G A;  2EM0 A;  1HNX E;  2ELY A;  3DF6 A;  1YUJ A;  3BID A;  3JTZ A;  4DUZ E;  3HPZ A;  2EPA A;  4R2A A;  1T4L B;  3C4B A;  1IBM E;  4R2P A;  3BGH A;  2DGC A;  4R2E A;  1RMD A;  2VE7 C;  4F9B B;  2EN6 A;  1BBG A;  5LMN E;  1A1J A;  1YZ9 A;  2YTD A;  2GHF A;  2EQ1 A;  4BMJ A;  2EMX A;  2LTR A;  4ZYH A;  2R1F A;  4Q28 A;  2ZM6 E;  1AAY A;  2M7Q A;  5IV8 B;  4JI3 E;  2YRM A;  2ENC A;  2EPO A;  4R2C A;  1RC7 A;  1IBK E;  3KWR A;  2V83 A;  3MHS C;  3L00 A;  2WBU A;  2UXB E;  1YYO A;  1N34 E;  4X8W A;  4Q35 B;  1X3C A;  1IQS A;  4NXM E;  1P47 A;  2EMI A;  2EPZ A;  1QNT A;  4I8O A;  2EP3 A;  5A69 A;  2DLK A;  4JI7 E;  4F54 A;  4LF6 E;  2JWO A;  2LRS A;  2V86 A;  4HEI A;  3ZOQ B;  3P1X A;  3EPK A;  2LJH A;  2MC6 A;  1PDA A;  2LBS B;  3IWB A;  4DR5 E;  4DV0 E;  4F9C B;  5KL3 A;  1A1I A;  2KHX A;  3ADI A;  2YSP A;  2DIX A;  2CT1 A;  2FGG A;  2BBG A;  2N8X A;  2LE2 A;  4X9J A;  4LF5 E;  2YWQ A;  4RH8 A;  2DLQ A;  1JK1 A;  3ECR A;  4R2S A;  2FTX B;  2RTX A;  5LMU E;  1HNW E;  2J7J A;  2GPI A;  3M99 B;  4AQY E;  2EE8 A;  2ADR A;  2YTF A;  4WFT A;  5IWA E;  2EM6 A;  3ADG A;  2UXC E;  4R2R A;  4IJD A;  2EN3 A;  4R8O A;  5TSE A;  2EM8 A;  1IBL E;  2JP9 A;  2EPL X;  5A6B A;  3LML A;  2NUF A;  1QU6 A;  2V89 A;  4DV7 E;  1IQO A;  2EMC A;  4P78 A;  4J8Z A;  2YU8 A;  3HXL A;  3VHT B;  4MLV A;  2WBT A;  1UIL A;  5CFF E;  3UK3 C;  1ZAA C;  4GZN C;  4LF4 E;  2L33 A;  1X6H A;  2EL4 A; 
#chains in the Genus database with same CATH homology
 1TF3 A;  2YTN A;  1NCS A;  2NAB A;  2JPA A;  2E72 A;  1KJK A;  2EMY A;  1TF6 A;  2EOO A;  2BB8 A;  2WBS A;  1A1G A;  2I13 A;  2YRK A;  2YTJ A;  2EQ3 A;  2EPC A;  2YU5 A;  3EPH A;  3EPJ A;  1A1H A;  2MKD A;  2GLI A;  2EM0 A;  2ENH A;  1YUI A;  2ELY A;  2EN8 A;  1Z1B A;  1YUJ A;  2EOJ A;  2EOS A;  5KL5 A;  2EPA A;  4R2A A;  2EOI A;  2EPX A;  2EN7 A;  4R2P A;  2M9A A;  2EM7 A;  2DGC A;  4R2E A;  1DGC A;  1RMD A;  1G2F C;  1LLM C;  1X6E A;  2EN6 A;  1A1J A;  2ELZ A;  2MDG A;  2YTD A;  2YTG A;  2LT7 A;  2EMK A;  2PRT A;  2GHF A;  4IS1 C;  2EQ1 A;  2EMX A;  2LO3 A;  2R1F A;  1AAY A;  2EPP A;  2EOE A;  2YRM A;  2EMF A;  2ENC A;  4R2C A;  2LV2 A;  5KL6 A;  1UN6 B;  2EOH A;  2YSO A;  3MHS C;  4R2D A;  2WBU A;  2MKN A;  2YTO A;  2EOR A;  2EOQ A;  5KL7 A;  2D9H A;  1X3C A;  3MHH C;  2CTD A;  1G2D C;  1P47 A;  1TN9 A;  2EMI A;  2EPZ A;  2EM9 A;  2HGH A;  1A1K A;  2YTP A;  2EMH A;  1MEY C;  4WSG A;  2EP3 A;  2DLK A;  1A1F A;  2EMW A;  1WJP A;  2EMB A;  2EL5 A;  2RPC A;  1BB8 A;  3EPK A;  5KL4 A;  2EOX A;  2EOM A;  2VRD A;  4F2J C;  4R2Q A;  4M9V C;  5KL3 A;  1B69 A;  1F2I G;  1A1I A;  2EMG A;  3EPL A;  2YSP A;  2EQ0 A;  2A25 A;  2CT1 A;  1ZU1 A;  2EPR A;  4X9J A;  4F6M A;  1JK1 A;  2DLQ A;  2LCE A;  2EOF A;  4F6N A;  2EML A;  4R2S A;  2EN1 A;  1YSA C;  1ZR9 A;  2J7J A;  1X5W A;  5KL2 A;  2YTQ A;  3M99 B;  2EE8 A;  2ENA A;  2ADR A;  2EPU A;  2WCC 3;  2EM5 A;  2DMI A;  2YTF A;  2LVH A;  4FK5 C;  2EM4 A;  2EM6 A;  4R2R A;  4IJD A;  2EMA A;  2EN3 A;  2EL6 A;  2YTI A;  2EM8 A;  2YRH A;  2JP9 A;  2EOY A;  2DRP A;  1UBD C;  2EMC A;  1BBO A;  2YU8 A;  3VHT B;  2WBT A;  2EOZ A;  2EM3 A;  2RSI A;  2EJ4 A;  2EMZ A;  2YTE A;  3UK3 C;  2EM2 A;  1X6F A;  1JK2 A;  1ZAA C;  1A1L A;  4GZN C;  1X6H A;  2EN2 A;  2EL4 A;  2CSH A;  2EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...