1ZAAC

Zinc finger-dna recognition: crystal structure of a zif268-dna complex at 2.1 angstroms
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
85
structure length
85
Chain Sequence
RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
publication title Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A.
pubmed rcsb
molecule tags Transcription/dna
total genus 27
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 1992-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zaaC02
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zaaC01
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1zaaC03
4IJDA 4R2DA 4WSGA 1A1HA 1YSAC 2YTJA 4R2AA 2GHFA 4R2CA 2RPCA 2YTEA 1RMDA 2E72A 2ENCA 2EPRA 2EM0A 2ENAA 1LLMC 2A25A 2ELZA 2EOFA 2EPUA 2DMIA 2EPPA 2NABA 1DGCA 2EM3A 5KL6A 2EM9A 1ZR9A 2EN7A 2YTIA 2EPXA 2EOYA 2YTPA 1TF3A 2EN2A 2MDGA 2R1FA 2EL4A 2EQ1A 1A1IA 2EOSA 2DGCA 2EMYA 3EPLA 2EM2A 2EOOA 2EOXA 2EOHA 1Z1BA 2YRMA 3MHHC 3EPHA 2I13A 2DLKA 2EQ0A 1A1KA 1UN6B 2EP3A 5KL7A 2LT7A 2RSIA 4FK5C 2EMHA 1BBOA 2EOIA 2HGHA 1G2DC 2EMFA 1G2FC 2WCC3 1X5WA 5KL4A 1P47A 4M9VC 2YRHA 4R2SA 2EM4A 3M99B 4X9JA 4R2QA 2EOQA 2PRTA 2DLQA 2WBTA 2EN3A 2EN8A 1AAYA 1F2IG 2DRPA 2EMCA 2YTOA 2CT1A 2EN1A 2YSPA 1X6EA 2LVHA 4F2JC 2YU8A 2EMGA 2WBSA 2YRKA 2YTGA 2JPAA 1X6HA 2GLIA 2EM7A 3EPJA 2EL5A 2EOJA 1YUIA 1X3CA 2EPAA 2EPCA 2JP9A 1TN9A 2EOEA 2EMIA 1A1FA 2WBUA 4R2PA 1A1LA 2EMLA 2EM6A 2EOMA 2LO3A 2YTQA 4F6MA 3VHTB 2LCEA 2EMAA 2EMKA 2M9AA 1JK1A 2EOZA 1UBDC 2BB8A 2EN6A 1NCSA 5KL5A 2ELYA 1MEYC 2EMBA 2LV2A 2EL6A 2MKNA 1BB8A 2CSHA 2EORA 5KL3A 2EN4A 2EMXA 2J7JA 2VRDA 2YTDA 3EPKA 1B69A 2ENHA 2EE8A 4R2EA 1ZU1A 1JK2A 3MHSC 2CTDA 4IS1C 2EJ4A 1YUJA 2EMZA 2EMWA 4R2RA 2YU5A 5KL2A 2EM5A 4F6NA 2EPZA 1A1GA 2EQ3A 1A1JA 1TF6A 1ZAAC 2D9HA 2YTFA 4GZNC 1KJKA 2MKDA 2YTNA 2YSOA 2ADRA 3UK3C 2EM8A 1WJPA 1X6FA
chains in the Genus database with same CATH superfamily
1GTKA 5LMUE 4R2DA 4HTGA 1YSAC 2L2MA 4R2AA 1PJQA 2K4VA 1X48A 4TUGA 1STUA 2YTEA 4P78A 1N36E 4LF7E 4LFAE 2F8BA 2EPRA 2UU9E 2ENAA 2NABA 4F54A 2EM3A 4I8OA 2EN7A 2HJJA 1PKPA 2GPIA 1J26A 2N8XA 1IBME 2V89A 1YYOA 4DV5E 2EL4A 4DR3E 2EMYA 4BHBA 2NUEA 2VQFE 1T4LB 2EOXA 3MHHC 1A1KA 1QU6A 2RSIA 4ZYGA 2M1SA 3KWRA 4X66E 1RQ0A 4WSPA 4AQYE 1BBOA 4M2ZA 5A2QC 5KL4A 2F4VE 2HC5A 2EM4A 4X8WA 2LRSA 4X9JA 4R2QA 1HR0E 2M4IA 3ECRA 3H09A 2DLQA 4DKKA 3QG5C 2MC5A 2YTOA 2EN1A 1X6EA 2LVHA 4F2JC 1J5EE 4L5NC 4ZYDA 2WBSA 2YRKA 2KHXA 5A6BA 3J81C 4LF9E 1X6HA 3JTZA 3TQMA 2YPNA 1YZ9A 2EPCA 1TN9A 1A1LA 1UILA 2EMLA 2EM6A 2LO3A 1X47A 2LJUA 1QNTA 2LCEA 3VHTB 2RS6A 3IWDA 1JK1A 4JI7E 1PDAA 3C4TA 2L33A 4B3ME 4RH8A 2NUFA 4R8OA 4JI0E 2NA2A 2FGGA 4X65E 2IHR1 2ELYA 2JWOA 2EMBA 3AV0A 2EL6A 4F9AB 5A6JA 1BB8A 2CSHA 3IWCA 1FJGE 3LLHA 4DV7E 2EE8A 4WX9A 5LLQA 2G7HA 2CPNA 1SR9A 4DR5E 1YUJA 2EMWA 4R03A 2N3HA 5KL2A 2EM5A 3DJWA 1ZAAC 1O0WA 4Q35B 2H36X 1N3GA 1YPNA 1XMOE 2MKDA 4DUYE 4DV0E 1WJPA 3KZYA 5BR8E 4IJDA 4BMJA 2YT4A 2RS7A 4LF4E 4NXNE 2B3TB 1WHQA 4R2CA 2EPNA 3HTXA 2I9IA 2WZOA 1MGTA 2LE2A 1RMDA 2E1MA 2K7IA 4NHRA 2EM0A 1LLMC 2A25A 4DMIA 1EH7A 4LTYA 4O24A 1DGCA 5KL6A 4M30A 2EPXA 4DR4E 4OX9E 2LTRA 4OOGC 2UUAE 2EQ1A 1A1IA 2DGCA 4LF5E 1T4NA 1EKZA 3EPHA 2FTXB 1Z1BA 4M0VA 2EQ0A 2UXCE 5KL7A 2EZ6A 3ZOQB 2EMHA 1YYWA 1G2DC 5AE2A 3OTOE 3M99B 2EPLX 2DIXA 2VQEE 1XMQE 4O5GA 2EN3A 2EN8A 1AAYA 1F2IG 1IMUA 4ZYHA 2CT1A 1HNXE 2YSPA 2LBSB 4MLQA 1KYQA 2EMGA 3RMPA 2YTGA 4B3TE 2EM7A 3EPJA 5F3WA 1AH5A 1PJSA 1YUIA 4JYAE 2E5LE 2EPAA 4WXCA 4B3RE 4BS9A 2HHHE 2ODRD 3THOB 2L2KB 2WBUA 4R2PA 2YTQA 2V85A 2EMKA 2M9AA 2EOZA 1UBDC 2BB8A 2EN6A 4O43A 1PJTA 4YHHE 1MEYC 3T1YE 2DMYA 1GQEA 2MKNA 2EORA 2ZM6E 5IWAE 2ENHA 3HQ1A 4GKJE 2CTDA 5A6KA 1T39A 2YU5A 1WRJA 4JI1E 2EPZA 5LL6R 1TF6A 2LMZA 2D9HA 2YTFA 3ADIA 2YTNA 2YSOA 4BHCA 3HPSA 1T4OA 1N34E 3VYXA 2V83A 3IWBA 1DI2A 5DNYA 4LFCE 1GZ6A 3BGHA 4WSGA 1A1HA 2GHFA 3DF6A 2LUPB 2N3GA 2RPCA 4BC7A 4NXME 2E72A 2ENCA 3J7AG 1N33E 2Q8UA 4HEIA 4LF6E 3HXLA 5A6AA 1EH8A 1N32E 2BBGA 3OMLA 2ELZA 4ZYEA 1T38A 4GEQB 1ZR9A 3L00A 5IT9C 4WYQB 2RQLA 2L3CA 2B7VA 2EWLA 3ADLA 2EN2A 2MDGA 3T1HE 3BIDA 3AUZA 2EOSA 4TUIA 2MDRA 2YWQA 4DV6E 2EOHA 2YRMA 4DR2E 1WXRA 2DLKA 5AC5A 4DV4E 1UN6B 2LT7A 4FK5C 2EOIA 4JI8E 2EMFA 1G2FC 1IQOA 1P47A 1X5WA 4B3SE 2YRHA 4R2SA 3EQ1A 2PRTA 3ADGA 2WBTA 3P1XA 2LTSA 2DRPA 4JV5E 4LU9A 3ADJA 1FKAE 1RC7A 1IBKE 4BC9A 1ZBTA 5LMNE 2L3JA 1UHZA 4F9BB 2JP9A 4X64E 4DR6E 2EOMA 4X62E 2EMAA 4J8ZA 5AE3A 1YYKA 1DQ3A 4F9CB 4DV3E 4WXDA 5TSEA 2JYAA 2ODRC 1WHNA 3C6MA 1XNQE 4N4RB 2EN4A 2EMXA 5A6BD 2J7JA 2VRDA 2YTDA 4LFBE 2LJHA 2EPOA 3VYYA 2JOBA 2LUQA 2UXBE 2EJ4A 2B7TA 5IXMB 1HNWE 3THNA 4DR7E 4GZNC 1KJKA 4GKKE 2JR1A 2R76A 2HGHA 2EM8A 2FV4B 1X6FA 2L2NA 3LMLA 5AC4A 2UUBE 3BBGA 2YTJA 4K0KE 1NEIA 2KONA 4DUZE 1SFEA 4DV2E 4JI5E 3VK6A 2JOXA 2DSYA 2EOFA 4JI2E 5A69A 2V88A 2EPUA 2DMIA 2EPPA 2VE7C 3F6HA 4P7DA 2EM9A 3C6KA 2YTIA 1ZBQA 2V86A 2UXDE 4WFTA 2EOYA 1HNZE 1XNRE 2YZTA 1X49A 2YTPA 1TF3A 2R1FA 4JI4E 4L8NA 5AE1A 3EPLA 4WPYA 2EM2A 2EOOA 4BBYA 2I13A 2EP3A 3J7Yp 4Q28A 1IBLE 2WCC3 4M9VC 5FLXC 4KHPE 4YY3E 3C4BA 2EOQA 2M7QA 2L6MA 2EMCA 4LF8E 2V8QB 2YU8A 5CFFE 2VF1A 3K6QA 1BBGA 4DR1E 2DB2A 2JXPA 2JPAA 3J80C 1YFHA 2GLIA 2EL5A 2EOJA 2L8TA 1X3CA 2RTXA 2EOEA 2EMIA 1A1FA 1EH6A 2EPKX 5IV8B 2RSMA 3JU0A 4F6MA 2NUGA 5ADZA 4BCAA 1NCSA 2V87A 4MLVA 5KL5A 3KZZA 2L92A 2LV2A 4NZVA 4DV1E 4RHBB 5KL3A 3BF2A 2MC6A 2JVAA 2KOUA 3EPKA 1B69A 4R2EA 1ZU1A 3F6GA 1JK2A 4KZSA 3MHSC 4O4KA 5T6JA 4IS1C 4KWYA 2EPMX 2EMZA 1I94E 4R2RA 4JI6E 4F6NA 3FIGA 3MSWA 2EQ3A 1A1JA 1A1GA 2JY9A 1IQSA 2UUCE 1L4SA 5AASA 3HPZA 4JI3E 2ADRA 3UK3C 3JAMC 2B9DA
chains in the Genus database with same CATH topology
4IJDA 4R2DA 4WSGA 1A1HA 1YSAC 2YTJA 4R2AA 2GHFA 4R2CA 2RPCA 2YTEA 1RMDA 2E72A 2ENCA 2EPRA 2EM0A 2ENAA 1LLMC 2A25A 2ELZA 2EOFA 2EPUA 2DMIA 2EPPA 2NABA 1DGCA 2EM3A 5KL6A 2EM9A 1ZR9A 2EN7A 2YTIA 2EPXA 2EOYA 2YTPA 1TF3A 2EN2A 2MDGA 2R1FA 2EL4A 2EQ1A 1A1IA 2EOSA 2DGCA 2EMYA 3EPLA 2EM2A 2EOOA 2EOXA 2EOHA 1Z1BA 2YRMA 3MHHC 3EPHA 2I13A 2DLKA 2EQ0A 1A1KA 1UN6B 2EP3A 5KL7A 2LT7A 2RSIA 4FK5C 2EMHA 1BBOA 2EOIA 2HGHA 1G2DC 2EMFA 1G2FC 2WCC3 1X5WA 5KL4A 1P47A 4M9VC 2YRHA 4R2SA 2EM4A 3M99B 4X9JA 4R2QA 2EOQA 2PRTA 2DLQA 2WBTA 2EN3A 2EN8A 1AAYA 1F2IG 2DRPA 2EMCA 2YTOA 2CT1A 2EN1A 2YSPA 1X6EA 2LVHA 4F2JC 2YU8A 2EMGA 2WBSA 2YRKA 2YTGA 2JPAA 1X6HA 2GLIA 2EM7A 3EPJA 2EL5A 2EOJA 1YUIA 1X3CA 2EPAA 2EPCA 2JP9A 1TN9A 2EOEA 2EMIA 1A1FA 2WBUA 4R2PA 1A1LA 2EMLA 2EM6A 2EOMA 2LO3A 2YTQA 4F6MA 3VHTB 2LCEA 2EMAA 2EMKA 2M9AA 1JK1A 2EOZA 1UBDC 2BB8A 2EN6A 1NCSA 5KL5A 2ELYA 1MEYC 2EMBA 2LV2A 2EL6A 2MKNA 1BB8A 2CSHA 2EORA 5KL3A 2EN4A 2EMXA 2J7JA 2VRDA 2YTDA 3EPKA 1B69A 2ENHA 2EE8A 4R2EA 1ZU1A 1JK2A 3MHSC 2CTDA 4IS1C 2EJ4A 1YUJA 2EMZA 2EMWA 4R2RA 2YU5A 5KL2A 2EM5A 4F6NA 2EPZA 1A1GA 2EQ3A 1A1JA 1TF6A 1ZAAC 2D9HA 2YTFA 4GZNC 1KJKA 2MKDA 2YTNA 2YSOA 2ADRA 3UK3C 2EM8A 1WJPA 1X6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJD A;  4R2D A;  4WSG A;  1A1H A;  1YSA C;  2YTJ A;  4R2A A;  2GHF A;  4R2C A;  2RPC A;  2YTE A;  1RMD A;  2E72 A;  2ENC A;  2EPR A;  2EM0 A;  2ENA A;  1LLM C;  2A25 A;  2ELZ A;  2EOF A;  2EPU A;  2DMI A;  2EPP A;  2NAB A;  1DGC A;  2EM3 A;  5KL6 A;  2EM9 A;  1ZR9 A;  2EN7 A;  2YTI A;  2EPX A;  2EOY A;  2YTP A;  1TF3 A;  2EN2 A;  2MDG A;  2R1F A;  2EL4 A;  2EQ1 A;  1A1I A;  2EOS A;  2DGC A;  2EMY A;  3EPL A;  2EM2 A;  2EOO A;  2EOX A;  2EOH A;  1Z1B A;  2YRM A;  3MHH C;  3EPH A;  2I13 A;  2DLK A;  2EQ0 A;  1A1K A;  1UN6 B;  2EP3 A;  5KL7 A;  2LT7 A;  2RSI A;  4FK5 C;  2EMH A;  1BBO A;  2EOI A;  2HGH A;  1G2D C;  2EMF A;  1G2F C;  2WCC 3;  1X5W A;  5KL4 A;  1P47 A;  4M9V C;  2YRH A;  4R2S A;  2EM4 A;  3M99 B;  4X9J A;  4R2Q A;  2EOQ A;  2PRT A;  2DLQ A;  2WBT A;  2EN3 A;  2EN8 A;  1AAY A;  1F2I G;  2DRP A;  2EMC A;  2YTO A;  2CT1 A;  2EN1 A;  2YSP A;  1X6E A;  2LVH A;  4F2J C;  2YU8 A;  2EMG A;  2WBS A;  2YRK A;  2YTG A;  2JPA A;  1X6H A;  2GLI A;  2EM7 A;  3EPJ A;  2EL5 A;  2EOJ A;  1YUI A;  1X3C A;  2EPA A;  2EPC A;  2JP9 A;  1TN9 A;  2EOE A;  2EMI A;  1A1F A;  2WBU A;  4R2P A;  1A1L A;  2EML A;  2EM6 A;  2EOM A;  2LO3 A;  2YTQ A;  4F6M A;  3VHT B;  2LCE A;  2EMA A;  2EMK A;  2M9A A;  1JK1 A;  2EOZ A;  1UBD C;  2BB8 A;  2EN6 A;  1NCS A;  5KL5 A;  2ELY A;  1MEY C;  2EMB A;  2LV2 A;  2EL6 A;  2MKN A;  1BB8 A;  2CSH A;  2EOR A;  5KL3 A;  2EN4 A;  2EMX A;  2J7J A;  2VRD A;  2YTD A;  3EPK A;  1B69 A;  2ENH A;  2EE8 A;  4R2E A;  1ZU1 A;  1JK2 A;  3MHS C;  2CTD A;  4IS1 C;  2EJ4 A;  1YUJ A;  2EMZ A;  2EMW A;  4R2R A;  2YU5 A;  5KL2 A;  2EM5 A;  4F6N A;  2EPZ A;  1A1G A;  2EQ3 A;  1A1J A;  1TF6 A;  1ZAA C;  2D9H A;  2YTF A;  4GZN C;  1KJK A;  2MKD A;  2YTN A;  2YSO A;  2ADR A;  3UK3 C;  2EM8 A;  1WJP A;  1X6F A; 
#chains in the Genus database with same CATH topology
 1GTK A;  5LMU E;  4R2D A;  4HTG A;  1YSA C;  2L2M A;  4R2A A;  1PJQ A;  2K4V A;  1X48 A;  4TUG A;  1STU A;  2YTE A;  4P78 A;  1N36 E;  4LF7 E;  4LFA E;  2F8B A;  2EPR A;  2UU9 E;  2ENA A;  2NAB A;  4F54 A;  2EM3 A;  4I8O A;  2EN7 A;  2HJJ A;  1PKP A;  2GPI A;  1J26 A;  2N8X A;  1IBM E;  2V89 A;  1YYO A;  4DV5 E;  2EL4 A;  4DR3 E;  2EMY A;  4BHB A;  2NUE A;  2VQF E;  1T4L B;  2EOX A;  3MHH C;  1A1K A;  1QU6 A;  2RSI A;  4ZYG A;  2M1S A;  3KWR A;  4X66 E;  1RQ0 A;  4WSP A;  4AQY E;  1BBO A;  4M2Z A;  5A2Q C;  5KL4 A;  2F4V E;  2HC5 A;  2EM4 A;  4X8W A;  2LRS A;  4X9J A;  4R2Q A;  1HR0 E;  2M4I A;  3ECR A;  3H09 A;  2DLQ A;  4DKK A;  3QG5 C;  2MC5 A;  2YTO A;  2EN1 A;  1X6E A;  2LVH A;  4F2J C;  1J5E E;  4L5N C;  4ZYD A;  2WBS A;  2YRK A;  2KHX A;  5A6B A;  3J81 C;  4LF9 E;  1X6H A;  3JTZ A;  3TQM A;  2YPN A;  1YZ9 A;  2EPC A;  1TN9 A;  1A1L A;  1UIL A;  2EML A;  2EM6 A;  2LO3 A;  1X47 A;  2LJU A;  1QNT A;  2LCE A;  3VHT B;  2RS6 A;  3IWD A;  1JK1 A;  4JI7 E;  1PDA A;  3C4T A;  2L33 A;  4B3M E;  4RH8 A;  2NUF A;  4R8O A;  4JI0 E;  2NA2 A;  2FGG A;  4X65 E;  2IHR 1;  2ELY A;  2JWO A;  2EMB A;  3AV0 A;  2EL6 A;  4F9A B;  5A6J A;  1BB8 A;  2CSH A;  3IWC A;  1FJG E;  3LLH A;  4DV7 E;  2EE8 A;  4WX9 A;  5LLQ A;  2G7H A;  2CPN A;  1SR9 A;  4DR5 E;  1YUJ A;  2EMW A;  4R03 A;  2N3H A;  5KL2 A;  2EM5 A;  3DJW A;  1ZAA C;  1O0W A;  4Q35 B;  2H36 X;  1N3G A;  1YPN A;  1XMO E;  2MKD A;  4DUY E;  4DV0 E;  1WJP A;  3KZY A;  5BR8 E;  4IJD A;  4BMJ A;  2YT4 A;  2RS7 A;  4LF4 E;  4NXN E;  2B3T B;  1WHQ A;  4R2C A;  2EPN A;  3HTX A;  2I9I A;  2WZO A;  1MGT A;  2LE2 A;  1RMD A;  2E1M A;  2K7I A;  4NHR A;  2EM0 A;  1LLM C;  2A25 A;  4DMI A;  1EH7 A;  4LTY A;  4O24 A;  1DGC A;  5KL6 A;  4M30 A;  2EPX A;  4DR4 E;  4OX9 E;  2LTR A;  4OOG C;  2UUA E;  2EQ1 A;  1A1I A;  2DGC A;  4LF5 E;  1T4N A;  1EKZ A;  3EPH A;  2FTX B;  1Z1B A;  4M0V A;  2EQ0 A;  2UXC E;  5KL7 A;  2EZ6 A;  3ZOQ B;  2EMH A;  1YYW A;  1G2D C;  5AE2 A;  3OTO E;  3M99 B;  2EPL X;  2DIX A;  2VQE E;  1XMQ E;  4O5G A;  2EN3 A;  2EN8 A;  1AAY A;  1F2I G;  1IMU A;  4ZYH A;  2CT1 A;  1HNX E;  2YSP A;  2LBS B;  4MLQ A;  1KYQ A;  2EMG A;  3RMP A;  2YTG A;  4B3T E;  2EM7 A;  3EPJ A;  5F3W A;  1AH5 A;  1PJS A;  1YUI A;  4JYA E;  2E5L E;  2EPA A;  4WXC A;  4B3R E;  4BS9 A;  2HHH E;  2ODR D;  3THO B;  2L2K B;  2WBU A;  4R2P A;  2YTQ A;  2V85 A;  2EMK A;  2M9A A;  2EOZ A;  1UBD C;  2BB8 A;  2EN6 A;  4O43 A;  1PJT A;  4YHH E;  1MEY C;  3T1Y E;  2DMY A;  1GQE A;  2MKN A;  2EOR A;  2ZM6 E;  5IWA E;  2ENH A;  3HQ1 A;  4GKJ E;  2CTD A;  5A6K A;  1T39 A;  2YU5 A;  1WRJ A;  4JI1 E;  2EPZ A;  5LL6 R;  1TF6 A;  2LMZ A;  2D9H A;  2YTF A;  3ADI A;  2YTN A;  2YSO A;  4BHC A;  3HPS A;  1T4O A;  1N34 E;  3VYX A;  2V83 A;  3IWB A;  1DI2 A;  5DNY A;  4LFC E;  1GZ6 A;  3BGH A;  4WSG A;  1A1H A;  2GHF A;  3DF6 A;  2LUP B;  2N3G A;  2RPC A;  4BC7 A;  4NXM E;  2E72 A;  2ENC A;  3J7A G;  1N33 E;  2Q8U A;  4HEI A;  4LF6 E;  3HXL A;  5A6A A;  1EH8 A;  1N32 E;  2BBG A;  3OML A;  2ELZ A;  4ZYE A;  1T38 A;  4GEQ B;  1ZR9 A;  3L00 A;  5IT9 C;  4WYQ B;  2RQL A;  2L3C A;  2B7V A;  2EWL A;  3ADL A;  2EN2 A;  2MDG A;  3T1H E;  3BID A;  3AUZ A;  2EOS A;  4TUI A;  2MDR A;  2YWQ A;  4DV6 E;  2EOH A;  2YRM A;  4DR2 E;  1WXR A;  2DLK A;  5AC5 A;  4DV4 E;  1UN6 B;  2LT7 A;  4FK5 C;  2EOI A;  4JI8 E;  2EMF A;  1G2F C;  1IQO A;  1P47 A;  1X5W A;  4B3S E;  2YRH A;  4R2S A;  3EQ1 A;  2PRT A;  3ADG A;  2WBT A;  3P1X A;  2LTS A;  2DRP A;  4JV5 E;  4LU9 A;  3ADJ A;  1FKA E;  1RC7 A;  1IBK E;  4BC9 A;  1ZBT A;  5LMN E;  2L3J A;  1UHZ A;  4F9B B;  2JP9 A;  4X64 E;  4DR6 E;  2EOM A;  4X62 E;  2EMA A;  4J8Z A;  5AE3 A;  1YYK A;  1DQ3 A;  4F9C B;  4DV3 E;  4WXD A;  5TSE A;  2JYA A;  2ODR C;  1WHN A;  3C6M A;  1XNQ E;  4N4R B;  2EN4 A;  2EMX A;  5A6B D;  2J7J A;  2VRD A;  2YTD A;  4LFB E;  2LJH A;  2EPO A;  3VYY A;  2JOB A;  2LUQ A;  2UXB E;  2EJ4 A;  2B7T A;  5IXM B;  1HNW E;  3THN A;  4DR7 E;  4GZN C;  1KJK A;  4GKK E;  2JR1 A;  2R76 A;  2HGH A;  2EM8 A;  2FV4 B;  1X6F A;  2L2N A;  3LML A;  5AC4 A;  2UUB E;  3BBG A;  2YTJ A;  4K0K E;  1NEI A;  2KON A;  4DUZ E;  1SFE A;  4DV2 E;  4JI5 E;  3VK6 A;  2JOX A;  2DSY A;  2EOF A;  4JI2 E;  5A69 A;  2V88 A;  2EPU A;  2DMI A;  2EPP A;  2VE7 C;  3F6H A;  4P7D A;  2EM9 A;  3C6K A;  2YTI A;  1ZBQ A;  2V86 A;  2UXD E;  4WFT A;  2EOY A;  1HNZ E;  1XNR E;  2YZT A;  1X49 A;  2YTP A;  1TF3 A;  2R1F A;  4JI4 E;  4L8N A;  5AE1 A;  3EPL A;  4WPY A;  2EM2 A;  2EOO A;  4BBY A;  2I13 A;  2EP3 A;  3J7Y p;  4Q28 A;  1IBL E;  2WCC 3;  4M9V C;  5FLX C;  4KHP E;  4YY3 E;  3C4B A;  2EOQ A;  2M7Q A;  2L6M A;  2EMC A;  4LF8 E;  2V8Q B;  2YU8 A;  5CFF E;  2VF1 A;  3K6Q A;  1BBG A;  4DR1 E;  2DB2 A;  2JXP A;  2JPA A;  3J80 C;  1YFH A;  2GLI A;  2EL5 A;  2EOJ A;  2L8T A;  1X3C A;  2RTX A;  2EOE A;  2EMI A;  1A1F A;  1EH6 A;  2EPK X;  5IV8 B;  2RSM A;  3JU0 A;  4F6M A;  2NUG A;  5ADZ A;  4BCA A;  1NCS A;  2V87 A;  4MLV A;  5KL5 A;  3KZZ A;  2L92 A;  2LV2 A;  4NZV A;  4DV1 E;  4RHB B;  5KL3 A;  3BF2 A;  2MC6 A;  2JVA A;  2KOU A;  3EPK A;  1B69 A;  4R2E A;  1ZU1 A;  3F6G A;  1JK2 A;  4KZS A;  3MHS C;  4O4K A;  5T6J A;  4IS1 C;  4KWY A;  2EPM X;  2EMZ A;  1I94 E;  4R2R A;  4JI6 E;  4F6N A;  3FIG A;  3MSW A;  2EQ3 A;  1A1J A;  1A1G A;  2JY9 A;  1IQS A;  2UUC E;  1L4S A;  5AAS A;  3HPZ A;  4JI3 E;  2ADR A;  3UK3 C;  3JAM C;  2B9D A; 
#chains in the Genus database with same CATH homology
 4IJD A;  4R2D A;  4WSG A;  1A1H A;  1YSA C;  2YTJ A;  4R2A A;  2GHF A;  4R2C A;  2RPC A;  2YTE A;  1RMD A;  2E72 A;  2ENC A;  2EPR A;  2EM0 A;  2ENA A;  1LLM C;  2A25 A;  2ELZ A;  2EOF A;  2EPU A;  2DMI A;  2EPP A;  2NAB A;  1DGC A;  2EM3 A;  5KL6 A;  2EM9 A;  1ZR9 A;  2EN7 A;  2YTI A;  2EPX A;  2EOY A;  2YTP A;  1TF3 A;  2EN2 A;  2MDG A;  2R1F A;  2EL4 A;  2EQ1 A;  1A1I A;  2EOS A;  2DGC A;  2EMY A;  3EPL A;  2EM2 A;  2EOO A;  2EOX A;  2EOH A;  1Z1B A;  2YRM A;  3MHH C;  3EPH A;  2I13 A;  2DLK A;  2EQ0 A;  1A1K A;  1UN6 B;  2EP3 A;  5KL7 A;  2LT7 A;  2RSI A;  4FK5 C;  2EMH A;  1BBO A;  2EOI A;  2HGH A;  1G2D C;  2EMF A;  1G2F C;  2WCC 3;  1X5W A;  5KL4 A;  1P47 A;  4M9V C;  2YRH A;  4R2S A;  2EM4 A;  3M99 B;  4X9J A;  4R2Q A;  2EOQ A;  2PRT A;  2DLQ A;  2WBT A;  2EN3 A;  2EN8 A;  1AAY A;  1F2I G;  2DRP A;  2EMC A;  2YTO A;  2CT1 A;  2EN1 A;  2YSP A;  1X6E A;  2LVH A;  4F2J C;  2YU8 A;  2EMG A;  2WBS A;  2YRK A;  2YTG A;  2JPA A;  1X6H A;  2GLI A;  2EM7 A;  3EPJ A;  2EL5 A;  2EOJ A;  1YUI A;  1X3C A;  2EPA A;  2EPC A;  2JP9 A;  1TN9 A;  2EOE A;  2EMI A;  1A1F A;  2WBU A;  4R2P A;  1A1L A;  2EML A;  2EM6 A;  2EOM A;  2LO3 A;  2YTQ A;  4F6M A;  3VHT B;  2LCE A;  2EMA A;  2EMK A;  2M9A A;  1JK1 A;  2EOZ A;  1UBD C;  2BB8 A;  2EN6 A;  1NCS A;  5KL5 A;  2ELY A;  1MEY C;  2EMB A;  2LV2 A;  2EL6 A;  2MKN A;  1BB8 A;  2CSH A;  2EOR A;  5KL3 A;  2EN4 A;  2EMX A;  2J7J A;  2VRD A;  2YTD A;  3EPK A;  1B69 A;  2ENH A;  2EE8 A;  4R2E A;  1ZU1 A;  1JK2 A;  3MHS C;  2CTD A;  4IS1 C;  2EJ4 A;  1YUJ A;  2EMZ A;  2EMW A;  4R2R A;  2YU5 A;  5KL2 A;  2EM5 A;  4F6N A;  2EPZ A;  1A1G A;  2EQ3 A;  1A1J A;  1TF6 A;  1ZAA C;  2D9H A;  2YTF A;  4GZN C;  1KJK A;  2MKD A;  2YTN A;  2YSO A;  2ADR A;  3UK3 C;  2EM8 A;  1WJP A;  1X6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...